BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25336_g3_i1 len=1968 path=[10733:0-1187 11921:1188-1212
5979:1213-1967]

Length=1968
                                                                      Score     E

ref|XP_006344453.1|  PREDICTED: putative pentatricopeptide repeat...    769   0.0      
ref|XP_004236539.1|  PREDICTED: putative pentatricopeptide repeat...    754   0.0      
ref|XP_009605679.1|  PREDICTED: putative pentatricopeptide repeat...    733   0.0      
ref|XP_009779890.1|  PREDICTED: putative pentatricopeptide repeat...    732   0.0      
emb|CDP12753.1|  unnamed protein product                                697   0.0      
ref|XP_011071912.1|  PREDICTED: putative pentatricopeptide repeat...    689   0.0      
ref|XP_002278116.1|  PREDICTED: putative pentatricopeptide repeat...    666   0.0      Vitis vinifera
emb|CAN62187.1|  hypothetical protein VITISV_003709                     663   0.0      Vitis vinifera
gb|ABK96162.1|  unknown                                                 652   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006476859.1|  PREDICTED: putative pentatricopeptide repeat...    649   0.0      
ref|XP_006439896.1|  hypothetical protein CICLE_v10023947mg             647   0.0      
gb|KDP31046.1|  hypothetical protein JCGZ_11422                         647   0.0      
gb|EYU22166.1|  hypothetical protein MIMGU_mgv1a003924mg                646   0.0      
ref|XP_008374396.1|  PREDICTED: putative pentatricopeptide repeat...    641   0.0      
ref|XP_002322190.2|  hypothetical protein POPTR_0015s09390g             648   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010678845.1|  PREDICTED: putative pentatricopeptide repeat...    632   0.0      
ref|XP_010094711.1|  hypothetical protein L484_003019                   629   0.0      
ref|XP_004501885.1|  PREDICTED: putative pentatricopeptide repeat...    627   0.0      
ref|XP_008239578.1|  PREDICTED: putative pentatricopeptide repeat...    627   0.0      
ref|XP_007211064.1|  hypothetical protein PRUPE_ppa018108mg             627   0.0      
ref|XP_003528138.1|  PREDICTED: putative pentatricopeptide repeat...    625   0.0      
ref|XP_003601206.1|  hypothetical protein MTR_3g077200                  616   0.0      
ref|XP_008464524.1|  PREDICTED: putative pentatricopeptide repeat...    611   0.0      
ref|XP_004138268.1|  PREDICTED: putative pentatricopeptide repeat...    610   0.0      
ref|XP_007138028.1|  hypothetical protein PHAVU_009G175100g             600   0.0      
ref|XP_004301691.1|  PREDICTED: putative pentatricopeptide repeat...    596   0.0      
ref|XP_007042233.1|  Tetratricopeptide repeat-like superfamily pr...    599   0.0      
ref|XP_008346811.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    593   0.0      
ref|XP_008358062.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    594   0.0      
ref|XP_010474616.1|  PREDICTED: putative pentatricopeptide repeat...    576   0.0      
ref|XP_006476860.1|  PREDICTED: putative pentatricopeptide repeat...    574   0.0      
ref|XP_010520718.1|  PREDICTED: putative pentatricopeptide repeat...    575   0.0      
ref|XP_010521030.1|  PREDICTED: putative pentatricopeptide repeat...    574   0.0      
ref|XP_010419506.1|  PREDICTED: putative pentatricopeptide repeat...    570   0.0      
ref|NP_176613.1|  pentatricopeptide repeat-containing protein           570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887903.1|  pentatricopeptide repeat-containing protein        559   0.0      
ref|XP_006300931.1|  hypothetical protein CARUB_v10021308mg             558   0.0      
ref|XP_006391645.1|  hypothetical protein EUTSA_v10023386mg             554   0.0      
gb|KHN19267.1|  Putative pentatricopeptide repeat-containing protein    544   0.0      
ref|XP_009112820.1|  PREDICTED: putative pentatricopeptide repeat...    544   0.0      
ref|XP_010924113.1|  PREDICTED: putative pentatricopeptide repeat...    542   0.0      
ref|XP_008792876.1|  PREDICTED: putative pentatricopeptide repeat...    540   0.0      
gb|KCW48919.1|  hypothetical protein EUGRSUZ_K02532                     532   1e-179   
ref|XP_011046253.1|  PREDICTED: putative pentatricopeptide repeat...    519   3e-175   
ref|XP_010431737.1|  PREDICTED: putative pentatricopeptide repeat...    508   7e-170   
emb|CDY38180.1|  BnaA09g12090D                                          503   8e-168   
emb|CDY64787.1|  BnaCnng44930D                                          494   1e-164   
gb|EPS68514.1|  hypothetical protein M569_06253                         488   5e-162   
ref|XP_004968903.1|  PREDICTED: putative pentatricopeptide repeat...    462   2e-151   
ref|XP_002455765.1|  hypothetical protein SORBIDRAFT_03g024530          453   2e-148   Sorghum bicolor [broomcorn]
tpg|DAA59060.1|  TPA: selenium-binding protein-like protein             446   2e-145   
ref|NP_001150921.1|  selenium-binding protein-like                      442   6e-144   Zea mays [maize]
ref|XP_003569172.1|  PREDICTED: putative pentatricopeptide repeat...    438   3e-142   
ref|NP_001043280.1|  Os01g0545900                                       436   3e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511339.1|  pentatricopeptide repeat-containing protein,...    430   1e-140   Ricinus communis
gb|EMT14463.1|  hypothetical protein F775_09791                         431   1e-139   
emb|CDM80099.1|  unnamed protein product                                428   3e-138   
gb|EMS61193.1|  hypothetical protein TRIUR3_15047                       422   4e-136   
ref|XP_006645980.1|  PREDICTED: putative pentatricopeptide repeat...    412   1e-132   
ref|XP_010041330.1|  PREDICTED: putative pentatricopeptide repeat...    404   4e-131   
gb|EEC70845.1|  hypothetical protein OsI_02345                          402   1e-129   Oryza sativa Indica Group [Indian rice]
gb|ACR38662.1|  unknown                                                 402   1e-129   Zea mays [maize]
ref|XP_010231894.1|  PREDICTED: putative pentatricopeptide repeat...    365   6e-115   
ref|XP_002868974.1|  hypothetical protein ARALYDRAFT_490847             355   5e-112   
emb|CBI14973.3|  unnamed protein product                                350   4e-109   
ref|XP_010243611.1|  PREDICTED: pentatricopeptide repeat-containi...    355   5e-107   
ref|XP_010273754.1|  PREDICTED: putative pentatricopeptide repeat...    345   8e-107   
ref|XP_010247013.1|  PREDICTED: pentatricopeptide repeat-containi...    348   2e-106   
ref|XP_007045237.1|  Tetratricopeptide repeat-like superfamily pr...    347   2e-105   
ref|XP_004290399.1|  PREDICTED: pentatricopeptide repeat-containi...    344   9e-105   
ref|XP_004135750.1|  PREDICTED: pentatricopeptide repeat-containi...    346   2e-104   
gb|KGN65963.1|  hypothetical protein Csa_1G553510                       347   5e-104   
ref|XP_008799870.1|  PREDICTED: putative pentatricopeptide repeat...    343   9e-104   
gb|ABR17838.1|  unknown                                                 345   2e-103   Picea sitchensis
ref|XP_004158080.1|  PREDICTED: pentatricopeptide repeat-containi...    343   2e-103   
ref|XP_010922662.1|  PREDICTED: putative pentatricopeptide repeat...    340   6e-103   
ref|XP_008791010.1|  PREDICTED: pentatricopeptide repeat-containi...    340   7e-103   
ref|XP_007216378.1|  hypothetical protein PRUPE_ppa020947mg             340   9e-103   
emb|CBI31086.3|  unnamed protein product                                342   1e-102   
ref|XP_002284799.1|  PREDICTED: pentatricopeptide repeat-containi...    340   1e-102   Vitis vinifera
ref|XP_006594225.1|  PREDICTED: pentatricopeptide repeat-containi...    340   1e-102   
ref|XP_008245930.1|  PREDICTED: pentatricopeptide repeat-containi...    337   3e-102   
ref|XP_008379914.1|  PREDICTED: putative pentatricopeptide repeat...    339   3e-102   
ref|XP_008459124.1|  PREDICTED: pentatricopeptide repeat-containi...    342   4e-102   
ref|XP_010920030.1|  PREDICTED: pentatricopeptide repeat-containi...    338   4e-102   
ref|XP_002275537.1|  PREDICTED: pentatricopeptide repeat-containi...    338   4e-102   Vitis vinifera
gb|EYU38224.1|  hypothetical protein MIMGU_mgv1a019053mg                335   1e-101   
ref|XP_007212808.1|  hypothetical protein PRUPE_ppa002835mg             335   2e-101   
ref|XP_007154904.1|  hypothetical protein PHAVU_003G157500g             337   2e-101   
gb|AEB39774.1|  pentatricopeptide repeat protein 65                     338   2e-101   
ref|XP_007154903.1|  hypothetical protein PHAVU_003G157500g             337   2e-101   
ref|XP_004150613.1|  PREDICTED: pentatricopeptide repeat-containi...    333   3e-101   
ref|XP_011101861.1|  PREDICTED: pentatricopeptide repeat-containi...    337   8e-101   
ref|XP_004499531.1|  PREDICTED: pentatricopeptide repeat-containi...    334   1e-100   
ref|XP_010250424.1|  PREDICTED: pentatricopeptide repeat-containi...    335   1e-100   
ref|XP_009342639.1|  PREDICTED: pentatricopeptide repeat-containi...    338   2e-100   
ref|XP_004289150.1|  PREDICTED: pentatricopeptide repeat-containi...    334   2e-100   
emb|CAN83391.1|  hypothetical protein VITISV_041405                     338   2e-100   Vitis vinifera
ref|XP_007132588.1|  hypothetical protein PHAVU_011G107600g             333   2e-100   
ref|XP_004294643.1|  PREDICTED: pentatricopeptide repeat-containi...    337   3e-100   
ref|XP_010258697.1|  PREDICTED: pentatricopeptide repeat-containi...    337   3e-100   
ref|XP_008368655.1|  PREDICTED: pentatricopeptide repeat-containi...    337   4e-100   
ref|XP_008225349.1|  PREDICTED: pentatricopeptide repeat-containi...    331   4e-100   
ref|XP_006470740.1|  PREDICTED: pentatricopeptide repeat-containi...    333   5e-100   
ref|XP_007198953.1|  hypothetical protein PRUPE_ppa018505mg             334   5e-100   
ref|XP_010270642.1|  PREDICTED: pentatricopeptide repeat-containi...    333   6e-100   
ref|XP_004499782.1|  PREDICTED: pentatricopeptide repeat-containi...    335   7e-100   
ref|XP_008377650.1|  PREDICTED: pentatricopeptide repeat-containi...    329   9e-100   
ref|XP_009357835.1|  PREDICTED: pentatricopeptide repeat-containi...    335   2e-99    
ref|XP_009388427.1|  PREDICTED: pentatricopeptide repeat-containi...    332   2e-99    
ref|XP_010936927.1|  PREDICTED: putative pentatricopeptide repeat...    328   2e-99    
ref|XP_009341462.1|  PREDICTED: putative pentatricopeptide repeat...    331   3e-99    
ref|XP_010940790.1|  PREDICTED: pentatricopeptide repeat-containi...    333   3e-99    
ref|XP_009386862.1|  PREDICTED: pentatricopeptide repeat-containi...    333   4e-99    
ref|XP_008455782.1|  PREDICTED: pentatricopeptide repeat-containi...    329   4e-99    
ref|XP_008797358.1|  PREDICTED: putative pentatricopeptide repeat...    327   4e-99    
ref|XP_009362516.1|  PREDICTED: pentatricopeptide repeat-containi...    327   4e-99    
ref|XP_010269696.1|  PREDICTED: pentatricopeptide repeat-containi...    333   4e-99    
emb|CBI15366.3|  unnamed protein product                                332   5e-99    
ref|XP_009353237.1|  PREDICTED: putative pentatricopeptide repeat...    330   6e-99    
ref|XP_001754449.1|  predicted protein                                  330   7e-99    
ref|XP_002278128.1|  PREDICTED: pentatricopeptide repeat-containi...    327   8e-99    Vitis vinifera
ref|XP_010107071.1|  hypothetical protein L484_001394                   330   8e-99    
ref|XP_008371575.1|  PREDICTED: pentatricopeptide repeat-containi...    327   8e-99    
ref|XP_006338058.1|  PREDICTED: pentatricopeptide repeat-containi...    327   1e-98    
ref|XP_008364184.1|  PREDICTED: pentatricopeptide repeat-containi...    327   1e-98    
ref|XP_009388863.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    328   1e-98    
ref|XP_004503357.1|  PREDICTED: pentatricopeptide repeat-containi...    333   2e-98    
ref|XP_006857329.1|  hypothetical protein AMTR_s00067p00084250          326   2e-98    
ref|XP_003610363.1|  Pentatricopeptide repeat-containing protein        328   4e-98    
ref|XP_006847845.1|  hypothetical protein AMTR_s00029p00062590          325   8e-98    
ref|XP_010320212.1|  PREDICTED: pentatricopeptide repeat-containi...    324   9e-98    
ref|XP_009775604.1|  PREDICTED: putative pentatricopeptide repeat...    326   1e-97    
ref|XP_002510620.1|  pentatricopeptide repeat-containing protein,...    327   1e-97    Ricinus communis
gb|KDO44965.1|  hypothetical protein CISIN_1g005487mg                   326   2e-97    
ref|XP_007015317.1|  Tetratricopeptide repeat-like superfamily pr...    326   2e-97    
gb|KHN22086.1|  Pentatricopeptide repeat-containing protein             322   2e-97    
ref|XP_002305733.2|  hypothetical protein POPTR_0004s05810g             327   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010920594.1|  PREDICTED: pentatricopeptide repeat-containi...    332   3e-97    
ref|XP_009779214.1|  PREDICTED: pentatricopeptide repeat-containi...    323   3e-97    
ref|XP_010657333.1|  PREDICTED: putative pentatricopeptide repeat...    326   3e-97    
ref|XP_006369200.1|  hypothetical protein POPTR_0001s18710g             322   4e-97    
ref|XP_003629790.1|  Pentatricopeptide repeat-containing protein        330   4e-97    
ref|XP_002268853.1|  PREDICTED: pentatricopeptide repeat-containi...    329   4e-97    Vitis vinifera
ref|XP_008225340.1|  PREDICTED: pentatricopeptide repeat-containi...    329   5e-97    
ref|XP_010668450.1|  PREDICTED: pentatricopeptide repeat-containi...    320   5e-97    
ref|XP_011100907.1|  PREDICTED: pentatricopeptide repeat-containi...    325   5e-97    
ref|XP_004161068.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    325   5e-97    
ref|XP_007214267.1|  hypothetical protein PRUPE_ppa025121mg             327   6e-97    
ref|XP_011019049.1|  PREDICTED: putative pentatricopeptide repeat...    324   7e-97    
gb|EYU40350.1|  hypothetical protein MIMGU_mgv1a021272mg                327   8e-97    
ref|XP_008793555.1|  PREDICTED: pentatricopeptide repeat-containi...    328   8e-97    
ref|XP_010228112.1|  PREDICTED: pentatricopeptide repeat-containi...    325   8e-97    
gb|EMT00934.1|  hypothetical protein F775_15202                         325   9e-97    
emb|CDP19953.1|  unnamed protein product                                324   9e-97    
ref|XP_003540859.1|  PREDICTED: pentatricopeptide repeat-containi...    324   1e-96    
ref|XP_003588887.1|  Pentatricopeptide repeat-containing protein        324   1e-96    
ref|XP_008445307.1|  PREDICTED: pentatricopeptide repeat-containi...    324   1e-96    
ref|XP_002265522.1|  PREDICTED: putative pentatricopeptide repeat...    323   1e-96    Vitis vinifera
ref|XP_006479094.1|  PREDICTED: pentatricopeptide repeat-containi...    332   1e-96    
ref|XP_008366040.1|  PREDICTED: pentatricopeptide repeat-containi...    328   2e-96    
gb|KDP40584.1|  hypothetical protein JCGZ_24583                         326   2e-96    
gb|EYU18632.1|  hypothetical protein MIMGU_mgv1a022910mg                320   2e-96    
ref|XP_009352737.1|  PREDICTED: pentatricopeptide repeat-containi...    327   2e-96    
ref|XP_007022988.1|  Tetratricopeptide repeat (TPR)-like superfam...    326   2e-96    
gb|KHN22863.1|  Pentatricopeptide repeat-containing protein, chlo...    323   2e-96    
ref|XP_010662541.1|  PREDICTED: pentatricopeptide repeat-containi...    320   3e-96    
ref|XP_008811840.1|  PREDICTED: pentatricopeptide repeat-containi...    325   3e-96    
ref|XP_002272819.1|  PREDICTED: pentatricopeptide repeat-containi...    321   3e-96    Vitis vinifera
ref|XP_006344830.1|  PREDICTED: pentatricopeptide repeat-containi...    323   3e-96    
ref|XP_011040529.1|  PREDICTED: pentatricopeptide repeat-containi...    326   4e-96    
ref|XP_006843170.1|  hypothetical protein AMTR_s00146p00058250          313   4e-96    
ref|XP_008352297.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    322   4e-96    
ref|XP_009380253.1|  PREDICTED: pentatricopeptide repeat-containi...    324   4e-96    
ref|XP_010931478.1|  PREDICTED: pentatricopeptide repeat-containi...    323   4e-96    
ref|XP_007022987.1|  Tetratricopeptide repeat (TPR)-like superfam...    325   4e-96    
ref|XP_010091782.1|  hypothetical protein L484_003842                   320   5e-96    
ref|XP_006446259.1|  hypothetical protein CICLE_v10014446mg             322   5e-96    
gb|KDP36856.1|  hypothetical protein JCGZ_08147                         322   5e-96    
ref|XP_002317690.2|  pentatricopeptide repeat-containing family p...    323   6e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010465057.1|  PREDICTED: pentatricopeptide repeat-containi...    322   7e-96    
ref|XP_008246495.1|  PREDICTED: putative pentatricopeptide repeat...    318   7e-96    
ref|XP_009614402.1|  PREDICTED: pentatricopeptide repeat-containi...    319   8e-96    
ref|XP_010256994.1|  PREDICTED: putative pentatricopeptide repeat...    321   1e-95    
ref|XP_008230158.1|  PREDICTED: pentatricopeptide repeat-containi...    320   1e-95    
ref|XP_009605798.1|  PREDICTED: pentatricopeptide repeat-containi...    325   1e-95    
ref|XP_007208504.1|  hypothetical protein PRUPE_ppa026555mg             317   1e-95    
ref|XP_008243706.1|  PREDICTED: pentatricopeptide repeat-containi...    317   1e-95    
ref|XP_003530713.1|  PREDICTED: pentatricopeptide repeat-containi...    321   1e-95    
ref|XP_007047622.1|  Pentatricopeptide repeat (PPR) superfamily p...    321   2e-95    
ref|XP_010681694.1|  PREDICTED: pentatricopeptide repeat-containi...    317   2e-95    
ref|XP_008784571.1|  PREDICTED: pentatricopeptide repeat-containi...    325   2e-95    
ref|XP_010648490.1|  PREDICTED: pentatricopeptide repeat-containi...    321   2e-95    
ref|XP_010668439.1|  PREDICTED: pentatricopeptide repeat-containi...    320   2e-95    
ref|XP_010999774.1|  PREDICTED: pentatricopeptide repeat-containi...    325   2e-95    
ref|XP_004504288.1|  PREDICTED: pentatricopeptide repeat-containi...    325   2e-95    
gb|KDP24179.1|  hypothetical protein JCGZ_25836                         318   2e-95    
emb|CAN75707.1|  hypothetical protein VITISV_031420                     320   3e-95    Vitis vinifera
gb|KGN62280.1|  hypothetical protein Csa_2G348180                       323   3e-95    
gb|KCW68026.1|  hypothetical protein EUGRSUZ_F01709                     318   3e-95    
gb|KGN54859.1|  hypothetical protein Csa_4G554180                       323   3e-95    
ref|XP_010062241.1|  PREDICTED: pentatricopeptide repeat-containi...    321   3e-95    
ref|XP_008361264.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    319   3e-95    
ref|XP_008790066.1|  PREDICTED: pentatricopeptide repeat-containi...    324   3e-95    
ref|XP_002313273.1|  hypothetical protein POPTR_0009s07140g             319   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_002270092.1|  PREDICTED: pentatricopeptide repeat-containi...    319   4e-95    Vitis vinifera
gb|KDP35999.1|  hypothetical protein JCGZ_08394                         320   4e-95    
ref|XP_002533783.1|  pentatricopeptide repeat-containing protein,...    319   4e-95    Ricinus communis
ref|XP_011020490.1|  PREDICTED: pentatricopeptide repeat-containi...    323   4e-95    
ref|XP_008373135.1|  PREDICTED: pentatricopeptide repeat-containi...    323   4e-95    
ref|XP_009793572.1|  PREDICTED: pentatricopeptide repeat-containi...    323   4e-95    
ref|XP_010264952.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-95    
ref|XP_010487003.1|  PREDICTED: pentatricopeptide repeat-containi...    319   5e-95    
emb|CDP12634.1|  unnamed protein product                                317   6e-95    
ref|XP_004515015.1|  PREDICTED: pentatricopeptide repeat-containi...    320   6e-95    
ref|XP_009611168.1|  PREDICTED: putative pentatricopeptide repeat...    318   8e-95    
ref|XP_010253997.1|  PREDICTED: pentatricopeptide repeat-containi...    320   9e-95    
gb|KEH26664.1|  PPR containing plant-like protein                       315   9e-95    
ref|XP_010535427.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    316   9e-95    
ref|XP_010907184.1|  PREDICTED: pentatricopeptide repeat-containi...    323   1e-94    
ref|XP_002303960.2|  hypothetical protein POPTR_0003s19010g             321   1e-94    Populus trichocarpa [western balsam poplar]
dbj|BAD94552.1|  hypothetical protein                                   318   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004168907.1|  PREDICTED: pentatricopeptide repeat-containi...    321   1e-94    
ref|XP_010694640.1|  PREDICTED: pentatricopeptide repeat-containi...    321   1e-94    
ref|XP_008442216.1|  PREDICTED: putative pentatricopeptide repeat...    319   2e-94    
ref|XP_006653155.1|  PREDICTED: pentatricopeptide repeat-containi...    319   2e-94    
ref|XP_003545819.1|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-94    
ref|XP_006299513.1|  hypothetical protein CARUB_v10015683mg             318   2e-94    
ref|XP_010264131.1|  PREDICTED: pentatricopeptide repeat-containi...    316   2e-94    
ref|XP_010918777.1|  PREDICTED: pentatricopeptide repeat-containi...    320   2e-94    
gb|KDO77573.1|  hypothetical protein CISIN_1g003150mg                   322   2e-94    
ref|XP_006407296.1|  hypothetical protein EUTSA_v10020185mg             318   2e-94    
ref|NP_187883.2|  mitochondrial editing factor 22                       318   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942311.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    318   2e-94    
gb|KHN26409.1|  Pentatricopeptide repeat-containing protein             320   2e-94    
ref|XP_010916602.1|  PREDICTED: pentatricopeptide repeat-containi...    320   2e-94    
gb|KCW65849.1|  hypothetical protein EUGRSUZ_G03194                     319   2e-94    
ref|XP_002884925.1|  predicted protein                                  317   3e-94    
ref|XP_006436374.1|  hypothetical protein CICLE_v10031036mg             314   3e-94    
ref|XP_003526349.1|  PREDICTED: pentatricopeptide repeat-containi...    320   3e-94    
ref|XP_004984117.1|  PREDICTED: pentatricopeptide repeat-containi...    319   3e-94    
ref|XP_008790794.1|  PREDICTED: pentatricopeptide repeat-containi...    314   3e-94    
ref|XP_010499449.1|  PREDICTED: pentatricopeptide repeat-containi...    317   3e-94    
ref|XP_011036383.1|  PREDICTED: pentatricopeptide repeat-containi...    320   3e-94    
gb|AID21657.1|  At4g21300p-like protein                                 321   3e-94    
gb|KEH25607.1|  pentatricopeptide (PPR) repeat protein                  326   4e-94    
ref|XP_010939340.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-94    
ref|XP_010061133.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-94    
ref|XP_006448816.1|  hypothetical protein CICLE_v10014257mg             320   4e-94    
emb|CBI21243.3|  unnamed protein product                                319   5e-94    
gb|EPS64446.1|  hypothetical protein M569_10333                         316   5e-94    
ref|XP_004233934.1|  PREDICTED: pentatricopeptide repeat-containi...    317   5e-94    
ref|XP_007146280.1|  hypothetical protein PHAVU_006G027400g             317   5e-94    
gb|AFW67452.1|  hypothetical protein ZEAMMB73_642603                    320   5e-94    
ref|XP_008644454.1|  PREDICTED: pentatricopeptide repeat-containi...    320   5e-94    
ref|XP_006347159.1|  PREDICTED: pentatricopeptide repeat-containi...    319   6e-94    
ref|XP_010048583.1|  PREDICTED: pentatricopeptide repeat-containi...    315   6e-94    
ref|XP_007148792.1|  hypothetical protein PHAVU_005G014700g             319   6e-94    
ref|XP_004305327.1|  PREDICTED: putative pentatricopeptide repeat...    311   6e-94    
ref|NP_193861.1|  pentatricopeptide repeat-containing protein           320   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315549.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    317   7e-94    
ref|XP_008644451.1|  PREDICTED: pentatricopeptide repeat-containi...    320   7e-94    
ref|XP_009390805.1|  PREDICTED: putative pentatricopeptide repeat...    318   7e-94    
ref|XP_008442211.1|  PREDICTED: putative pentatricopeptide repeat...    319   7e-94    
ref|XP_010067671.1|  PREDICTED: pentatricopeptide repeat-containi...    319   7e-94    
ref|XP_010916743.1|  PREDICTED: pentatricopeptide repeat-containi...    320   7e-94    
ref|XP_010248045.1|  PREDICTED: pentatricopeptide repeat-containi...    315   7e-94    
ref|XP_010266600.1|  PREDICTED: pentatricopeptide repeat-containi...    322   7e-94    
ref|XP_003630936.1|  Pentatricopeptide repeat-containing protein        322   8e-94    
ref|XP_008783512.1|  PREDICTED: pentatricopeptide repeat-containi...    320   8e-94    
ref|XP_009341394.1|  PREDICTED: pentatricopeptide repeat-containi...    316   8e-94    
ref|XP_009602573.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    313   9e-94    
ref|XP_010261548.1|  PREDICTED: pentatricopeptide repeat-containi...    314   9e-94    
gb|EMT28927.1|  hypothetical protein F775_10857                         317   9e-94    
ref|XP_010264122.1|  PREDICTED: putative pentatricopeptide repeat...    316   9e-94    
ref|XP_004959988.1|  PREDICTED: putative pentatricopeptide repeat...    315   1e-93    
ref|XP_002512645.1|  pentatricopeptide repeat-containing protein,...    316   1e-93    Ricinus communis
gb|KDO43259.1|  hypothetical protein CISIN_1g038522mg                   313   1e-93    
ref|XP_002466353.1|  hypothetical protein SORBIDRAFT_01g006260          320   1e-93    Sorghum bicolor [broomcorn]
ref|XP_011032581.1|  PREDICTED: putative pentatricopeptide repeat...    315   1e-93    
ref|XP_004233195.1|  PREDICTED: pentatricopeptide repeat-containi...    320   1e-93    
ref|XP_006468372.1|  PREDICTED: pentatricopeptide repeat-containi...    319   1e-93    
ref|XP_010254272.1|  PREDICTED: pentatricopeptide repeat-containi...    315   1e-93    
ref|XP_008237400.1|  PREDICTED: pentatricopeptide repeat-containi...    316   1e-93    
ref|XP_007212464.1|  hypothetical protein PRUPE_ppa015027mg             315   1e-93    
ref|XP_008455346.1|  PREDICTED: pentatricopeptide repeat-containi...    313   1e-93    
ref|XP_008227721.1|  PREDICTED: pentatricopeptide repeat-containi...    315   1e-93    
ref|XP_006353048.1|  PREDICTED: pentatricopeptide repeat-containi...    319   2e-93    
ref|XP_002272111.2|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-93    
ref|XP_004147126.1|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-93    
ref|XP_008793742.1|  PREDICTED: pentatricopeptide repeat-containi...    316   2e-93    
ref|XP_006467621.1|  PREDICTED: pentatricopeptide repeat-containi...    319   2e-93    
ref|XP_009373109.1|  PREDICTED: putative pentatricopeptide repeat...    315   2e-93    
ref|XP_010911842.1|  PREDICTED: putative pentatricopeptide repeat...    319   2e-93    
ref|XP_003608008.1|  Pentatricopeptide repeat-containing protein        324   2e-93    
ref|XP_009799583.1|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-93    
gb|AID21585.1|  AT4G21300p                                              319   2e-93    
ref|XP_010542851.1|  PREDICTED: pentatricopeptide repeat-containi...    315   2e-93    
ref|XP_003523921.1|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-93    
ref|XP_010929767.1|  PREDICTED: putative pentatricopeptide repeat...    317   2e-93    
ref|XP_004137012.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-93    
emb|CDP14719.1|  unnamed protein product                                313   3e-93    
ref|XP_007153023.1|  hypothetical protein PHAVU_003G001300g             318   3e-93    
ref|XP_008804180.1|  PREDICTED: pentatricopeptide repeat-containi...    311   3e-93    
ref|XP_002869895.1|  pentatricopeptide repeat-containing protein        318   3e-93    
ref|XP_002282466.1|  PREDICTED: pentatricopeptide repeat-containi...    313   3e-93    
emb|CDP08457.1|  unnamed protein product                                315   3e-93    
ref|XP_008785768.1|  PREDICTED: pentatricopeptide repeat-containi...    315   3e-93    
ref|XP_004986208.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-93    
ref|XP_008236588.1|  PREDICTED: pentatricopeptide repeat-containi...    317   4e-93    
emb|CDO99505.1|  unnamed protein product                                317   4e-93    
ref|XP_008234475.1|  PREDICTED: pentatricopeptide repeat-containi...    311   4e-93    
ref|XP_004233812.1|  PREDICTED: pentatricopeptide repeat-containi...    317   4e-93    
ref|XP_010655542.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-93    
gb|KHN42050.1|  Pentatricopeptide repeat-containing protein             313   5e-93    
gb|AEB39779.1|  pentatricopeptide repeat protein 98                     320   5e-93    
ref|XP_009631335.1|  PREDICTED: pentatricopeptide repeat-containi...    317   5e-93    
gb|EMT20741.1|  hypothetical protein F775_07206                         315   5e-93    
gb|AID21624.1|  At4g21300p-like protein                                 318   5e-93    
ref|XP_009764015.1|  PREDICTED: pentatricopeptide repeat-containi...    312   5e-93    
ref|XP_010249165.1|  PREDICTED: putative pentatricopeptide repeat...    315   6e-93    
ref|XP_008788871.1|  PREDICTED: putative pentatricopeptide repeat...    316   6e-93    
ref|XP_007202196.1|  hypothetical protein PRUPE_ppa018835mg             313   6e-93    
ref|XP_009341449.1|  PREDICTED: pentatricopeptide repeat-containi...    315   7e-93    
gb|KEH32949.1|  pentatricopeptide (PPR) repeat protein                  316   8e-93    
ref|XP_008244805.1|  PREDICTED: putative pentatricopeptide repeat...    313   8e-93    
ref|XP_008445930.1|  PREDICTED: pentatricopeptide repeat-containi...    317   8e-93    
ref|XP_008370552.1|  PREDICTED: putative pentatricopeptide repeat...    312   8e-93    
ref|XP_002272240.1|  PREDICTED: pentatricopeptide repeat-containi...    311   8e-93    
emb|CDX85089.1|  BnaC07g08170D                                          313   9e-93    
ref|XP_009353362.1|  PREDICTED: pentatricopeptide repeat-containi...    315   9e-93    
ref|XP_010037097.1|  PREDICTED: pentatricopeptide repeat-containi...    310   1e-92    
ref|XP_001774871.1|  predicted protein                                  318   1e-92    
ref|XP_006651878.1|  PREDICTED: pentatricopeptide repeat-containi...    316   1e-92    
ref|XP_007013861.1|  Pentatricopeptide repeat (PPR) superfamily p...    316   1e-92    
ref|XP_004493379.1|  PREDICTED: pentatricopeptide repeat-containi...    316   1e-92    
gb|AEB39778.1|  pentatricopeptide repeat protein 77                     322   1e-92    
ref|XP_008381477.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    310   1e-92    
ref|XP_007198996.1|  hypothetical protein PRUPE_ppa002176mg             313   1e-92    
gb|KHN10657.1|  Pentatricopeptide repeat-containing protein             317   1e-92    
ref|XP_010098515.1|  hypothetical protein L484_025954                   317   1e-92    
ref|XP_007207055.1|  hypothetical protein PRUPE_ppb002198mg             311   2e-92    
ref|XP_004140282.1|  PREDICTED: pentatricopeptide repeat-containi...    313   2e-92    
ref|XP_008806000.1|  PREDICTED: pentatricopeptide repeat-containi...    314   2e-92    
ref|XP_010100741.1|  hypothetical protein L484_005808                   317   2e-92    
ref|XP_010921568.1|  PREDICTED: pentatricopeptide repeat-containi...    319   2e-92    
ref|XP_009611873.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-92    
ref|XP_009376489.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-92    
ref|XP_008778672.1|  PREDICTED: pentatricopeptide repeat-containi...    311   2e-92    
ref|XP_006292336.1|  hypothetical protein CARUB_v10018547mg             312   3e-92    
ref|XP_007199081.1|  hypothetical protein PRUPE_ppa019139mg             310   3e-92    
ref|XP_010275204.1|  PREDICTED: pentatricopeptide repeat-containi...    313   3e-92    
ref|XP_003549163.1|  PREDICTED: pentatricopeptide repeat-containi...    310   3e-92    
ref|XP_010273676.1|  PREDICTED: pentatricopeptide repeat-containi...    314   3e-92    
ref|XP_010244691.1|  PREDICTED: pentatricopeptide repeat-containi...    313   3e-92    
gb|KHN24470.1|  Pentatricopeptide repeat-containing protein, mito...    309   3e-92    
ref|XP_008372492.1|  PREDICTED: putative pentatricopeptide repeat...    310   3e-92    
ref|XP_011070072.1|  PREDICTED: pentatricopeptide repeat-containi...    312   3e-92    
ref|XP_008785452.1|  PREDICTED: pentatricopeptide repeat-containi...    318   3e-92    
ref|XP_004966592.1|  PREDICTED: pentatricopeptide repeat-containi...    313   4e-92    
ref|XP_002323645.2|  pentatricopeptide repeat-containing family p...    311   4e-92    
ref|XP_011089782.1|  PREDICTED: pentatricopeptide repeat-containi...    318   4e-92    
ref|XP_010024034.1|  PREDICTED: pentatricopeptide repeat-containi...    312   4e-92    
ref|XP_003568274.2|  PREDICTED: pentatricopeptide repeat-containi...    317   4e-92    
ref|XP_008338210.1|  PREDICTED: pentatricopeptide repeat-containi...    312   4e-92    
ref|XP_010249162.1|  PREDICTED: putative pentatricopeptide repeat...    315   4e-92    
ref|XP_009341614.1|  PREDICTED: pentatricopeptide repeat-containi...    310   4e-92    
ref|XP_011089777.1|  PREDICTED: pentatricopeptide repeat-containi...    319   5e-92    
ref|XP_010255668.1|  PREDICTED: pentatricopeptide repeat-containi...    311   5e-92    
ref|XP_010273675.1|  PREDICTED: pentatricopeptide repeat-containi...    313   5e-92    
ref|XP_006400718.1|  hypothetical protein EUTSA_v10012749mg             311   6e-92    
ref|XP_008394135.1|  PREDICTED: pentatricopeptide repeat-containi...    308   6e-92    
ref|XP_010939608.1|  PREDICTED: pentatricopeptide repeat-containi...    308   6e-92    
ref|XP_009147262.1|  PREDICTED: putative pentatricopeptide repeat...    307   7e-92    
ref|XP_010937492.1|  PREDICTED: pentatricopeptide repeat-containi...    313   7e-92    
ref|XP_006345300.1|  PREDICTED: pentatricopeptide repeat-containi...    311   7e-92    
ref|XP_011084297.1|  PREDICTED: putative pentatricopeptide repeat...    310   8e-92    
ref|XP_008805366.1|  PREDICTED: pentatricopeptide repeat-containi...    319   8e-92    
ref|XP_009346255.1|  PREDICTED: pentatricopeptide repeat-containi...    314   8e-92    
emb|CDP03192.1|  unnamed protein product                                316   8e-92    
emb|CBI35582.3|  unnamed protein product                                309   8e-92    
ref|XP_002318245.2|  hypothetical protein POPTR_0012s13730g             308   9e-92    
ref|XP_007208151.1|  hypothetical protein PRUPE_ppa022107mg             311   9e-92    
ref|XP_007042438.1|  Tetratricopeptide repeat (TPR)-like superfam...    313   9e-92    
emb|CBI30833.3|  unnamed protein product                                311   1e-91    
gb|AAK09236.1|AC084320_23  hypothetical protein                         314   1e-91    
ref|XP_009770754.1|  PREDICTED: pentatricopeptide repeat-containi...    311   1e-91    
gb|KDP34853.1|  hypothetical protein JCGZ_09141                         313   1e-91    
ref|XP_003575265.1|  PREDICTED: pentatricopeptide repeat-containi...    315   1e-91    
ref|XP_009628569.1|  PREDICTED: pentatricopeptide repeat-containi...    310   1e-91    
gb|KDP33346.1|  hypothetical protein JCGZ_12895                         308   1e-91    
ref|XP_009416361.1|  PREDICTED: pentatricopeptide repeat-containi...    313   1e-91    
ref|XP_009377141.1|  PREDICTED: putative pentatricopeptide repeat...    311   1e-91    
gb|EYU32070.1|  hypothetical protein MIMGU_mgv1a017635mg                311   1e-91    
gb|EEE60039.1|  hypothetical protein OsJ_12814                          314   1e-91    
emb|CDP11486.1|  unnamed protein product                                307   1e-91    
ref|XP_007038198.1|  Tetratricopeptide repeat-like superfamily pr...    311   1e-91    
ref|XP_002867139.1|  EMB2758                                            313   1e-91    
ref|XP_010935759.1|  PREDICTED: pentatricopeptide repeat-containi...    310   1e-91    
gb|KDP46635.1|  hypothetical protein JCGZ_04569                         308   1e-91    
ref|XP_003565766.1|  PREDICTED: pentatricopeptide repeat-containi...    311   1e-91    
ref|XP_011010563.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-91    
ref|XP_006429514.1|  hypothetical protein CICLE_v10011209mg             310   2e-91    
ref|XP_007203957.1|  hypothetical protein PRUPE_ppa022872mg             310   2e-91    
ref|XP_010905005.1|  PREDICTED: pentatricopeptide repeat-containi...    318   2e-91    
ref|XP_009413784.1|  PREDICTED: pentatricopeptide repeat-containi...    314   2e-91    
ref|XP_010940317.1|  PREDICTED: pentatricopeptide repeat-containi...    307   2e-91    
gb|KCW69344.1|  hypothetical protein EUGRSUZ_F02828                     311   2e-91    
ref|XP_008781342.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-91    
ref|XP_010930171.1|  PREDICTED: pentatricopeptide repeat-containi...    307   2e-91    
ref|XP_010229470.1|  PREDICTED: pentatricopeptide repeat-containi...    313   2e-91    
ref|XP_011030049.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    308   2e-91    
ref|XP_008367262.1|  PREDICTED: pentatricopeptide repeat-containi...    308   2e-91    
ref|XP_010243020.1|  PREDICTED: putative pentatricopeptide repeat...    313   2e-91    
ref|XP_004296063.1|  PREDICTED: pentatricopeptide repeat-containi...    314   2e-91    
gb|EYU45383.1|  hypothetical protein MIMGU_mgv1a023657mg                310   2e-91    
ref|XP_010689997.1|  PREDICTED: pentatricopeptide repeat-containi...    308   2e-91    
ref|XP_009370362.1|  PREDICTED: putative pentatricopeptide repeat...    310   2e-91    
ref|XP_006400719.1|  hypothetical protein EUTSA_v10012749mg             311   2e-91    
ref|XP_009407445.1|  PREDICTED: putative pentatricopeptide repeat...    310   3e-91    
gb|EYU18584.1|  hypothetical protein MIMGU_mgv1a025869mg                308   3e-91    
ref|XP_008656571.1|  PREDICTED: pentatricopeptide repeat-containi...    311   3e-91    
ref|XP_010106812.1|  hypothetical protein L484_005358                   306   3e-91    
ref|XP_009389822.1|  PREDICTED: pentatricopeptide repeat-containi...    309   3e-91    
ref|XP_004291741.1|  PREDICTED: pentatricopeptide repeat-containi...    310   3e-91    
ref|XP_010248466.1|  PREDICTED: pentatricopeptide repeat-containi...    306   3e-91    
ref|XP_010434199.1|  PREDICTED: pentatricopeptide repeat-containi...    309   3e-91    
ref|XP_010246108.1|  PREDICTED: pentatricopeptide repeat-containi...    310   3e-91    
ref|XP_008386813.1|  PREDICTED: pentatricopeptide repeat-containi...    317   3e-91    
emb|CBI21510.3|  unnamed protein product                                310   3e-91    
ref|XP_001780298.1|  predicted protein                                  315   3e-91    
ref|XP_009419163.1|  PREDICTED: putative pentatricopeptide repeat...    304   3e-91    
ref|XP_007159470.1|  hypothetical protein PHAVU_002G240000g             307   4e-91    
ref|XP_004304934.1|  PREDICTED: pentatricopeptide repeat-containi...    310   4e-91    
ref|XP_009398812.1|  PREDICTED: pentatricopeptide repeat-containi...    313   4e-91    
ref|XP_009355807.1|  PREDICTED: pentatricopeptide repeat-containi...    306   4e-91    
dbj|BAD67155.1|  PpPPR_98                                               315   5e-91    
ref|XP_004984890.1|  PREDICTED: pentatricopeptide repeat-containi...    314   5e-91    
ref|XP_008344992.1|  PREDICTED: pentatricopeptide repeat-containi...    309   5e-91    
ref|XP_010271746.1|  PREDICTED: pentatricopeptide repeat-containi...    306   5e-91    
ref|XP_006651472.1|  PREDICTED: pentatricopeptide repeat-containi...    310   5e-91    
ref|XP_006474640.1|  PREDICTED: pentatricopeptide repeat-containi...    305   6e-91    
ref|XP_002266026.1|  PREDICTED: putative pentatricopeptide repeat...    309   6e-91    
ref|XP_007014360.1|  Pentatricopeptide repeat superfamily protein...    306   6e-91    
ref|XP_010906006.1|  PREDICTED: putative pentatricopeptide repeat...    309   6e-91    
emb|CAN64903.1|  hypothetical protein VITISV_019802                     306   6e-91    
ref|XP_006855751.1|  hypothetical protein AMTR_s00044p00169670          307   6e-91    
ref|XP_010532896.1|  PREDICTED: putative pentatricopeptide repeat...    306   6e-91    
ref|XP_006293702.1|  hypothetical protein CARUB_v10022660mg             311   7e-91    
ref|XP_010260583.1|  PREDICTED: pentatricopeptide repeat-containi...    309   7e-91    
ref|XP_010273363.1|  PREDICTED: pentatricopeptide repeat-containi...    307   7e-91    
ref|XP_010091324.1|  hypothetical protein L484_012217                   311   7e-91    
ref|XP_006453289.1|  hypothetical protein CICLE_v10010788mg             305   7e-91    
ref|XP_004148338.1|  PREDICTED: pentatricopeptide repeat-containi...    306   7e-91    
ref|XP_010314241.1|  PREDICTED: pentatricopeptide repeat-containi...    306   7e-91    
ref|XP_010434198.1|  PREDICTED: pentatricopeptide repeat-containi...    308   8e-91    
ref|XP_004134351.1|  PREDICTED: pentatricopeptide repeat-containi...    313   8e-91    
ref|XP_008223803.1|  PREDICTED: pentatricopeptide repeat-containi...    306   8e-91    
ref|XP_004155862.1|  PREDICTED: pentatricopeptide repeat-containi...    313   8e-91    
ref|XP_004308660.1|  PREDICTED: pentatricopeptide repeat-containi...    308   8e-91    
ref|XP_007033247.1|  Mitochondrial editing factor 22                    309   9e-91    
ref|XP_009134643.1|  PREDICTED: pentatricopeptide repeat-containi...    311   9e-91    
ref|XP_010108948.1|  hypothetical protein L484_027143                   310   9e-91    
ref|XP_004163029.1|  PREDICTED: pentatricopeptide repeat-containi...    306   9e-91    
ref|NP_172596.1|  pentatricopeptide repeat-containing protein           311   9e-91    
ref|XP_008445931.1|  PREDICTED: pentatricopeptide repeat-containi...    308   9e-91    
ref|XP_006437011.1|  hypothetical protein CICLE_v10033882mg             308   1e-90    
ref|XP_006585174.1|  PREDICTED: pentatricopeptide repeat-containi...    311   1e-90    
ref|XP_008440673.1|  PREDICTED: pentatricopeptide repeat-containi...    307   1e-90    
ref|XP_007208178.1|  hypothetical protein PRUPE_ppa017277mg             306   1e-90    
ref|XP_008235735.1|  PREDICTED: putative pentatricopeptide repeat...    305   1e-90    
ref|XP_010931126.1|  PREDICTED: pentatricopeptide repeat-containi...    306   1e-90    
ref|XP_008231644.1|  PREDICTED: pentatricopeptide repeat-containi...    308   1e-90    
ref|XP_002266689.1|  PREDICTED: pentatricopeptide repeat-containi...    306   1e-90    
ref|XP_010106970.1|  hypothetical protein L484_016898                   311   1e-90    
ref|XP_007010336.1|  Pentatricopeptide repeat (PPR) superfamily p...    307   1e-90    
ref|XP_010255213.1|  PREDICTED: putative pentatricopeptide repeat...    308   1e-90    
ref|XP_008440672.1|  PREDICTED: pentatricopeptide repeat-containi...    307   1e-90    
emb|CDY26156.1|  BnaA06g12610D                                          309   1e-90    
gb|KHN28184.1|  Pentatricopeptide repeat-containing protein, chlo...    307   1e-90    
ref|XP_002265720.2|  PREDICTED: putative pentatricopeptide repeat...    307   1e-90    
gb|KDO79365.1|  hypothetical protein CISIN_1g038516mg                   308   1e-90    
ref|XP_003532067.1|  PREDICTED: pentatricopeptide repeat-containi...    308   1e-90    
ref|XP_003580863.1|  PREDICTED: putative pentatricopeptide repeat...    308   1e-90    
ref|XP_008241570.1|  PREDICTED: pentatricopeptide repeat-containi...    308   1e-90    
ref|XP_002318942.2|  pentatricopeptide repeat-containing family p...    308   2e-90    
ref|XP_010923157.1|  PREDICTED: pentatricopeptide repeat-containi...    314   2e-90    
ref|XP_007208505.1|  hypothetical protein PRUPE_ppa026465mg             304   2e-90    
ref|XP_011042994.1|  PREDICTED: pentatricopeptide repeat-containi...    305   2e-90    
ref|XP_002319916.2|  pentatricopeptide repeat-containing family p...    305   2e-90    
ref|XP_010242634.1|  PREDICTED: pentatricopeptide repeat-containi...    314   2e-90    
ref|XP_007014357.1|  Pentatricopeptide repeat superfamily protein...    306   2e-90    
ref|XP_009588647.1|  PREDICTED: pentatricopeptide repeat-containi...    306   2e-90    
ref|XP_008787659.1|  PREDICTED: pentatricopeptide repeat-containi...    305   2e-90    
gb|KHN10242.1|  Putative pentatricopeptide repeat-containing protein    306   2e-90    
ref|XP_002454923.1|  hypothetical protein SORBIDRAFT_03g001460          308   2e-90    
ref|XP_009409574.1|  PREDICTED: pentatricopeptide repeat-containi...    305   2e-90    
dbj|BAD67156.2|  PpPPR_77                                               315   2e-90    
ref|XP_010096505.1|  hypothetical protein L484_017957                   308   2e-90    
ref|XP_009623675.1|  PREDICTED: pentatricopeptide repeat-containi...    308   2e-90    



>ref|XP_006344453.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X1 [Solanum tuberosum]
 ref|XP_006344454.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X2 [Solanum tuberosum]
 ref|XP_006344455.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X3 [Solanum tuberosum]
Length=559

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/553 (67%), Positives = 442/553 (80%), Gaps = 1/553 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MFI F SLL QLS+    IS TK LHA I+KTHLSH PFYATRIIRFYALN DI+SA  L
Sbjct  1     MFIPFNSLLAQLSKPKLPISRTKELHAFIIKTHLSHDPFYATRIIRFYALNNDIISAHNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TP RSI+LWNS+IRAYARAH+F NAF LF DML S   PDNFT+AC+++A S+ FD 
Sbjct  61    FDKTPHRSIYLWNSLIRAYARAHKFRNAFSLFNDMLYSEIMPDNFTYACLVKASSENFDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LRV+HGGVV+SGL+LD ICSSQLVSAYS+LG + +A KVF GI  PDLV WNSMISG+
Sbjct  121   HSLRVLHGGVVLSGLQLDFICSSQLVSAYSRLGCIADASKVFSGITGPDLVLWNSMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G LG+ +K + LF +MQ MG +PD ++ VGLIM +D PS+L IG+ +H+ CLK G +SN 
Sbjct  181   GGLGELEKGIELFSEMQIMGVRPDEYSMVGLIMTIDDPSVLIIGEAIHAFCLKLGVESND  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HV SLLVSMYSRCKCMGSA  +FDSL+EPD+VTWSA+I G+S  GD +KALDFFREMNMK
Sbjct  241   HVSSLLVSMYSRCKCMGSAFSVFDSLVEPDLVTWSALISGISLCGDSVKALDFFREMNMK  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             GGK D  LI +VL+A +QLA VQPG ETHG+A R GYH EV VSSAL+DMYSKCGFL LG
Sbjct  301   GGKADASLITTVLTACSQLANVQPGIETHGYAFRHGYHSEVMVSSALLDMYSKCGFLELG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              QV++ M  KNI+SYNS+IS+LGL+G A++AF+IFE+ LE E + PDEATFSALLCACCH
Sbjct  361   YQVYETMVFKNIVSYNSIISSLGLYGLASQAFEIFEKALE-EGHKPDEATFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR YFR M D+FGI   TEHY+YMVKLLGM G+L EAYEL+QS+Q P+D GIWG
Sbjct  420   AGLVNDGREYFRRMKDQFGISANTEHYIYMVKLLGMEGQLREAYELVQSLQEPIDSGIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD H NY +  IVA  LF NK+E +SY +M+SNMYA DGRW+ V KLRVD    K
Sbjct  480   ALLSCCDAHRNYEVADIVACRLFGNKLENNSYRIMLSNMYASDGRWDLVNKLRVDSGLTK  539

Query  1768  GKMPGKSWISNIK  1806
              K+PGKSWI++ K
Sbjct  540   LKLPGKSWITSKK  552



>ref|XP_004236539.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Solanum lycopersicum]
 ref|XP_010319005.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Solanum lycopersicum]
 ref|XP_010319006.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Solanum lycopersicum]
 ref|XP_010319007.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Solanum lycopersicum]
 ref|XP_010319009.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Solanum lycopersicum]
Length=555

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/553 (66%), Positives = 432/553 (78%), Gaps = 1/553 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MFI F SL+ QLS+    IS TK LHA I+KTHLS  PFYAT+IIRFYALN DI+SA ++
Sbjct  1     MFIPFNSLVAQLSKLKLPISRTKELHAFIIKTHLSQDPFYATKIIRFYALNNDIISAHKV  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TP R+I+LWNS+IR YARAH+F NAF LF DML S   PDNFT+AC+++A S+ FD 
Sbjct  61    FDKTPHRTIYLWNSLIRGYARAHKFRNAFSLFNDMLHSQIMPDNFTYACLVKASSENFDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LRV+HGGVV+SGL LD ICSSQLVSAYS+LG + +A KVF GI EPDLV WNSM+SG+
Sbjct  121   HSLRVLHGGVVLSGLRLDFICSSQLVSAYSRLGCIADASKVFSGITEPDLVLWNSMLSGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G LG+ +K + LF KMQ MG +PD ++ VGLIM +D  S+L  G+ +H  CLK G +SN 
Sbjct  181   GGLGELEKGIALFSKMQIMGVRPDEYSMVGLIMTIDDSSVLETGEAIHGFCLKLGVESND  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HV SLLVSMYSRCKC+ SA  +F SL+EPD+VTWSA+I G+S  GD + ALDFFREMNMK
Sbjct  241   HVTSLLVSMYSRCKCIDSAFIVFGSLVEPDLVTWSALISGISLCGDSVNALDFFREMNMK  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             GGK D  LIA+VL+A  QLA VQPG E HG+A R GYH EV VSSAL+DMYSKCGFL  G
Sbjct  301   GGKADASLIANVLTACTQLANVQPGIEIHGYAFRHGYHSEVMVSSALLDMYSKCGFLEFG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              QV++ M  KNI+SYNS+IS+LGLHG A+ AFQIFE+ LE E + PDEATFSALLCACCH
Sbjct  361   YQVYETMVFKNIVSYNSIISSLGLHGLASHAFQIFEKALE-EGHKPDEATFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR YFR M D FGI   TEHY+YMVKLLGM G+L EAYEL+QS+Q P+D GIWG
Sbjct  420   AGLVNDGREYFRKMKDHFGILANTEHYIYMVKLLGMEGQLREAYELVQSLQEPIDSGIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD H NY L  IVA  LF NK+E SSY +M+SNMYA DGRW+ V KLRVD E  K
Sbjct  480   ALLSCCDAHRNYELADIVACRLFGNKLENSSYRIMLSNMYASDGRWDLVNKLRVDSEITK  539

Query  1768  GKMPGKSWISNIK  1806
              K+PGKSWI++ K
Sbjct  540   LKLPGKSWITSKK  552



>ref|XP_009605679.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana tomentosiformis]
 ref|XP_009605680.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana tomentosiformis]
 ref|XP_009605682.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana tomentosiformis]
 ref|XP_009605683.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana tomentosiformis]
 ref|XP_009605684.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana tomentosiformis]
Length=556

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/554 (66%), Positives = 446/554 (81%), Gaps = 2/554 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MFI F SLL+QLS+   TIS TK LHA +++THLS  PFYATR++RFYA+N+DI+SAR L
Sbjct  1     MFIPFHSLLSQLSKLKLTISRTKELHAFVIRTHLSRDPFYATRVLRFYAINDDIISARNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRSI+LWNS+IRAYA AH+F++AF LFKDML S  +PDNFTFAC++RA S+ FD 
Sbjct  61    FDKTPQRSIYLWNSLIRAYASAHKFTDAFFLFKDMLYSEIKPDNFTFACVVRASSENFDV  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LRV+HG + +SGL  D ICSSQLVSAYS+LG + +A KVF GI +PDLV WNSMISG+
Sbjct  121   HSLRVLHGAIFLSGLHWDFICSSQLVSAYSRLGCIADASKVFSGITDPDLVLWNSMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             GCLG+ +K L LF +MQ+MG +PD +T VGLI  +  PS+L IG+++H+ CLK G +SN+
Sbjct  181   GCLGELEKGLELFSRMQKMGLRPDEYTMVGLIKAIYDPSVLEIGESIHAFCLKLGVESNS  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             H+ SLLVSMYSRCKCMG A R+F+  +EPD+VTWSA+I G S  G+ +KALDFFREMNMK
Sbjct  241   HITSLLVSMYSRCKCMGLAFRVFECRVEPDLVTWSAIISGTSLCGNSVKALDFFREMNMK  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K DP LIA+VL+A +QLA VQPG E HG+A R GYH+EV VSSAL+DMYSKCGFL LG
Sbjct  301   GRKADPPLIATVLTACSQLATVQPGSEIHGYAFRHGYHMEVMVSSALVDMYSKCGFLELG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              QV+K M  KNI+S NS+IS+LGL+G A++AFQIFE+ L  E + PDEATFSALLCACCH
Sbjct  361   YQVYKTMTFKNIVSINSIISSLGLYGLASQAFQIFEKAL-VEGHKPDEATFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELI-QSIQGPVDFGIW  1584
              GLV DGR+YFR M D+FGI   TEHY+YMVKLLGM G+L EAYELI QS+Q PVD GIW
Sbjct  420   AGLVNDGRKYFRRMKDQFGIPANTEHYIYMVKLLGMEGQLREAYELIVQSLQEPVDSGIW  479

Query  1585  GALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAI  1764
             GALLSCCD H NY L  IVA HLF NK+E S Y +M++NMYA DGRW+ V KLRVD+E+ 
Sbjct  480   GALLSCCDAHRNYELADIVASHLFGNKLENSRYKIMLANMYASDGRWDLVNKLRVDLESK  539

Query  1765  KGKMPGKSWISNIK  1806
             + K PGKSWI++ K
Sbjct  540   ELKHPGKSWITSTK  553



>ref|XP_009779890.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779892.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779893.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779894.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779895.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779896.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779897.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779898.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779899.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779900.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779901.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779902.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
 ref|XP_009779903.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Nicotiana sylvestris]
Length=555

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/553 (66%), Positives = 447/553 (81%), Gaps = 1/553 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I F SLL+QLS+   TI  TK LHA+I++THLS  PFYATRI+RFYALN+DI+SAR L
Sbjct  1     MSIPFHSLLSQLSKLKLTIPRTKELHALIIRTHLSCDPFYATRILRFYALNDDIISARNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TP RSI+LWNS+IRAYARA +F++AF LFKDML S  +PDNFTFAC++RA S+ FD 
Sbjct  61    FDKTPHRSIYLWNSLIRAYARARKFTDAFSLFKDMLYSEIKPDNFTFACLVRASSENFDV  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LRV HG VV+SGL+ D ICSSQLVSAYS+LG + +A KVF GI +PDLV WNSMISG+
Sbjct  121   HSLRVFHGAVVLSGLQWDFICSSQLVSAYSRLGCIADASKVFSGITDPDLVLWNSMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             GC G+ +K L LF +MQRMG +PD +T VGLI+ +  PS+L+IG+++H+ CLK G +SN+
Sbjct  181   GCFGELEKGLELFSRMQRMGFRPDEYTMVGLIIAIYDPSVLKIGESIHACCLKLGVESNS  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HV SLLVSMYSRCKCMG A R+F+SLLEPD+VTWSA+I G+S  G+ +KALDFFREMNMK
Sbjct  241   HVSSLLVSMYSRCKCMGLAFRVFESLLEPDLVTWSAIISGVSLCGNSVKALDFFREMNMK  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             GGK DPLLIA++L+A +QL  V+PG E HG++ R G HLEV VSSAL+DMYSKCGFL LG
Sbjct  301   GGKADPLLIATILTACSQLTTVRPGSEVHGYSFRHGCHLEVMVSSALVDMYSKCGFLELG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              QV+K M  KNI+S NS+IS+LGL+G A++AFQIFE+ L+ E + PDEATFSALLCACCH
Sbjct  361   YQVYKTMTFKNIVSINSIISSLGLYGLASQAFQIFEKALD-EGHKPDEATFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GL+ DGR YFR M D+FGI   TEHYVYMVKLLGM G+L EAYEL+QS+Q PVD GIWG
Sbjct  420   AGLLNDGREYFRRMKDQFGIPANTEHYVYMVKLLGMEGQLREAYELVQSLQEPVDSGIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD H NY L  I+A   F NK++ S Y VM+SNMYA DGRW+ V KLRVD+ + +
Sbjct  480   ALLSCCDAHRNYELADIIASRFFGNKLQNSRYRVMLSNMYASDGRWDLVNKLRVDLGSTE  539

Query  1768  GKMPGKSWISNIK  1806
              K+ GKSWIS+IK
Sbjct  540   LKLAGKSWISSIK  552



>emb|CDP12753.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/545 (63%), Positives = 432/545 (79%), Gaps = 1/545 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I FR+LL++LSR + T+  T++LHA I+KTHLS  PFYATR++R YA+N D+ SA +L
Sbjct  1     MLIPFRALLSELSRPHHTLLRTQILHAFIIKTHLSRDPFYATRLVRLYAINNDLSSAHQL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FDETPQRSIFLWNSIIRAYA+ H FS+AF LFK ML   T PDNFTFACILRACS+K D 
Sbjct  61    FDETPQRSIFLWNSIIRAYAKTHLFSDAFALFKRMLSLETSPDNFTFACILRACSEKADI  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
             +GL +VHG  VV G  LDS+C S LVSAYSKLG L++A +VF GI EPDLV WNSMISG+
Sbjct  121   NGLEIVHGLGVVLGFGLDSVCCSALVSAYSKLGHLDKASRVFYGILEPDLVLWNSMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             GC G+W+K + LF KM+ +G+ PDS+T VGL + L  P+LLRIG++VH  C+K  F    
Sbjct  181   GCCGNWEKGMELFRKMRELGKCPDSYTVVGLSIGLTDPTLLRIGESVHGFCVKCNFGWIG  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HV S+LV+MYSR KCM SA ++F+SLL+PD+VTWSA+I G SQ+     ALDFFR+MN++
Sbjct  241   HVNSVLVNMYSRLKCMDSAYKLFNSLLQPDLVTWSALITGFSQAEQHNLALDFFRKMNLE  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K D +LI+S L+AAAQ AIV+PG E HG+A+R G H EV+VSSALIDMY+KCG+L LG
Sbjct  301   GRKPDHVLISSALAAAAQTAIVRPGCELHGYAIRHGCHSEVTVSSALIDMYAKCGYLGLG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             +++FK+MP KNI+SYNS+I+ LGL+G A EAF+ FEEVL  E   PDE+TF+ALL ACCH
Sbjct  361   MKLFKSMPKKNIVSYNSIIACLGLYGFAAEAFKTFEEVL-SEGIRPDESTFAALLGACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
             +GLV  GR YFR M DEFGI PK EHYV+MVKL+GMAGEL EA+EL+QS+Q P D  IWG
Sbjct  420   SGLVDTGREYFRRMRDEFGILPKNEHYVHMVKLIGMAGELTEAFELVQSLQQPADSSIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCC++H NY L  +VA++LF +K  K+SY VM+SN+YA DGRW+ V+KLR D E +K
Sbjct  480   ALLSCCNVHENYELAEVVAENLFKSKQTKNSYKVMLSNIYASDGRWDDVQKLRFDAEDLK  539

Query  1768  GKMPG  1782
             GK+PG
Sbjct  540   GKIPG  544



>ref|XP_011071912.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Sesamum indicum]
Length=552

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/553 (61%), Positives = 429/553 (78%), Gaps = 2/553 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I F+SLL+QL++ N T+S T++LHA+++K  LS  PFYAT+I+RFYA+N D++SA  +
Sbjct  1     MHIHFKSLLSQLTKPNHTLSATRILHALLIKQRLSSDPFYATKIVRFYAINNDLISAHIV  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD TPQRSIFLWNSIIRAYA+ H+F +AF LFK +L SGT+PDN+TFAC+ RAC+++ D 
Sbjct  61    FDTTPQRSIFLWNSIIRAYAQVHKFCDAFLLFKGLLTSGTQPDNYTFACVARACAERSDV  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               L+VVHG VV  G  LD IC+S L+S YSKLG ++ A  VF GI EPDLV WN+MISG+
Sbjct  121   EALKVVHGQVVAFGFGLDFICNSALISCYSKLGLVDVASCVFCGIEEPDLVLWNAMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  GD  K + LF  MQ MG +PD +T VGLIM L   S+LR+GK VH  C+K G   N 
Sbjct  181   GTFGDSAKGVELFNAMQNMGIRPDGYTMVGLIMGLSDHSVLRVGKTVHGFCVKCGLILND  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             H  S LVSMYSRCK M  AC++FDSL++PD+V+WSA+I G S SGD ++AL+FFRE+ M 
Sbjct  241   HACSALVSMYSRCKSMELACKVFDSLVQPDLVSWSALIAGFSLSGDHVRALEFFRELLMD  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             GGK DP+L+ASVL+A+AQLAIV PG E HG+A+R    +EV+VSSALIDMY+KCGFL +G
Sbjct  301   GGKADPVLLASVLAASAQLAIVGPGCEIHGYAIRHDCSMEVAVSSALIDMYAKCGFLEMG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             I+VFK MP +NIISYN++IS+LGL+G A EAFQ+FEEVL  E   PD  TF  LLCACCH
Sbjct  361   IKVFKNMPKRNIISYNTVISSLGLYGCAREAFQMFEEVL-GEGLKPDGTTFIGLLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
             +GLV +G +YFR+MN EFGIQ KTEH+V+MVKLLGM G++EEA++LI+S+  PV+  IWG
Sbjct  420   SGLVNEGWKYFRLMN-EFGIQAKTEHHVHMVKLLGMNGKVEEAFDLIKSLPEPVNSSIWG  478

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD H NY L  ++AKHL + K +   Y V++SN++AGDGRW+ VK+LRVD   +K
Sbjct  479   ALLSCCDSHKNYDLLVVIAKHLSETKPKDFGYSVLLSNLFAGDGRWDEVKRLRVDSGRVK  538

Query  1768  GKMPGKSWISNIK  1806
             GK PG SWI++I 
Sbjct  539   GKTPGISWINDIN  551



>ref|XP_002278116.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Vitis vinifera]
Length=560

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/546 (63%), Positives = 422/546 (77%), Gaps = 2/546 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F  LL +LS+ +QT+  TK LHA I++ HLS  PFYATRI+RFYA+N D+ SAR LFD T
Sbjct  11    FSKLLFELSKIHQTLPRTKKLHAFIIRNHLSDDPFYATRILRFYAINSDLCSARNLFDGT  70

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               RS++LWNS+IRAYA  H+F +A  LF  ML +  +PD+FTFAC+LRAC++ FD  GLR
Sbjct  71    SYRSVYLWNSVIRAYAGEHQFDDALLLFAKMLRTEIKPDSFTFACVLRACAENFDPDGLR  130

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
             VVHGGVVVSGL  DS+C S LV+AYSKL  ++EA +VF G+AEPDLV WN+M +G+G  G
Sbjct  131   VVHGGVVVSGLGFDSVCGSALVTAYSKLCMVDEASRVFYGMAEPDLVLWNAMAAGYGYCG  190

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K L LF  M+ MGE+PDS+T VGLI  L  PSLL IGK +H  CLK  FD N HVGS
Sbjct  191   FWDKGLQLFSAMRSMGEQPDSYTMVGLISGLADPSLLGIGKGIHGFCLKSSFDCNDHVGS  250

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LVSMYSRC C+ SA  +F  L +PD+VTWSA+I GLS+SGD  KAL FFR+MNM+G +V
Sbjct  251   ALVSMYSRCHCLNSAYGVFTILSQPDLVTWSALITGLSKSGDYEKALLFFRKMNMEGKRV  310

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             DP+LIASVL+A+ Q AI+ PG E HG+ +R G   EV +SSALIDMYSKCGF+NLG++VF
Sbjct  311   DPILIASVLAASGQSAILGPGSEIHGYVLRHGLESEVMISSALIDMYSKCGFVNLGVRVF  370

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
              +MP++N +SYNSMI  LG+HG A +AF++FEEVLEK  + PDE+TFSALLC CCH GLV
Sbjct  371   DSMPNRNTVSYNSMILGLGIHGLAPQAFKMFEEVLEKG-FKPDESTFSALLCTCCHAGLV  429

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +GR  F  M +EF IQ +T+HYV+MVKLLGMAGEL+EAY+LI S+Q PVD GIWGALLS
Sbjct  430   KNGREIFSRMTEEFHIQARTDHYVHMVKLLGMAGELQEAYDLILSLQQPVDSGIWGALLS  489

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKM  1776
             CC+ HGN  L  IVA+ LF+NK EKS+Y VM+SN+YAGD RW+ VKKLR D+ EA   KM
Sbjct  490   CCNFHGNPELAEIVAQQLFENKPEKSAYRVMLSNIYAGDDRWDDVKKLRDDIQEAGIKKM  549

Query  1777  PGKSWI  1794
             PG SWI
Sbjct  550   PGLSWI  555



>emb|CAN62187.1| hypothetical protein VITISV_003709 [Vitis vinifera]
Length=560

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/546 (63%), Positives = 420/546 (77%), Gaps = 2/546 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F  LL +LS+ +Q++  TK LHA I++ HLS  PFYATRI+RFYA+N D+ SAR LFD T
Sbjct  11    FSKLLFELSKIHQSLPRTKKLHAFIIRNHLSDDPFYATRILRFYAINSDLCSARNLFDGT  70

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               RS++LWNS+IRAYA  H+F +A  LF  ML +  +PD+FTFAC+LRAC++ FD  GLR
Sbjct  71    SHRSVYLWNSVIRAYAGEHQFDDALLLFAKMLRTEIKPDSFTFACVLRACAENFDPDGLR  130

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
             VVHGGVVVSGL  DS+C S LV+AYSKL  ++EA +VF G+AE DLV WN+M +G+G  G
Sbjct  131   VVHGGVVVSGLGFDSVCGSALVTAYSKLCMVDEASRVFYGMAEQDLVLWNAMAAGYGYCG  190

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K L LF  M+ MGE+PDS+T VGLI  L  P+LL IGK +H  CLK  FD NAHVGS
Sbjct  191   FWDKGLQLFSAMRSMGEQPDSYTMVGLISGLADPNLLGIGKGIHGFCLKSSFDCNAHVGS  250

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LVSMYSRC C+ SA  +F  L +PD+VTWSA+I GLS+SGD  KAL FFR+MNM+G +V
Sbjct  251   ALVSMYSRCHCLNSAYGVFTILSQPDLVTWSALITGLSKSGDYEKALLFFRKMNMEGKRV  310

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             DP+LI SVL+A+ Q AI+ PG E HG+ +R G   EV +SSALIDMYSKCGF+NLG++VF
Sbjct  311   DPILIXSVLAASGQSAILGPGSEIHGYVLRHGLESEVMISSALIDMYSKCGFVNLGVRVF  370

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
              +MP++N +SYNSMI  LG+HG A +AF++FEEVLEK  + PDE+TFSALLC CCH GLV
Sbjct  371   DSMPNRNTVSYNSMILGLGIHGLAXQAFKMFEEVLEKG-FKPDESTFSALLCTCCHAGLV  429

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              DGR  F  M +EF IQ +TEHYV+MVKLLGMAGEL+EAY+LI S+Q P D GIWGALLS
Sbjct  430   NDGREIFSRMTEEFHIQARTEHYVHMVKLLGMAGELQEAYDLILSLQQPADSGIWGALLS  489

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKM  1776
             CC+ HGN  L  IVA+ LF+NK EKS+Y VM+SN+YAGD RW+ VKKLR D+ EA   KM
Sbjct  490   CCNFHGNSELAXIVAQQLFENKPEKSAYRVMLSNIYAGDXRWDDVKKLRDDIQEAGIKKM  549

Query  1777  PGKSWI  1794
             PG SWI
Sbjct  550   PGLSWI  555



>gb|ABK96162.1| unknown [Populus trichocarpa]
Length=553

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/554 (59%), Positives = 411/554 (74%), Gaps = 5/554 (1%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I F+SL  QLS+++QT+S TK LHA++ KTHL   PFYAT+++RFYALN D+ SAR L
Sbjct  1     MLIKFQSLFLQLSKTHQTLSRTKQLHALVTKTHLLQDPFYATKLVRFYALNNDLSSARNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRS+FLWNSIIRAYA+AH+F +AF L+  M+     PD +T+AC++RAC + F  
Sbjct  61    FDKTPQRSVFLWNSIIRAYAQAHKFDDAFLLYTKMIGFDVIPDKYTYACLIRACCEDFYV  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GLR+VHGGV+VSGL LDS+  S LV+ YSK+G + EA KVF G+ EPDLV WN+MISG 
Sbjct  121   DGLRIVHGGVIVSGLGLDSVTCSALVTGYSKMGLVGEASKVFCGVFEPDLVLWNAMISGC  180

Query  688   GCLGDWKKALLLFIKMQRMGEK-PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSN  864
             G  G   K LL F +M+  G K PD +T+V LI  L   S L +G+ +H LCLK GFD N
Sbjct  181   GYCGFGDKGLLFFNEMRDNGNKRPDGYTFVALISGLANSSSLELGQGIHGLCLKSGFDCN  240

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
              HVGS LVSMYSR  C+  A  +F SL +PD+VTWSA+I G SQ+G+  KAL F++ +N+
Sbjct  241   DHVGSSLVSMYSRFSCINLAYSVFRSLCQPDLVTWSALITGFSQAGEHEKALLFYKNLNL  300

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
              G K D +LIASVL A AQLA V PG + HG+ VR G+   V VSSALIDMYSKCGF+ L
Sbjct  301   AGKKPDSVLIASVLVATAQLANVGPGAQIHGYIVRYGFESHVMVSSALIDMYSKCGFVGL  360

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
             G++VF+ MP++NI+SYNS+IS LGLHG A++AF +F E++EK    PDE+TFSALLCACC
Sbjct  361   GLRVFENMPNRNIVSYNSIISGLGLHGLASQAFDMFTEIVEKG-LKPDESTFSALLCACC  419

Query  1405  HTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIW  1584
             H GLV DGR  FR M DEF IQ +TEHYV++VKLLGMAGEL+EAY  I S++ PVD GIW
Sbjct  420   HAGLVKDGREIFRRMKDEFWIQARTEHYVHIVKLLGMAGELDEAYNFILSLKQPVDSGIW  479

Query  1585  GALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAI  1764
             GALLSCCD HG+  L  IVA+ LFD + +K +Y VM+SN+YAGDGRW  V+K+R D    
Sbjct  480   GALLSCCDAHGDSELAEIVAQQLFDGEPKKGAYRVMLSNVYAGDGRWVDVEKMR-DYITT  538

Query  1765  KG--KMPGKSWISN  1800
              G  KMPG S I +
Sbjct  539   AGAEKMPGLSRIGS  552



>ref|XP_006476859.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X1 [Citrus sinensis]
Length=554

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/551 (59%), Positives = 406/551 (74%), Gaps = 2/551 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MF     L+ +LS+S+Q++S TK LHA++ K  L   PFYAT+++R YALN  + +AR L
Sbjct  1     MFFNLHFLVLELSKSHQSLSRTKELHALVAKASLLRDPFYATKLVRLYALNNVLPAARIL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRS+FLWNSIIRAYA AHRF++A  LFK++L +  +PDNFT+ACI RACS+  D 
Sbjct  61    FDKTPQRSVFLWNSIIRAYALAHRFNDAKSLFKNLLRTQLKPDNFTYACITRACSENSDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GLR VHGG +VSGL  DSI SS LV+AYSKL  ++EAIKVFDG+++PDLV  NSMISG 
Sbjct  121   PGLRFVHGGAIVSGLGRDSITSSALVTAYSKLSLIDEAIKVFDGVSDPDLVLCNSMISGF  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G W K+L LF  M R+G+ PD +T VGLI  L  P LL +G+ +H  CLK  FDS  
Sbjct  181   AHCGFWDKSLQLFDWMLRLGKTPDGYTLVGLISGLWEPCLLNVGQGIHGFCLKSSFDSYD  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             +V S+LVSMY+RC CM SA  +F+SLL PD+VTWSA+I G SQ GD  KAL +FR++NM+
Sbjct  241   YVSSVLVSMYARCNCMNSAYHVFNSLLHPDLVTWSALINGYSQQGDYGKALYYFRKLNMQ  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K DP+LIASVL+AAA+ A V PG   HG+ +R G+ L V VSSAL+DMYSKCG+L LG
Sbjct  301   GKKADPVLIASVLAAAAKSANVWPGAVIHGYVIRHGFELSVMVSSALVDMYSKCGYLGLG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             IQVF+ M  +NII+YNS+I  LGLHG   +AF+IF +++EK   NPDE+TFSALLCACCH
Sbjct  361   IQVFETMSERNIITYNSVILGLGLHGFTYQAFEIFRDIIEKG-LNPDESTFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  FR M +E+GIQ KTEHY+YMVKLLG++G LEEAY  I S+  PVD  + G
Sbjct  420   GGLVNDGREIFRRMTEEYGIQAKTEHYIYMVKLLGLSGNLEEAYSFIWSLPKPVDPAVSG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALLSCC I+GN  L  IVA  LF+N   K +Y VM+SN YA DGRW+ V KLR D+ +  
Sbjct  480   ALLSCCHIYGNSELAEIVAHQLFENDPRKGAYKVMLSNTYAEDGRWDDVMKLRDDIVDNG  539

Query  1765  KGKMPGKSWIS  1797
               K  G SW+S
Sbjct  540   LRKEAGVSWVS  550



>ref|XP_006439896.1| hypothetical protein CICLE_v10023947mg [Citrus clementina]
 gb|ESR53136.1| hypothetical protein CICLE_v10023947mg [Citrus clementina]
 gb|KDO69513.1| hypothetical protein CISIN_1g045069mg [Citrus sinensis]
Length=554

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/551 (59%), Positives = 404/551 (73%), Gaps = 2/551 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MF     L+ +LS+S+Q++S TK LHA++ K  L   PFYAT+++R YALN  + SAR L
Sbjct  1     MFFNLHFLVLELSKSHQSLSRTKELHALVAKASLLRDPFYATKLVRLYALNNVLPSARIL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRS+FLWNSIIRAYA AHRF++A  LFK++L +  +PDNFT+ACI RACS+  D 
Sbjct  61    FDKTPQRSVFLWNSIIRAYALAHRFNDAKSLFKNLLRTQLKPDNFTYACITRACSENSDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GLR VHGG +VSGL  DSI SS LV+AYSKL  ++EAIKVFDG+++PDLV  NSMISG 
Sbjct  121   PGLRFVHGGAIVSGLGRDSITSSALVTAYSKLSLIDEAIKVFDGVSDPDLVLCNSMISGF  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G W K+L LF  M R+G+ PD +T VGLI  L  PSLL +G+ +H  CLK  FDS  
Sbjct  181   AHCGFWDKSLQLFDWMLRLGKTPDEYTLVGLISGLWEPSLLSVGQGIHGFCLKSSFDSYD  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             +V S+LVSMY+RC CM SA  +F+SL  PD+VTWSA+I G SQ GD  KAL +FR++NM+
Sbjct  241   YVSSVLVSMYARCNCMNSAYHVFNSLFHPDLVTWSALITGYSQQGDYGKALYYFRKLNMQ  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K DP+LIASVL+AAA+ A V PG   HG+ ++ G+ L V VSSAL+DMYSKCG+L LG
Sbjct  301   GKKADPVLIASVLAAAAKSANVWPGAVIHGYVIQHGFELSVMVSSALVDMYSKCGYLGLG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             IQVF+ M  +NII+YNS+I  LGLHG   +AF+ F +++EK   NPDE+TFSALLCACCH
Sbjct  361   IQVFETMSERNIITYNSVILGLGLHGFTYQAFEFFRDIIEKG-LNPDESTFSALLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  F  M +E+GIQ KTEHY+YMVKLLG+AG LEEAY  I S+  PVD  + G
Sbjct  420   GGLVNDGREIFTRMTEEYGIQAKTEHYIYMVKLLGLAGNLEEAYSFIWSLPKPVDPAVSG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALLSCC I+GN  L  IVA  LF+N   K +Y VM+SN YA DGRW+ V KLR D+ +  
Sbjct  480   ALLSCCHIYGNSDLAEIVAHQLFENDPRKGAYKVMLSNTYAEDGRWDDVMKLRDDIVDNG  539

Query  1765  KGKMPGKSWIS  1797
               K  G SW+S
Sbjct  540   LRKEAGVSWVS  550



>gb|KDP31046.1| hypothetical protein JCGZ_11422 [Jatropha curcas]
Length=555

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/551 (58%), Positives = 409/551 (74%), Gaps = 3/551 (1%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M + F SLL +L++S+QT S TK LHA+IL++HLSH  FYAT+I+RFYALN+D++SA  L
Sbjct  1     MSVKFSSLLQELTKSHQTRSRTKQLHALILRSHLSHESFYATKILRFYALNDDLISAYNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRSIFLWNS+IRA+A+AH+F  A   +  ML + T+PDNFT+AC++R C + FD 
Sbjct  61    FDKTPQRSIFLWNSMIRAFAKAHKFDEALSFYAKMLRTETKPDNFTYACLIRGCHENFDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GLR++HGG++VSGL LDS+ SS LV+AYSK   + EA KVF GI E DLV  N+MISG+
Sbjct  121   DGLRILHGGLIVSGLGLDSVSSSALVTAYSKFSHVSEASKVFSGIFERDLVLCNAMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMG-EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSN  864
                G W K L LF  M+ +G ++PD FT VGLI  L   SLL IG+ +H LCLK GFD N
Sbjct  181   SYCGFWGKGLQLFNGMREIGKQQPDGFTLVGLISGLMDFSLLGIGQGIHGLCLKSGFDCN  240

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
             A+VGS LV+MYSR KCM SA  +F  L +PD+V WSA+I G  Q  D  KAL F+R +++
Sbjct  241   AYVGSALVNMYSRFKCMNSAYGVFIGLYQPDLVAWSALITGFLQCEDYKKALFFYRNLSV  300

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
              G K DP+LIAS+L A+AQL  V+ G E HG+ +R G    + VSSALIDMY KCGF+ L
Sbjct  301   AGKKADPILIASLLVASAQLTDVRLGTEIHGYVLRHGLESNIIVSSALIDMYLKCGFVGL  360

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
             GI VF+ M ++NI+SYNS+IS LGLHG A +AF++FEE+LEK    PDE+T S LLCACC
Sbjct  361   GILVFENMRNRNIVSYNSVISGLGLHGLAAQAFKLFEEMLEKG-LKPDESTLSGLLCACC  419

Query  1405  HTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIW  1584
             H GLV DG+  FR M DEF I P+TEHY+++VKLLGMAGELEEAY  + S+  PVD GIW
Sbjct  420   HAGLVKDGQEIFRRMMDEFCIPPRTEHYIHIVKLLGMAGELEEAYNFVLSLMQPVDSGIW  479

Query  1585  GALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAI  1764
             GALLSCCD+HGN  L  IV++ LFDN+  K +Y VM+SN+YA DGRW+ VK+ R ++  +
Sbjct  480   GALLSCCDVHGNTELAEIVSQQLFDNEPRKGAYKVMLSNIYASDGRWDDVKRTRDNIVNV  539

Query  1765  KG-KMPGKSWI  1794
                KMPG SWI
Sbjct  540   GARKMPGLSWI  550



>gb|EYU22166.1| hypothetical protein MIMGU_mgv1a003924mg [Erythranthe guttata]
Length=555

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/553 (58%), Positives = 412/553 (75%), Gaps = 3/553 (1%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I   S+L+QL++ + TIS T++LHA+++   LS  PFYAT+I+R YA+N D++SAR L
Sbjct  1     MNIHLNSILSQLTKPHHTISRTRILHALVIANSLSSDPFYATKILRLYAVNNDLISARNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD TPQRS+FLWNSIIRAYA++HRF +AF LFK +L S T PDN+TFAC+ RA +D FD 
Sbjct  61    FDRTPQRSVFLWNSIIRAYAQSHRFPDAFALFKRLLISETPPDNYTFACVARATADSFDI  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LR+VHG VV  GL LD +C+S LVS+YSKLG ++EA  VF GI EPDLV +N+MISG+
Sbjct  121   KALRIVHGKVVSFGLSLDFVCNSALVSSYSKLGLVDEASCVFRGIEEPDLVLFNAMISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  GDW K + LF  MQ  G +PD +T VGLI+ L     +  G+ +H  C+K G D N 
Sbjct  181   GNCGDWVKGIELFNTMQNTGFRPDGYTMVGLIIGLIDHRSINTGEMIHGFCVKCGLDLND  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HVGS+LVSMYS+CK + S  ++F SL++PD+V+WSA+I GLS +G  +KAL FFRE  + 
Sbjct  241   HVGSVLVSMYSKCKNIESVFKVFGSLVQPDLVSWSAIITGLSLAGYYVKALLFFREFLID  300

Query  1048  G-GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
             G  K D +LIAS LSA+AQLAIV PG E HG+A+R     EV+VSSALIDMY+KCGFL +
Sbjct  301   GRKKADYVLIASALSASAQLAIVGPGCEIHGYAIRHECSTEVAVSSALIDMYAKCGFLEM  360

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
             G++VF  MP +N +SYN +IS+LGL+G A EAF++F+E+L+ E   PDE TF+ LLCACC
Sbjct  361   GVKVFDKMPHRNTVSYNIVISSLGLYGRAQEAFRLFDEILQ-EGLKPDETTFAGLLCACC  419

Query  1405  HTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI-QGPVDFGI  1581
             H+G V +GR YFR M +EF I  KTEHY++MVKLLGM G+LEEAY L++SI Q PV+ GI
Sbjct  420   HSGHVSEGREYFRRMTEEFEIGAKTEHYIHMVKLLGMNGKLEEAYNLVKSINQEPVNSGI  479

Query  1582  WGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEA  1761
             WGALLSCC    NY L  ++  HL +NK E  SYGV++SN++AGD RW+ VK+LRVD   
Sbjct  480   WGALLSCCASCKNYELVDVITNHLDENKQENCSYGVVLSNLFAGDERWDHVKQLRVDNGG  539

Query  1762  IKGKMPGKSWISN  1800
              KGK+P  SWISN
Sbjct  540   AKGKIPAISWISN  552



>ref|XP_008374396.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Malus domestica]
Length=552

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/543 (60%), Positives = 406/543 (75%), Gaps = 2/543 (0%)
 Frame = +1

Query  181   LSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFL  360
             LS+  Q++S T  LHA+ LKTHL   PFYATR++RFYA+N D+ SAR++FDE P RS++L
Sbjct  8     LSKVYQSLSRTNQLHALFLKTHLRPDPFYATRLLRFYAINGDLXSARQVFDEXPHRSVYL  67

Query  361   WNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             WNSIIRA+A+A+RF +AF LF +M  +  +PDNFT+ACI+RAC+D FD  GL++VH GV+
Sbjct  68    WNSIIRAHAQAYRFEDAFSLFSEMRRTDIKPDNFTYACIVRACADSFDLDGLKLVHCGVM  127

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
             V+GL LDSICSS LVSAYS+L  ++EA +VF+GI +PDLV WNSMISG+G  G W K L 
Sbjct  128   VAGLGLDSICSSALVSAYSRLSLVDEASRVFNGIRQPDLVLWNSMISGYGSGGFWDKGLQ  187

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
             LF +M+ M   PD +T VGL+  L   SL+ IG+ +HSLCLK+  DSNAHV S+LVSMYS
Sbjct  188   LFSEMRSMEMVPDGYTIVGLLSGLADSSLISIGEGIHSLCLKWNLDSNAHVSSVLVSMYS  247

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             RC    SA R+F  L EPD+VTWSA+I G SQSGD  KAL FF+ +NM+G K D +LIAS
Sbjct  248   RCMSXNSAHRVFSGLSEPDLVTWSALITGFSQSGDYXKALFFFKNLNMEGKKPDSVLIAS  307

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             +L+ AAQ+A V PG E H + +R G   +V +SSALI MYSKCGFL +G +VF+ MP KN
Sbjct  308   MLAXAAQMAHVGPGCEIHAYVLRHGXESDVMISSALIAMYSKCGFLGMGTRVFEIMPEKN  367

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYF  1440
             I+SYNS+I  LGLHG A+EAF++F+E+L      PDE+TFS LLCACCH GLV DGR  F
Sbjct  368   IVSYNSLILGLGLHGLASEAFRMFDEILGNG-LKPDESTFSXLLCACCHAGLVKDGREVF  426

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
             R M DEF IQ +TEHYV+MVKLLGM G LEEAY LI S+  PVD GIWGALL CCD+ GN
Sbjct  427   RRMKDEFCIQARTEHYVHMVKLLGMEGRLEEAYYLILSLPEPVDSGIWGALLLCCDVCGN  486

Query  1621  YRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWIS  1797
               L  IVA+ LF +  EKS+Y VM+SN+YAGDGRW+  KKLR  + E    KMPG SWI 
Sbjct  487   LDLAEIVAQGLFQSNSEKSAYRVMLSNIYAGDGRWDDAKKLRDSITEGKLMKMPGLSWIK  546

Query  1798  NIK  1806
              + 
Sbjct  547   GLN  549



>ref|XP_002322190.2| hypothetical protein POPTR_0015s09390g [Populus trichocarpa]
 gb|EEF06317.2| hypothetical protein POPTR_0015s09390g [Populus trichocarpa]
Length=854

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/549 (59%), Positives = 408/549 (74%), Gaps = 5/549 (1%)
 Frame = +1

Query  163   RSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETP  342
             +SL  QLS+++QT+S TK LHA++ KTHL   PFYAT+++RFYALN D+ SAR LFD+TP
Sbjct  307   KSLFLQLSKTHQTLSRTKQLHALVTKTHLLQDPFYATKLVRFYALNNDLSSARNLFDKTP  366

Query  343   QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRV  522
             QRS+FLWNSIIRAYA+AH+F +AF L+  M+     PD +T+AC++RAC + F   GLR+
Sbjct  367   QRSVFLWNSIIRAYAQAHKFDDAFLLYTKMIGFDVIPDKYTYACLIRACCEDFYVDGLRI  426

Query  523   VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGD  702
             VHGGV+VSGL LDS+  S LV+ YSK+G + EA KVF G+ EPDLV WN+MISG G  G 
Sbjct  427   VHGGVIVSGLGLDSVTCSALVTGYSKMGLVGEASKVFCGVFEPDLVLWNAMISGCGYCGF  486

Query  703   WKKALLLFIKMQRMGEK-PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
               K LL F +M+  G K PD +T+V LI  L   S L +G+ +H LCLK GFD N HVGS
Sbjct  487   GDKGLLFFNEMRDNGNKRPDGYTFVALISGLANSSSLELGQGIHGLCLKSGFDCNDHVGS  546

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LVSMYSR  C+  A  +F SL +PD+VTWSA+I G SQ+GD  KAL F++ +N+ G K 
Sbjct  547   SLVSMYSRFSCINLAYSVFRSLCQPDLVTWSALITGFSQAGDHEKALLFYKNLNLAGKKP  606

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +LIASVL A AQLA V PG + HG+ VR G+   V VSSALIDMYSKCGF+ LG++VF
Sbjct  607   DSVLIASVLVATAQLANVGPGAQIHGYIVRYGFESHVMVSSALIDMYSKCGFVGLGLRVF  666

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
             + MP++NI+SYNS+IS LGLHG A++AF +F E++EK    PDE+TFSALLCACCH GLV
Sbjct  667   ENMPNRNIVSYNSIISGLGLHGLASQAFDMFTEIVEKG-LKPDESTFSALLCACCHAGLV  725

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              DGR  FR M DEF IQ +TEHYV++VKLLGMAGEL+EAY  I S++ PVD GIWGALLS
Sbjct  726   KDGREIFRRMKDEFWIQARTEHYVHIVKLLGMAGELDEAYNFILSLKQPVDSGIWGALLS  785

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--K  1773
             CCD HG+  L  IVA+ LFD + +K +Y VM+SN+YAGDGRW  V+K+R D     G  K
Sbjct  786   CCDAHGDSELAEIVAQQLFDGEPKKGAYRVMLSNVYAGDGRWVDVEKMR-DYITTAGAEK  844

Query  1774  MPGKSWISN  1800
             MPG S I +
Sbjct  845   MPGLSRIGS  853



>ref|XP_010678845.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Beta vulgaris subsp. vulgaris]
Length=554

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/550 (56%), Positives = 399/550 (73%), Gaps = 2/550 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MFI  R +L++ S  +QT+S TK LHA+I KTHLS  PF+AT+IIR+YALN  + SA +L
Sbjct  1     MFIPLRIILSKFSIPHQTLSNTKQLHAMITKTHLSLDPFFATKIIRYYALNSQLSSAHQL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FDE P +SI+LWNSIIRAYA+ H F NAF LF  +L S   PDNFTFACILRACS+  D 
Sbjct  61    FDEIPHKSIYLWNSIIRAYAQVHDFKNAFHLFNQLLSSDLCPDNFTFACILRACSENHDV  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              G+R++HGG+VVSGL++DSIC   LV+AYSK+G L++A K F  + +PDL  WNS+I G+
Sbjct  121   VGVRLIHGGLVVSGLQMDSICGCALVNAYSKVGLLDDASKAFYVVVDPDLATWNSLIKGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  G     L LF  M+ MG +PD +T V L+  +  P LL IG+ +H  C+K GF  N 
Sbjct  181   GYSGFCDDGLKLFNAMRDMGIEPDGYTMVALLSAVAEPGLLHIGQGIHGFCIKSGFLLND  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HVGS LV+MYSRC C+ +A  +  SLL+PD+VTWSA+I G + SGDI +AL FFRE NM 
Sbjct  241   HVGSSLVTMYSRCGCLDAAQGVLYSLLKPDIVTWSALITGFANSGDISRALLFFRERNMD  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K DP+L+ASVL    QL  V PG E HG+ +R G  +++ V+SALIDMYSKCGF++L 
Sbjct  301   GMKADPVLLASVLVGVVQLGNVGPGCEIHGYVLRHGLEIDIRVASALIDMYSKCGFMDLA  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             IQV   +P +NII YNS I  LG HGNA++AF++F+E ++K +  PDE+TFSALL ACC 
Sbjct  361   IQVLNVLPRRNIIVYNSAILGLGSHGNADQAFRLFDEAMDKGFM-PDESTFSALLHACCQ  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV +G   F+ M DEFGI+P+ EHYV+MVK+LGMAG+L EAY  + S+  PVD GIWG
Sbjct  420   AGLVEEGEEMFKRMKDEFGIEPRNEHYVHMVKILGMAGKLSEAYRFVLSLYEPVDAGIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDME-AI  1764
             ALL+CC++HGN  L   V +H+FDN++++ S+ V +S +YA  GRW+ VKKLR DM  + 
Sbjct  480   ALLACCEMHGNSALAETVLQHVFDNQIQEDSHSVSLSRIYADHGRWDDVKKLRDDMTYSR  539

Query  1765  KGKMPGKSWI  1794
             + K+PG SWI
Sbjct  540   QKKLPGLSWI  549



>ref|XP_010094711.1| hypothetical protein L484_003019 [Morus notabilis]
 gb|EXB56757.1| hypothetical protein L484_003019 [Morus notabilis]
Length=549

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 404/540 (75%), Gaps = 2/540 (0%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIF  357
             +LS+  Q++S TK LHA+I+KT LS  PFYAT+++R YA++ D+ SAR +FDE   RS++
Sbjct  11    ELSKIYQSLSATKKLHALIIKTQLSSDPFYATQMVRIYAIHGDLCSARNVFDEGSIRSVY  70

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGV  537
             LWNSIIRA+A+AH+F +AF LF+ ML++   PDNFT+AC++RACS++FD  GL++ H G 
Sbjct  71    LWNSIIRAHAQAHQFYDAFSLFRKMLETDISPDNFTYACVIRACSERFDMHGLKLCHAGS  130

Query  538   VVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL  717
             +VSGL+ DSIC S LV+AYSKLG +EEA KVF GI EPDLV WNSMIS +G  G W K+L
Sbjct  131   IVSGLKSDSICGSSLVTAYSKLGLVEEASKVFYGIREPDLVMWNSMISAYGNSGFWDKSL  190

Query  718   LLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
              LF  MQ  G KPD +  VGL++ L   + + IG+ VH  CLK  FDSNAHVGS LV+MY
Sbjct  191   ELFSNMQNSGTKPDGYALVGLLLGLSDSTSMYIGQGVHGFCLKTSFDSNAHVGSALVTMY  250

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
             SRCK M  A ++F  + +PD+VTWSA++ G SQSG+  KAL FF+++ + G K DP+L A
Sbjct  251   SRCKSMSYAYKVFSGISQPDLVTWSALLTGYSQSGEREKALLFFKKLVLVGKKPDPVLSA  310

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             SVL+AAAQ+A V+ G E HG+ +R G   +V V SALIDMYSK GFL LGI+VF  MP K
Sbjct  311   SVLAAAAQMANVKVGSEIHGYVLRQGLESDVMVCSALIDMYSKSGFLGLGIRVFDIMPEK  370

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             NI+SYNS+I   GLHG A+ AFQ+FEE+LE     PDE+TFSALLCAC H GLV DG+  
Sbjct  371   NIVSYNSLILGFGLHGLASHAFQMFEEILENRLV-PDESTFSALLCACGHAGLVEDGKFL  429

Query  1438  FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             FR M +EFGIQ +TEHYV++VKLLGM G+LEEAY LIQS+  P++ GIWGALLSCCD  G
Sbjct  430   FRRMKEEFGIQARTEHYVHLVKLLGMNGKLEEAYYLIQSLPEPIEHGIWGALLSCCDACG  489

Query  1618  NYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
             N+ L  + A+ L ++  +++SY VM+SNMYAGDGRW+  +K+R  M E    KMPG SWI
Sbjct  490   NFELAEVAAERLIESNTKRASYKVMLSNMYAGDGRWDDARKVRESMREGKVRKMPGVSWI  549



>ref|XP_004501885.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Cicer arietinum]
Length=553

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/549 (58%), Positives = 392/549 (71%), Gaps = 1/549 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M   F+ L ++LS   +++   K LH  +LKTHLS  PFYAT+IIR YA+N DI SA  +
Sbjct  1     MLTQFQWLHSELSNVCKSLLRAKQLHVWLLKTHLSQDPFYATQIIRLYAINNDISSAHHV  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TP RS++LWNS+IRA+A+  RF NA  LF+ ML+S  RPDN+T+AC++RAC+D FDF
Sbjct  61    FDKTPTRSVYLWNSMIRAFAKTRRFGNAISLFRTMLESDIRPDNYTYACVIRACADNFDF  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LR+VHG  V +GL LD IC S LVSAYSKLG + EA +VFDGIAEPD V WNS+IS +
Sbjct  121   GMLRLVHGSAVSAGLGLDPICCSALVSAYSKLGLVHEACRVFDGIAEPDSVLWNSLISAY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
              C G W   + +F  M+  G+KPD FT  GL++ +   SLL IG+ +H L  K G D ++
Sbjct  181   VCSGMWDIGIQMFSSMRLSGKKPDGFTLAGLLVGIADSSLLSIGQGLHGLSQKSGLDFDS  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HVGSLLVSMYSRCKCM SA R+F S+  PD+VTWSA+I G SQ G+  KAL  F ++NM+
Sbjct  241   HVGSLLVSMYSRCKCMDSAYRVFCSIFNPDLVTWSALIAGYSQCGEYHKALIIFWKLNME  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K D +LIASVL++ AQ A V PG E HG+ +R G   +V VSSALIDMYSKCGFL+L 
Sbjct  301   GKKPDSVLIASVLASIAQTANVGPGCEIHGYVLRHGLESDVKVSSALIDMYSKCGFLHLA  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF+ MP +NIISYNS+I  LGLHG A++AF IF+E+LE E   PDEATFSALL ACCH
Sbjct  361   TCVFRIMPERNIISYNSVILALGLHGCASKAFVIFDEILE-EGLVPDEATFSALLGACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  F+ M DEF I+ + EHYVYMVKLLG AGELEEAY L QS+  PVD  I G
Sbjct  420   AGLVKDGREIFQRMKDEFNIKARPEHYVYMVKLLGTAGELEEAYNLTQSLPEPVDKAILG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD +GN  L   +A  +F      + Y VM+SN+YAGDGRW+ VKKLR  +    
Sbjct  480   ALLSCCDSYGNSELAETIAHQIFKTNPTDNVYRVMLSNIYAGDGRWDDVKKLRDKLTGGL  539

Query  1768  GKMPGKSWI  1794
              KMPG S I
Sbjct  540   KKMPGVSRI  548



>ref|XP_008239578.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Prunus mume]
Length=565

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/538 (61%), Positives = 402/538 (75%), Gaps = 2/538 (0%)
 Frame = +1

Query  184   SRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLW  363
             S+   ++S  K LHA+ILKTHLSH PFYATRI+RFYA+N D+ SA +LFDE+P +S++LW
Sbjct  13    SKVYLSLSRAKQLHALILKTHLSHDPFYATRIVRFYAVNGDLHSACKLFDESPSQSVYLW  72

Query  364   NSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             NSIIRA+A+AH+F  AF LF  ML +  RPDNFT+ACI+RACS+ FD  GL++VH GV V
Sbjct  73    NSIIRAHAQAHKFEEAFSLFTKMLRTEIRPDNFTYACIIRACSESFDLEGLKLVHCGVTV  132

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             SGL LDSICSS LV+AYSKLG ++EA +VF G  + DLV WNS+IS +G  G W K L L
Sbjct  133   SGLGLDSICSSALVTAYSKLGLVDEASRVFYGTPQQDLVLWNSIISAYGNCGRWDKGLQL  192

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             F +M+ M   PD +T VGL++ L   SL+ IG+ +H LCLK   DSNAHV S+LVSMYSR
Sbjct  193   FSEMRSMEMMPDGYTIVGLLLGLSDSSLITIGQGLHGLCLKCNLDSNAHVSSVLVSMYSR  252

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASV  1083
             C CM SA R+F  L +PD+VTWSA+I G SQSGD  KAL FF+ +NM+G K D +LIASV
Sbjct  253   CMCMNSAHRVFSGLFQPDLVTWSALITGYSQSGDYGKALFFFKNLNMEGKKADSILIASV  312

Query  1084  LSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNI  1263
             L+AAAQ+A V PG E H + +R G    V +SSALI MYSKCGFL +G +VF+ MP KNI
Sbjct  313   LAAAAQIANVGPGCEIHAYVLRHGLESHVMISSALIAMYSKCGFLGMGTRVFEIMPEKNI  372

Query  1264  ISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFR  1443
             ISYNS+I  LGLHG A+EAF++F+E+L +    PDE TF+ALL ACCH G+V DGR  FR
Sbjct  373   ISYNSLILGLGLHGLASEAFRMFDEIL-RNGLKPDEYTFTALLGACCHAGIVKDGREIFR  431

Query  1444  IMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNY  1623
              M DEF IQP+TEHYV+MVKLLGM G LEEAY LI S+  PVD GIWGALL CCD+ GN 
Sbjct  432   RMKDEFCIQPRTEHYVHMVKLLGMEGGLEEAYNLILSLPEPVDCGIWGALLLCCDVCGNS  491

Query  1624  RLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
              L  IVA+ LF++  EK +Y VM+SN+YAGDGRW+  KKLR  M E    K+ G SWI
Sbjct  492   ELAEIVAQRLFESSSEKGAYRVMLSNIYAGDGRWDDAKKLRDHMTEGKLRKITGLSWI  549



>ref|XP_007211064.1| hypothetical protein PRUPE_ppa018108mg [Prunus persica]
 gb|EMJ12263.1| hypothetical protein PRUPE_ppa018108mg [Prunus persica]
Length=558

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/550 (60%), Positives = 406/550 (74%), Gaps = 2/550 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MF  F  L   LS+   ++S TK LHA+ILKTHLSH PFYAT+I+RFYA+N D+ SA +L
Sbjct  1     MFFHFHLLHLDLSKVYLSLSRTKQLHALILKTHLSHDPFYATKIVRFYAVNGDLHSACKL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FDE+P +S++LWNSIIRA+A+AH+F  AF LF  ML +  +PDNFT+ACI+RACS+ FD 
Sbjct  61    FDESPSQSVYLWNSIIRAHAQAHKFDEAFSLFTKMLRTEIKPDNFTYACIIRACSESFDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GL++VH GV VSGL LDSICSS LV+AYSKLG +++A +VF G  + DLV WNS+ISG+
Sbjct  121   EGLKLVHCGVTVSGLGLDSICSSALVTAYSKLGLVDKASRVFYGTPQQDLVLWNSIISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  G W K L LF +M+ M   PD +T VGL+  L   SL+ IG+ +H LCLK   DSNA
Sbjct  181   GNCGRWDKGLQLFSEMRSMEMMPDGYTIVGLLSGLSDSSLITIGQGLHGLCLKCNLDSNA  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HV S+LVSMYSRC CM SA R+F  L +PD+VTWSA+I G SQSGD  KAL FF+ +NM+
Sbjct  241   HVSSVLVSMYSRCMCMNSAHRVFSGLFQPDLVTWSALITGYSQSGDYGKALFFFKNLNME  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K D +LIASVL+A AQ+A V PG E H + +R G    V +SSALI MYSKCGFL +G
Sbjct  301   GKKADSILIASVLAAGAQIANVGPGCEIHAYVLRHGLESHVMISSALIAMYSKCGFLGMG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              +VF+ MP KNIISYNS+I  LGLHG A+EAF++F+E+L +    PDE TF+ALL ACCH
Sbjct  361   TRVFEIMPEKNIISYNSLILGLGLHGLASEAFRMFDEIL-RNGLKPDEYTFTALLGACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  FR M DEF IQP+TEHYV+MVKLLGM G LEEAY LI S+  PVD GIWG
Sbjct  420   AGLVKDGREIFRRMKDEFCIQPRTEHYVHMVKLLGMEGGLEEAYNLILSLPEPVDCGIWG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALL CCD+ GN  L  IVA+ LF++  EK +Y VM+SN+YAGD RW+  KKLR  + E  
Sbjct  480   ALLLCCDVCGNSELAEIVAQRLFESSSEKGAYRVMLSNIYAGDERWDDAKKLRDHITEGK  539

Query  1765  KGKMPGKSWI  1794
               K+ G SWI
Sbjct  540   LRKITGLSWI  549



>ref|XP_003528138.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X1 [Glycine max]
 ref|XP_006581910.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X2 [Glycine max]
Length=551

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/549 (57%), Positives = 397/549 (72%), Gaps = 1/549 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M I F  L  +L+   +++   K LHA +LKTHLS  PFYAT+I+R YA N DI SA  L
Sbjct  1     MLIPFEWLHCELNNICKSLLRAKQLHAFLLKTHLSQDPFYATKIVRLYAANNDINSAHHL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TP RS++LWNS+IRA+A++ RF NA  LF+ ML +   PD  T+AC++RAC++ FDF
Sbjct  61    FDKTPNRSVYLWNSMIRAFAQSQRFFNAISLFRTMLGADISPDGHTYACVIRACANNFDF  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LR VHGG V +GL  D +C S LV+AYSKLG + EA +VFDGIAEPDLV WNS+ISG+
Sbjct  121   GMLRRVHGGAVAAGLGRDPVCCSALVAAYSKLGLVHEARRVFDGIAEPDLVLWNSLISGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  G W   + +F  M+  G KPD +T  GL++ +    +L IG+ +H L  K G DS++
Sbjct  181   GGFGLWDVGMQMFSMMRLFGMKPDGYTLAGLLVGIADSGMLSIGQGLHCLSQKSGLDSDS  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HVGSLL+SMYSRCK M SA R+F S+L PD+VTWSA+I G SQSG+  K L FFR++NM+
Sbjct  241   HVGSLLLSMYSRCKHMASAYRVFCSILNPDLVTWSALIVGYSQSGEYEKVLLFFRKLNME  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               K D +LIASVL++ AQ+A V  G E HG+A+R G  L+V VSSAL+DMYSKCGFL+LG
Sbjct  301   SKKPDSVLIASVLASIAQMANVGLGCEVHGYALRHGLELDVRVSSALVDMYSKCGFLHLG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             I VF+ MP +NI+S+NS+I   GLHG A+EAF++F+++LEK    PDEATFS+LLCACCH
Sbjct  361   ICVFRVMPERNIVSFNSVILGFGLHGCASEAFRMFDKMLEKGLV-PDEATFSSLLCACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  F+ M  EF I+ + EHYVYMVKLLG AGELEEAY L QS+  PVD  I G
Sbjct  420   AGLVKDGREIFQRMKHEFNIRARPEHYVYMVKLLGSAGELEEAYNLTQSLPEPVDKAILG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCC+I GN  L   VA  LF++    + Y VM+SN+YAGDGRW+ VKKLR +M    
Sbjct  480   ALLSCCNICGNSELAETVAHQLFESSPADNVYRVMLSNIYAGDGRWDDVKKLRDNMTGGP  539

Query  1768  GKMPGKSWI  1794
              KMPG SWI
Sbjct  540   RKMPGLSWI  548



>ref|XP_003601206.1| hypothetical protein MTR_3g077200 [Medicago truncatula]
 gb|AES71457.1| PPR containing plant-like protein [Medicago truncatula]
Length=553

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 386/549 (70%), Gaps = 1/549 (0%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M   F  L ++L+   +++   K LHA +LKTHLS  PFYAT+IIR YA N  I  A  +
Sbjct  1     MLTQFHWLHSELTNVCKSLLRVKQLHACLLKTHLSKDPFYATQIIRLYAFNNHINYAHHV  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+T  RS+FLWNS+IRA+A+A RFSNA  LF+ ML    RPDN+T+AC +RAC+D FDF
Sbjct  61    FDKTSTRSVFLWNSMIRAFAKARRFSNAISLFRTMLVDDIRPDNYTYACAIRACADSFDF  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               LRVVHG  V  GL LD IC S LVSAYSKLG + EA +VFDGI EPDLV WNS+IS +
Sbjct  121   GMLRVVHGSAVSVGLGLDPICCSALVSAYSKLGVVHEARRVFDGIVEPDLVLWNSLISAY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
             G  G W+  + +F  M+  G+KPD FT  GL+  +   SLL IG+ +H L  K G DS+ 
Sbjct  181   GGSGMWEIGIQMFSSMRLAGKKPDGFTLAGLLGGIADSSLLSIGQELHGLSQKSGLDSDC  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             HVGSLLVSMYSRCKC+ SA R+F  +  PD+VTWSA+I G SQ G+  KAL FFR++NMK
Sbjct  241   HVGSLLVSMYSRCKCIDSAYRVFCGIFNPDLVTWSALISGYSQCGEYQKALLFFRKLNMK  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               K+D +LIA+VL++  Q+A V PG E HG+ +R G   +V VSSALIDMYSKCGFL+LG
Sbjct  301   SKKLDSVLIATVLASITQMANVLPGCEIHGYVLRHGLESDVKVSSALIDMYSKCGFLHLG  360

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF+ M  +NIISYNSMI   GLHG A++AF +F+E+L+K    PDE TFSALL ACCH
Sbjct  361   TCVFRIMLERNIISYNSMILAYGLHGCASQAFTMFDEMLQKGLV-PDEGTFSALLSACCH  419

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  F  M DEF I+ + EHYVYMVKLLG  GELEEAY L QS+  PVD  I G
Sbjct  420   AGLVKDGRELFWRMKDEFNIKARPEHYVYMVKLLGGVGELEEAYNLTQSLPKPVDKAILG  479

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLSCCD +GN  L   VA+ +F +    + Y VM+SN+YAGDGRW+ VKKLR  M   +
Sbjct  480   ALLSCCDSYGNSELAETVAQQIFKSNPADNVYRVMLSNIYAGDGRWDDVKKLRDKMVGGQ  539

Query  1768  GKMPGKSWI  1794
              KM G SWI
Sbjct  540   KKMRGVSWI  548



>ref|XP_008464524.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Cucumis melo]
 ref|XP_008464525.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Cucumis melo]
 ref|XP_008464526.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Cucumis melo]
Length=549

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/543 (56%), Positives = 390/543 (72%), Gaps = 2/543 (0%)
 Frame = +1

Query  169   LLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L T+LS+S  T+  TK LHA I K+HL+  PFYATRI+R Y++N  +  AR +FD+TP R
Sbjct  8     LTTELSKSFLTLLRTKELHAFITKSHLAFDPFYATRIVRLYSINSKLDYARHVFDKTPNR  67

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             S++LWNSIIRAYA+AH+F +A  LF  M  + T PDNFT++CI+RACS+      L+ VH
Sbjct  68    SVYLWNSIIRAYAKAHKFGDALSLFLTMSATETLPDNFTYSCIIRACSENHHREWLKFVH  127

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
             G V+V+G  LD IC S LV+A S L  +EEA KVF G+  PDLV WNS+I G G  G W 
Sbjct  128   GRVLVTGFGLDPICCSALVTACSNLDLIEEANKVFGGMPHPDLVMWNSIICGFGSCGYWN  187

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
             + LLLF +M+ +GE PD  T VG+   +  PSLL  GK +H LCLK+ FDSN HV S LV
Sbjct  188   QGLLLFSRMRNLGEHPDGCTVVGVASGIAEPSLLSTGKGIHGLCLKYNFDSNEHVASALV  247

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
             SMYSRC CM SA  +F SLL+PD+VTWSA+I G S++GD  KA+ FF+++NM+G K+D +
Sbjct  248   SMYSRCNCMDSAYLVFSSLLQPDLVTWSALITGYSRAGDFRKAMLFFQKLNMQGKKMDSI  307

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
             LI S+L+A AQ   ++ G E HG+ +R G      +SS+LIDMYSKCG+LNLGI+VF  M
Sbjct  308   LIVSILAATAQSTNMRHGIEIHGYVLRSGIESNEMISSSLIDMYSKCGYLNLGIRVFHVM  367

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
             P K+I +YNS+I  LGLHG A++A ++FEE+L      P+E+TFSALLCACCH GL   G
Sbjct  368   PQKSISTYNSVIWGLGLHGLASKALEMFEELLTIGLV-PNESTFSALLCACCHVGLNSVG  426

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +  F+ M DEF I+ +TEHYVY+VKLLGM GELE AY LI S+   VD GIWGALLSCCD
Sbjct  427   KEIFKRMKDEFCIKYRTEHYVYIVKLLGMTGELEVAYNLIMSLPESVDSGIWGALLSCCD  486

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGK  1785
               GN  L  +VA+ L +   +K++Y VM+SN+YAGDGRW+ VKKLR  M E  +GK+PG 
Sbjct  487   ACGNVELAEVVAQRLIEKDPDKTAYKVMLSNIYAGDGRWDDVKKLRDTMTEKERGKLPGL  546

Query  1786  SWI  1794
             SWI
Sbjct  547   SWI  549



>ref|XP_004138268.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Cucumis sativus]
 ref|XP_004168896.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Cucumis sativus]
 gb|KGN63548.1| hypothetical protein Csa_1G004140 [Cucumis sativus]
Length=549

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/543 (56%), Positives = 387/543 (71%), Gaps = 2/543 (0%)
 Frame = +1

Query  169   LLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L T+LS+S  T+  TK LHA I K+HL+  PFYATRI++ Y++N  +  AR LFD+TP R
Sbjct  8     LTTELSKSFLTLLRTKELHAFITKSHLASDPFYATRIVKLYSINAKLGYARHLFDKTPNR  67

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             S++LWNSIIRAYA+A++F +A  LF  M  + T PDNFT++CI+RACS+      L+ VH
Sbjct  68    SVYLWNSIIRAYAKAYKFRDALSLFLTMSGTETSPDNFTYSCIIRACSENHHREWLKFVH  127

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
             G V+V+G  LD IC S LV+AYS L  +EEA KVF  I  PDLV WNS+I G G  G W 
Sbjct  128   GRVLVTGFGLDPICCSALVTAYSNLDLIEEASKVFGRIQHPDLVMWNSIICGFGSCGYWN  187

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
             + LLLF +M+ +GE PD +T VG+   +  PSLL  GK +H LCLK  FDSN HV S LV
Sbjct  188   QGLLLFSRMRNLGELPDGYTVVGVASGIAEPSLLSTGKGIHGLCLKCNFDSNEHVASALV  247

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
             SMYSRC CM SA  +F SLL+PD+VTWSA+I G SQ+GD  KA+ FF+ +NM+G K+D +
Sbjct  248   SMYSRCNCMDSAYLVFSSLLQPDLVTWSALITGYSQAGDFRKAMLFFQRLNMQGKKMDSI  307

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
             LIAS+L+A AQ   ++ G E HG+ +R G      +SS+LIDMYSKCG+L+LGI+VF  M
Sbjct  308   LIASILAATAQSTNIRHGIEIHGYVLRQGIESNEMISSSLIDMYSKCGYLSLGIRVFHVM  367

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
               KNI +YNS+I  LGLHG A++A ++FEE+L      P+E+TFSALL ACCH GL   G
Sbjct  368   SQKNISTYNSVIWGLGLHGLASKALEMFEELLTIGLV-PNESTFSALLFACCHAGLNSVG  426

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +  F+ M DEF I+ KTEHYVY+VKLLGM GELE AY L+ S+  P D GIWGALLSCCD
Sbjct  427   KEIFKRMKDEFCIKYKTEHYVYIVKLLGMTGELEVAYNLVMSLPEPADSGIWGALLSCCD  486

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGK  1785
               GN  L  +VA+ L +N  EK+ Y VM+SN+YAGDGRW+ VKKLR  M E  +GK PG 
Sbjct  487   ACGNVELAEVVAQRLIENDPEKTVYKVMLSNIYAGDGRWDDVKKLRDTMTEKERGKCPGL  546

Query  1786  SWI  1794
             SWI
Sbjct  547   SWI  549



>ref|XP_007138028.1| hypothetical protein PHAVU_009G175100g [Phaseolus vulgaris]
 gb|ESW10022.1| hypothetical protein PHAVU_009G175100g [Phaseolus vulgaris]
Length=539

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/535 (56%), Positives = 382/535 (71%), Gaps = 1/535 (0%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K LH  +LKTHL   PFYAT+I+R YA+N DI SAR +FD+T  RS++LWNS+I
Sbjct  5     RSLLRVKQLHTFLLKTHLLEDPFYATKIVRLYAINNDINSARHVFDKTSNRSVYLWNSMI  64

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             RA+A+  RF NA  LF+ M+ +   PD  T+AC+ RAC+D FDF  LR VHGG V +GL 
Sbjct  65    RAFAQCQRFFNAISLFRTMVGADISPDGHTYACLTRACADNFDFGMLRRVHGGAVAAGLG  124

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LD +C S LV+AYSKLG + EA +VF+ I EPD+V WNS+ISG+G  G W   + +F  M
Sbjct  125   LDLVCCSALVTAYSKLGLVHEARRVFNRITEPDIVLWNSLISGYGSSGLWDVGMQMFSAM  184

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
             + +G+KPD +T  GL++ +    +L IG+ +H L  K G DS++HVGSLLVS+YSRCKCM
Sbjct  185   KLVGKKPDEYTLAGLLVGIVDSGVLSIGQGLHCLSQKSGLDSDSHVGSLLVSLYSRCKCM  244

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
              SA R+F S+L PD+VTWSA+I G SQ+G+  K L  FR++NM+  K D +L+ASVL++ 
Sbjct  245   ASAYRVFCSILNPDLVTWSALIVGYSQAGEYEKVLHLFRKLNMEDKKPDTVLVASVLASI  304

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A  A V  G E HG+A+R G  L+V VSSALIDMYSKCG L LGI VF+ MP +NI+SYN
Sbjct  305   AHTANVGLGCEVHGYALRHGLELDVRVSSALIDMYSKCGCLQLGICVFRTMPKRNIVSYN  364

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMND  1455
             S+I   GLHG A+EAF++F+++LEK    PDEATFS+LL ACCH GLV DG   FR M +
Sbjct  365   SVILGFGLHGYASEAFKMFDKMLEKGLV-PDEATFSSLLSACCHAGLVKDGWEIFRRMKE  423

Query  1456  EFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGG  1635
             EF I+ + EHYVYMVKLLG +GELEEAY L QS+  PVD  I GALLSCC+  GN  L  
Sbjct  424   EFNIRARAEHYVYMVKLLGSSGELEEAYSLTQSLPEPVDKAILGALLSCCNSCGNSELAE  483

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKMPGKSWISN  1800
              VA+ LF N    + Y VM+SN+YAGDGRW+ VK+LR  M     KMPG SWI +
Sbjct  484   TVAQQLFSNNPADNVYRVMLSNIYAGDGRWDDVKRLRDRMTGGLRKMPGLSWIES  538



>ref|XP_004301691.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/507 (59%), Positives = 374/507 (74%), Gaps = 2/507 (0%)
 Frame = +1

Query  277   IIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPD  456
             ++R YA+N D+ SAR++FDE+P RS++LWNSIIRA+A+AHRF +AF LF  ML S T+PD
Sbjct  1     MVRHYAVNGDLHSARKVFDESPSRSVYLWNSIIRAHAQAHRFDHAFSLFNRMLRSETKPD  60

Query  457   NFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFD  636
             NFT+AC++RACSD  D  GLR+VH GV VSGL LDSICSS LV+AYSKLG ++EA +VF 
Sbjct  61    NFTYACLIRACSDSLDLDGLRLVHCGVAVSGLGLDSICSSALVTAYSKLGLVDEASRVFH  120

Query  637   GIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI  816
                +PDLV WNSMIS  G  G W K L LF  M+     PD +T+VGL+  L   SL+ +
Sbjct  121   LTPQPDLVMWNSMISSCGNFGFWDKGLELFSMMRCRKVGPDGYTFVGLLSGLKDSSLISV  180

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             G+ +H LCLK   D N HV S+LVSMYSRCKCM SA ++F  L EPD+VTWS++I G SQ
Sbjct  181   GQGIHGLCLKSNLDCNDHVCSVLVSMYSRCKCMESAHKVFSGLFEPDLVTWSSLITGYSQ  240

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
             SGD  KAL FF+ +NM+G K DP+LIASVL+AA+Q+A V PG E H + VR G   +V V
Sbjct  241   SGDYEKALLFFKCLNMEGKKADPILIASVLAAASQIANVGPGSEIHAYVVRRGTVSDVMV  300

Query  1177  SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY  1356
             SSALI MYSKCGF+ +GI+VF+AMP KNI+SYNS+I   GLHG A+EAF++F E+L    
Sbjct  301   SSALIAMYSKCGFMRMGIRVFEAMPEKNIVSYNSLILGFGLHGLASEAFRMFNEILRNGL  360

Query  1357  YNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEA  1536
               PDE+TFSALL ACCH+GLV DGR  FR M +EFGI+ + EHYV++VKLLGM G LEEA
Sbjct  361   V-PDESTFSALLSACCHSGLVKDGREIFRKMREEFGIEARAEHYVHLVKLLGMEGRLEEA  419

Query  1537  YELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGD  1716
             Y LI  +  PVD GIWG+LLSCCD  G+  L  I+A+ LF++  EK++Y VM+SN+YAGD
Sbjct  420   YNLILCLPEPVDSGIWGSLLSCCDACGDSELAEIIAQKLFESSSEKTAYRVMLSNIYAGD  479

Query  1717  GRWECVKKLR-VDMEAIKGKMPGKSWI  1794
              RW+  K++R    E    K  G SWI
Sbjct  480   RRWDESKRVRDYITEGQLRKTTGFSWI  506


 Score =   144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/305 (30%), Positives = 155/305 (51%), Gaps = 0/305 (0%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             +L+H  +  + L      ++ ++  Y+    +  A R+F  TPQ  + +WNS+I +    
Sbjct  81    RLVHCGVAVSGLGLDSICSSALVTAYSKLGLVDEASRVFHLTPQPDLVMWNSMISSCGNF  140

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
               +    +LF  M      PD +TF  +L    D    S  + +HG  + S L+ +    
Sbjct  141   GFWDKGLELFSMMRCRKVGPDGYTFVGLLSGLKDSSLISVGQGIHGLCLKSNLDCNDHVC  200

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S LVS YS+   +E A KVF G+ EPDLV W+S+I+G+   GD++KALL F  +   G+K
Sbjct  201   SVLVSMYSRCKCMESAHKVFSGLFEPDLVTWSSLITGYSQSGDYEKALLFFKCLNMEGKK  260

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
              D      ++      + +  G  +H+  ++ G  S+  V S L++MYS+C  M    R+
Sbjct  261   ADPILIASVLAAASQIANVGPGSEIHAYVVRRGTVSDVMVSSALIAMYSKCGFMRMGIRV  320

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F+++ E ++V+++++I G    G   +A   F E+   G   D    +++LSA     +V
Sbjct  321   FEAMPEKNIVSYNSLILGFGLHGLASEAFRMFNEILRNGLVPDESTFSALLSACCHSGLV  380

Query  1114  QPGRE  1128
             + GRE
Sbjct  381   KDGRE  385


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/292 (26%), Positives = 139/292 (48%), Gaps = 8/292 (3%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
              F  LL+ L + +  IS  + +H + LK++L  +    + ++  Y+  + + SA ++F  
Sbjct  164   TFVGLLSGL-KDSSLISVGQGIHGLCLKSNLDCNDHVCSVLVSMYSRCKCMESAHKVFSG  222

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
               +  +  W+S+I  Y+++  +  A   FK +   G + D    A +L A S   +    
Sbjct  223   LFEPDLVTWSSLITGYSQSGDYEKALLFFKCLNMEGKKADPILIASVLAAASQIANVGPG  282

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
               +H  VV  G   D + SS L++ YSK G +   I+VF+ + E ++V +NS+I G G  
Sbjct  283   SEIHAYVVRRGTVSDVMVSSALIAMYSKCGFMRMGIRVFEAMPEKNIVSYNSLILGFGLH  342

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV-HSLCLKFGFDSNAHV  873
             G   +A  +F ++ R G  PD  T+  L+       L++ G+ +   +  +FG ++ A  
Sbjct  343   GLASEAFRMFNEILRNGLVPDESTFSALLSACCHSGLVKDGREIFRKMREEFGIEARAEH  402

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEP-DMVTWSAMI-----CGLSQSGDIM  1011
                LV +      +  A  +   L EP D   W +++     CG S+  +I+
Sbjct  403   YVHLVKLLGMEGRLEEAYNLILCLPEPVDSGIWGSLLSCCDACGDSELAEII  454



>ref|XP_007042233.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOX98064.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=625

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/538 (57%), Positives = 389/538 (72%), Gaps = 3/538 (1%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M     SLL++LS+ +QTI  TK +HA+I KT LS  PF+AT+++RFYA N+D+ SA  L
Sbjct  1     MLFQIHSLLSELSKPHQTILKTKQIHALIAKTRLSLDPFFATKLVRFYAHNDDLCSAHNL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FDETP RS+FLWNSIIRAYARA +F++A  LF+ ML + T+PDNFT+AC++RAC + FD 
Sbjct  61    FDETPARSVFLWNSIIRAYARARKFNDALSLFERMLGTETKPDNFTYACVVRACCENFDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
               +R+VH  V+VSGL LD IC S LV+ YSKL  ++EA KVF G+ E DL  WNSM+SG+
Sbjct  121   DVMRLVHTRVIVSGLGLDLICGSALVTGYSKLYLVDEASKVFYGMPERDLALWNSMVSGY  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCL-DCPSLLRIGKNVHSLCLKFGFDSN  864
             G  G   K L LF  M+ MG++PD +T VGLI  L D   LL +G+ +H  CLK GFD  
Sbjct  181   GHCGLCNKGLELFSWMRHMGQQPDGYTLVGLISGLVDSHGLLSVGQGLHGFCLKSGFDRT  240

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
              HVGS LVSMYSR KCM SA  +F SLL+PD+V WS++I G SQ G+  KAL +F ++NM
Sbjct  241   VHVGSSLVSMYSRFKCMDSANIVFSSLLQPDVVAWSSLITGYSQCGEYGKALLYFWKLNM  300

Query  1045  K-GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
             +   K DP+LI++VL AAA+    + G E HG+ VR G+   V VSSALIDMY KCGF  
Sbjct  301   EMDKKADPILISAVLEAAARSTNARFGSEIHGYVVRHGFESNVMVSSALIDMYFKCGFTC  360

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             LGI VF+ MP ++ ISYN +IS LGL+G A +AF++F+E+L      PD++TFSALL AC
Sbjct  361   LGIGVFEIMPERSTISYNCLISGLGLNGMAYQAFEMFDEMLVVG-LKPDDSTFSALLTAC  419

Query  1402  CHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI  1581
             CH GL+ DG   FR M  EF IQP+TEHYV+MVKLLGMAGELEEAY  I  +  PVD  I
Sbjct  420   CHAGLLNDGWEIFRRMKYEFSIQPRTEHYVHMVKLLGMAGELEEAYNFILCLPKPVDSSI  479

Query  1582  WGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM  1755
             WGA+LSCCD HGN  L  +V++ L +N+ +K +Y VM+SN+YAGDGRW+ V+KLR D+
Sbjct  480   WGAMLSCCDGHGNSELAEVVSQQLLENEPKKGAYRVMLSNIYAGDGRWDDVQKLRGDI  537



>ref|XP_008346811.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g64310 [Malus domestica]
Length=561

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/539 (57%), Positives = 383/539 (71%), Gaps = 2/539 (0%)
 Frame = +1

Query  181   LSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFL  360
             LS+  Q++S T  LHA+ LKTHL H PFYATR++RFYA+N ++ SARR+FDE+P  S++L
Sbjct  8     LSKVYQSLSRTNQLHALFLKTHLPHDPFYATRLLRFYAINGEVRSARRVFDESPHWSVYL  67

Query  361   WNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             WNSIIRA+A+A  F +AF LF +M  +  + DNFT AC +R C+D FD  GL++VH GV+
Sbjct  68    WNSIIRAHAQARGFEDAFSLFAEMRRTEIKXDNFTHACXVRXCADSFDLDGLKLVHCGVM  127

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
             V+GL LDSICSS LVSAY +L  ++EA +VF+ I +PDLV WNSMISG+G  G W   L 
Sbjct  128   VAGLGLDSICSSALVSAYXRLSLVDEAXRVFNXIRQPDLVLWNSMISGYGSGGFWDXGLQ  187

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
             LF +M+ M   PD +T VGL+  L   SL+ IG+ +H LCLK+  DSNAHV  +LVSMYS
Sbjct  188   LFSEMRSMEXVPDGYTIVGLLXGLADSSLISIGEGIHXLCLKWNLDSNAHVSXVLVSMYS  247

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             RC    S  R F  L EPD+VT SA+I G SQSGD  KAL FF+ +NM+G K + +LIAS
Sbjct  248   RCMSXNSXHRXFSGLXEPDLVTXSALITGFSQSGDYXKALFFFKNLNMEGKKPBSVLIAS  307

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             +L+ A Q+A V PG E H +  R G   +V +SSA I MYSKCGFL +G +VF+ MP KN
Sbjct  308   MLAXAXQMAHVGPGCEIHAYVXRHGXESDVMISSAXIAMYSKCGFLGMGTRVFEIMPEKN  367

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYF  1440
             I+SYNS+I  LGLHG A+EAF++F+E+L      PDE+TFSAL CACCH GLV DG   F
Sbjct  368   IVSYNSLILGLGLHGLASEAFRMFDEILXNG-LKPDESTFSALXCACCHAGLVXDGXEXF  426

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
               M D F IQ +TEHYV+MVKLLGM G LEEAY LI S+  PVD GIWGAL  CCD+ GN
Sbjct  427   XRMKDXFCIQARTEHYVHMVKLLGMEGRLEEAYYLILSLPEPVDSGIWGALXLCCDVCGN  486

Query  1621  YRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
               L  IVA  LF++  EKS+Y VM+SN+Y GDGRW+  KKLR  + E    KMPG  WI
Sbjct  487   LXLAEIVAXXLFZSNXEKSAYRVMLSNIYXGDGRWDDAKKLRDSITEGKLMKMPGLXWI  545



>ref|XP_008358062.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g64310 [Malus domestica]
Length=591

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/539 (57%), Positives = 383/539 (71%), Gaps = 2/539 (0%)
 Frame = +1

Query  181   LSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFL  360
             LS+  Q++S T  LHA+ LKTHL H PFYATR++RFYA+N D+ SARR+FDE+P RS++L
Sbjct  8     LSKVYQSLSRTNQLHALFLKTHLPHDPFYATRLLRFYAINGDVRSARRVFDESPHRSVYL  67

Query  361   WNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             WNSIIRA+A+A  F +AF LF +M  +  +PDNFT ACI+RAC+D FD  GL++VH GV+
Sbjct  68    WNSIIRAHAQARGFEDAFSLFAEMRRTEIKPDNFTHACIVRACADSFDLDGLKLVHCGVM  127

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
             V+GL LDSICSS LVSAY +L  ++EA +VF+GI +PDLV WNSMISG+G  G W   L 
Sbjct  128   VAGLGLDSICSSALVSAYXRLSLVDEAXRVFNGIRQPDLVLWNSMISGYGSGGFWDXGLQ  187

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
             LF +M+ M   PD +T VGL+  L   SL+ IG+ +H LCLK+  DSNAHV  +LVSMYS
Sbjct  188   LFSEMRSMEXVPDGYTIVGLLXGLADSSLISIGEGIHXLCLKWNLDSNAHVSXVLVSMYS  247

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             RC    S  R F  L EPD+VT SA+I G SQ G   KAL FF+ +NM+G K + +LIAS
Sbjct  248   RCMSXNSXHRXFSGLXEPDLVTXSALITGXSQXGXYDKALFFFKNLNMEGKKPBSVLIAS  307

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             +L+ AAQ+A V PG E H + +R G    V +S A   MYSKCGFL +G +VF  MP KN
Sbjct  308   MLAXAAQMAHVGPGCEIHAYVLRHGXESXVMISXAXXAMYSKCGFLGMGTRVFXIMPEKN  367

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYF  1440
             I+SYNS+I  LGLHG A+EAF++F+E+L      PDE+TF  L  ACCH GLV DGR  F
Sbjct  368   IVSYNSLILGLGLHGLASEAFRMFDEILXNG-LKPDESTFXXLXXACCHAGLVXDGREXF  426

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
               M DEF IQ +TEHYV+MVKLLGM G LEEAY LI S+  PVD GI GAL  CCD+ GN
Sbjct  427   XRMKDEFCIQARTEHYVHMVKLLGMEGRLEEAYYLILSLPEPVDSGIXGALXLCCDVCGN  486

Query  1621  YRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
               L  IVA  LF++  EKS+Y VM+SN+Y GDGRW+  KKLR  + E    KMPG +WI
Sbjct  487   LXLAEIVAXXLFZSNXEKSAYRVMLSNIYXGDGRWDDAKKLRDSITEGKLMKMPGLNWI  545



>ref|XP_010474616.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Camelina sativa]
Length=552

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/543 (51%), Positives = 386/543 (71%), Gaps = 3/543 (1%)
 Frame = +1

Query  169   LLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             ++ + SR +QT  +T+ LH+ + K+ L+  PF+AT+++RFYALN+D+VSAR+LFD  P+R
Sbjct  10    IIFEFSRKSQTKLSTQKLHSFVTKSKLARDPFFATQLVRFYALNDDLVSARKLFDVFPER  69

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             S+FLWNS+IRA+A+AH+FS AF LF  ML S TRPDNFT+AC+ R CS+ FD  GLR +H
Sbjct  70    SVFLWNSVIRAFAKAHQFSTAFSLFSQMLSSATRPDNFTYACLARGCSESFDTEGLRCIH  129

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
             G  +VSGL  D IC S +V AYSK G   EA K+F  I +PD+  WN+MISG+GC G W 
Sbjct  130   GIAIVSGLGFDQICGSAIVKAYSKAGLTFEASKLFLSIPDPDVALWNAMISGYGCSGFWD  189

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
             K + LF  MQ  G  P+ +T V L  CL  PS L I ++VH  CLK   D++A+VG  LV
Sbjct  190   KGVNLFNLMQHRGHVPNCYTMVALTTCLIDPSSLLIARSVHGFCLKINLDTHAYVGCALV  249

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
             ++YSRC+C+ SAC +++++  PD+V  S++I G S+ G+  +AL  F EM M G K D +
Sbjct  250   NLYSRCRCIASACSVYNTISGPDLVACSSLITGYSRCGNHKEALYLFNEMRMSGKKPDCV  309

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
             L+A VL + A+L+    G+E HG+ +R G   ++ V SALIDMYSKCG L+  + +F  +
Sbjct  310   LVAIVLGSCAELSDSVYGKEVHGYVIRLGLEFDIKVCSALIDMYSKCGVLDYAMNLFAGI  369

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
             P KNI+S+NS+I  LGLHG A+ AF+ F E+LE     PDE TF+ALL  CCH+GL+ +G
Sbjct  370   PEKNIVSFNSVILGLGLHGFASSAFEKFTEMLEMG-LKPDEVTFAALLSTCCHSGLLNEG  428

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +  F  M  EFG++P+TEHYVY+VKL+GMAG+LEEA+E + S++ P+D GI GALLS C+
Sbjct  429   QEIFERMKSEFGVEPQTEHYVYVVKLMGMAGKLEEAFEFVMSLRKPIDSGILGALLSYCE  488

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSS-YGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPG  1782
             +H N +L  +VA+++ +N  E+ S Y VM+SN+YA  GRW+ V++LR  + E+ +GK+PG
Sbjct  489   VHENTQLAEVVAENILENGEERRSVYKVMLSNVYARYGRWDDVERLRDGITESSEGKLPG  548

Query  1783  KSW  1791
              SW
Sbjct  549   ISW  551



>ref|XP_006476860.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like isoform X2 [Citrus sinensis]
Length=506

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/551 (54%), Positives = 371/551 (67%), Gaps = 50/551 (9%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             MF     L+ +LS+S+Q++S TK LHA++ K  L   PFYAT+++R YALN  + +AR L
Sbjct  1     MFFNLHFLVLELSKSHQSLSRTKELHALVAKASLLRDPFYATKLVRLYALNNVLPAARIL  60

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD+TPQRS+FLWNSIIRAYA AHRF++A  LFK++L +  +PDNFT+ACI RACS+  D 
Sbjct  61    FDKTPQRSVFLWNSIIRAYALAHRFNDAKSLFKNLLRTQLKPDNFTYACITRACSENSDL  120

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              GLR VHGG +VSGL  DSI SS LV+AYSKL  ++EAIKVFDG+++PDLV  NSMISG 
Sbjct  121   PGLRFVHGGAIVSGLGRDSITSSALVTAYSKLSLIDEAIKVFDGVSDPDLVLCNSMISGF  180

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G W K+L LF  M R+G+ PD +T VGLI  L  P LL +G+ +H  CLK  FDS  
Sbjct  181   AHCGFWDKSLQLFDWMLRLGKTPDGYTLVGLISGLWEPCLLNVGQGIHGFCLKSSFDSYD  240

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             +V S+LVSMY+RC CM SA  +F+SLL PD+VTWSA+I G SQ GD  KAL +FR++NM+
Sbjct  241   YVSSVLVSMYARCNCMNSAYHVFNSLLHPDLVTWSALINGYSQQGDYGKALYYFRKLNMQ  300

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
                                                             DMYSKCG+L LG
Sbjct  301   ------------------------------------------------DMYSKCGYLGLG  312

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             IQVF+ M  +NII+YNS+I  LGLHG   +AF+IF +++EK   NPDE+TFSALLCACCH
Sbjct  313   IQVFETMSERNIITYNSVILGLGLHGFTYQAFEIFRDIIEKG-LNPDESTFSALLCACCH  371

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV DGR  FR M +E+GIQ KTEHY+YMVKLLG++G LEEAY  I S+  PVD  + G
Sbjct  372   GGLVNDGREIFRRMTEEYGIQAKTEHYIYMVKLLGLSGNLEEAYSFIWSLPKPVDPAVSG  431

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALLSCC I+GN  L  IVA  LF+N   K +Y VM+SN YA DGRW+ V KLR D+ +  
Sbjct  432   ALLSCCHIYGNSELAEIVAHQLFENDPRKGAYKVMLSNTYAEDGRWDDVMKLRDDIVDNG  491

Query  1765  KGKMPGKSWIS  1797
               K  G SW+S
Sbjct  492   LRKEAGVSWVS  502



>ref|XP_010520718.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Tarenaya hassleriana]
Length=584

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/546 (52%), Positives = 390/546 (71%), Gaps = 3/546 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             FR ++++ +++ QT+ +T+ L A + KTHL+  PF+AT+++RFYALN D+ SAR+LFDE 
Sbjct  5     FRVIISEFAKTFQTMVSTEKLQAFVAKTHLARDPFFATKLVRFYALNGDLHSARKLFDEI  64

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             PQ+S+FLWNSIIRAY++A +  +A  LF +ML S T PDNFT+AC++R  S+ FD  GLR
Sbjct  65    PQKSVFLWNSIIRAYSQARQMGDAVSLFYEMLGSDTMPDNFTYACLVRGFSESFDSKGLR  124

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHGGV+VSGL  D IC S +V+AYSKL  + EA KVF  I +PD+V WN+MISG+G  G
Sbjct  125   RVHGGVIVSGLGFDHICGSAVVTAYSKLCLVGEATKVFHSIPDPDVVLWNAMISGYGSCG  184

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  M  +G++PD +T  GL   L    LL IG++VH  CLK   D   HVGS
Sbjct  185   FWDKGISLFSLMLHLGKRPDFYTMAGLTAGLSNCGLLIIGQSVHGFCLKVNLDYEVHVGS  244

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK-GGK  1056
              LVSMYSRCKC+ SA R+F ++ EPD+V WS++I G S+  +  +AL +F ++NM    K
Sbjct  245   ALVSMYSRCKCIDSAYRMFLTVPEPDLVAWSSLITGFSRCMNHKEALFWFSKLNMSCKKK  304

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D +L+A VL + A+L+    G+E HG  +R G  L++ V ++LID YSKCG L+  I V
Sbjct  305   PDCILVACVLGSCAELSNPMQGKEVHGHVLRQGLELDIMVCTSLIDFYSKCGSLDSAINV  364

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  M  KN++S+N++I  LGLHG A+ AF+ F+++LE     PDE TFSALLC CCH+GL
Sbjct  365   FAGMAEKNVVSFNAIILGLGLHGFASIAFEKFKDMLEMG-IRPDEGTFSALLCTCCHSGL  423

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             +  GR + RIM +EFG++P+ EH+VYMVKLLGM G+LEEA+  + S+Q P+D GIWGALL
Sbjct  424   LDKGREFLRIMRNEFGLEPRPEHHVYMVKLLGMEGKLEEAFGFVSSLQEPIDSGIWGALL  483

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             +CC+ HG+  L  +VA+ LF++  EKS+Y VM+SN+YA  GRW+ VK LR  + E+ +GK
Sbjct  484   ACCESHGDAHLAEVVAEKLFESDPEKSAYKVMLSNVYARHGRWDEVKMLRDGISESKEGK  543

Query  1774  MPGKSW  1791
             +PG SW
Sbjct  544   VPGISW  549



>ref|XP_010521030.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Tarenaya hassleriana]
Length=550

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 390/547 (71%), Gaps = 3/547 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             FR ++++ +++ QT+ +T+ L A + KTHL+  PF+AT+++R Y LN D+ SAR++FDET
Sbjct  5     FRVIISEFAKTFQTMVSTEKLQAFVAKTHLARDPFFATKLVRLYTLNGDLHSARKVFDET  64

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             PQ+S+FLWNSIIRAY++A +  +A  LF +ML S T PDNFT+AC++R  S+ FD  GLR
Sbjct  65    PQKSVFLWNSIIRAYSQARQMGDAVSLFYEMLGSDTMPDNFTYACLVRGFSESFDSKGLR  124

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHGGV+VSGL  D IC S +V+AYSKL  + EA KVF  I +PD+V WN+MISG+G  G
Sbjct  125   RVHGGVIVSGLGFDHICGSAVVTAYSKLCLVGEATKVFHSIPDPDVVLWNAMISGYGSCG  184

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  M  +G++PD +T  GL   L    LL IG++VH  CLK   D   HVGS
Sbjct  185   FWDKGISLFSLMLHLGKRPDFYTMAGLTAGLSNCGLLIIGQSVHGFCLKVNLDYEVHVGS  244

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK-GGK  1056
              LVSMYSRCKC+ SA R+F ++ EPD+V WS++I G S+  +  +AL +F ++NM    K
Sbjct  245   ALVSMYSRCKCIDSAYRMFLTVPEPDLVAWSSLITGFSRCMNHKEALFWFSKLNMSCKKK  304

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D +L+A VL + A+L+    G+E HG  +R G  L++ V ++LID YSKCG L+  I V
Sbjct  305   PDCILVACVLGSCAELSNPMQGKEVHGHVLRQGLELDIMVCTSLIDFYSKCGSLDSAINV  364

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  M  KN++S+N++I  LGLHG A+ AF+ F+++LE     PDE TFSALLC CCH+GL
Sbjct  365   FAGMAEKNVVSFNAIILGLGLHGFASIAFEKFKDMLEMG-IRPDEGTFSALLCTCCHSGL  423

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             +  GR + RIM +EFG++P+ EH+VYMVKLLGM G+LEEA+  + S+Q P+D GIWGALL
Sbjct  424   LDKGREFLRIMRNEFGLEPRPEHHVYMVKLLGMEGKLEEAFGFVSSLQEPIDSGIWGALL  483

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             +CC+ HG+  L  +VA+ LF++  EKS+Y VM+SN+YA  GRW+ VK LR  + E+ +GK
Sbjct  484   ACCESHGDAHLAEVVAEKLFESDPEKSAYKVMLSNVYARHGRWDEVKILRDGISESKEGK  543

Query  1774  MPGKSWI  1794
             +PG SW+
Sbjct  544   VPGISWV  550



>ref|XP_010419506.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Camelina sativa]
Length=552

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 381/546 (70%), Gaps = 3/546 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + S+  QT S+T+ LH+ + K+ L+  PF+AT+++R YALN+D+VSAR+LFD  
Sbjct  7     LRLIIFEFSKKFQTKSSTQKLHSFVTKSKLARDPFFATQLVRLYALNDDLVSARKLFDVC  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNS+IRA+A+AH+FS AF LF  ML S TRPDNFT+AC+ R CS+ FD  GLR
Sbjct  67    PERSVFLWNSVIRAFAKAHQFSTAFSLFSQMLSSDTRPDNFTYACLARGCSESFDTEGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D IC S +V AYSK G   EA K+F  I +PD+  WN+MISG+GC G
Sbjct  127   CIHGIAIVSGLGFDQICGSAIVKAYSKAGLTFEASKLFLSIPDPDVALWNAMISGYGCSG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  MQ  G  P+ +T V L  CL  PS L I  +VH  CLK   D++A+VG 
Sbjct  187   FWDKGVNLFNLMQHRGHVPNCYTMVALTTCLIDPSSLLIAWSVHGFCLKINLDTHAYVGG  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV+MYSRC+C+ SAC +++S+  PD+V  S++I G S+ G+  +AL  F EM M G   
Sbjct  247   ALVNMYSRCRCIASACSVYNSIFGPDLVACSSLITGYSRCGNHKEALHLFNEMRMSGKMP  306

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +L+A VL + A+L+    G+E H + +R G   ++ V SALIDMYSKCG L+  + +F
Sbjct  307   DCVLVAIVLGSCAELSDSVYGKEMHSYVIRLGLEFDIKVCSALIDMYSKCGVLDSAMNLF  366

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +P KN +++NS+I  LGLHG A+ AF+ F E+LE     PDE TF+ALL  CCH+GL+
Sbjct  367   AGIPEKNNVAFNSVILGLGLHGFASSAFEKFTEMLEMG-LKPDEVTFAALLSTCCHSGLL  425

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G+  F  M  EFG++P+TEHYVY+VKL+GMAG+LEEA+E + S++ P+D GI GALLS
Sbjct  426   NEGQEIFERMKSEFGVEPQTEHYVYLVKLMGMAGKLEEAFEFVMSLRKPIDSGILGALLS  485

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSS-YGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             CC++H N +L  +VA+ + +N  E+ S Y VM+SN+YA  GRW+ V++LR  + E+  GK
Sbjct  486   CCEVHENTQLAEVVAEKILENGEERRSVYKVMLSNVYARYGRWDEVERLRDGISESFGGK  545

Query  1774  MPGKSW  1791
             +PG SW
Sbjct  546   LPGISW  551



>ref|NP_176613.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9C7V5.1|PP104_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein 
At1g64310 [Arabidopsis thaliana]
 gb|AAG51720.1|AC066689_19 hypothetical protein; 77621-75963 [Arabidopsis thaliana]
 gb|AEE34225.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=552

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/546 (51%), Positives = 378/546 (69%), Gaps = 3/546 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + +R  QT   T+ LH+ + K+ L+  P++AT++ RFYALN+D++SAR+LFD  
Sbjct  7     LRLIIYEFTRKIQTRLNTQKLHSFVTKSKLARDPYFATQLARFYALNDDLISARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNSIIRAYA+AH+F+    LF  +L S TRPDNFT+AC+ R  S+ FD  GLR
Sbjct  67    PERSVFLWNSIIRAYAKAHQFTTVLSLFSQILRSDTRPDNFTYACLARGFSESFDTKGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D IC S +V AYSK G + EA K+F  I +PDL  WN MI G+GC G
Sbjct  127   CIHGIAIVSGLGFDQICGSAIVKAYSKAGLIVEASKLFCSIPDPDLALWNVMILGYGCCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  MQ  G +P+ +T V L   L  PSLL +  +VH+ CLK   DS+++VG 
Sbjct  187   FWDKGINLFNLMQHRGHQPNCYTMVALTSGLIDPSLLLVAWSVHAFCLKINLDSHSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV+MYSRC C+ SAC +F+S+ EPD+V  S++I G S+ G+  +AL  F E+ M G K 
Sbjct  247   ALVNMYSRCMCIASACSVFNSISEPDLVACSSLITGYSRCGNHKEALHLFAELRMSGKKP  306

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +L+A VL + A+L+    G+E H + +R G  L++ V SALIDMYSKCG L   + +F
Sbjct  307   DCVLVAIVLGSCAELSDSVSGKEVHSYVIRLGLELDIKVCSALIDMYSKCGLLKCAMSLF  366

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +P KNI+S+NS+I  LGLHG A+ AF+ F E+LE     PDE TFSALLC CCH+GL+
Sbjct  367   AGIPEKNIVSFNSLILGLGLHGFASTAFEKFTEILEMGLI-PDEITFSALLCTCCHSGLL  425

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
               G+  F  M  EFGI+P+TEHYVYMVKL+GMAG+LEEA+E + S+Q P+D GI GALLS
Sbjct  426   NKGQEIFERMKSEFGIEPQTEHYVYMVKLMGMAGKLEEAFEFVMSLQKPIDSGILGALLS  485

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSS-YGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             CC++H N  L  +VA+++  N  E+ S Y VM+SN+YA  GRW+ V++LR  + E+  GK
Sbjct  486   CCEVHENTHLAEVVAENIHKNGEERRSVYKVMLSNVYARYGRWDEVERLRDGISESYGGK  545

Query  1774  MPGKSW  1791
             +PG SW
Sbjct  546   LPGISW  551



>ref|XP_002887903.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64162.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=552

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/546 (51%), Positives = 380/546 (70%), Gaps = 3/546 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + SR  QT  +T+ LH+ + K+ L+  P++AT+++RFYALN+D+VSAR+LFD  
Sbjct  7     LRLIIYEFSRKFQTRLSTQKLHSFVTKSKLARDPYFATQLVRFYALNDDLVSARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNSIIRAYA+A++FS +  LF  ML S TRPDNFT+AC+ R  S+ FD  GLR
Sbjct  67    PERSVFLWNSIIRAYAKAYQFSTSLSLFSQMLSSDTRPDNFTYACLARGFSESFDTEGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHG  ++SGL  D IC S +V AYSK G + EA K+F  I +PDL  WN MI G+GC G
Sbjct  127   RVHGIAIMSGLGFDQICGSAIVKAYSKAGLIVEASKLFCSIPDPDLALWNVMILGYGCCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  MQ  G  P+ +T V L + L  PSLL I  +VH  CLK   DS+++VG 
Sbjct  187   FWDKGINLFNLMQHRGHLPNCYTMVALTIGLIDPSLLLIAWSVHGFCLKINLDSHSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV+MYSRC C+ SAC +++S+ EPD+V  S++I G S+ G+  +AL  F E+ M G K 
Sbjct  247   ALVNMYSRCWCIVSACSVYNSICEPDLVACSSLITGYSRCGNHKEALHMFAELRMSGKKP  306

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +L+A VL + A+L+    G++ HG+ +R G  L++ V S LIDMYSKCG L+  + +F
Sbjct  307   DCVLVAIVLGSCAELSNSVYGKKVHGYVIRLGLELDIKVCSGLIDMYSKCGLLDCAMSLF  366

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +P KNI+S+NS+I  LGLHG A+ AF+ F E+LE     PDE TFSALLC CCH+GL+
Sbjct  367   AGIPEKNIVSFNSLILGLGLHGFASSAFEKFTEMLEMG-LKPDEITFSALLCTCCHSGLL  425

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
               G+  F  M  EFGI+P+TEHYVY+VKL+GMAG+LEEA+E + S++ P+D GI GALLS
Sbjct  426   DKGQDIFERMKSEFGIKPQTEHYVYIVKLMGMAGKLEEAFEFVMSLRKPIDSGILGALLS  485

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSS-YGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             CC++H N  L  +VA+ +  +  E+ S Y VM+SN+YA  GRW+ V++LR  + E+  GK
Sbjct  486   CCEVHENTHLAEVVAEKIQKSGEERRSVYKVMLSNVYARYGRWDEVERLRDGISESFGGK  545

Query  1774  MPGKSW  1791
             +PG SW
Sbjct  546   LPGISW  551



>ref|XP_006300931.1| hypothetical protein CARUB_v10021308mg [Capsella rubella]
 gb|EOA33829.1| hypothetical protein CARUB_v10021308mg [Capsella rubella]
Length=553

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/547 (50%), Positives = 378/547 (69%), Gaps = 4/547 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R +L + SR  QT  +T+ LH+ + K+ L+  PF+AT+++R YA N+D+ SAR+LFD  
Sbjct  7     LRLILYEFSRKFQTKLSTQKLHSFVTKSRLARDPFFATQLVRLYAQNDDLASARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P RS+FLWNS+IRAYA+AH+FS AF LF  ML S  RPDNFT+AC+ R  S+ FD  GLR
Sbjct  67    PDRSVFLWNSVIRAYAKAHQFSTAFSLFSQMLSSDRRPDNFTYACLARGFSESFDTDGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSG   D IC S +V AYSK G + EA K+F  I +PD+  WN MISG+ C G
Sbjct  127   CIHGIAMVSGHGFDQICGSAIVKAYSKAGHISEASKLFLSIPDPDVALWNVMISGYECCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + +F  MQ  G  P+ +T V L  CL  PSLL I  +VH  CLK   D++++VG 
Sbjct  187   IWDKGINMFNLMQHRGNLPNCYTMVALATCLIDPSLLHIAWSVHGFCLKINLDTHSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV+MYSRC+C+ SA  +++S+  PD+V  S++I G S+ G+  +AL  F E+ + G K 
Sbjct  247   ALVNMYSRCRCIASARSVYNSISGPDLVACSSLITGYSRCGNHKEALYLFNELRVSGKKP  306

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +L+A VL + A+L+    G+E HG+A+R G   ++ V SALIDMYSKCG L+  I +F
Sbjct  307   DCVLVAIVLGSCAELSDSVYGKEVHGYAIRLGLEFDIKVHSALIDMYSKCGVLDSAINLF  366

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
             + +P KNI+S+NS+I  LGL+G A+  F+ F E+LE     PDEATF+ALLC CCH+GL+
Sbjct  367   EGIPEKNIVSFNSVILGLGLNGFASTVFEKFTEMLEMG-LKPDEATFAALLCTCCHSGLL  425

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
               G+  F  M  EFGI+PKTEHYVY+VKL+GMAG+LEEA+E + S++ P+D GI GALLS
Sbjct  426   YKGQEIFERMKFEFGIEPKTEHYVYLVKLMGMAGKLEEAFEFVMSLRKPIDSGILGALLS  485

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVE--KSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKG  1770
             CC++H N +L  +VA+ + +N  E  +S Y VM+SN+YA  GRW+ V++LR  + E+  G
Sbjct  486   CCEVHENTQLAEVVAEKILENGEERGRSVYKVMLSNVYARYGRWDEVERLRDGISESFGG  545

Query  1771  KMPGKSW  1791
             K+PG SW
Sbjct  546   KLPGISW  552



>ref|XP_006391645.1| hypothetical protein EUTSA_v10023386mg [Eutrema salsugineum]
 gb|ESQ28931.1| hypothetical protein EUTSA_v10023386mg [Eutrema salsugineum]
Length=563

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/530 (50%), Positives = 370/530 (70%), Gaps = 2/530 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + SR +Q   +T+ L + + KTHL+  P++AT+++R+YALN+D++SAR+LFD  
Sbjct  7     LRLIINEFSRKSQKRLSTQKLQSFVTKTHLARDPYFATQLVRYYALNDDLLSARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNSIIRAYA+AH+   +  LF  ML S T+PDNFTFAC+ R  S+ FD   L+
Sbjct  67    PERSVFLWNSIIRAYAKAHQLGTSLSLFSQMLSSDTKPDNFTFACLARGFSESFDTERLK  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHG  +VSGL  D IC S +V AYS+ G + EA K+F  I EPD+  WN+M+SG+   G
Sbjct  127   CVHGTAIVSGLGFDQICGSAIVKAYSEAGLIVEASKLFVSILEPDVALWNTMVSGYARCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W+  + LF  M   G +PD +T V L   +  PSLL +  +VH  CLK   DS++HVG 
Sbjct  187   FWENGINLFNSMLHQGNRPDCYTMVALTTGVIDPSLLLVAWSVHGFCLKVNLDSHSHVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LVSMYSRC+CM SA  +F S+ EPD+V  S++I G S+ G+  +AL  F E+ M G K 
Sbjct  247   ALVSMYSRCRCMTSAYSVFGSISEPDLVACSSLITGYSKCGNHKEALYLFSELIMIGKKP  306

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +++A VL + A+L+    G E HG+ +R G   ++ V SALIDMYSKCGFL+  + +F
Sbjct  307   DCVIVAVVLGSCAELSNSLYGNEVHGYVIRLGLEPDIKVCSALIDMYSKCGFLDSAMSLF  366

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
             + +P KN +S+NS+I  LGLHG A+ AF+ F E+LE    NPDEATFS+LLC CCH+GL+
Sbjct  367   ERIPEKNTVSFNSVILGLGLHGFASSAFENFSEMLEMG-LNPDEATFSSLLCTCCHSGLL  425

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G+  F  M  EFG++P+TEHYVY+VKL+GMAG+LEEA+E + S + PVD GIWGALLS
Sbjct  426   NEGQEIFMRMKSEFGVEPRTEHYVYIVKLMGMAGKLEEAFEFVMSFRKPVDSGIWGALLS  485

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSY-GVMVSNMYAGDGRWECVKKLR  1746
             CC++H N  L  +VA+ + +N+ E+ S+  VM+SNMYA  G+W+ V++LR
Sbjct  486   CCEVHENTHLAEVVAEKILENEEERRSFHNVMLSNMYARYGKWDEVERLR  535



>gb|KHN19267.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=477

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 346/475 (73%), Gaps = 1/475 (0%)
 Frame = +1

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +IRA+A++ RF NA  LF+ ML +   PD  T+AC++RAC+D FDF  LR VHGG V +G
Sbjct  1     MIRAFAQSQRFFNAISLFRTMLGADISPDGHTYACVIRACADNFDFGMLRRVHGGAVAAG  60

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             L  D +C S LV+AYSKLG + EA +VFDGIAEPDLV WNS+ISG+G  G W   + +F 
Sbjct  61    LGRDPVCCSALVAAYSKLGLVHEARRVFDGIAEPDLVLWNSLISGYGGFGLWDVGMQMFS  120

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              M+  G KPD +T  GL++ +    +L IG+ +H L  K G DS++HVGSLL+SMYSRCK
Sbjct  121   MMRLFGMKPDGYTLAGLLVGIADSGMLSIGQGLHCLSQKSGLDSDSHVGSLLLSMYSRCK  180

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              M SA R+F S+L PD+VTWSA+I G SQSG+  K L FFR++NM+  K D +LIASVL+
Sbjct  181   HMASAYRVFCSILNPDLVTWSALIVGYSQSGEYEKVLLFFRKLNMESKKPDSVLIASVLA  240

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             + AQ+A V  G E HG+A+R G  L+V VSSAL+DMYSKCGFL+LGI VF+ MP +NI+S
Sbjct  241   SIAQMANVGLGCEVHGYALRHGLELDVRVSSALVDMYSKCGFLHLGICVFRVMPERNIVS  300

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +NS+I   GLHG A+EAF++F+++LEK    PDEATFS+LLCACCH GLV DGR  F+ M
Sbjct  301   FNSVILGFGLHGCASEAFRMFDKMLEKGLV-PDEATFSSLLCACCHAGLVKDGREIFQRM  359

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
               EF I+ + EHYVYMVKLLG AGELEEAY L QS+  PVD  I GALLSCC+I GN  L
Sbjct  360   KHEFNIRARPEHYVYMVKLLGSAGELEEAYNLTQSLPEPVDKAILGALLSCCNICGNSEL  419

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKMPGKSWI  1794
                VA  LF++    + Y VM+SN+YAGDGRW+ VKKLR +M     KMPG SWI
Sbjct  420   AETVAHQLFESSPADNVYRVMLSNIYAGDGRWDDVKKLRDNMTGGPRKMPGLSWI  474


 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 110/404 (27%), Positives = 182/404 (45%), Gaps = 39/404 (10%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N      + +H   +   L   P   + ++  Y+    +  ARR+FD   +  + LWNS+
Sbjct  43    NFDFGMLRRVHGGAVAAGLGRDPVCCSALVAAYSKLGLVHEARRVFDGIAEPDLVLWNSL  102

Query  373   IRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGL  552
             I  Y     +    Q+F  M   G +PD +T A +L   +D    S  + +H     SGL
Sbjct  103   ISGYGGFGLWDVGMQMFSMMRLFGMKPDGYTLAGLLVGIADSGMLSIGQGLHCLSQKSGL  162

Query  553   ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIK  732
             + DS   S L+S YS+   +  A +VF  I  PDLV W+++I G+   G+++K LL F K
Sbjct  163   DSDSHVGSLLLSMYSRCKHMASAYRVFCSILNPDLVTWSALIVGYSQSGEYEKVLLFFRK  222

Query  733   MQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             +    +KPDS     ++  +   + + +G  VH   L+ G + +  V S LV MYS+C  
Sbjct  223   LNMESKKPDSVLIASVLASIAQMANVGLGCEVHGYALRHGLELDVRVSSALVDMYSKCGF  282

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
             +     +F  + E ++V+++++I G    G   +A   F +M  KG   D    +S+L A
Sbjct  283   LHLGICVFRVMPERNIVSFNSVILGFGLHGCASEAFRMFDKMLEKGLVPDEATFSSLLCA  342

Query  1093  AAQLAIVQPGRE-----THGFAVRC--------------------GYHLEVSVSS-----  1182
                  +V+ GRE      H F +R                      Y+L  S+       
Sbjct  343   CCHAGLVKDGREIFQRMKHEFNIRARPEHYVYMVKLLGSAGELEEAYNLTQSLPEPVDKA  402

Query  1183  ---ALIDMYSKCGFLNLGI----QVFKAMPSKNIISYNSMISNL  1293
                AL+   + CG   L      Q+F++ P+ N+  Y  M+SN+
Sbjct  403   ILGALLSCCNICGNSELAETVAHQLFESSPADNV--YRVMLSNI  444



>ref|XP_009112820.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Brassica rapa]
Length=554

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/549 (48%), Positives = 379/549 (69%), Gaps = 5/549 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + S+  QT   T+ LH+ + K+ L+  P++AT+++R+Y+LN+D++SAR+LFD  
Sbjct  7     LRLIINEFSKKFQTKLNTQKLHSFVTKSQLARDPYFATQLVRYYSLNDDLLSARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNS+IRAYA++H    A  LF  ML S T+PD+FT+AC+ R CS+ FD  GLR
Sbjct  67    PERSVFLWNSVIRAYAKSHHLGPASSLFSQMLSSDTKPDSFTYACLARGCSESFDTEGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D +C S LV AYSK G   EA K+F  I EPD+  WN+M+SG+G  G
Sbjct  127   CIHGNAIVSGLGFDRVCGSTLVKAYSKAGLTFEASKLFYSIPEPDVPLWNAMLSGYGSCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W++ + +F  M R G +PD +T V L+  +  P L  + ++VH  CLK G DS ++VG 
Sbjct  187   YWEEGISMFNIMLRQGNRPDCYTMVALMTGVIDPGLTLVARSVHGFCLKVGLDSQSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEP-DMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
              LVSMYSRCKC+ SAC +F  + EP D+V  S++I G S+ G   +AL  F E+ M G K
Sbjct  247   ALVSMYSRCKCIASACGVFSGISEPTDLVACSSLINGYSKCGYHKEALCLFNELRMSGKK  306

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D +L+A VL + A+L+    G+E H + +R G  L++ VSSALIDMYSKCG L+  + +
Sbjct  307   PDSVLVAIVLGSCAELSNSLYGQEVHSYVIRQGLELDIKVSSALIDMYSKCGVLDSAMTL  366

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  +P K++IS+NS+I  LGLHG A+ AF++F E+LE     PDE TFSALLC CCH+GL
Sbjct  367   FAKVPEKSVISFNSVILGLGLHGFASSAFEMFNEMLEMG-LKPDEVTFSALLCTCCHSGL  425

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             + +G+  F  M  EFG++P+TEH+VY+VKL+GMA +LEEA+E + S++ P+D GIWGALL
Sbjct  426   LREGQEMFMRMKREFGVEPRTEHHVYIVKLMGMARKLEEAFEFVMSLRRPIDSGIWGALL  485

Query  1597  SCCDIHGNYRLGGIVAKHL--FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIK  1767
             SCC++H +  L  +VA+ +   + +  +S Y VM+SN+YA  G+W+ V+ LR  + E+  
Sbjct  486   SCCEVHEDAHLAEVVAEKIRENEEEERRSVYNVMLSNVYARYGKWDEVEMLRDGVSESFG  545

Query  1768  GKMPGKSWI  1794
             GK+PG SW+
Sbjct  546   GKLPGISWV  554



>ref|XP_010924113.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Elaeis guineensis]
Length=554

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/536 (51%), Positives = 375/536 (70%), Gaps = 4/536 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             T+S TK LHA+++ T LS HP  AT+++R YA ++DI+SAR LFD+TP R++  WNSIIR
Sbjct  18    TLSETKQLHAVLITTRLSSHPPLATKLLRSYAAHDDILSARLLFDQTPHRTVRFWNSIIR  77

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              +AR H FS  F LF  M  S T PD  TFACILRACS+  +    ++VHG ++  GL  
Sbjct  78    VHARRHDFSRIFSLFAQMRRSCTSPDGHTFACILRACSEVSNLRCAKMVHGNLISFGLGC  137

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             D I SS ++SAYSKLG + +A  +FD + EPDLV WNSMISG+G  G W+K L LF +M+
Sbjct  138   DPIGSSAVISAYSKLGLVNDARSLFDVLPEPDLVLWNSMISGYGYKGLWQKGLELFHRMR  197

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               GE+PD ++ VGL+      S L  G+ +H +CLK G+DS++HV S+LVSMYSRC C+ 
Sbjct  198   EAGERPDGYSLVGLLSSFWDRSSLFFGRGIHGICLKGGYDSSSHVRSVLVSMYSRCGCLD  257

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             S  RIF  L + D+VTWSA+I G SQ G   +AL  F+EMN  G + D +LIA VLSA A
Sbjct  258   SGYRIFRGLSQADLVTWSALITGFSQVGKCKEALMLFKEMNSLGERPDAILIAGVLSACA  317

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
              ++ V PG+E HG+A+R G  L+++VS AL+D Y+KCGF+ LG+QVF+  P KN+++YN+
Sbjct  318   SVSGVGPGKEIHGYAIRHGIQLDIAVSCALVDTYAKCGFVELGLQVFELTPVKNLVAYNT  377

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             +IS LG +G   EA ++FEE+L+K  + PD ATFSA+L ACCH+G + DG R F  M +E
Sbjct  378   VISCLGSYGLGREAVRVFEEMLDKG-FKPDGATFSAVLLACCHSGFLDDGWRLFGRMTEE  436

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
             FG++ + EHYVYMV+LL M G+L+EAY+LI ++    D GIWGALL  C +HG+  L  I
Sbjct  437   FGLEVQMEHYVYMVRLLAMVGQLKEAYDLIGTMPMLPDSGIWGALLWGCSVHGSLDLAKI  496

Query  1639  VAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--EAIKGKMPGKSWISN  1800
              A+ LF+    K++Y VM+SN+YA + +W  V+KLR ++  E ++ K PG SWI +
Sbjct  497   AAQRLFEINPSKAAYRVMLSNVYAAEEKWGDVRKLRDEIMNEGLQ-KSPGLSWIGD  551



>ref|XP_008792876.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Phoenix dactylifera]
Length=554

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/536 (51%), Positives = 366/536 (68%), Gaps = 4/536 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             T+S TK LHA+++   LS H   AT+++R YA ++DI SAR LFD T  R++ LWNSIIR
Sbjct  18    TLSETKQLHAVLITARLSSHAPLATKLLRSYAAHDDIFSARLLFDRTTHRTVRLWNSIIR  77

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
             A+AR H FS    LF  M  SGT PD  TFACILR+ S+  +    ++VHG ++ SGL  
Sbjct  78    AHARRHDFSRIISLFTQMRRSGTSPDGHTFACILRSFSENSNLRCAKMVHGNLISSGLGA  137

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             D I SS ++SAYSKLG +++A  +FD + EPDLV WNSMISG+G  G W+K L LF +M+
Sbjct  138   DPIGSSAVISAYSKLGLVDDARSMFDVLPEPDLVLWNSMISGYGYKGLWQKGLALFHRMR  197

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               GE+PD ++ VGL+ C    S L     +H +CLK G+DS+ HV S+LVSMYSRC C+ 
Sbjct  198   EAGERPDGYSLVGLLSCFWDRSSLLFASGIHGICLKGGYDSSPHVRSVLVSMYSRCGCLD  257

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             S  RIF  L   D+VTWSA+I G SQ G   KAL  F+EMN  G + D +L+A VLSA A
Sbjct  258   SGYRIFRGLSRADLVTWSALIAGFSQVGRCKKALTLFKEMNSSGERPDAILVAGVLSACA  317

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
              ++ + PG+E HG A+R G  L+V+VS ALID Y+KCGF  LG++VF+ MP KN+++YN+
Sbjct  318   SVSGIAPGKEIHGHAIRHGMELDVAVSCALIDTYAKCGFAELGLRVFELMPCKNLVAYNT  377

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
              IS LG HG   EA ++FEE+L+K  + PD ATFSA L ACCH+GL+ DG R F  M DE
Sbjct  378   AISCLGSHGLGREAVRVFEEMLDKG-FKPDGATFSAALLACCHSGLLDDGWRLFGRMADE  436

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
             FG++ + EHYVYMVKLL M G+L+EAY+LI ++    D GIWGALL  C +HG+  L  I
Sbjct  437   FGLEVQREHYVYMVKLLAMVGQLKEAYDLIGTMPMLPDSGIWGALLWGCSVHGSLDLAKI  496

Query  1639  VAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--EAIKGKMPGKSWISN  1800
              A+ L +    K++Y VM+SN+YA + +W  V KLR +M  E ++ K PG SWI +
Sbjct  497   AAQRLLEINPSKAAYRVMLSNIYAAEEKWRDVGKLRDEMMNEGLQ-KSPGLSWIGD  551


 Score =   149 bits (375),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/402 (25%), Positives = 184/402 (46%), Gaps = 5/402 (1%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N  +   K++H  ++ + L   P  ++ +I  Y+    +  AR +FD  P+  + LWNS+
Sbjct  117   NSNLRCAKMVHGNLISSGLGADPIGSSAVISAYSKLGLVDDARSMFDVLPEPDLVLWNSM  176

Query  373   IRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGL  552
             I  Y     +     LF  M ++G RPD ++   +L    D+        +HG  +  G 
Sbjct  177   ISGYGYKGLWQKGLALFHRMREAGERPDGYSLVGLLSCFWDRSSLLFASGIHGICLKGGY  236

Query  553   ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIK  732
             +      S LVS YS+ G L+   ++F G++  DLV W+++I+G   +G  KKAL LF +
Sbjct  237   DSSPHVRSVLVSMYSRCGCLDSGYRIFRGLSRADLVTWSALIAGFSQVGRCKKALTLFKE  296

Query  733   MQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             M   GE+PD+    G++      S +  GK +H   ++ G + +  V   L+  Y++C  
Sbjct  297   MNSSGERPDAILVAGVLSACASVSGIAPGKEIHGHAIRHGMELDVAVSCALIDTYAKCGF  356

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
                  R+F+ +   ++V ++  I  L   G   +A+  F EM  KG K D    ++ L A
Sbjct  357   AELGLRVFELMPCKNLVAYNTAISCLGSHGLGREAVRVFEEMLDKGFKPDGATFSAALLA  416

Query  1093  AAQLAIVQPGRETHG-FAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS-KNII  1266
                  ++  G    G  A   G  ++      ++ + +  G L     +   MP   +  
Sbjct  417   CCHSGLLDDGWRLFGRMADEFGLEVQREHYVYMVKLLAMVGQLKEAYDLIGTMPMLPDSG  476

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
              + +++    +HG+ + A    + +LE    NP +A +  +L
Sbjct  477   IWGALLWGCSVHGSLDLAKIAAQRLLE---INPSKAAYRVML  515



>gb|KCW48919.1| hypothetical protein EUGRSUZ_K02532 [Eucalyptus grandis]
Length=507

 Score =   532 bits (1371),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 343/470 (73%), Gaps = 8/470 (2%)
 Frame = +1

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
             F+ AF +F  ML S  RPDNFT+AC++RAC D+ D  GL++VHGG VVSGL  DSIC S 
Sbjct  27    FNMAFSMFGQMLRSEIRPDNFTYACLMRACCDEADLDGLKIVHGGAVVSGLGWDSICGSA  86

Query  580   LVSAYSKLGPLEEAIKVFDGIAEP--DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             LV+AYS+LG ++EA +VF  ++E   DLV WNSMISG+G L  W K L LF +M+ +G  
Sbjct  87    LVTAYSRLGHVDEASRVFYAMSESHQDLVMWNSMISGYGHLCAWDKGLKLFSEMRSLGRL  146

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PD +T VGLI  L   S + +G+++H LC+K   DS+A+VG+ LVSMY+RC+CM SAC++
Sbjct  147   PDGYTLVGLISGLADMSFIGVGQSIHGLCMKSCLDSDAYVGAALVSMYARCRCMDSACKV  206

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F  L +PD+V WSA++ G  Q GD  KAL  FR++ ++   VD +LI+SVL A AQLA V
Sbjct  207   FGGLSQPDLVAWSALVMGYCQCGDGEKALLIFRKLTIECRMVDHVLISSVLVAIAQLANV  266

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             +PG+E HGF +RCG    + VSSALIDMYSKCGFL+ G+ +F+ M  +NII+YNS+I  L
Sbjct  267   RPGKEIHGFVLRCGLESNIMVSSALIDMYSKCGFLDEGMHIFEHMADRNIITYNSIILGL  326

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             GLHG A++AFQ+FEE+L     NPD  TFSALLCACCH GL+ DG++ FR M DEF +QP
Sbjct  327   GLHGLASQAFQLFEEILSIG-VNPDHCTFSALLCACCHAGLIEDGKKIFRRMEDEFCLQP  385

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
              TEHYVYMVKLLG AGELEEA++ IQS+  PVD G+WGALLSCC++ GN  + GIVA+ L
Sbjct  386   GTEHYVYMVKLLGTAGELEEAFDFIQSLPQPVDPGVWGALLSCCEMCGNSTMAGIVAQQL  445

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG---KMPGKSWI  1794
             F  + EK +Y VM+S  YA DGRW  VKKLR   E I G   K+PG SWI
Sbjct  446   FQMEPEKGAYRVMLSKTYASDGRWSDVKKLRD--EIIDGRLKKIPGLSWI  493


 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/402 (24%), Positives = 193/402 (48%), Gaps = 17/402 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ--RSIFLWNSIIRAYA  387
             K++H   + + L       + ++  Y+    +  A R+F    +  + + +WNS+I  Y 
Sbjct  66    KIVHGGAVVSGLGWDSICGSALVTAYSRLGHVDEASRVFYAMSESHQDLVMWNSMISGYG  125

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL-RVVHGGVVVSGLELDS  564
                 +    +LF +M   G  PD +T   ++   +D   F G+ + +HG  + S L+ D+
Sbjct  126   HLCAWDKGLKLFSEMRSLGRLPDGYTLVGLISGLAD-MSFIGVGQSIHGLCMKSCLDSDA  184

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
                + LVS Y++   ++ A KVF G+++PDLV W++++ G+   GD +KALL+F K+   
Sbjct  185   YVGAALVSMYARCRCMDSACKVFGGLSQPDLVAWSALVMGYCQCGDGEKALLIFRKLTIE  244

Query  745   GEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSA  924
                 D      +++ +   + +R GK +H   L+ G +SN  V S L+ MYS+C  +   
Sbjct  245   CRMVDHVLISSVLVAIAQLANVRPGKEIHGFVLRCGLESNIMVSSALIDMYSKCGFLDEG  304

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQL  1104
               IF+ + + +++T++++I GL   G   +A   F E+   G   D    +++L A    
Sbjct  305   MHIFEHMADRNIITYNSIILGLGLHGLASQAFQLFEEILSIGVNPDHCTFSALLCACCHA  364

Query  1105  AIVQPG-----RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-NII  1266
              +++ G     R    F ++ G    V     ++ +    G L       +++P   +  
Sbjct  365   GLIEDGKKIFRRMEDEFCLQPGTEHYVY----MVKLLGTAGELEEAFDFIQSLPQPVDPG  420

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
              + +++S   + GN+  A  + +++ + E   P++  +  +L
Sbjct  421   VWGALLSCCEMCGNSTMAGIVAQQLFQME---PEKGAYRVML  459


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 110/233 (47%), Gaps = 5/233 (2%)
 Frame = +1

Query  202  ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
            I   + +H + +K+ L    +    ++  YA    + SA ++F    Q  +  W++++  
Sbjct  165  IGVGQSIHGLCMKSCLDSDAYVGAALVSMYARCRCMDSACKVFGGLSQPDLVAWSALVMG  224

Query  382  YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
            Y +      A  +F+ +       D+   + +L A +   +    + +HG V+  GLE +
Sbjct  225  YCQCGDGEKALLIFRKLTIECRMVDHVLISSVLVAIAQLANVRPGKEIHGFVLRCGLESN  284

Query  562  SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
             + SS L+  YSK G L+E + +F+ +A+ +++ +NS+I G G  G   +A  LF ++  
Sbjct  285  IMVSSALIDMYSKCGFLDEGMHIFEHMADRNIITYNSIILGLGLHGLASQAFQLFEEILS  344

Query  742  MGEKPDSFTYVGLIMCLDCPSLLRIGKNV-----HSLCLKFGFDSNAHVGSLL  885
            +G  PD  T+  L+       L+  GK +        CL+ G +   ++  LL
Sbjct  345  IGVNPDHCTFSALLCACCHAGLIEDGKKIFRRMEDEFCLQPGTEHYVYMVKLL  397



>ref|XP_011046253.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Populus euphratica]
Length=459

 Score =   519 bits (1337),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 268/453 (59%), Positives = 334/453 (74%), Gaps = 5/453 (1%)
 Frame = +1

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             PD +T+AC++RAC + F   GLR+VHGGV++SGL LDS+  S LV+ YSK+G + EA KV
Sbjct  8     PDKYTYACLIRACCEDFYVDGLRIVHGGVIISGLGLDSVTCSALVTGYSKMGLVGEASKV  67

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK-PDSFTYVGLIMCLDCPSL  807
             F G+ EPDLV WN+MISG G  G   K LL F +M+  G K PD +TYV LI  L   S 
Sbjct  68    FCGVFEPDLVLWNAMISGCGYCGFGDKGLLFFNEMRDNGNKRPDGYTYVALISGLANSSS  127

Query  808   LRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICG  987
             L +G+ +H+LCLK GFD N HVGS LVSMYSR +C+  A  +F SL +PD+VTWSA+I G
Sbjct  128   LELGQGIHALCLKSGFDCNDHVGSSLVSMYSRFRCVNLAYSVFRSLCQPDLVTWSALITG  187

Query  988   LSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLE  1167
              SQ+G+  KAL F++ +N+ G K D +LIASVL A AQLA V PG + HG+ VR G+   
Sbjct  188   FSQAGEHEKALLFYKNLNLAGKKPDSVLIASVLVAIAQLANVGPGVQIHGYIVRYGFESH  247

Query  1168  VSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLE  1347
             V VSSALIDMYSKCGF+ LG++VF+ MP +NI+SYNS+IS LGLHG A++AF +F E+LE
Sbjct  248   VMVSSALIDMYSKCGFVGLGLRVFQNMPYRNIVSYNSIISGLGLHGLASQAFDMFTEILE  307

Query  1348  KEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGEL  1527
             K    PDE+TFSALLCACCH GLV DGR  FR M DEF IQ +TEHYV++VKLLGMAGEL
Sbjct  308   KG-LKPDESTFSALLCACCHAGLVKDGREIFRRMKDEFWIQARTEHYVHIVKLLGMAGEL  366

Query  1528  EEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMY  1707
             +EAY  I S++ PVD GIWGALLSCCD HG+  L  IVA+ LFD++ +K +Y VM+SN+Y
Sbjct  367   DEAYSFILSLKQPVDSGIWGALLSCCDAHGDSELAEIVAQQLFDSEPKKGAYRVMLSNIY  426

Query  1708  AGDGRWECVKKLRVDMEAIKG--KMPGKSWISN  1800
             AGDGRW  V+K+R D     G  KMPG S I +
Sbjct  427   AGDGRWVDVEKMR-DYITTDGSEKMPGLSRIGS  458


 Score =   139 bits (349),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/310 (26%), Positives = 156/310 (50%), Gaps = 1/310 (0%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   +++H  ++ + L       + ++  Y+    +  A ++F    +  + LWN++I  
Sbjct  26    VDGLRIVHGGVIISGLGLDSVTCSALVTGYSKMGLVGEASKVFCGVFEPDLVLWNAMISG  85

Query  382   YARAHRFSNAFQLFKDMLDSGT-RPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
                          F +M D+G  RPD +T+  ++   ++       + +H   + SG + 
Sbjct  86    CGYCGFGDKGLLFFNEMRDNGNKRPDGYTYVALISGLANSSSLELGQGIHALCLKSGFDC  145

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             +    S LVS YS+   +  A  VF  + +PDLV W+++I+G    G+ +KALL +  + 
Sbjct  146   NDHVGSSLVSMYSRFRCVNLAYSVFRSLCQPDLVTWSALITGFSQAGEHEKALLFYKNLN  205

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G+KPDS     +++ +   + +  G  +H   +++GF+S+  V S L+ MYS+C  +G
Sbjct  206   LAGKKPDSVLIASVLVAIAQLANVGPGVQIHGYIVRYGFESHVMVSSALIDMYSKCGFVG  265

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
                R+F ++   ++V+++++I GL   G   +A D F E+  KG K D    +++L A  
Sbjct  266   LGLRVFQNMPYRNIVSYNSIISGLGLHGLASQAFDMFTEILEKGLKPDESTFSALLCACC  325

Query  1099  QLAIVQPGRE  1128
                +V+ GRE
Sbjct  326   HAGLVKDGRE  335


 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +1

Query  157  AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
             + +L++ L+ S+ ++   + +HA+ LK+    +    + ++  Y+    +  A  +F  
Sbjct  114  TYVALISGLANSS-SLELGQGIHALCLKSGFDCNDHVGSSLVSMYSRFRCVNLAYSVFRS  172

Query  337  TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
              Q  +  W+++I  +++A     A   +K++  +G +PD+   A +L A +   +    
Sbjct  173  LCQPDLVTWSALITGFSQAGEHEKALLFYKNLNLAGKKPDSVLIASVLVAIAQLANVGPG  232

Query  517  RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
              +HG +V  G E   + SS L+  YSK G +   ++VF  +   ++V +NS+ISG G  
Sbjct  233  VQIHGYIVRYGFESHVMVSSALIDMYSKCGFVGLGLRVFQNMPYRNIVSYNSIISGLGLH  292

Query  697  GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
            G   +A  +F ++   G KPD  T+  L+       L++ G+ +
Sbjct  293  GLASQAFDMFTEILEKGLKPDESTFSALLCACCHAGLVKDGREI  336



>ref|XP_010431737.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Camelina sativa]
Length=520

 Score =   508 bits (1308),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 256/546 (47%), Positives = 356/546 (65%), Gaps = 35/546 (6%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + SR  QT  +T+ LH+ +  + L+  PF+AT+++RFYALN+D+VSAR+LF   
Sbjct  7     LRLIIYEFSRKFQTKLSTQKLHSFVTTSKLARDPFFATQLVRFYALNDDLVSARKLF---  63

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
                                          DML S TRPDNFT+AC+ R CS+ FD  GLR
Sbjct  64    -----------------------------DMLSSDTRPDNFTYACLARGCSESFDTEGLR  94

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D IC S +V AYSK G   EA K+F  I +PD+  WN+MISG+GC G
Sbjct  95    CIHGIAIVSGLGFDQICGSAIVKAYSKAGLTFEASKLFLSIPDPDVALWNAMISGYGCSG  154

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K + LF  MQ  G  PD +T V L  CL  PSLL I  +VH  CLK   D++++VG 
Sbjct  155   FWDKGVNLFNLMQHRGHVPDCYTIVALTTCLIDPSLLLIAWSVHGFCLKINLDTHSYVGC  214

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L++MYSRC+C+ SA  ++DS+  PD+V  S++I G S+ G+  +AL  F E+ M G K 
Sbjct  215   ALMNMYSRCRCIASAFSVYDSISGPDLVACSSLITGYSRCGNHKEALYLFNELRMSGKKP  274

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +L+A VL + A+L+    G+E HG+ +R G   ++ V SALIDMYSKCG L+  + +F
Sbjct  275   DCVLVAIVLGSCAELSDSVYGKEVHGYVIRLGLEFDIKVCSALIDMYSKCGVLDSAMNLF  334

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +P KNI+S+NS+I   GLHG A+ AF+ F E+LE     PDE TF+ALL  CCH+GL+
Sbjct  335   AGIPEKNIVSFNSVILGFGLHGFASSAFEKFTEMLEMG-LKPDEVTFAALLSTCCHSGLL  393

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G+  F  M  EFG++P+TEHYVY+VKL+GMAG+LEEA+E + S++ P+D GI GALLS
Sbjct  394   NEGQEIFERMKSEFGVEPQTEHYVYVVKLMGMAGKLEEAFEFVMSLRKPIDSGILGALLS  453

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSS-YGVMVSNMYAGDGRWECVKKLRVDM-EAIKGK  1773
             CC++H N +L  +VA+ + +N  E+ S Y VM+SN+YA  GRW+ V++LR  + E+  GK
Sbjct  454   CCEVHENTQLAEVVAEKILENGEERRSVYKVMLSNVYARYGRWDEVERLRDGISESSGGK  513

Query  1774  MPGKSW  1791
             +PG SW
Sbjct  514   LPGISW  519



>emb|CDY38180.1| BnaA09g12090D [Brassica napus]
Length=520

 Score =   503 bits (1294),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 360/549 (66%), Gaps = 39/549 (7%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + SR  QT   T+ LH+ + K+ L+  P++AT+++R+Y+LN+D++SAR+LFD  
Sbjct  7     LRLIINEFSRKIQTKLNTQKLHSFVTKSQLARDPYFATQLVRYYSLNDDLLSARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNS+IRAYA++H    A  LF  ML S T+PD+FT+AC+ R CS+ F+  GLR
Sbjct  67    PERSVFLWNSVIRAYAKSHHLGPASSLFSQMLSSDTKPDSFTYACLARGCSESFETEGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D +C S LV AYSK G   EA K+F  I EPD+  WN+M+SG+G  G
Sbjct  127   CIHGNAIVSGLGFDRVCGSTLVKAYSKAGLTFEASKLFYSIPEPDVPLWNAMLSGYGSCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W++ + +F  M R G +PD +T V L+  +  P L  + ++VH  CLK G DS+++VG 
Sbjct  187   YWEEGISMFNIMLRQGNRPDCYTMVALMTGVIDPGLTLVARSVHGFCLKVGLDSHSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEP-DMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
              LVSMYSRCKC+ SAC +F  + EP D+V  S++I G                       
Sbjct  247   ALVSMYSRCKCIASACGVFSGISEPTDLVACSSLING-----------------------  283

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                        + A+L+    G+E H + +R G  L++ VSSALIDMYSKCG L+  + +
Sbjct  284   -----------SCAELSNSLYGQEVHSYVIRQGLELDIKVSSALIDMYSKCGVLDSAMTL  332

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  +P K+++S+NS+I  LGLHG A+ AF++F E+LE     PDE TFSALLC  CH+GL
Sbjct  333   FAKVPEKSVVSFNSVILGLGLHGFASSAFEMFNEMLEMGL-KPDEVTFSALLCTFCHSGL  391

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             + +G+  F  M  EFG++P+TEH VY+VKL+GMAG+LEEA+E + S++ P+D GIWGALL
Sbjct  392   LHEGQEMFMRMKREFGVEPRTEHQVYIVKLMGMAGKLEEAFEFVMSLRRPIDSGIWGALL  451

Query  1597  SCCDIHGNYRLGGIVAKHL--FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIK  1767
             SCC++H +  L  +VA+ +   + +  +S Y VM+SN+YA  G+W+ V+ LR  + E+  
Sbjct  452   SCCEVHEDAHLAEVVAEKIRENEEEERRSVYNVMLSNVYARYGKWDEVEMLRDGVSESFG  511

Query  1768  GKMPGKSWI  1794
             GK+PG SW+
Sbjct  512   GKLPGISWV  520



>emb|CDY64787.1| BnaCnng44930D [Brassica napus]
Length=520

 Score =   494 bits (1273),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/549 (45%), Positives = 357/549 (65%), Gaps = 39/549 (7%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
              R ++ + SR  QT   T+ LH+ + K+ L+  P++AT+++R Y+LN+D++SAR+LFD  
Sbjct  7     LRLIINEFSRKIQTKLNTQKLHSFVTKSQLARDPYFATQLVRCYSLNDDLISARKLFDVF  66

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
             P+RS+FLWNS+IRAYA++H    A  LF  ML S T+PD+FT+AC+ R  S+  D  GLR
Sbjct  67    PERSVFLWNSVIRAYAKSHHLGPASSLFSQMLSSDTKPDSFTYACLARGFSESSDTEGLR  126

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +VSGL  D +C S LV AYSK G   EA K+F  + EPD+  WN+M+SG+G  G
Sbjct  127   CIHGNAIVSGLGFDQVCGSTLVKAYSKAGLTFEASKLFYSVTEPDVPLWNAMLSGYGSCG  186

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W + + +F  M R G +PD +T V L+  +  P L  + ++VH  CLK   DS+++VG 
Sbjct  187   YWDEGISMFNLMLRQGNRPDCYTMVALMTGVIDPGLTLVARSVHGFCLKVNLDSHSYVGC  246

Query  880   LLVSMYSRCKCMGSACRIFDSLLEP-DMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
              LVSMYSRCKC+ SAC +F  + EP D+V  S++I G                       
Sbjct  247   ALVSMYSRCKCIASACGVFSGISEPTDLVACSSLING-----------------------  283

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                        + A+L+    G+E H + +R G  L++ VSSALIDMYSKCG L+  + +
Sbjct  284   -----------SCAELSDSLYGQEVHSYVIRQGLELDIKVSSALIDMYSKCGVLDSAMTL  332

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  +P K+++S+NS+I  LGLHG A+ AF+ F+E+LE     PDE TFSALLC CCH+GL
Sbjct  333   FAKVPEKSVVSFNSVILGLGLHGFASSAFEKFDEMLEMGL-QPDEVTFSALLCTCCHSGL  391

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             + +G+  F  M  EFG++P+T+H+VY+VKL+GMAG++EEA+E + S+  PVD GIWGALL
Sbjct  392   LHEGQEMFMRMKREFGVEPRTKHHVYIVKLMGMAGKVEEAFEFVMSLPRPVDTGIWGALL  451

Query  1597  SCCDIHGNYRLGGIVAKHL--FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIK  1767
             SCC++H + +L  +VA+ +   + +  +S Y VM+SN+YA  G+W+ V+ LR  + E+  
Sbjct  452   SCCEVHEDAQLAEVVAEKIRENEEEERRSVYNVMLSNVYARYGKWDEVEMLRDGVSESFG  511

Query  1768  GKMPGKSWI  1794
             GK+PG SW+
Sbjct  512   GKLPGISWV  520



>gb|EPS68514.1| hypothetical protein M569_06253, partial [Genlisea aurea]
Length=522

 Score =   488 bits (1256),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 263/525 (50%), Positives = 347/525 (66%), Gaps = 14/525 (3%)
 Frame = +1

Query  214   KLLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYAR  390
             ++LH  ++K   LS  PFYAT+++ FYA N+D+ SAR LFDETP+R+I+LWN IIRAYAR
Sbjct  1     RILHGFVIKAPRLSRDPFYATKLVGFYAANDDLRSARNLFDETPRRTIYLWNYIIRAYAR  60

Query  391   AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                F  AF  F  +L S   PD+ TFAC+ RAC+D  +   LR++H   VVSG   DSI 
Sbjct  61    GRHFLEAFLHFNRLLRSDISPDSHTFACVARACADNSEADHLRILHCKAVVSGFGSDSIS  120

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
              S  V  YSKLG L+EA ++F GI EPDLV WN+MISG+G   D +  + LF +MQ  G 
Sbjct  121   GSSFVRCYSKLGSLDEARRLFRGIGEPDLVLWNAMISGYGLWRDVRNGIELFCEMQYKGM  180

Query  751   KPDSFTYVGLIMCL-DCPSLLRIGKNVHSLCLKFGFDS-NAHVGSLLVSMYSRCKCMGSA  924
             KPD  T VGL++ L +  S   + + +H   LK    S N+HVGS LVS YS+ + + SA
Sbjct  181   KPDGHTLVGLMLSLSEDKSFTGLLETIHGYSLKCCLVSKNSHVGSSLVSAYSKLENLESA  240

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG--KVDPLLIASVLSAAA  1098
                F  L++PD+V+WSA+I G S SG+ ++AL   REM M  G  K DP+L+A+ LSA+A
Sbjct  241   FMAFGDLVDPDVVSWSAIIAGFSDSGEHLEALKLLREMLMMEGRRKPDPILLATGLSASA  300

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             +++I  PG E HG+AVR G    V+VSSAL+DMY+KCGFLN   +VF  MP KN +SYN 
Sbjct  301   RISIPGPGAEIHGYAVRHGCDAVVAVSSALVDMYAKCGFLNTATRVFDLMPVKNAVSYNI  360

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MIS+LGL+G A  + ++  E++E   + PD   FS +L ACCH+GLV +GR Y R+M  +
Sbjct  361   MISSLGLYGRAESSIRLLNEMIEGG-FPPDGTAFSGILSACCHSGLVSEGREYLRMMTRD  419

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVD-FGIWGALLSCCDIHGNYRLGG  1635
             FGI+P TEH+VYMVKLLGM G  EEAY +I S+   V    +WGALL+CCD      L  
Sbjct  420   FGIKPNTEHHVYMVKLLGMNGGWEEAYGMIASLPEEVQKSSLWGALLTCCD--AGCSLAE  477

Query  1636  IVAKHLFDNKVEK-----SSYGVMVSNMYAGDGRWECVKKLRVDM  1755
              V K L +++ +K     S Y VMVSN YAG GRWE V +LR++M
Sbjct  478   EVEKRLSEDESKKNGGDSSGYRVMVSNAYAGGGRWEDVGELRLEM  522


 Score =   133 bits (334),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 179/429 (42%), Gaps = 44/429 (10%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N      ++LH   + +         +  +R Y+    +  ARRLF    +  + LWN++
Sbjct  96    NSEADHLRILHCKAVVSGFGSDSISGSSFVRCYSKLGSLDEARRLFRGIGEPDLVLWNAM  155

Query  373   IRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG-LRVVHGGVVVSG  549
             I  Y       N  +LF +M   G +PD  T   ++ + S+   F+G L  +HG  +   
Sbjct  156   ISGYGLWRDVRNGIELFCEMQYKGMKPDGHTLVGLMLSLSEDKSFTGLLETIHGYSLKCC  215

Query  550   L-ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             L   +S   S LVSAYSKL  LE A   F  + +PD+V W+++I+G    G+  +AL L 
Sbjct  216   LVSKNSHVGSSLVSAYSKLENLESAFMAFGDLVDPDVVSWSAIIAGFSDSGEHLEALKLL  275

Query  727   IKMQRMG--EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
              +M  M    KPD       +      S+   G  +H   ++ G D+   V S LV MY+
Sbjct  276   REMLMMEGRRKPDPILLATGLSASARISIPGPGAEIHGYAVRHGCDAVVAVSSALVDMYA  335

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             +C  + +A R+FD +   + V+++ MI  L   G    ++    EM   G   D    + 
Sbjct  336   KCGFLNTATRVFDLMPVKNAVSYNIMISSLGLYGRAESSIRLLNEMIEGGFPPDGTAFSG  395

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             +LSA     +V  GRE                            +L +  + F   P+  
Sbjct  396   ILSACCHSGLVSEGRE----------------------------YLRMMTRDFGIKPNTE  427

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL---LCACCHTGLVCDGR  1431
                Y  M+  LG++G   EA+ +   +       P+E   S+L   L  CC  G      
Sbjct  428   HHVY--MVKLLGMNGGWEEAYGMIASL-------PEEVQKSSLWGALLTCCDAGCSLAEE  478

Query  1432  RYFRIMNDE  1458
                R+  DE
Sbjct  479   VEKRLSEDE  487



>ref|XP_004968903.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Setaria italica]
Length=563

 Score =   462 bits (1188),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 249/543 (46%), Positives = 342/543 (63%), Gaps = 10/543 (2%)
 Frame = +1

Query  199   TISTTKLLHA--IILKTHLSHHPF-YATRIIRFYALNEDIVSARRLFDETPQ-RSIFLWN  366
             +I  TK  HA  I+     +H P      ++R YA   D+ SARRL DE P+  S  L N
Sbjct  23    SIPHTKQFHARLILAPPSAAHGPADLRLLLLRSYAARGDLASARRLLDEAPRPASPLLHN  82

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             ++IRA+AR      A  LF  M  S T PD  TFAC+LRAC+D      ++VVHG     
Sbjct  83    ALIRAHARRLDLPAALALFSRMRRSATPPDAHTFACVLRACADCLRPGAVKVVHGVASSR  142

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G+ L  I  S LVSAY+KLG +++A +VFDG+ EPDLV WNSMISG+G  G W   L +F
Sbjct  143   GMCLHPIVGSALVSAYAKLGLVDDARRVFDGLREPDLVLWNSMISGYGYRGMWHDGLQMF  202

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
               M+R GE+PD ++ VGL+ CL  P +L  G+ VH +C+K G+DS  HV S LVSMY RC
Sbjct  203   SAMRRAGEQPDGYSMVGLVSCLWNPEVLVFGQAVHGVCVKGGYDSGHHVRSALVSMYMRC  262

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
              CM S   +F +  + D+VTWS++I GL Q+G  M++ D FR+M   G + D +LI+SVL
Sbjct  263   GCMESGQSLFHNFPDADLVTWSSLITGLLQTGKYMESFDLFRQMCFTGRRPDSVLISSVL  322

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             SA A    +   RE H + +R G   +V+VSS+L+D Y+KCGF  LG  VF  +P+KN +
Sbjct  323   SACASTTAINHTREVHCYVLRLGADKDVTVSSSLMDAYAKCGFAELGYWVFCQIPNKNSV  382

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
              YN++ISNLG HG A +A ++ +E++  +   PD ATFSALL ACCH G + +G + FR 
Sbjct  383   IYNTVISNLGTHGFATKAIEVLDEMV-NDGLRPDSATFSALLAACCHVGNLEEGWKLFRR  441

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M DEF I  + EHYVYMV+LL   G+L+EAY+LIQ++Q   D G+WGALL  C +H +  
Sbjct  442   MRDEFQIVIEMEHYVYMVRLLATFGQLKEAYDLIQTMQIQPDCGVWGALLWGCCVHCDSN  501

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM---EAIKGKMPGKSWIS  1797
             LG IVA+ LF    +K++Y VM+SN+Y     W   +++R ++   E  K +  G SW+ 
Sbjct  502   LGRIVAEKLFQFNPDKAAYRVMLSNLYTSQEMWWDAEEVREELSKEEMYKNR--GISWVG  559

Query  1798  NIK  1806
              +K
Sbjct  560   KVK  562



>ref|XP_002455765.1| hypothetical protein SORBIDRAFT_03g024530 [Sorghum bicolor]
 gb|EES00885.1| hypothetical protein SORBIDRAFT_03g024530 [Sorghum bicolor]
Length=529

 Score =   453 bits (1166),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/512 (46%), Positives = 324/512 (63%), Gaps = 3/512 (1%)
 Frame = +1

Query  277   IIRFYALNEDIVSARRLFDETPQR-SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRP  453
             ++R YA   D  SARRL DE P   S  L+N++IRA+AR      A  LF  M  S T P
Sbjct  18    VLRSYAARGDFSSARRLLDEAPHPVSPLLYNALIRAHARRLDLPAALALFARMRRSATPP  77

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF  633
             D  TFAC+LRAC++      ++VVHG     G+    I  S LVS Y+K+G ++ A  VF
Sbjct  78    DAHTFACVLRACAESSRPDAVKVVHGIATSCGMCSRPIVLSALVSGYAKVGLVDNARSVF  137

Query  634   DGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLR  813
             DG+ EPDLV WNSM+S +G  G W   L +F  M+R GE+PD ++ VGLI C   P +L 
Sbjct  138   DGLCEPDLVLWNSMMSAYGYQGMWYDGLQMFSLMRRAGEQPDGYSMVGLISCFWNPEILA  197

Query  814   IGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLS  993
              G+ VH +C+K G+DS  HV S LVSMY RC CM S   +F SL + D++TWS++I GL 
Sbjct  198   FGQAVHGMCVKGGYDSGHHVRSTLVSMYMRCGCMESGQSLFGSLPDADLITWSSLITGLM  257

Query  994   QSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS  1173
             Q+G   ++ D FR++   G + D +LIASVLS  A  A V   RE H +A+R G  +++ 
Sbjct  258   QTGKYEESFDLFRKLCFTGRRPDSILIASVLSVCASTASVSCTREVHCYALRLGADMDIR  317

Query  1174  VSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKE  1353
             VSS+L+D Y+KCGF  LG  VF  +P KN + YN++ISNLG HG A +A ++ +E++  +
Sbjct  318   VSSSLMDAYAKCGFTELGYLVFHQLPDKNSVMYNTVISNLGSHGFATKAIEVLDEMVNDK  377

Query  1354  YYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEE  1533
                PD ATFSALL ACCH G + +G + FR M DEF I  + EHYVYMV+LL   G+L+E
Sbjct  378   -LRPDSATFSALLAACCHVGHLEEGWKLFRRMRDEFKIVVEVEHYVYMVRLLATFGQLKE  436

Query  1534  AYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAG  1713
             AY+LIQ++Q   D G+WGALL  C +H +  LG IVA+ LF+   EK++Y VM+SN+YA 
Sbjct  437   AYDLIQTMQIQPDCGVWGALLWGCCVHRDSSLGRIVAEKLFELNSEKAAYRVMLSNLYAS  496

Query  1714  DGRWECVKKLRVDMEAIKG-KMPGKSWISNIK  1806
                W   +++R ++      K  G SW+  +K
Sbjct  497   QEMWWDAEEVRDELSKENMYKNTGMSWVGKVK  528


 Score =   116 bits (290),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 90/404 (22%), Positives = 166/404 (41%), Gaps = 44/404 (11%)
 Frame = +1

Query  208   TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYA  387
               K++H I     +   P   + ++  YA    + +AR +FD   +  + LWNS++ AY 
Sbjct  97    AVKVVHGIATSCGMCSRPIVLSALVSGYAKVGLVDNARSVFDGLCEPDLVLWNSMMSAYG  156

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
                 + +  Q+F  M  +G +PD ++   ++    +    +  + VHG  V  G +    
Sbjct  157   YQGMWYDGLQMFSLMRRAGEQPDGYSMVGLISCFWNPEILAFGQAVHGMCVKGGYDSGHH  216

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
               S LVS Y + G +E    +F  + + DL+ W+S+I+G    G ++++  LF K+   G
Sbjct  217   VRSTLVSMYMRCGCMESGQSLFGSLPDADLITWSSLITGLMQTGKYEESFDLFRKLCFTG  276

Query  748   EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
              +PDS     ++      + +   + VH   L+ G D +  V S L+  Y++C       
Sbjct  277   RRPDSILIASVLSVCASTASVSCTREVHCYALRLGADMDIRVSSSLMDAYAKCGFTELGY  336

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLA  1107
              +F  L + + V ++ +I  L   G   KA++   EM     + D    +++L+A   + 
Sbjct  337   LVFHQLPDKNSVMYNTVISNLGSHGFATKAIEVLDEMVNDKLRPDSATFSALLAACCHV-  395

Query  1108  IVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-----NIISY  1272
                                               G L  G ++F+ M  +      +  Y
Sbjct  396   ----------------------------------GHLEEGWKLFRRMRDEFKIVVEVEHY  421

Query  1273  NSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
               M+  L   G   EA+ + + +       PD   + ALL  CC
Sbjct  422   VYMVRLLATFGQLKEAYDLIQTM----QIQPDCGVWGALLWGCC  461



>tpg|DAA59060.1| TPA: selenium-binding protein-like protein [Zea mays]
Length=560

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 239/541 (44%), Positives = 337/541 (62%), Gaps = 6/541 (1%)
 Frame = +1

Query  199   TISTTKLLHA--IILKTHLSHHPFYATRII-RFYALNEDIVSARRLFDETPQ-RSIFLWN  366
             + S TK LHA  I+     +  P Y   ++ R YA   D+ SARRL DE P+  S  L+N
Sbjct  20    SFSQTKQLHARLIVASPFSASGPAYLRLLVLRSYAARGDLSSARRLLDEAPRPASPLLYN  79

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             ++IRA+AR      A  LF  M  S T PD  TFAC+LRAC++      ++VVHG     
Sbjct  80    ALIRAHARRLDLPAALALFARMRRSATPPDAHTFACVLRACAESSRPDAVKVVHGIATTC  139

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G+    I  S LVSAY+KLG ++ A  +FDG+ EPDLV WNSM+S +G  G W   L +F
Sbjct  140   GMCSRPIVLSSLVSAYAKLGLVDNARSLFDGLCEPDLVIWNSMMSAYGYQGMWYDGLQMF  199

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
               M+R G+ PD ++ V L+ C   P +L  G+ VH +C+K G+DS  HV S LVSMY R 
Sbjct  200   SLMRRAGQHPDGYSMVSLVSCFWNPEILAFGQAVHGICVKGGYDSGHHVRSTLVSMYMRF  259

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
              C+ S  R+F SL + D++TWS++I GL Q+G   ++ D FR+M   G + D +LIASVL
Sbjct  260   GCVESGQRLFGSLSDVDLITWSSLITGLIQTGKYEESFDLFRKMCFTGRRPDSILIASVL  319

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             S  A  A +   +E H +AV+ G  +++ VSS+L+D Y+KCGF  LG  VF+ +P+KN +
Sbjct  320   SVFASTAAISYTKEVHCYAVKLGADIDIRVSSSLMDAYAKCGFTELGYWVFRQVPNKNSV  379

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
              YN++ISNLG HG A +A ++ +E++  +   PD ATFS+LL ACCH G + +G + FR 
Sbjct  380   MYNTVISNLGSHGFATKAIEVLDEMVNDK-LRPDSATFSSLLAACCHVGHLEEGWKLFRR  438

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M DEF I  + EHYVYMV+LL   G+L+EAY+LIQ++Q   D G+WGALL  C +H +  
Sbjct  439   MRDEFKIVVEMEHYVYMVRLLATFGQLKEAYDLIQTMQIQPDCGVWGALLWGCCVHRDSS  498

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG-KMPGKSWISNI  1803
              G IVA+ L +   +K++Y VM+SNMYA    W   +++R ++      K  G SW+  +
Sbjct  499   FGRIVAEKLCELNSDKAAYRVMLSNMYASQEMWWDAEEVRDELSKENMYKNTGTSWVGEV  558

Query  1804  K  1806
             K
Sbjct  559   K  559



>ref|NP_001150921.1| selenium-binding protein-like [Zea mays]
 gb|ACG40954.1| selenium-binding protein-like [Zea mays]
Length=560

 Score =   442 bits (1138),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 334/537 (62%), Gaps = 6/537 (1%)
 Frame = +1

Query  211   TKLLHA--IILKTHLSHHPFYATRII-RFYALNEDIVSARRLFDETPQ-RSIFLWNSIIR  378
             TK LHA  I+     +  P Y   ++ R YA   D+ SARRL DE P+  S  L+N++IR
Sbjct  24    TKQLHARLIVASPSSASGPAYLRLLVLRSYAARGDLSSARRLLDEAPRPASPLLYNALIR  83

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
             A+AR         LF  M  S T PD  TFAC+LRAC++      ++VVHG     G+  
Sbjct  84    AHARRLDLPAGLALFARMRCSATPPDAHTFACVLRACAESSRPDAVKVVHGIATTCGMCS  143

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
               I  S LVSAY+KLG ++ A  +FDG+ EPDLV WNSM+S +G  G W   L +F  M+
Sbjct  144   RPIVLSSLVSAYAKLGLVDNARSLFDGLCEPDLVIWNSMMSAYGYQGMWYDGLQMFSLMR  203

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             R G+ PD ++ V L+ C   P +L  G+ VH +C+K G+DS  HV S LVSMY RC C+ 
Sbjct  204   RAGQHPDGYSMVSLVSCFWNPEILAFGQAVHGICVKGGYDSGHHVRSTLVSMYMRCGCVE  263

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             S  R+F SL + D++TWS++I GL Q+G   ++ D FR+M   G + D +LIASVLS  A
Sbjct  264   SGQRLFGSLPDVDLITWSSLITGLIQTGKYEESFDLFRKMCFTGRRPDSILIASVLSVFA  323

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
               A +   +E H +AV+ G  +++ VSS+L+D Y+KCGF  LG  VF+ +P+KN + YN+
Sbjct  324   STAAISYTKEVHCYAVKLGADIDIRVSSSLMDAYAKCGFTELGYWVFRQVPNKNSVMYNT  383

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             +ISNL  HG A +A ++ +E++  +   PD ATFS+LL ACCH G + +G + FR M DE
Sbjct  384   VISNLESHGFATKAIEVLDEMVNDK-LRPDSATFSSLLAACCHVGHLEEGWKLFRRMRDE  442

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
             F I  + EHYVYMV+LL   G+L+EAY+LIQ++Q   D G+WGALL  C +H +   G I
Sbjct  443   FKIVVEMEHYVYMVRLLATFGQLKEAYDLIQTMQIQPDCGVWGALLWGCCVHRDSSFGRI  502

Query  1639  VAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG-KMPGKSWISNIK  1806
             VA+ L +   +K++Y VM+SNMYA    W   +++R ++      K  G SW+  +K
Sbjct  503   VAEKLCELNSDKAAYRVMLSNMYASQEMWWDAEEVRDELSKENMYKNTGTSWVGEVK  559



>ref|XP_003569172.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 isoform X1 [Brachypodium distachyon]
Length=555

 Score =   438 bits (1127),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 239/540 (44%), Positives = 333/540 (62%), Gaps = 11/540 (2%)
 Frame = +1

Query  205   STTKLLHAIILKTHLSHHPFYATRI----IRFYALNEDIVSARRLFDETPQR-SIFLWNS  369
             S TK +HA +L       PF    +    +R YA   D  SA  L DETP+  S  L+N+
Sbjct  20    SHTKQIHARLLLVS----PFIPDDVRLFLLRSYAGRGDFASAHCLLDETPRPVSPLLYNA  75

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +IRA+AR      A  LF  M  S T PD  TFAC++RAC+D       ++VHG    SG
Sbjct  76    VIRAHARRLDLPAALALFARMRRSATPPDAHTFACVVRACADCSSPDTAKIVHGVASSSG  135

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             +    +  S LVSAYSK   ++ A  +FDG+ +PDLV WNSM+SG+G    W + L LF 
Sbjct  136   MSSHPVVGSALVSAYSKFLLVDSARHMFDGLPDPDLVLWNSMLSGYGYREMWVEGLQLFS  195

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              M+R GE+PD ++ V L+     P  L  G+ VH +C+K G+DS  HV S LVSMY RC 
Sbjct  196   AMRRAGEEPDGYSMVSLVSSFRNPEALDFGQAVHGVCIKGGYDSGHHVRSALVSMYFRCG  255

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
             CM S   +F +LL+ D+VTWS++I G  Q+G   ++ + FR+M   G + D +LIAS+LS
Sbjct  256   CMESGQTLFGNLLDADLVTWSSLITGQLQTGKYEESFNLFRQMCYSGRRPDSILIASLLS  315

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A  A V   RE H +A+R G   +V VSS+L+D Y+KCGF  LG  VF+ MP+KN + 
Sbjct  316   ACASTATVSCSREIHCYAIRIGADADVKVSSSLMDAYAKCGFAELGYLVFRQMPNKNSVV  375

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             YN +ISNLG HG A +A ++ +E++  + Y PD ATFSALL ACCH GL+ +G + FR M
Sbjct  376   YNMVISNLGSHGFALKAIEVHDEMICDK-YRPDGATFSALLAACCHAGLLDEGWKLFRRM  434

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              DEF I  + EHYVYMV+LL    +L+EAY+LIQ++    D G+WGALL  C  H N  L
Sbjct  435   QDEFHIVVEMEHYVYMVRLLATFNQLKEAYDLIQTMPMAPDCGVWGALLWGCCFHRNSSL  494

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVD-MEAIKGKMPGKSWISNIK  1806
             G +V++ LF+   +K++YG+M+SN+YA    W   +++R + ++    K  G SW+  ++
Sbjct  495   GRVVSEKLFEIYPDKAAYGIMLSNLYASQDMWWDAEEVRSEILKEGMHKNTGISWVGEVR  554



>ref|NP_001043280.1| Os01g0545900 [Oryza sativa Japonica Group]
 dbj|BAD88071.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD88108.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF05194.1| Os01g0545900 [Oryza sativa Japonica Group]
 gb|EAZ12264.1| hypothetical protein OsJ_02152 [Oryza sativa Japonica Group]
Length=569

 Score =   436 bits (1121),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 320/514 (62%), Gaps = 10/514 (2%)
 Frame = +1

Query  289   YALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS------GTR  450
             YA   D+ +A RL DE P  S  L N++IRA+AR      A  LF  M  S       T 
Sbjct  57    YAARGDLATAARLLDEAPPPSPLLHNALIRAHARRLDLRAALALFARMRRSRSSAATATA  116

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             PD  TFAC+LRAC+D       RVV+G VV +G+    +  S LVSAY+KLGP+ +A +V
Sbjct  117   PDAHTFACVLRACADCSRPDVARVVNGIVVCAGMSSHPVVGSALVSAYAKLGPVGDARRV  176

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL  810
             FDG+ EPDLV WN M+SG+G  G W   L LF  M++ GE+PD ++ V L+        L
Sbjct  177   FDGLPEPDLVLWNCMMSGYGYRGMWNDGLDLFSAMRKAGERPDGYSMVSLVSSFWNREAL  236

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
               G+ +H +C+K G+DS  HV S LVSMY RC CM S   +F +LL+ D+VTWS++I GL
Sbjct  237   AFGQAIHGMCIKGGYDSGHHVRSALVSMYFRCGCMDSGHSLFGNLLDADLVTWSSLITGL  296

Query  991   SQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEV  1170
                    ++   FR+M   G + D +L+AS+LSA A +  +   +E H +A R G H ++
Sbjct  297   LHICKYEESFGLFRQMCNSGRRPDSILVASLLSACASMVNISYSKEIHCYAFRVGAHTDI  356

Query  1171  SVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEK  1350
              VSS+L+D YSKCGF +L   VF  MP KN++ YN++ISNLG HG A +A ++ +E++  
Sbjct  357   RVSSSLMDAYSKCGFADLAYGVFFQMPDKNLVMYNTVISNLGSHGFAMKAIEVLDEMVSD  416

Query  1351  EYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELE  1530
             +   PD  TFSALL ACCH GL+ +G + FR M DEF +  KTEHYVY+V+LL   G+L+
Sbjct  417   K-LKPDSVTFSALLAACCHAGLLEEGWKLFRRMRDEFNMAVKTEHYVYIVRLLATFGQLK  475

Query  1531  EAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYA  1710
             EAY LIQ++  P D G+WGALL  C +H +  LG IVA  LF+   +K+SY VM+SN+YA
Sbjct  476   EAYGLIQTMPAPADSGVWGALLWGCCVHRDSSLGRIVADKLFELYPDKASYRVMLSNLYA  535

Query  1711  GDGRWECVKKLRVDM--EAIKGKMPGKSWISNIK  1806
                 W   +++R ++  E +  K  G SW+ N +
Sbjct  536   SQEMWWDAEEVREELWNEDVH-KNTGISWVGNAR  568


 Score =   129 bits (323),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/405 (22%), Positives = 193/405 (48%), Gaps = 21/405 (5%)
 Frame = +1

Query  208   TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYA  387
               ++++ I++   +S HP   + ++  YA    +  ARR+FD  P+  + LWN ++  Y 
Sbjct  137   VARVVNGIVVCAGMSSHPVVGSALVSAYAKLGPVGDARRVFDGLPEPDLVLWNCMMSGYG  196

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
                 +++   LF  M  +G RPD ++   ++ +  ++   +  + +HG  +  G +    
Sbjct  197   YRGMWNDGLDLFSAMRKAGERPDGYSMVSLVSSFWNREALAFGQAIHGMCIKGGYDSGHH  256

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
               S LVS Y + G ++    +F  + + DLV W+S+I+G   +  ++++  LF +M   G
Sbjct  257   VRSALVSMYFRCGCMDSGHSLFGNLLDADLVTWSSLITGLLHICKYEESFGLFRQMCNSG  316

Query  748   EKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              +PDS     L+    C S++ I   K +H    + G  ++  V S L+  YS+C     
Sbjct  317   RRPDSILVASLLSA--CASMVNISYSKEIHCYAFRVGAHTDIRVSSSLMDAYSKCGFADL  374

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F  + + ++V ++ +I  L   G  MKA++   EM     K D +  +++L+A   
Sbjct  375   AYGVFFQMPDKNLVMYNTVISNLGSHGFAMKAIEVLDEMVSDKLKPDSVTFSALLAACCH  434

Query  1102  LAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-  1257
               +++ G       R+    AV+  +++ +      + + +  G L     + + MP+  
Sbjct  435   AGLLEEGWKLFRRMRDEFNMAVKTEHYVYI------VRLLATFGQLKEAYGLIQTMPAPA  488

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + +++    +H +++    + +++ E     PD+A++  +L
Sbjct  489   DSGVWGALLWGCCVHRDSSLGRIVADKLFE---LYPDKASYRVML  530



>ref|XP_002511339.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF51941.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=428

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/374 (59%), Positives = 277/374 (74%), Gaps = 2/374 (1%)
 Frame = +1

Query  430   MLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGP  609
             ML +G +PDN+T AC++RAC + FD  GLRV+HGGV+VSGL +DS+  S LV+AYSK+  
Sbjct  1     MLVTGIKPDNYTHACLIRACHENFDLDGLRVLHGGVIVSGLGIDSVSCSALVTAYSKMNY  60

Query  610   LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM-QRMGEKPDSFTYVGLIM  786
             + EA KVF GI EPD+V WNSMISG+   G W K L LF +M +   ++PD FT VGLI 
Sbjct  61    VREASKVFKGIFEPDMVLWNSMISGYSYCGFWNKGLELFNQMRENRKQQPDGFTLVGLIS  120

Query  787   CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVT  966
              L   SLLRIG+ VH LCLK GF+ NA+VGS LVSMYSR KC+ SA  +F SL +PD+V 
Sbjct  121   GLMDFSLLRIGQGVHGLCLKTGFNCNAYVGSALVSMYSRFKCINSAYNVFSSLCQPDLVA  180

Query  967   WSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAV  1146
             WSA+I G SQSGD  KAL F   +  +G K DP+LIASVL AAA+LA +  G E HG+ +
Sbjct  181   WSALITGYSQSGDYNKALVFCTNLCGEGKKADPVLIASVLVAAARLADLGHGTEIHGYVL  240

Query  1147  RCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQ  1326
             R G+  ++ VSSALIDMY KCG +  GI+VF  + ++NIISYNS+I  LGLHG A +AF+
Sbjct  241   RHGFESDIMVSSALIDMYMKCGLVGWGIRVFDNIRNQNIISYNSVILGLGLHGLAAQAFE  300

Query  1327  IFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKL  1506
             +FEE+LEK    PDE+TFS LLCACCH GLV DG R ++ M DEF I P+TEHYV++VKL
Sbjct  301   LFEEMLEKG-LKPDESTFSTLLCACCHAGLVKDGWRIYKQMMDEFCIPPRTEHYVHIVKL  359

Query  1507  LGMAGELEEAYELI  1548
             LGMAGELE+AY+ I
Sbjct  360   LGMAGELEKAYDFI  373


 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 161/321 (50%), Gaps = 7/321 (2%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             L +    N  +   ++LH  ++ + L       + ++  Y+    +  A ++F    +  
Sbjct  16    LIRACHENFDLDGLRVLHGGVIVSGLGIDSVSCSALVTAYSKMNYVREASKVFKGIFEPD  75

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDS-GTRPDNFTFACILRACSDKFDFSGLRV--  522
             + LWNS+I  Y+    ++   +LF  M ++   +PD FT   ++   S   DFS LR+  
Sbjct  76    MVLWNSMISGYSYCGFWNKGLELFNQMRENRKQQPDGFTLVGLI---SGLMDFSLLRIGQ  132

Query  523   -VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHG  + +G   ++   S LVS YS+   +  A  VF  + +PDLV W+++I+G+   G
Sbjct  133   GVHGLCLKTGFNCNAYVGSALVSMYSRFKCINSAYNVFSSLCQPDLVAWSALITGYSQSG  192

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             D+ KAL+    +   G+K D      +++     + L  G  +H   L+ GF+S+  V S
Sbjct  193   DYNKALVFCTNLCGEGKKADPVLIASVLVAAARLADLGHGTEIHGYVLRHGFESDIMVSS  252

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L+ MY +C  +G   R+FD++   ++++++++I GL   G   +A + F EM  KG K 
Sbjct  253   ALIDMYMKCGLVGWGIRVFDNIRNQNIISYNSVILGLGLHGLAAQAFELFEEMLEKGLKP  312

Query  1060  DPLLIASVLSAAAQLAIVQPG  1122
             D    +++L A     +V+ G
Sbjct  313   DESTFSTLLCACCHAGLVKDG  333



>gb|EMT14463.1| hypothetical protein F775_09791 [Aegilops tauschii]
Length=556

 Score =   431 bits (1109),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/513 (45%), Positives = 323/513 (63%), Gaps = 3/513 (1%)
 Frame = +1

Query  274   RIIRFYALNEDIVSARRLFDETPQ-RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTR  450
             R++R YA + +  SA RL DE P+  S  L+N++IRA++R      A  LF  M  S T 
Sbjct  44    RLLRSYAAHGEFASAHRLLDEAPRPASPLLYNAVIRAHSRRLDLPTALALFASMRRSATP  103

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             PD  TFAC+LRAC+D     G + +HG    SG     I  S LVSAYSK   +E A  V
Sbjct  104   PDAHTFACVLRACADCDRPGGAKTLHGIASTSGWSSHPIVGSALVSAYSKFLLVESARHV  163

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL  810
             FDG+ EPDLV WNSM+SG+G    W + L LF  M+R GE+PD ++ V L+     P  L
Sbjct  164   FDGLREPDLVLWNSMMSGYGYREMWLEGLQLFSAMRRAGEEPDGYSMVSLLSSFWDPEAL  223

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
               G+ VH +C+K G+DS  HV S LVSMY RC C+ S   +F SLL+ D+VT S++I G 
Sbjct  224   AFGQAVHGVCIKGGYDSGHHVRSTLVSMYFRCGCVESGQTLFGSLLDADLVTCSSLITGQ  283

Query  991   SQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEV  1170
              Q+G   ++ D FREM   G + D +LIAS+LSA A  A +   +E H +AVR G   ++
Sbjct  284   LQTGKYDESFDLFREMCYFGRRPDSILIASLLSACASTATISYSKEIHCYAVRVGADKDM  343

Query  1171  SVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEK  1350
              VSS+L+D Y+KCGF  LG  VF+ +P+KN + YN +ISNLG HG A +A ++ +E++ +
Sbjct  344   KVSSSLMDAYAKCGFAELGYLVFRQIPNKNSVMYNMVISNLGSHGFAMKAIEVLDEMV-R  402

Query  1351  EYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELE  1530
             +   PD ATFSALL ACCH GL+ +G + FR M DEF I  + +HYVYMV+LL    +L+
Sbjct  403   DKLRPDGATFSALLAACCHAGLLDEGWKLFRRMGDEFHIVVEMQHYVYMVRLLATFNQLK  462

Query  1531  EAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYA  1710
             EAY+LIQ++  P D G+WGALL  C +H +  LG  VA+ L +   +K+SY +M+SN+YA
Sbjct  463   EAYDLIQTMPMPPDCGVWGALLWGCCLHRDSSLGRAVAEKLCELYPDKASYKIMLSNLYA  522

Query  1711  GDGRWECVKKLRVDM-EAIKGKMPGKSWISNIK  1806
              +  W   +++R +M +    K  G SW+ + +
Sbjct  523   SEEMWWDAEEVRTEMLKEDMHKNTGISWVGDTR  555


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 88/196 (45%), Gaps = 0/196 (0%)
 Frame = +1

Query  196  QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
            + ++  + +H + +K          + ++  Y     + S + LF       +   +S+I
Sbjct  221  EALAFGQAVHGVCIKGGYDSGHHVRSTLVSMYFRCGCVESGQTLFGSLLDADLVTCSSLI  280

Query  376  RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
                +  ++  +F LF++M   G RPD+   A +L AC+     S  + +H   V  G +
Sbjct  281  TGQLQTGKYDESFDLFREMCYFGRRPDSILIASLLSACASTATISYSKEIHCYAVRVGAD  340

Query  556  LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             D   SS L+ AY+K G  E    VF  I   + V +N +IS  G  G   KA+ +  +M
Sbjct  341  KDMKVSSSLMDAYAKCGFAELGYLVFRQIPNKNSVMYNMVISNLGSHGFAMKAIEVLDEM  400

Query  736  QRMGEKPDSFTYVGLI  783
             R   +PD  T+  L+
Sbjct  401  VRDKLRPDGATFSALL  416



>emb|CDM80099.1| unnamed protein product [Triticum aestivum]
Length=555

 Score =   428 bits (1100),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 323/512 (63%), Gaps = 3/512 (1%)
 Frame = +1

Query  277   IIRFYALNEDIVSARRLFDETPQ-RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRP  453
             ++R YA + +  SA RL +E P+  S  L+N++IRA++R      A   F  M  S T P
Sbjct  44    LLRSYAAHGEFASAHRLLEEAPRPASPLLYNAVIRAHSRRLDLPTALAFFASMRRSATPP  103

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF  633
             D  TFAC+LRAC+D    +  +++HG  + SG     I  S LVSAYSK   ++ A +VF
Sbjct  104   DAHTFACVLRACADCDRPAAAKILHGLALSSGWSSHPIVGSALVSAYSKFLFVDSARRVF  163

Query  634   DGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLR  813
             DG+ EPDLV WNSM+SG+G    W + + LF  M+R GE+PD ++ V L+     P  L 
Sbjct  164   DGLREPDLVLWNSMMSGYGYREMWLEGIQLFSAMRRAGEEPDGYSMVSLLSSFWDPEALA  223

Query  814   IGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLS  993
              G+ VH +C+K G+DS  HV S LVSMY RC C+ S   +F SLL+ D+VT S++I G  
Sbjct  224   FGQAVHGVCIKGGYDSGHHVRSTLVSMYFRCGCVESGQTLFGSLLDADLVTCSSLITGQL  283

Query  994   QSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS  1173
             Q+G   ++ D FREM   G + D +LIAS+LSA A  A +   +E H +AVR G   ++ 
Sbjct  284   QTGKYDESFDLFREMCYFGRRPDSILIASLLSACASTATISYSKEIHCYAVRVGADKDIK  343

Query  1174  VSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKE  1353
             VSS+L+D Y+KCGF  LG  VF+ +P KN + YN +ISNLG HG A +A ++ +E++ ++
Sbjct  344   VSSSLMDAYAKCGFAELGYLVFRQIPKKNSVMYNMVISNLGSHGFAMKAIEVHDEMV-RD  402

Query  1354  YYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEE  1533
                PD ATFSALL ACCH GL+ DG + FR M DEF I  + +HYVYMV+LL    +L+E
Sbjct  403   KLRPDGATFSALLAACCHAGLLDDGWKLFRRMRDEFHIVVQMQHYVYMVRLLATFNQLKE  462

Query  1534  AYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAG  1713
             AY+LIQ++  P D G+WGALL  C +H +  LG  VA+ L +   +K+SY +M+SN+YA 
Sbjct  463   AYDLIQTMPMPPDCGVWGALLWGCCLHRDSSLGRAVAEKLCELYPDKASYKIMLSNLYAS  522

Query  1714  DGRWECVKKLRVDM-EAIKGKMPGKSWISNIK  1806
             +  W   +++R +M +    K  G SW+ + +
Sbjct  523   EEMWWDAEEVRTEMLKEYMNKNTGISWVGDTR  554


 Score =   125 bits (314),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 92/399 (23%), Positives = 181/399 (45%), Gaps = 7/399 (2%)
 Frame = +1

Query  205   STTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAY  384
             +  K+LH + L +  S HP   + ++  Y+    + SARR+FD   +  + LWNS++  Y
Sbjct  122   AAAKILHGLALSSGWSSHPIVGSALVSAYSKFLFVDSARRVFDGLREPDLVLWNSMMSGY  181

Query  385   ARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDS  564
                  +    QLF  M  +G  PD ++   +L +  D    +  + VHG  +  G +   
Sbjct  182   GYREMWLEGIQLFSAMRRAGEEPDGYSMVSLLSSFWDPEALAFGQAVHGVCIKGGYDSGH  241

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
                S LVS Y + G +E    +F  + + DLV  +S+I+G    G + ++  LF +M   
Sbjct  242   HVRSTLVSMYFRCGCVESGQTLFGSLLDADLVTCSSLITGQLQTGKYDESFDLFREMCYF  301

Query  745   GEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSA  924
             G +PDS     L+      + +   K +H   ++ G D +  V S L+  Y++C      
Sbjct  302   GRRPDSILIASLLSACASTATISYSKEIHCYAVRVGADKDIKVSSSLMDAYAKCGFAELG  361

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQL  1104
               +F  + + + V ++ +I  L   G  MKA++   EM     + D    +++L+A    
Sbjct  362   YLVFRQIPKKNSVMYNMVISNLGSHGFAMKAIEVHDEMVRDKLRPDGATFSALLAACCHA  421

Query  1105  AIVQPGRETHGFAVRCGYHLEVSVSS--ALIDMYSKCGFLNLGIQVFKAMP-SKNIISYN  1275
              ++  G +     +R  +H+ V +     ++ + +    L     + + MP   +   + 
Sbjct  422   GLLDDGWKLFR-RMRDEFHIVVQMQHYVYMVRLLATFNQLKEAYDLIQTMPMPPDCGVWG  480

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +++    LH +++    + E++ E     PD+A++  +L
Sbjct  481   ALLWGCCLHRDSSLGRAVAEKLCE---LYPDKASYKIML  516


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 89/196 (45%), Gaps = 0/196 (0%)
 Frame = +1

Query  196  QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
            + ++  + +H + +K          + ++  Y     + S + LF       +   +S+I
Sbjct  220  EALAFGQAVHGVCIKGGYDSGHHVRSTLVSMYFRCGCVESGQTLFGSLLDADLVTCSSLI  279

Query  376  RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
                +  ++  +F LF++M   G RPD+   A +L AC+     S  + +H   V  G +
Sbjct  280  TGQLQTGKYDESFDLFREMCYFGRRPDSILIASLLSACASTATISYSKEIHCYAVRVGAD  339

Query  556  LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             D   SS L+ AY+K G  E    VF  I + + V +N +IS  G  G   KA+ +  +M
Sbjct  340  KDIKVSSSLMDAYAKCGFAELGYLVFRQIPKKNSVMYNMVISNLGSHGFAMKAIEVHDEM  399

Query  736  QRMGEKPDSFTYVGLI  783
             R   +PD  T+  L+
Sbjct  400  VRDKLRPDGATFSALL  415



>gb|EMS61193.1| hypothetical protein TRIUR3_15047 [Triticum urartu]
Length=556

 Score =   422 bits (1085),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 227/513 (44%), Positives = 320/513 (62%), Gaps = 3/513 (1%)
 Frame = +1

Query  274   RIIRFYALNEDIVSARRLFDETPQ-RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTR  450
             R++R YA + +  SA RL DE P+  S  L+N++IRA++R      A   F  M  S T 
Sbjct  44    RLLRSYAAHGEFASAHRLLDEAPRPASPLLYNAVIRAHSRRLDLPTALAFFASMRRSATS  103

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             PD  TFAC+LRAC+D    +  +V+HG    SG     I  S LVSAYSK   ++ A  V
Sbjct  104   PDAHTFACVLRACADCDRPAAAKVLHGIASSSGWSSHPIVGSALVSAYSKFLLVDSARHV  163

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL  810
             FDG+ EPDLV WNSM+SG+G    W + L LF  M+R GE+PD ++ V L+     P  L
Sbjct  164   FDGLREPDLVLWNSMMSGYGYREMWLEGLQLFSAMRRAGEEPDGYSMVSLLSSFWDPEAL  223

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
               G+ VH +C+K G+DS  HV S LV+MY RC C+ S   +F SLL+ D+VT S++I G 
Sbjct  224   AFGQAVHGVCIKGGYDSGHHVRSTLVTMYFRCGCVESGQTLFGSLLDVDLVTCSSLITGQ  283

Query  991   SQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEV  1170
              Q+G   ++ D FREM   G + D +LIAS+LSA A  A +   +E H +AVR G   ++
Sbjct  284   LQTGKYDESFDLFREMCYSGRRPDGILIASLLSACASTATISYSKEIHCYAVRVGADKDI  343

Query  1171  SVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEK  1350
              VSS+L+D Y+KCGF  LG  VF+ +  KN + YN +ISNLG HG   +A ++ +E++ +
Sbjct  344   KVSSSLMDAYAKCGFAELGYLVFRQIRKKNSVMYNMVISNLGSHGFVMKAIEVHDEMV-R  402

Query  1351  EYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELE  1530
             +   PD ATFSALL ACCH GL+ +G + FR M DEF I  + +HYVYMV+LL    +L+
Sbjct  403   DKLRPDGATFSALLAACCHAGLLDEGWKLFRRMRDEFHIVVEMQHYVYMVRLLATYNQLK  462

Query  1531  EAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYA  1710
             EAY+LIQ++  P D G+WGALL  C +H +  LG  VA+ L +   +K+SY +M+SN+YA
Sbjct  463   EAYDLIQTMPMPPDCGVWGALLWGCCLHRDSSLGRAVAEKLCELYPDKASYKIMLSNLYA  522

Query  1711  GDGRWECVKKLRVDM-EAIKGKMPGKSWISNIK  1806
              +  W   +++R +M +    K  G SW+ + +
Sbjct  523   SEEMWWDAEEVRTEMLKEDMHKNTGISWVGDTR  555


 Score =   119 bits (299),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 89/399 (22%), Positives = 179/399 (45%), Gaps = 7/399 (2%)
 Frame = +1

Query  205   STTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAY  384
             +  K+LH I   +  S HP   + ++  Y+    + SAR +FD   +  + LWNS++  Y
Sbjct  123   AAAKVLHGIASSSGWSSHPIVGSALVSAYSKFLLVDSARHVFDGLREPDLVLWNSMMSGY  182

Query  385   ARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDS  564
                  +    QLF  M  +G  PD ++   +L +  D    +  + VHG  +  G +   
Sbjct  183   GYREMWLEGLQLFSAMRRAGEEPDGYSMVSLLSSFWDPEALAFGQAVHGVCIKGGYDSGH  242

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
                S LV+ Y + G +E    +F  + + DLV  +S+I+G    G + ++  LF +M   
Sbjct  243   HVRSTLVTMYFRCGCVESGQTLFGSLLDVDLVTCSSLITGQLQTGKYDESFDLFREMCYS  302

Query  745   GEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSA  924
             G +PD      L+      + +   K +H   ++ G D +  V S L+  Y++C      
Sbjct  303   GRRPDGILIASLLSACASTATISYSKEIHCYAVRVGADKDIKVSSSLMDAYAKCGFAELG  362

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQL  1104
               +F  + + + V ++ +I  L   G +MKA++   EM     + D    +++L+A    
Sbjct  363   YLVFRQIRKKNSVMYNMVISNLGSHGFVMKAIEVHDEMVRDKLRPDGATFSALLAACCHA  422

Query  1105  AIVQPGRETHGFAVRCGYHLEVSVSS--ALIDMYSKCGFLNLGIQVFKAMP-SKNIISYN  1275
              ++  G +     +R  +H+ V +     ++ + +    L     + + MP   +   + 
Sbjct  423   GLLDEGWKLFR-RMRDEFHIVVEMQHYVYMVRLLATYNQLKEAYDLIQTMPMPPDCGVWG  481

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +++    LH +++    + E++ E     PD+A++  +L
Sbjct  482   ALLWGCCLHRDSSLGRAVAEKLCE---LYPDKASYKIML  517



>ref|XP_006645980.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310-like [Oryza brachyantha]
Length=522

 Score =   412 bits (1059),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 218/463 (47%), Positives = 291/463 (63%), Gaps = 1/463 (0%)
 Frame = +1

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             +++RA+AR      A  LF  M  S T PD  TFAC+LRAC D       R  H  VV S
Sbjct  35    ALLRAHARRLDLRAALALFACMRRSATAPDAHTFACVLRACVDCSRPDAARAAHAIVVCS  94

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
              +    +  S LVSAY+KLGPL +  +VFDG+ EPDLV WNSM+S +G  G W   L LF
Sbjct  95    AMSSHPVVGSALVSAYAKLGPLADVRRVFDGLPEPDLVLWNSMMSAYGYRGMWYDGLDLF  154

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
               M+R GE+PD ++ V L+        L  G  VH +C+K G+D+  HV S LVSMY RC
Sbjct  155   SAMRRAGEQPDGYSMVSLVSSFWNHEALAFGHAVHGVCIKGGYDAGHHVRSALVSMYFRC  214

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
              CM S   +FD+LL+ D+VTWS++I GL + G    + D F+ M   G + D +L+AS+L
Sbjct  215   GCMDSGHTLFDNLLDADLVTWSSLITGLLRIGMYGDSFDLFQRMCHSGRRPDNILLASLL  274

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             SA A    +   +E H FAVR G HL++ VSS+LID Y+KCGF +L   VF  MPSKN++
Sbjct  275   SACASTVNINHSKEIHCFAVRLGAHLDIKVSSSLIDAYAKCGFPDLAYGVFFQMPSKNLV  334

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
              YN++ISNLG HG A +A +I +E++  +   PD ATFSALL ACCH GL+ +G + F  
Sbjct  335   MYNTVISNLGSHGFAVKAIEILDEMIS-DNLRPDSATFSALLAACCHAGLLDEGWKLFSR  393

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M DEF I  K EHYVY+V+LL   G+L  AY+LIQ++    D G+WGALL  C +H +  
Sbjct  394   MRDEFNILVKIEHYVYIVRLLATFGQLRAAYDLIQTMPVQPDSGVWGALLWGCCVHRDSS  453

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM  1755
             LG IVA+ L +   +K+SY VM+SN+YA    W  V+ +R D+
Sbjct  454   LGRIVAERLSELCPDKASYRVMLSNLYASQEMWWDVEDVRADL  496


 Score =   124 bits (312),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 90/405 (22%), Positives = 185/405 (46%), Gaps = 21/405 (5%)
 Frame = +1

Query  208   TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYA  387
               +  HAI++ + +S HP   + ++  YA    +   RR+FD  P+  + LWNS++ AY 
Sbjct  83    AARAAHAIVVCSAMSSHPVVGSALVSAYAKLGPLADVRRVFDGLPEPDLVLWNSMMSAYG  142

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
                 + +   LF  M  +G +PD ++   ++ +  +    +    VHG  +  G +    
Sbjct  143   YRGMWYDGLDLFSAMRRAGEQPDGYSMVSLVSSFWNHEALAFGHAVHGVCIKGGYDAGHH  202

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
               S LVS Y + G ++    +FD + + DLV W+S+I+G   +G +  +  LF +M   G
Sbjct  203   VRSALVSMYFRCGCMDSGHTLFDNLLDADLVTWSSLITGLLRIGMYGDSFDLFQRMCHSG  262

Query  748   EKPDSFTYVGLIMCLDCPSLLRIG--KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              +PD+     L+    C S + I   K +H   ++ G   +  V S L+  Y++C     
Sbjct  263   RRPDNILLASLLSA--CASTVNINHSKEIHCFAVRLGAHLDIKVSSSLIDAYAKCGFPDL  320

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F  +   ++V ++ +I  L   G  +KA++   EM     + D    +++L+A   
Sbjct  321   AYGVFFQMPSKNLVMYNTVISNLGSHGFAVKAIEILDEMISDNLRPDSATFSALLAACCH  380

Query  1102  LAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-  1257
               ++  G       R+     V+  +++ +      + + +  G L     + + MP + 
Sbjct  381   AGLLDEGWKLFSRMRDEFNILVKIEHYVYI------VRLLATFGQLRAAYDLIQTMPVQP  434

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + +++    +H +++    + E + E     PD+A++  +L
Sbjct  435   DSGVWGALLWGCCVHRDSSLGRIVAERLSE---LCPDKASYRVML  476


 Score =   116 bits (290),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 125/253 (49%), Gaps = 3/253 (1%)
 Frame = +1

Query  655   LVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVH  831
             LV   +++  H    D + AL LF  M+R    PD+ T+  ++  C+DC S     +  H
Sbjct  30    LVSSVALLRAHARRLDLRAALALFACMRRSATAPDAHTFACVLRACVDC-SRPDAARAAH  88

Query  832   SLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIM  1011
             ++ +     S+  VGS LVS Y++   +    R+FD L EPD+V W++M+      G   
Sbjct  89    AIVVCSAMSSHPVVGSALVSAYAKLGPLADVRRVFDGLPEPDLVLWNSMMSAYGYRGMWY  148

Query  1012  KALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALI  1191
               LD F  M   G + D   + S++S+      +  G   HG  ++ GY     V SAL+
Sbjct  149   DGLDLFSAMRRAGEQPDGYSMVSLVSSFWNHEALAFGHAVHGVCIKGGYDAGHHVRSALV  208

Query  1192  DMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDE  1371
              MY +CG ++ G  +F  +   ++++++S+I+ L   G   ++F +F+ +       PD 
Sbjct  209   SMYFRCGCMDSGHTLFDNLLDADLVTWSSLITGLLRIGMYGDSFDLFQRMCHSG-RRPDN  267

Query  1372  ATFSALLCACCHT  1410
                ++LL AC  T
Sbjct  268   ILLASLLSACAST  280



>ref|XP_010041330.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 [Eucalyptus grandis]
Length=403

 Score =   404 bits (1038),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/372 (55%), Positives = 266/372 (72%), Gaps = 2/372 (1%)
 Frame = +1

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS  861
             G+G L  W K L LF +M+ +G  PD +T VGLI  L   S + +G+++H LC+K   DS
Sbjct  19    GYGHLCAWDKGLKLFCEMRSLGRLPDGYTLVGLISGLADMSFIGVGQSIHGLCMKSCLDS  78

Query  862   NAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMN  1041
             +A+VG+ LVSMY+RC+CM SAC++F  L +PD+V WSA++ G  Q GD  KAL  FR++ 
Sbjct  79    DAYVGAALVSMYARCRCMDSACKVFGGLSQPDLVAWSALVMGYCQCGDGEKALLVFRKLT  138

Query  1042  MKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
             ++   VD +LI+SVL A AQLA V+PG+E HGF +R G   ++ VSSALIDMYSKCGFL+
Sbjct  139   IECRMVDHVLISSVLVAIAQLANVRPGKEIHGFVLRLGLESDIMVSSALIDMYSKCGFLD  198

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
              G+ +F+ M  +NII+YNS+I  LGLHG A++AFQ+FEE+L     NPD  TFSALLCAC
Sbjct  199   EGMHIFEQMSDRNIITYNSIILGLGLHGLASQAFQLFEEILSIG-VNPDHCTFSALLCAC  257

Query  1402  CHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI  1581
             CH GL+ DG++  R M DEF +QP TEHYVYMVKLLG AGELEEA+  IQS+  PVD G+
Sbjct  258   CHAGLIEDGKKIVRRMEDEFCLQPGTEHYVYMVKLLGTAGELEEAFNFIQSLPQPVDPGV  317

Query  1582  WGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVD-ME  1758
             WGALLSCC++ GN  + GIVA+ LF  + EK +Y VM+S  YA  GRW  VKKLR + ++
Sbjct  318   WGALLSCCEMCGNSTMAGIVAQQLFRMEPEKGAYRVMLSKTYASHGRWSDVKKLRDEIID  377

Query  1759  AIKGKMPGKSWI  1794
                 K+P   W+
Sbjct  378   RRLKKIPELGWV  389


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 166/345 (48%), Gaps = 15/345 (4%)
 Frame = +1

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL-RVVHGGVVVSGLE  555
              Y     +    +LF +M   G  PD +T   ++   +D   F G+ + +HG  + S L+
Sbjct  19    GYGHLCAWDKGLKLFCEMRSLGRLPDGYTLVGLISGLAD-MSFIGVGQSIHGLCMKSCLD  77

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              D+   + LVS Y++   ++ A KVF G+++PDLV W++++ G+   GD +KALL+F K+
Sbjct  78    SDAYVGAALVSMYARCRCMDSACKVFGGLSQPDLVAWSALVMGYCQCGDGEKALLVFRKL  137

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                    D      +++ +   + +R GK +H   L+ G +S+  V S L+ MYS+C  +
Sbjct  138   TIECRMVDHVLISSVLVAIAQLANVRPGKEIHGFVLRLGLESDIMVSSALIDMYSKCGFL  197

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
                  IF+ + + +++T++++I GL   G   +A   F E+   G   D    +++L A 
Sbjct  198   DEGMHIFEQMSDRNIITYNSIILGLGLHGLASQAFQLFEEILSIGVNPDHCTFSALLCAC  257

Query  1096  AQLAIVQPG-----RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-  1257
                 +++ G     R    F ++ G    V     ++ +    G L       +++P   
Sbjct  258   CHAGLIEDGKKIVRRMEDEFCLQPGTEHYVY----MVKLLGTAGELEEAFNFIQSLPQPV  313

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + +++S   + GN+  A  + +++   E   P++  +  +L
Sbjct  314   DPGVWGALLSCCEMCGNSTMAGIVAQQLFRME---PEKGAYRVML  355


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 132/294 (45%), Gaps = 16/294 (5%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             I   + +H + +K+ L    +    ++  YA    + SA ++F    Q  +  W++++  
Sbjct  61    IGVGQSIHGLCMKSCLDSDAYVGAALVSMYARCRCMDSACKVFGGLSQPDLVAWSALVMG  120

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             Y +      A  +F+ +       D+   + +L A +   +    + +HG V+  GLE D
Sbjct  121   YCQCGDGEKALLVFRKLTIECRMVDHVLISSVLVAIAQLANVRPGKEIHGFVLRLGLESD  180

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
              + SS L+  YSK G L+E + +F+ +++ +++ +NS+I G G  G   +A  LF ++  
Sbjct  181   IMVSSALIDMYSKCGFLDEGMHIFEQMSDRNIITYNSIILGLGLHGLASQAFQLFEEILS  240

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNV-----HSLCLKFGFDSNAHVGSLLVSMYSRC  906
             +G  PD  T+  L+       L+  GK +        CL+ G +   ++  LL +     
Sbjct  241   IGVNPDHCTFSALLCACCHAGLIEDGKKIVRRMEDEFCLQPGTEHYVYMVKLLGTAGE--  298

Query  907   KCMGSACRIFDSLLEP-DMVTWSAMI-----CGLSQSGDIMKALDFFREMNMKG  1050
               +  A     SL +P D   W A++     CG S    I+ A   FR    KG
Sbjct  299   --LEEAFNFIQSLPQPVDPGVWGALLSCCEMCGNSTMAGIV-AQQLFRMEPEKG  349



>gb|EEC70845.1| hypothetical protein OsI_02345 [Oryza sativa Indica Group]
Length=466

 Score =   402 bits (1034),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 209/458 (46%), Positives = 292/458 (64%), Gaps = 4/458 (1%)
 Frame = +1

Query  439   SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEE  618
             + T PD  TFAC+LRAC+D       RVV+G VV +G+    +  S LVSAY+KLGP+ +
Sbjct  10    TATAPDAHTFACVLRACADCSRPDVARVVNGIVVCAGMSSHPVVGSALVSAYAKLGPVGD  69

Query  619   AIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDC  798
             A +VFDG+ EPDLV WN M+SG+G  G W   L LF  M++ GE+PD ++ V LI     
Sbjct  70    ARRVFDGLPEPDLVLWNCMMSGYGYRGMWNDGLDLFSAMRKAGERPDGYSMVSLISSFWN  129

Query  799   PSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAM  978
                   G+ +H +C+K  +DS  HV S LVSMY RC CM S   +F +LL+ D+VTWS++
Sbjct  130   REARAFGQAIHGMCIKGSYDSGHHVRSALVSMYFRCGCMDSGHSLFGNLLDADLVTWSSL  189

Query  979   ICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGY  1158
             I GL       ++   FR+M   G + D +L+AS+LSA A +  +   +E H +A R G 
Sbjct  190   ITGLLHICKYEESFGLFRQMCNSGRRPDSILVASLLSACASMVNISYSKEIHCYAFRVGA  249

Query  1159  HLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEE  1338
             H ++ VSS+L+D YSKCGF +L   VF  MP KN++ YN++ISNLG HG A +A ++ +E
Sbjct  250   HTDIRVSSSLMDAYSKCGFADLAYGVFFQMPDKNLVMYNTVISNLGSHGFAMKAIEVLDE  309

Query  1339  VLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMA  1518
             ++  +   PD  TFSALL ACCH GL+ +G + FR M DEF +  KTEHYVY+V+LL   
Sbjct  310   MVSDK-LKPDSVTFSALLAACCHAGLLEEGWKLFRRMRDEFNMAVKTEHYVYIVRLLATF  368

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVS  1698
             G+L+EAY LIQ++  P D G+WGALL  C +H +  LG IVA  LF+   +K+SY VM+S
Sbjct  369   GQLKEAYGLIQTMPAPADSGVWGALLWGCCVHRDSSLGRIVADKLFELYPDKASYRVMLS  428

Query  1699  NMYAGDGRWECVKKLRVDM--EAIKGKMPGKSWISNIK  1806
             N+YA    W   +++R ++  E +  K  G SW+ N +
Sbjct  429   NLYASQEMWWDAEEVREELWNEDVH-KNTGISWVGNAR  465


 Score =   127 bits (320),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/405 (22%), Positives = 192/405 (47%), Gaps = 21/405 (5%)
 Frame = +1

Query  208   TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYA  387
               ++++ I++   +S HP   + ++  YA    +  ARR+FD  P+  + LWN ++  Y 
Sbjct  34    VARVVNGIVVCAGMSSHPVVGSALVSAYAKLGPVGDARRVFDGLPEPDLVLWNCMMSGYG  93

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
                 +++   LF  M  +G RPD ++   ++ +  ++   +  + +HG  +    +    
Sbjct  94    YRGMWNDGLDLFSAMRKAGERPDGYSMVSLISSFWNREARAFGQAIHGMCIKGSYDSGHH  153

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
               S LVS Y + G ++    +F  + + DLV W+S+I+G   +  ++++  LF +M   G
Sbjct  154   VRSALVSMYFRCGCMDSGHSLFGNLLDADLVTWSSLITGLLHICKYEESFGLFRQMCNSG  213

Query  748   EKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              +PDS     L+    C S++ I   K +H    + G  ++  V S L+  YS+C     
Sbjct  214   RRPDSILVASLLSA--CASMVNISYSKEIHCYAFRVGAHTDIRVSSSLMDAYSKCGFADL  271

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F  + + ++V ++ +I  L   G  MKA++   EM     K D +  +++L+A   
Sbjct  272   AYGVFFQMPDKNLVMYNTVISNLGSHGFAMKAIEVLDEMVSDKLKPDSVTFSALLAACCH  331

Query  1102  LAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK-  1257
               +++ G       R+    AV+  +++ +      + + +  G L     + + MP+  
Sbjct  332   AGLLEEGWKLFRRMRDEFNMAVKTEHYVYI------VRLLATFGQLKEAYGLIQTMPAPA  385

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + +++    +H +++    + +++ E     PD+A++  +L
Sbjct  386   DSGVWGALLWGCCVHRDSSLGRIVADKLFE---LYPDKASYRVML  427



>gb|ACR38662.1| unknown [Zea mays]
Length=460

 Score =   402 bits (1034),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 294/460 (64%), Gaps = 2/460 (0%)
 Frame = +1

Query  430   MLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGP  609
             M  S T PD  TFAC+LRAC++      ++VVHG     G+    I  S LVSAY+KLG 
Sbjct  1     MRRSATPPDAHTFACVLRACAESSRPDAVKVVHGIATTCGMCSRPIVLSSLVSAYAKLGL  60

Query  610   LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMC  789
             ++ A  +FDG+ EPDLV WNSM+S +G  G W   L +F  M+R G+ PD ++ V L+ C
Sbjct  61    VDNARSLFDGLCEPDLVIWNSMMSAYGYQGMWYDGLQMFSLMRRAGQHPDGYSMVSLVSC  120

Query  790   LDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTW  969
                P +L  G+ VH +C+K G+DS  HV S LVSMY R  C+ S  R+F SL + D++TW
Sbjct  121   FWNPEILAFGQAVHGICVKGGYDSGHHVRSTLVSMYMRFGCVESGQRLFGSLSDVDLITW  180

Query  970   SAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVR  1149
             S++I GL Q+G   ++ D FR+M   G + D +LIASVLS  A  A +   +E H +AV+
Sbjct  181   SSLITGLIQTGKYEESFDLFRKMCFTGRRPDSILIASVLSVFASTAAISYTKEVHCYAVK  240

Query  1150  CGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQI  1329
              G  +++ VSS+L+D Y+KCGF  LG  VF+ +P+KN + YN++ISNLG HG A +A ++
Sbjct  241   LGADIDIRVSSSLMDAYAKCGFTELGYWVFRQVPNKNSVMYNTVISNLGSHGFATKAIEV  300

Query  1330  FEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLL  1509
              +E++  +   PD ATFS+LL ACCH G + +G + FR M DEF I  + EHYVYMV+LL
Sbjct  301   LDEMVNDK-LRPDSATFSSLLAACCHVGHLEEGWKLFRRMRDEFKIVVEMEHYVYMVRLL  359

Query  1510  GMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGV  1689
                G+L+EAY+LIQ++Q   D G+WGALL  C +H +   G IVA+ L +   +K++Y V
Sbjct  360   ATFGQLKEAYDLIQTMQIQPDCGVWGALLWGCCVHRDSSFGRIVAEKLCELNSDKAAYRV  419

Query  1690  MVSNMYAGDGRWECVKKLRVDMEAIKG-KMPGKSWISNIK  1806
             M+SNMYA    W   +++R ++      K  G SW+  +K
Sbjct  420   MLSNMYASQEMWWDAEEVRDELSKENMYKNTGTSWVGEVK  459


 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 167/403 (41%), Gaps = 44/403 (11%)
 Frame = +1

Query  211   TKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYAR  390
              K++H I     +   P   + ++  YA    + +AR LFD   +  + +WNS++ AY  
Sbjct  29    VKVVHGIATTCGMCSRPIVLSSLVSAYAKLGLVDNARSLFDGLCEPDLVIWNSMMSAYGY  88

Query  391   AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                + +  Q+F  M  +G  PD ++   ++    +    +  + VHG  V  G +     
Sbjct  89    QGMWYDGLQMFSLMRRAGQHPDGYSMVSLVSCFWNPEILAFGQAVHGICVKGGYDSGHHV  148

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
              S LVS Y + G +E   ++F  +++ DL+ W+S+I+G    G ++++  LF KM   G 
Sbjct  149   RSTLVSMYMRFGCVESGQRLFGSLSDVDLITWSSLITGLIQTGKYEESFDLFRKMCFTGR  208

Query  751   KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
             +PDS     ++      + +   K VH   +K G D +  V S L+  Y++C        
Sbjct  209   RPDSILIASVLSVFASTAAISYTKEVHCYAVKLGADIDIRVSSSLMDAYAKCGFTELGYW  268

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             +F  +   + V ++ +I  L   G   KA++   EM     + D    +S+L+A   +  
Sbjct  269   VFRQVPNKNSVMYNTVISNLGSHGFATKAIEVLDEMVNDKLRPDSATFSSLLAACCHV--  326

Query  1111  VQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII-----SYN  1275
                                              G L  G ++F+ M  +  I      Y 
Sbjct  327   ---------------------------------GHLEEGWKLFRRMRDEFKIVVEMEHYV  353

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
              M+  L   G   EA+    ++++     PD   + ALL  CC
Sbjct  354   YMVRLLATFGQLKEAY----DLIQTMQIQPDCGVWGALLWGCC  392



>ref|XP_010231894.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g64310 isoform X2 [Brachypodium distachyon]
Length=502

 Score =   365 bits (938),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 201/442 (45%), Positives = 271/442 (61%), Gaps = 10/442 (2%)
 Frame = +1

Query  205   STTKLLHAIILKTHLSHHPFYATRI----IRFYALNEDIVSARRLFDETPQR-SIFLWNS  369
             S TK +HA +L       PF    +    +R YA   D  SA  L DETP+  S  L+N+
Sbjct  20    SHTKQIHARLLLVS----PFIPDDVRLFLLRSYAGRGDFASAHCLLDETPRPVSPLLYNA  75

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +IRA+AR      A  LF  M  S T PD  TFAC++RAC+D       ++VHG    SG
Sbjct  76    VIRAHARRLDLPAALALFARMRRSATPPDAHTFACVVRACADCSSPDTAKIVHGVASSSG  135

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             +    +  S LVSAYSK   ++ A  +FDG+ +PDLV WNSM+SG+G    W + L LF 
Sbjct  136   MSSHPVVGSALVSAYSKFLLVDSARHMFDGLPDPDLVLWNSMLSGYGYREMWVEGLQLFS  195

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              M+R GE+PD ++ V L+     P  L  G+ VH +C+K G+DS  HV S LVSMY RC 
Sbjct  196   AMRRAGEEPDGYSMVSLVSSFRNPEALDFGQAVHGVCIKGGYDSGHHVRSALVSMYFRCG  255

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
             CM S   +F +LL+ D+VTWS++I G  Q+G   ++ + FR+M   G + D +LIAS+LS
Sbjct  256   CMESGQTLFGNLLDADLVTWSSLITGQLQTGKYEESFNLFRQMCYSGRRPDSILIASLLS  315

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A  A V   RE H +A+R G   +V VSS+L+D Y+KCGF  LG  VF+ MP+KN + 
Sbjct  316   ACASTATVSCSREIHCYAIRIGADADVKVSSSLMDAYAKCGFAELGYLVFRQMPNKNSVV  375

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             YN +ISNLG HG A +A ++ +E++  + Y PD ATFSALL ACCH GL+ +G + FR M
Sbjct  376   YNMVISNLGSHGFALKAIEVHDEMI-CDKYRPDGATFSALLAACCHAGLLDEGWKLFRRM  434

Query  1450  NDEFGIQPKTEHYVYMVKLLGM  1515
              DEF I  + EHYVYM+   G+
Sbjct  435   QDEFHIVVEMEHYVYMIVACGV  456



>ref|XP_002868974.1| hypothetical protein ARALYDRAFT_490847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45233.1| hypothetical protein ARALYDRAFT_490847 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   355 bits (912),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 194/442 (44%), Positives = 261/442 (59%), Gaps = 50/442 (11%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             I  T+ LH+ + K+ LS  P++A +++RFYALN+D++SAR+LFD      +FL     R 
Sbjct  11    IYDTQKLHSFVTKSKLSRDPYFAAQLVRFYALNDDLLSARKLFD------VFLE----RT  60

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             YA+AH+FS +  LF  ML S TRPDNFT+ C+ R  S+ FD  GLR +HG  VVSGL  D
Sbjct  61    YAKAHQFSTSLSLFSQMLSSDTRPDNFTYVCVARGFSESFDSEGLRRIHGIAVVSGLGFD  120

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
              IC S +V AYS  G + EA K+F  I +PDL  WN MI G+GC G W K + LF  MQ 
Sbjct  121   QICGSAIVKAYSNPGLIVEASKLFCSIPDPDLALWNVMILGYGCCGFWDKGINLFNLMQH  180

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              G  P+ +T V L+  L  PSLL I  +VH  CLK   DS+++VG   V+MYSRC C+ S
Sbjct  181   RGHVPNCYTMVALMTGLIDPSLLLIAWSVHGFCLKINLDSHSYVGCAFVTMYSRCMCIAS  240

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +++S+ EPD+V  S++I G S+ G   +AL  F E+ M   K D +L+A        
Sbjct  241   AGSVYNSICEPDLVACSSLITGYSRCGIHKEALHLFAELRMSSKKPDCVLVAIYTEK---  297

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
                                  + +V S LIDMYSKCG L+  + +F  +P K+I+S+NS+
Sbjct  298   ---------------------KCTVCSGLIDMYSKCGLLDSAMNLFAGIPEKHIVSFNSV  336

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             IS           F    ++           TFSALLC CCH+GL+  G+  F  M  EF
Sbjct  337   ISRF-----TRFCFLCVRKI-----------TFSALLCNCCHSGLLDKGQEIFERMKSEF  380

Query  1462  GIQPKTEHYVYMVKLLGMAGEL  1527
             GI+P+TEHYVYMVKL+GMAG+L
Sbjct  381   GIEPQTEHYVYMVKLMGMAGKL  402



>emb|CBI14973.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   350 bits (899),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 209/476 (44%), Positives = 278/476 (58%), Gaps = 55/476 (12%)
 Frame = +1

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + +H  ++ + L  D   +++++  Y+    L  A  +FDG +   +  WNS+I  +   
Sbjct  29    KKLHAFIIRNHLSDDPFYATRILRFYAINSDLCSARNLFDGTSYRSVYLWNSVIRAYAGE  88

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMC----LDCPSLLRIGKNVHSLCLKFGFDSN  864
               +  ALLLF KM R   KPDSFT+  ++       D   L  +   V    L F    +
Sbjct  89    HQFDDALLLFAKMLRTEIKPDSFTFACVLRACAENFDPDGLRVVHGGVVVSGLGF----D  144

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
             +  GS LV+ YS+   +  A R+F  + EPD+V W+AM  G    G   K L  F  M  
Sbjct  145   SVCGSALVTAYSKLCMVDEASRVFYGMAEPDLVLWNAMAAGYGYCGFWDKGLQLFSAMRS  204

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAV-------------------RC-----  1152
              G + D   +  ++S  A  +++  G+  HGF +                   RC     
Sbjct  205   MGEQPDSYTMVGLISGLADPSLLGIGKGIHGFCLKSSFDCNDHVGSALVSMYSRCHCLNS  264

Query  1153  ---------------GYHL------EVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
                            GY L      EV +SSALIDMYSKCGF+NLG++VF +MP++N +S
Sbjct  265   AYGVFTILSQPDLIHGYVLRHGLESEVMISSALIDMYSKCGFVNLGVRVFDSMPNRNTVS  324

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             YNSMI  LG+HG A +AF++FEEVLEK +  PDE+TFSALLC CCH GLV +GR  F  M
Sbjct  325   YNSMILGLGIHGLAPQAFKMFEEVLEKGF-KPDESTFSALLCTCCHAGLVKNGREIFSRM  383

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              +EF IQ +T+HYV+MVKLLGMAGEL+EAY+LI S+Q PVD GIWGALLSCC+ HGN  L
Sbjct  384   TEEFHIQARTDHYVHMVKLLGMAGELQEAYDLILSLQQPVDSGIWGALLSCCNFHGNPEL  443

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
               IVA+ LF+NK EKS+Y VM+SN+YAGD RW+ VKKLR D+ EA   KMPG SWI
Sbjct  444   AEIVAQQLFENKPEKSAYRVMLSNIYAGDDRWDDVKKLRDDIQEAGIKKMPGLSWI  499


 Score =   305 bits (780),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 260/435 (60%), Gaps = 28/435 (6%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F  LL +LS+ +QT+  TK LHA I++ HLS  PFYATRI+RFYA+N D+ SAR LFD T
Sbjct  11    FSKLLFELSKIHQTLPRTKKLHAFIIRNHLSDDPFYATRILRFYAINSDLCSARNLFDGT  70

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               RS++LWNS+IRAYA  H+F +A  LF  ML +  +PD+FTFAC+LRAC++ FD  GLR
Sbjct  71    SYRSVYLWNSVIRAYAGEHQFDDALLLFAKMLRTEIKPDSFTFACVLRACAENFDPDGLR  130

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
             VVHGGVVVSGL  DS+C S LV+AYSKL  ++EA +VF G+AEPDLV WN+M +G+G  G
Sbjct  131   VVHGGVVVSGLGFDSVCGSALVTAYSKLCMVDEASRVFYGMAEPDLVLWNAMAAGYGYCG  190

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              W K L LF  M+ MGE+PDS+T VGLI  L  PSLL IGK +H  CLK  FD N HVGS
Sbjct  191   FWDKGLQLFSAMRSMGEQPDSYTMVGLISGLADPSLLGIGKGIHGFCLKSSFDCNDHVGS  250

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKAL-DFFRE---MNMK  1047
              LVSMYSRC C+ SA  +F  L +PD++    +  GL     I  AL D + +   +N+ 
Sbjct  251   ALVSMYSRCHCLNSAYGVFTILSQPDLIHGYVLRHGLESEVMISSALIDMYSKCGFVNLG  310

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRC----------GYHLEVSVSSALIDM  1197
                 D +   + +S  + +     G   HG A +           G+  + S  SAL+  
Sbjct  311   VRVFDSMPNRNTVSYNSMIL----GLGIHGLAPQAFKMFEEVLEKGFKPDESTFSALLCT  366

Query  1198  YSKCGFLNLGIQVFKAMPSKNIIS-----YNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
                 G +  G ++F  M  +  I      Y  M+  LG+ G   EA+ +   + +     
Sbjct  367   CCHAGLVKNGREIFSRMTEEFHIQARTDHYVHMVKLLGMAGELQEAYDLILSLQQ-----  421

Query  1363  PDEATFSALLCACCH  1407
             P ++     L +CC+
Sbjct  422   PVDSGIWGALLSCCN  436



>ref|XP_010243611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Nelumbo nucifera]
Length=829

 Score =   355 bits (910),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 199/537 (37%), Positives = 302/537 (56%), Gaps = 6/537 (1%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N  +   K +HA ++    S + F  T ++  YA    I  A ++FD  PQR +  WN+I
Sbjct  168   NSDLRRGKEIHAQLISNGFSSNVFAMTAVVNMYAKCRQIGEACKMFDRMPQRDLVAWNAI  227

Query  373   IRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGL  552
             I  YA+ +    A +L   M   G RPD+ T   IL AC+D       + VHG V+ +G 
Sbjct  228   IAGYAQNNCARRALELVVQMQQEGQRPDSITIVSILPACADIGSLRIGKAVHGYVIRAGF  287

Query  553   ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIK  732
             +     S+ LV  YSK G ++ A  ++DG+   ++V WNSMI G+   GD ++A+ +F K
Sbjct  288   QSLVNISTALVDMYSKCGSVKTARLIYDGMHIRNVVSWNSMIDGYAQNGDSEEAMEIFQK  347

Query  733   MQRMGEKPDSFTYVG-LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
             M   G +P   T +  L  C D   L R G  +H L  + G  S+  V + L+SMYS+CK
Sbjct  348   MMDEGVEPTDVTIMAALHACADLGDLQR-GSYIHELLNQNGLGSDVSVVNSLISMYSKCK  406

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +  A +IF +L   ++V+W+AMI G +Q+G + +AL +F +M  +  K D   + SV+ 
Sbjct  407   QVDVAAKIFHNLQGKNLVSWNAMISGYAQNGRVNEALSYFCKMQQENVKPDSFTMVSVIP  466

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A L+I++  R  HG  +R      V V +AL+DMY+KCG ++   ++F  M  +++ +
Sbjct  467   AIADLSILRQARWIHGLTIRSCLDTNVFVMTALVDMYAKCGGVHTARKLFDMMDERHVTT  526

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +N+MI   G HG    A Q+FEE +      P+  TF  +L AC H+GLV DGRRYF +M
Sbjct  527   WNAMIDGYGTHGLGKHAVQLFEE-MRTGVVRPNGVTFLCILSACSHSGLVEDGRRYFTVM  585

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
               ++ I+P T+HY  MV LLG AG L+EA++ IQ +    +  ++GA+L  C IH N  L
Sbjct  586   KHDYEIEPGTDHYATMVDLLGRAGHLDEAWDFIQKMPIEPEISVFGAMLGACKIHKNVEL  645

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             G   AK LF+ + ++  Y V++SN+YA    W+ V K+R  ME  +G  K PG S +
Sbjct  646   GEKAAKRLFELEPKEGGYHVLLSNIYATASMWDDVAKVRTMMER-RGLQKTPGCSMV  701


 Score =   208 bits (529),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 119/402 (30%), Positives = 220/402 (55%), Gaps = 3/402 (1%)
 Frame = +1

Query  229   IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSN  408
             +I+K  L +   + T++I  ++       A  +F+    +   L++++++ +A+     +
Sbjct  79    LIIKNGLYNEHLFQTKLISLFSKFGRFREAALVFEPIKDKIDPLYHTLLKGHAKNSSLED  138

Query  409   AFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVS  588
             A   F  M     RP  + F  +L+ C D  D    + +H  ++ +G   +    + +V+
Sbjct  139   AVSFFCRMKYDDVRPVVYNFTYLLKGCGDNSDLRRGKEIHAQLISNGFSSNVFAMTAVVN  198

Query  589   AYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFT  768
              Y+K   + EA K+FD + + DLV WN++I+G+      ++AL L ++MQ+ G++PDS T
Sbjct  199   MYAKCRQIGEACKMFDRMPQRDLVAWNAIIAGYAQNNCARRALELVVQMQQEGQRPDSIT  258

Query  769   YVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSL  945
              V ++  C D  S LRIGK VH   ++ GF S  ++ + LV MYS+C  + +A  I+D +
Sbjct  259   IVSILPACADIGS-LRIGKAVHGYVIRAGFQSLVNISTALVDMYSKCGSVKTARLIYDGM  317

Query  946   LEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGR  1125
                ++V+W++MI G +Q+GD  +A++ F++M  +G +   + I + L A A L  +Q G 
Sbjct  318   HIRNVVSWNSMIDGYAQNGDSEEAMEIFQKMMDEGVEPTDVTIMAALHACADLGDLQRGS  377

Query  1126  ETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHG  1305
               H    + G   +VSV ++LI MYSKC  +++  ++F  +  KN++S+N+MIS    +G
Sbjct  378   YIHELLNQNGLGSDVSVVNSLISMYSKCKQVDVAAKIFHNLQGKNLVSWNAMISGYAQNG  437

Query  1306  NANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
               NEA   F + +++E   PD  T  +++ A     ++   R
Sbjct  438   RVNEALSYFCK-MQQENVKPDSFTMVSVIPAIADLSILRQAR  478



>ref|XP_010273754.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Nelumbo nucifera]
Length=513

 Score =   345 bits (884),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 287/494 (58%), Gaps = 2/494 (0%)
 Frame = +1

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSD  495
             AR+LFD  PQR  FLWN++IR YA        F L+++M  SG  PDN+TF  ++R+C+ 
Sbjct  4     ARKLFDRVPQRDAFLWNTLIRGYADMGPCEEVFVLYRNMHLSGLLPDNYTFPFVVRSCAV  63

Query  496   KFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSM  675
                    + VH  ++ +G + D    S LVS YS+ G  +++  +FD +   ++V W +M
Sbjct  64    LSALREGKEVHCNIIKNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSWTAM  123

Query  676   ISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGF  855
             ISG+   G +K+ L +F +M   G +P++ T V ++       +L +GK +H   +K G 
Sbjct  124   ISGYVQNGFYKEGLSVFRRMVASGTQPNAVTLVSILPACGGLEVLNLGKLIHGYGVKLGV  183

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
             DS+  + + L+S+Y +C+ +  A  +FD ++  ++V+W+AMI    Q+G    A+  FR 
Sbjct  184   DSDTPLVNSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGASRDAIKLFRR  243

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             M  +  + D +   S++SA A +  +  G+  H      G  + VS+++ALIDMY+KCG 
Sbjct  244   MRNEKVEFDYITTVSLISACASMGALNTGKWAHELVTSKGLEINVSITNALIDMYAKCGS  303

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLC  1395
             +     VF  +P ++++S+ +MI     HG   +A ++F + +++E   P+  TF+A+L 
Sbjct  304   IESARDVFDKLPKRSVVSWTAMIGAYAAHGYGEDALKLFSK-MQEEGIQPNSFTFTAVLT  362

Query  1396  ACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDF  1575
             AC H+GLV +GR++F  M  ++ I P  E    MV LLG AG L EAYE I+ I    D 
Sbjct  363   ACRHSGLVEEGRKHFESMTRDYLIAPGLEQCACMVDLLGRAGRLTEAYEFIKGIPVEPDA  422

Query  1576  GIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM  1755
             G+WGALL  C IHGN  L  +VA+HL     +  +Y V++SN+YA  GRWE V +LR  M
Sbjct  423   GVWGALLGACRIHGNVELAELVAEHLIQLDPQTVTYYVLLSNIYAEAGRWEDVARLRELM  482

Query  1756  EAIK-GKMPGKSWI  1794
             +  +  K+PG+S +
Sbjct  483   KERELKKIPGRSLV  496


 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 171/336 (51%), Gaps = 3/336 (1%)
 Frame = +1

Query  610   LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMC  789
             ++ A K+FD + + D   WN++I G+  +G  ++  +L+  M   G  PD++T+  ++  
Sbjct  1     MDYARKLFDRVPQRDAFLWNTLIRGYADMGPCEEVFVLYRNMHLSGLLPDNYTFPFVVRS  60

Query  790   LDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTW  969
                 S LR GK VH   +K GFDS+  V S LVSMYS+      +  IFD ++  ++V+W
Sbjct  61    CAVLSALREGKEVHCNIIKNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSW  120

Query  970   SAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVR  1149
             +AMI G  Q+G   + L  FR M   G + + + + S+L A   L ++  G+  HG+ V+
Sbjct  121   TAMISGYVQNGFYKEGLSVFRRMVASGTQPNAVTLVSILPACGGLEVLNLGKLIHGYGVK  180

Query  1150  CGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQI  1329
              G   +  + ++LI +Y KC  +++   +F  M ++N++S+N+MI     +G + +A ++
Sbjct  181   LGVDSDTPLVNSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGASRDAIKL  240

Query  1330  FEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLL  1509
             F   +  E    D  T  +L+ AC   G +  G+    ++  + G++        ++ + 
Sbjct  241   FRR-MRNEKVEFDYITTVSLISACASMGALNTGKWAHELVTSK-GLEINVSITNALIDMY  298

Query  1510  GMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
                G +E A ++   +        W A++     HG
Sbjct  299   AKCGSIESARDVFDKLPKRSVVS-WTAMIGAYAAHG  333


 Score =   151 bits (382),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 102/399 (26%), Positives = 187/399 (47%), Gaps = 13/399 (3%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  I+K       F  + ++  Y+ + +   +  +FDE   R+I  W ++I  Y + 
Sbjct  71    KEVHCNIIKNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSWTAMISGYVQN  130

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
               +     +F+ M+ SGT+P+  T   IL AC      +  +++HG  V  G++ D+   
Sbjct  131   GFYKEGLSVFRRMVASGTQPNAVTLVSILPACGGLEVLNLGKLIHGYGVKLGVDSDTPLV  190

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + L+S Y K   ++ A  +FD +   +LV WN+MI  +   G  + A+ LF +M+    +
Sbjct  191   NSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGASRDAIKLFRRMRNEKVE  250

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
              D  T V LI        L  GK  H L    G + N  + + L+ MY++C  + SA  +
Sbjct  251   FDYITTVSLISACASMGALNTGKWAHELVTSKGLEINVSITNALIDMYAKCGSIESARDV  310

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD L +  +V+W+AMI   +  G    AL  F +M  +G + +     +VL+A     +V
Sbjct  311   FDKLPKRSVVSWTAMIGAYAAHGYGEDALKLFSKMQEEGIQPNSFTFTAVLTACRHSGLV  370

Query  1114  QPGRE-----THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIISYN  1275
             + GR+     T  + +  G    +   + ++D+  + G L    +  K +P   +   + 
Sbjct  371   EEGRKHFESMTRDYLIAPG----LEQCACMVDLLGRAGRLTEAYEFIKGIPVEPDAGVWG  426

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +++    +HGN   A  + E +++    +P   T+  LL
Sbjct  427   ALLGACRIHGNVELAELVAEHLIQ---LDPQTVTYYVLL  462


 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 129/283 (46%), Gaps = 22/283 (8%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             + ++  KL+H   +K  +         +I  Y    ++  AR LFD+   R++  WN++I
Sbjct  166   EVLNLGKLIHGYGVKLGVDSDTPLVNSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMI  225

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
              AY +     +A +LF+ M +     D  T   ++ AC+     +  +  H  V   GLE
Sbjct  226   GAYEQNGASRDAIKLFRRMRNEKVEFDYITTVSLISACASMGALNTGKWAHELVTSKGLE  285

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             ++   ++ L+  Y+K G +E A  VFD + +  +V W +MI  +   G  + AL LF KM
Sbjct  286   INVSITNALIDMYAKCGSIESARDVFDKLPKRSVVSWTAMIGAYAAHGYGEDALKLFSKM  345

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIG-KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             Q  G +P+SFT+  ++       L+  G K+  S+   +          L+     +C C
Sbjct  346   QEEGIQPNSFTFTAVLTACRHSGLVEEGRKHFESMTRDY----------LIAPGLEQCAC  395

Query  913   M----GSACRIFDSL-------LEPDMVTWSAMICGLSQSGDI  1008
             M    G A R+ ++        +EPD   W A++      G++
Sbjct  396   MVDLLGRAGRLTEAYEFIKGIPVEPDAGVWGALLGACRIHGNV  438



>ref|XP_010247013.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nelumbo nucifera]
Length=642

 Score =   348 bits (892),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 196/547 (36%), Positives = 319/547 (58%), Gaps = 10/547 (2%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTH-LSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L Q   + ++ +  K LHA ++ ++ L ++ +  T++  FYA+   +  AR +FD    +
Sbjct  49    LLQSFTNTKSYTEGKRLHAYMITSNILFNNTYLNTKLSAFYAICGSMTEARAVFDGIILK  108

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             + FLWN +IR YA      N+  L+++M+  G + DNFT+  +L+AC D       R +H
Sbjct  109   NSFLWNCMIRGYACNGFSLNSIVLYREMMSFGQKADNFTYPFVLKACGDLLLVEVGRKIH  168

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               +V+ GLE D    + L++ Y K G +E A ++FDG++  DL  WN+MISG+    +  
Sbjct  169   SELVIRGLESDVYVGNSLLAMYLKFGDMETARRLFDGMSLRDLTSWNTMISGYIKNHESG  228

Query  709   KALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLK--FGFDSNAHVGS  879
             +AL +F  M R+G++ D  T +G++  C D  +L + GK +H   ++   GF SN  V +
Sbjct  229   EALSVFYLMSRVGQRADCTTLLGVLSACADLGAL-KQGKEIHGFVIRNDIGF-SNIFVIN  286

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L+SMYS C  +    R+FD +++ D V+W++MI G +Q+GD  ++L  F +M  +G  +
Sbjct  287   SLISMYSHCNSIVCGRRLFDKMIDRDTVSWNSMILGYAQAGDAFESLRLFCQMVSEGRML  346

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +    VL A+ Q+  +Q G   H +  + GY ++  V +ALIDMY+KCG L+   ++F
Sbjct  347   DEVTFIGVLGASDQIMALQFGMSVHAYLAQKGYAMDTVVGTALIDMYAKCGSLDCSYRIF  406

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
             + M  +N+IS+++MI+  GLHG   EA   F E ++     PD+ TF+++L AC H GLV
Sbjct  407   EGMAERNLISWSAMITGFGLHGRGREAIATFNE-MKVNGIMPDKVTFTSVLSACSHAGLV  465

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G   F  M  ++ ++P  EHY  MV LLG AG L++AYE I+S++      IW + LS
Sbjct  466   DEGFDVFYQMIKKYKMKPGVEHYSCMVDLLGRAGRLDDAYEFIKSMEVKPTVDIWASFLS  525

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--K  1773
              C IH N +L  I A++ FD         + +SN+YA + RW+ V+++R  M + KG  K
Sbjct  526   ACHIHRNVKLAEIAAQNTFDLNPNGIGPYISLSNIYAAEKRWDNVERVRALMRS-KGLKK  584

Query  1774  MPGKSWI  1794
              PG S++
Sbjct  585   PPGYSFL  591



>ref|XP_007045237.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY01069.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=716

 Score =   347 bits (891),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 196/528 (37%), Positives = 305/528 (58%), Gaps = 8/528 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             H++ +KT      F  + ++  Y  +  +  AR++FDE P+++   W ++I  YA     
Sbjct  133   HSLAIKTDSFDDVFVGSSLLNVYCKSGVLAEARKVFDEMPKKNSVSWATMISGYAMQRSA  192

Query  403   SNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQL  582
              +AF+LF+ M     + + +  + +L A +D    +  R +H   V  GL + S   + L
Sbjct  193   LDAFELFELMRQEEEKVNEYAMSSVLSALADPEFLNTGRQIHCFTVKHGLLVFSSVGNAL  252

Query  583   VSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDS  762
             V+ Y+K G L++A+K F+     + + W++MI+G+   GD  KAL LF  M   G  P  
Sbjct  253   VTMYAKCGSLDDALKTFELSGNKNSITWSAMITGYAQSGDSLKALKLFSSMHFAGIMPSE  312

Query  763   FTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDS  942
             FT VG++        +  GK VH   LK G++S  ++ + LV MY++C C  +A + FD 
Sbjct  313   FTLVGVLNACSDTGAVEDGKQVHGYLLKLGYESQVYIMTALVDMYAKCGCTLAARKGFDY  372

Query  943   LLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPG  1122
             L EPDMV W++MI G  Q+G+   A+  +  M ++G   + L +AS+L A + LA ++ G
Sbjct  373   LQEPDMVLWTSMIGGYVQNGENENAMLLYGRMQIEGIVPNELTMASILKACSSLAALEQG  432

Query  1123  RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLH  1302
             ++ H   ++ G+ LEV + SAL  MY+KCG L  G  VF+ MP ++++S+NSMIS L  +
Sbjct  433   KQIHACTIKHGFGLEVPIGSALSTMYAKCGNLEDGNLVFRRMPRRDVVSWNSMISGLAQN  492

Query  1303  GNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTE  1482
             G+ NEA ++FEE+L  E   PD  TF  +L AC H GLV  G  YF +M+D+FGI P+ E
Sbjct  493   GHGNEALELFEEML-SEGTEPDYVTFVNILSACSHIGLVERGWAYFNMMSDKFGIVPRVE  551

Query  1483  HYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHLF  1656
             H+  MV +LG AG+L+EA E I+S    +D G  +W  LLS C    NY LG    + L 
Sbjct  552   HHACMVDMLGRAGKLDEAKEFIES--ATIDHGMYLWRILLSACRNFRNYELGAYAGEKLM  609

Query  1657  DNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             +   ++SS  V++S++YA  GR E V+++R  M  ++G  K PG SWI
Sbjct  610   ELGSQESSAYVLLSSIYAALGRLEDVERVR-RMMRLRGVNKEPGCSWI  656


 Score =   199 bits (505),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 124/431 (29%), Positives = 217/431 (50%), Gaps = 5/431 (1%)
 Frame = +1

Query  151   FIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFY-ATRIIRFYALNEDIVSARRL  327
             + +F S L Q+++  + +S  + +HA I+++  S    Y +  ++ FYA   D+  A+ +
Sbjct  6     YRSFFSELVQITK-QKNLSRGRAVHARIIRSGGSSSCVYLSNSLVNFYAKCGDLSKAKCV  64

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAF--QLFKDMLDSGTRPDNFTFACILRACSDKF  501
             F+    + +  WN +I  Y++    ++ F  QLF+ M      P+  TFA +  A S+  
Sbjct  65    FENIQHKDVVSWNCLINGYSQQGPTASTFVMQLFQRMRAENYLPNAHTFAGVFTAASNLS  124

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
             D    +  H   + +    D    S L++ Y K G L EA KVFD + + + V W +MIS
Sbjct  125   DVFSGQQAHSLAIKTDSFDDVFVGSSLLNVYCKSGVLAEARKVFDEMPKKNSVSWATMIS  184

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS  861
             G+        A  LF  M++  EK + +    ++  L  P  L  G+ +H   +K G   
Sbjct  185   GYAMQRSALDAFELFELMRQEEEKVNEYAMSSVLSALADPEFLNTGRQIHCFTVKHGLLV  244

Query  862   NAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMN  1041
              + VG+ LV+MY++C  +  A + F+     + +TWSAMI G +QSGD +KAL  F  M+
Sbjct  245   FSSVGNALVTMYAKCGSLDDALKTFELSGNKNSITWSAMITGYAQSGDSLKALKLFSSMH  304

Query  1042  MKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
               G       +  VL+A +    V+ G++ HG+ ++ GY  +V + +AL+DMY+KCG   
Sbjct  305   FAGIMPSEFTLVGVLNACSDTGAVEDGKQVHGYLLKLGYESQVYIMTALVDMYAKCGCTL  364

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                + F  +   +++ + SMI     +G  NE   +    ++ E   P+E T +++L AC
Sbjct  365   AARKGFDYLQEPDMVLWTSMIGGYVQNGE-NENAMLLYGRMQIEGIVPNELTMASILKAC  423

Query  1402  CHTGLVCDGRR  1434
                  +  G++
Sbjct  424   SSLAALEQGKQ  434



>ref|XP_004290399.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Fragaria vesca subsp. vesca]
Length=672

 Score =   344 bits (883),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 189/536 (35%), Positives = 291/536 (54%), Gaps = 2/536 (0%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S   I+    LH +++   L  H   A  +I  Y+    +  AR+LFD  P+  +  WN 
Sbjct  85    SEAMINFGTQLHGLVVAYGLESHSSVANTLIAVYSKCHILSDARKLFDMMPRTDVVRWNG  144

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +I  Y +    S A  LF +M+ +G +PD+ T A  L + +  F+    + +HG ++   
Sbjct  145   MISGYIQNGFMSEASGLFDEMISAGVKPDSITLASFLPSVTQPFNLKQAKEIHGYIIRHC  204

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             +  D    S L+  YSK   ++ A  +F+     D+V   +MISG    G    AL +F 
Sbjct  205   VPFDVYLKSALIDVYSKCRSVDMARNIFNQRTRTDVVMCTAMISGLVLNGMNTDALEIFR  264

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              + R   +P++ T   ++      + L++GK +H   LK G D + HVGS L+ MY++  
Sbjct  265   WLLRENLRPNTLTMASILPACAGLAALKLGKELHGNILKHGLDKSFHVGSSLIGMYAKSG  324

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +  A  +F  L E D + W++M+   SQ+G    A+D FR M M G K D +  +++LS
Sbjct  325   RVDLAHLVFKRLSERDAICWNSMLTSYSQNGKPEDAMDLFRHMGMGGVKYDCVSFSAILS  384

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
               A L  +  G+E HGF ++  +  ++   SALIDMY+KCG L +   VF +M  KN +S
Sbjct  385   VCANLPALHYGKEIHGFIIKSEFSSDIFAQSALIDMYAKCGNLVIARHVFDSMEEKNEVS  444

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +NS+IS  G HG   ++  +F ++L+     PD  +F  +L AC H G V DG  YFR M
Sbjct  445   WNSIISAYGYHGRLKDSLGLFRDMLDNGIL-PDHVSFVGVLSACVHAGQVDDGILYFRCM  503

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              +E+GI   +EHY  MV LLG AG L EA+E I+S+      G+WG LL  C +HGN  L
Sbjct  504   TEEYGIPASSEHYALMVDLLGRAGRLHEAFETIKSMPFSPGSGVWGTLLGACRVHGNIEL  563

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                 ++HLFD + E S Y ++++N+YA  G+WE ++++R  M E    K+PG SWI
Sbjct  564   AEEASRHLFDLEPENSGYYMLLANIYADAGQWENMRRVRNLMNERGVQKIPGYSWI  619


 Score =   202 bits (514),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 140/488 (29%), Positives = 245/488 (50%), Gaps = 8/488 (2%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             +  + +++ Y  N  I  AR +FD+   +    WN ++  YA+   FSNA  +F +M  S
Sbjct  8     YAGSSLLQLYVNNGCIRDARHVFDKMSHKDCVSWNVMLHGYAKKGEFSNAVGIFMEMRSS  67

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               + +  TF+C+L  C+ +   +    +HG VV  GLE  S  ++ L++ YSK   L +A
Sbjct  68    EIKANAVTFSCVLSVCASEAMINFGTQLHGLVVAYGLESHSSVANTLIAVYSKCHILSDA  127

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD +   D+V+WN MISG+   G   +A  LF +M   G KPDS T    +  +  P
Sbjct  128   RKLFDMMPRTDVVRWNGMISGYIQNGFMSEASGLFDEMISAGVKPDSITLASFLPSVTQP  187

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
               L+  K +H   ++     + ++ S L+ +YS+C+ +  A  IF+     D+V  +AMI
Sbjct  188   FNLKQAKEIHGYIIRHCVPFDVYLKSALIDVYSKCRSVDMARNIFNQRTRTDVVMCTAMI  247

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              GL  +G    AL+ FR +  +  + + L +AS+L A A LA ++ G+E HG  ++ G  
Sbjct  248   SGLVLNGMNTDALEIFRWLLRENLRPNTLTMASILPACAGLAALKLGKELHGNILKHGLD  307

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 V S+LI MY+K G ++L   VFK +  ++ I +NSM+++   +G   +A  +F   
Sbjct  308   KSFHVGSSLIGMYAKSGRVDLAHLVFKRLSERDAICWNSMLTSYSQNGKPEDAMDLFRH-  366

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDGRR-YFRIMNDEFGIQPKTEHYVYMVKLLGMA  1518
             +       D  +FSA+L  C +   +  G+  +  I+  EF      +    ++ +    
Sbjct  367   MGMGGVKYDCVSFSAILSVCANLPALHYGKEIHGFIIKSEFSSDIFAQS--ALIDMYAKC  424

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKV---EKSSYGV  1689
             G L  A  +  S++   +   W +++S    HG  +    + + + DN +     S  GV
Sbjct  425   GNLVIARHVFDSMEEKNEVS-WNSIISAYGYHGRLKDSLGLFRDMLDNGILPDHVSFVGV  483

Query  1690  MVSNMYAG  1713
             + + ++AG
Sbjct  484   LSACVHAG  491


 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 157/285 (55%), Gaps = 1/285 (0%)
 Frame = +1

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G E+D    S L+  Y   G + +A  VFD ++  D V WN M+ G+   G++  A+ +F
Sbjct  2     GFEVDIYAGSSLLQLYVNNGCIRDARHVFDKMSHKDCVSWNVMLHGYAKKGEFSNAVGIF  61

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
             ++M+    K ++ T+  ++      +++  G  +H L + +G +S++ V + L+++YS+C
Sbjct  62    MEMRSSEIKANAVTFSCVLSVCASEAMINFGTQLHGLVVAYGLESHSSVANTLIAVYSKC  121

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
               +  A ++FD +   D+V W+ MI G  Q+G + +A   F EM   G K D + +AS L
Sbjct  122   HILSDARKLFDMMPRTDVVRWNGMISGYIQNGFMSEASGLFDEMISAGVKPDSITLASFL  181

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
              +  Q   ++  +E HG+ +R     +V + SALID+YSKC  +++   +F      +++
Sbjct  182   PSVTQPFNLKQAKEIHGYIIRHCVPFDVYLKSALIDVYSKCRSVDMARNIFNQRTRTDVV  241

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                +MIS L L+G   +A +IF  +L +E   P+  T +++L AC
Sbjct  242   MCTAMISGLVLNGMNTDALEIFRWLL-RENLRPNTLTMASILPAC  285



>ref|XP_004135750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Cucumis sativus]
Length=762

 Score =   346 bits (888),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 189/526 (36%), Positives = 287/526 (55%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH I +   L      A  ++  Y+  + + +AR+LFD +PQ  +  WN II  Y +   
Sbjct  181   LHGIAVSCGLELDSPVANTLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGL  240

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A  LF+ M+ +G +PD+ TFA  L   ++       + +HG ++   + LD    S 
Sbjct  241   MGEAEHLFRGMISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSA  300

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A K+    +  D V   +MISG+   G  K+AL  F  + +   KP 
Sbjct  301   LIDIYFKCRDVEMAQKILCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPT  360

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T+  +       + L +GK +H   +K   D   HVGS ++ MY++C  +  ACR+F+
Sbjct  361   SVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFN  420

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D + W++MI   SQ+G   +A++ FR+M M+G + D + I+  LSA A L  +  
Sbjct  421   RITEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGTRYDCVSISGALSACANLPALHY  480

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  ++     ++   S+LIDMY+KCG LN   +VF  M  +N +S+NS+IS  G 
Sbjct  481   GKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRRVFDRMQERNEVSWNSIISAYGN  540

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG+  E   +F E+L +    PD  TF  ++ AC H G V +G RY+ +M +E+GI  + 
Sbjct  541   HGDLKECLALFHEML-RNGIQPDHVTFLGIISACGHAGQVDEGIRYYHLMTEEYGIPARM  599

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  +  + G AG L+EA+E I S+  P D G+WG LL  C IHGN  L  + +KHLFD
Sbjct  600   EHYACVADMFGRAGRLDEAFETINSMPFPPDAGVWGTLLGACHIHGNVELAEVASKHLFD  659

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                  S Y V+++N+ AG G+W  V K+R  M E    K+PG SWI
Sbjct  660   LDPLNSGYYVLLANVQAGAGKWRKVLKVRSIMKERGVRKVPGYSWI  705


 Score =   204 bits (520),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 129/419 (31%), Positives = 214/419 (51%), Gaps = 3/419 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K++H  +    L    F  + +I+ YA N  +  A+ LFD  PQ+   LWN ++
Sbjct  72    KSVKMGKIVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVML  131

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +     NA ++F +M  S  +P++ TFAC+L  C+ +        +HG  V  GLE
Sbjct  132   NGYVKNGDSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQLHGIAVSCGLE  191

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LDS  ++ L++ YSK   L+ A K+FD   + DLV WN +ISG+   G   +A  LF  M
Sbjct  192   LDSPVANTLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGLMGEAEHLFRGM  251

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                G KPDS T+   + C++    L+  K +H   ++     +  + S L+ +Y +C+ +
Sbjct  252   ISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSALIDIYFKCRDV  311

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A +I       D V  + MI G   +G   +AL+ FR +  +  K   +  +S+  A 
Sbjct  312   EMAQKILCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPTSVTFSSIFPAF  371

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A LA +  G+E HG  ++     +  V SA++DMY+KCG L+L  +VF  +  K+ I +N
Sbjct  372   AGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFNRITEKDAICWN  431

Query  1276  SMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             SMI++   +G   EA  +F ++ +E   Y  D  + S  L AC +   +  G+    +M
Sbjct  432   SMITSCSQNGRPGEAINLFRQMGMEGTRY--DCVSISGALSACANLPALHYGKEIHGLM  488


 Score =   190 bits (483),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/370 (30%), Positives = 195/370 (53%), Gaps = 1/370 (0%)
 Frame = +1

Query  289   YALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTF  468
             Y     +  A+ LF          WN +IR +    +F+ A   +  ML +G  PD +TF
Sbjct  2     YVRTGSLKDAKNLFYTLQLGCTSAWNWMIRGFTMMGQFNYALLFYLKMLGAGVSPDKYTF  61

Query  469   ACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAE  648
               +++AC         ++VH  V + GL+ D    S L+  Y++ G L +A  +FD I +
Sbjct  62    PYVVKACCGLKSVKMGKIVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQ  121

Query  649   PDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
              D V WN M++G+   GD   A+ +F++M+    KP+S T+  ++      ++L +G  +
Sbjct  122   KDSVLWNVMLNGYVKNGDSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQL  181

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             H + +  G + ++ V + L++MYS+C+C+ +A ++FD+  + D+V+W+ +I G  Q+G +
Sbjct  182   HGIAVSCGLELDSPVANTLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGLM  241

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
              +A   FR M   G K D +  AS L    +L  ++  +E HG+ +R    L+V + SAL
Sbjct  242   GEAEHLFRGMISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSAL  301

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             ID+Y KC  + +  ++     S + +   +MIS   L+G   EA + F  +++ E   P 
Sbjct  302   IDIYFKCRDVEMAQKILCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQ-ERMKPT  360

Query  1369  EATFSALLCA  1398
               TFS++  A
Sbjct  361   SVTFSSIFPA  370


 Score =   131 bits (329),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 179/388 (46%), Gaps = 9/388 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  I++  +    F  + +I  Y    D+  A+++  ++      +  ++I  Y   
Sbjct  280   KEIHGYIIRHAVVLDVFLKSALIDIYFKCRDVEMAQKILCQSSSFDTVVCTTMISGYVLN  339

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +   A + F+ ++    +P + TF+ I  A +     +  + +HG ++ + L+      
Sbjct  340   GKNKEALEAFRWLVQERMKPTSVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVG  399

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S ++  Y+K G L+ A +VF+ I E D + WNSMI+     G   +A+ LF +M   G +
Sbjct  400   SAILDMYAKCGRLDLACRVFNRITEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGTR  459

Query  754   PDSFTYVG-LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
              D  +  G L  C + P+ L  GK +H L +K    S+ +  S L+ MY++C  +  + R
Sbjct  460   YDCVSISGALSACANLPA-LHYGKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRR  518

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             +FD + E + V+W+++I      GD+ + L  F EM   G + D +    ++SA      
Sbjct  519   VFDRMQERNEVSWNSIISAYGNHGDLKECLALFHEMLRNGIQPDHVTFLGIISACGHAGQ  578

Query  1111  VQPG-RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIISYNSMI  1284
             V  G R  H      G    +   + + DM+ + G L+   +   +MP   +   + +++
Sbjct  579   VDEGIRYYHLMTEEYGIPARMEHYACVADMFGRAGRLDEAFETINSMPFPPDAGVWGTLL  638

Query  1285  SNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
                 +HGN   A     EV  K  ++ D
Sbjct  639   GACHIHGNVELA-----EVASKHLFDLD  661



>gb|KGN65963.1| hypothetical protein Csa_1G553510 [Cucumis sativus]
Length=848

 Score =   347 bits (890),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 189/526 (36%), Positives = 287/526 (55%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH I +   L      A  ++  Y+  + + +AR+LFD +PQ  +  WN II  Y +   
Sbjct  267   LHGIAVSCGLELDSPVANTLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGL  326

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A  LF+ M+ +G +PD+ TFA  L   ++       + +HG ++   + LD    S 
Sbjct  327   MGEAEHLFRGMISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSA  386

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A K+    +  D V   +MISG+   G  K+AL  F  + +   KP 
Sbjct  387   LIDIYFKCRDVEMAQKILCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPT  446

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T+  +       + L +GK +H   +K   D   HVGS ++ MY++C  +  ACR+F+
Sbjct  447   SVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFN  506

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D + W++MI   SQ+G   +A++ FR+M M+G + D + I+  LSA A L  +  
Sbjct  507   RITEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGTRYDCVSISGALSACANLPALHY  566

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  ++     ++   S+LIDMY+KCG LN   +VF  M  +N +S+NS+IS  G 
Sbjct  567   GKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRRVFDRMQERNEVSWNSIISAYGN  626

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG+  E   +F E+L +    PD  TF  ++ AC H G V +G RY+ +M +E+GI  + 
Sbjct  627   HGDLKECLALFHEML-RNGIQPDHVTFLGIISACGHAGQVDEGIRYYHLMTEEYGIPARM  685

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  +  + G AG L+EA+E I S+  P D G+WG LL  C IHGN  L  + +KHLFD
Sbjct  686   EHYACVADMFGRAGRLDEAFETINSMPFPPDAGVWGTLLGACHIHGNVELAEVASKHLFD  745

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                  S Y V+++N+ AG G+W  V K+R  M E    K+PG SWI
Sbjct  746   LDPLNSGYYVLLANVQAGAGKWRKVLKVRSIMKERGVRKVPGYSWI  791


 Score =   204 bits (520),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 129/419 (31%), Positives = 214/419 (51%), Gaps = 3/419 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K++H  +    L    F  + +I+ YA N  +  A+ LFD  PQ+   LWN ++
Sbjct  158   KSVKMGKIVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVML  217

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +     NA ++F +M  S  +P++ TFAC+L  C+ +        +HG  V  GLE
Sbjct  218   NGYVKNGDSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQLHGIAVSCGLE  277

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LDS  ++ L++ YSK   L+ A K+FD   + DLV WN +ISG+   G   +A  LF  M
Sbjct  278   LDSPVANTLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGLMGEAEHLFRGM  337

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                G KPDS T+   + C++    L+  K +H   ++     +  + S L+ +Y +C+ +
Sbjct  338   ISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSALIDIYFKCRDV  397

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A +I       D V  + MI G   +G   +AL+ FR +  +  K   +  +S+  A 
Sbjct  398   EMAQKILCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPTSVTFSSIFPAF  457

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A LA +  G+E HG  ++     +  V SA++DMY+KCG L+L  +VF  +  K+ I +N
Sbjct  458   AGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFNRITEKDAICWN  517

Query  1276  SMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             SMI++   +G   EA  +F ++ +E   Y  D  + S  L AC +   +  G+    +M
Sbjct  518   SMITSCSQNGRPGEAINLFRQMGMEGTRY--DCVSISGALSACANLPALHYGKEIHGLM  574


 Score =   195 bits (496),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/409 (28%), Positives = 210/409 (51%), Gaps = 1/409 (0%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + Q    +  +   K  HA  + + L+ +     R++  Y     +  A+ LF       
Sbjct  49    ILQACNDHTHLPQGKQSHAQAIVSGLAQNGDLGPRVLGMYVRTGSLKDAKNLFYTLQLGC  108

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
                WN +IR +    +F+ A   +  ML +G  PD +TF  +++AC         ++VH 
Sbjct  109   TSAWNWMIRGFTMMGQFNYALLFYLKMLGAGVSPDKYTFPYVVKACCGLKSVKMGKIVHE  168

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              V + GL+ D    S L+  Y++ G L +A  +FD I + D V WN M++G+   GD   
Sbjct  169   TVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVMLNGYVKNGDSGN  228

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
             A+ +F++M+    KP+S T+  ++      ++L +G  +H + +  G + ++ V + L++
Sbjct  229   AIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQLHGIAVSCGLELDSPVANTLLA  288

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             MYS+C+C+ +A ++FD+  + D+V+W+ +I G  Q+G + +A   FR M   G K D + 
Sbjct  289   MYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGLMGEAEHLFRGMISAGIKPDSIT  348

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
              AS L    +L  ++  +E HG+ +R    L+V + SALID+Y KC  + +  ++     
Sbjct  349   FASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSALIDIYFKCRDVEMAQKILCQSS  408

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             S + +   +MIS   L+G   EA + F  +++ E   P   TFS++  A
Sbjct  409   SFDTVVCTTMISGYVLNGKNKEALEAFRWLVQ-ERMKPTSVTFSSIFPA  456


 Score =   152 bits (384),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 153/310 (49%), Gaps = 1/310 (0%)
 Frame = +1

Query  463   TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
               A IL+AC+D       +  H   +VSGL  +     +++  Y + G L++A  +F  +
Sbjct  45    VLASILQACNDHTHLPQGKQSHAQAIVSGLAQNGDLGPRVLGMYVRTGSLKDAKNLFYTL  104

Query  643   AEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGK  822
                    WN MI G   +G +  ALL ++KM   G  PD +T+  ++        +++GK
Sbjct  105   QLGCTSAWNWMIRGFTMMGQFNYALLFYLKMLGAGVSPDKYTFPYVVKACCGLKSVKMGK  164

Query  823   NVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSG  1002
              VH      G   +  VGS L+ +Y+    +  A  +FD++ + D V W+ M+ G  ++G
Sbjct  165   IVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVMLNGYVKNG  224

Query  1003  DIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSS  1182
             D   A+  F EM     K + +  A VLS  A  A++  G + HG AV CG  L+  V++
Sbjct  225   DSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQLHGIAVSCGLELDSPVAN  284

Query  1183  ALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
              L+ MYSKC  L    ++F   P  +++S+N +IS    +G   EA  +F  ++      
Sbjct  285   TLLAMYSKCQCLQAARKLFDTSPQSDLVSWNGIISGYVQNGLMGEAEHLFRGMISAG-IK  343

Query  1363  PDEATFSALL  1392
             PD  TF++ L
Sbjct  344   PDSITFASFL  353


 Score =   130 bits (328),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 179/388 (46%), Gaps = 9/388 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  I++  +    F  + +I  Y    D+  A+++  ++      +  ++I  Y   
Sbjct  366   KEIHGYIIRHAVVLDVFLKSALIDIYFKCRDVEMAQKILCQSSSFDTVVCTTMISGYVLN  425

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +   A + F+ ++    +P + TF+ I  A +     +  + +HG ++ + L+      
Sbjct  426   GKNKEALEAFRWLVQERMKPTSVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVG  485

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S ++  Y+K G L+ A +VF+ I E D + WNSMI+     G   +A+ LF +M   G +
Sbjct  486   SAILDMYAKCGRLDLACRVFNRITEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGTR  545

Query  754   PDSFTYVG-LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
              D  +  G L  C + P+ L  GK +H L +K    S+ +  S L+ MY++C  +  + R
Sbjct  546   YDCVSISGALSACANLPA-LHYGKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRR  604

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             +FD + E + V+W+++I      GD+ + L  F EM   G + D +    ++SA      
Sbjct  605   VFDRMQERNEVSWNSIISAYGNHGDLKECLALFHEMLRNGIQPDHVTFLGIISACGHAGQ  664

Query  1111  VQPG-RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIISYNSMI  1284
             V  G R  H      G    +   + + DM+ + G L+   +   +MP   +   + +++
Sbjct  665   VDEGIRYYHLMTEEYGIPARMEHYACVADMFGRAGRLDEAFETINSMPFPPDAGVWGTLL  724

Query  1285  SNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
                 +HGN   A     EV  K  ++ D
Sbjct  725   GACHIHGNVELA-----EVASKHLFDLD  747


 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 92/201 (46%), Gaps = 1/201 (0%)
 Frame = +1

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             GK  H+  +  G   N  +G  ++ MY R   +  A  +F +L       W+ MI G + 
Sbjct  62    GKQSHAQAIVSGLAQNGDLGPRVLGMYVRTGSLKDAKNLFYTLQLGCTSAWNWMIRGFTM  121

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
              G    AL F+ +M   G   D      V+ A   L  V+ G+  H      G   +V V
Sbjct  122   MGQFNYALLFYLKMLGAGVSPDKYTFPYVVKACCGLKSVKMGKIVHETVNLMGLKEDVFV  181

Query  1177  SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY  1356
              S+LI +Y++ G L+    +F  +P K+ + +N M++    +G++  A +IF E+   E 
Sbjct  182   GSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVMLNGYVKNGDSGNAIKIFLEMRHSE-  240

Query  1357  YNPDEATFSALLCACCHTGLV  1419
               P+  TF+ +L  C    ++
Sbjct  241   IKPNSVTFACVLSVCASEAML  261



>ref|XP_008799870.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Phoenix dactylifera]
Length=702

 Score =   343 bits (879),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 296/530 (56%), Gaps = 4/530 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K LHA +L+  L+   +    ++R    ++    A  LF  T   +++LWN+++R    A
Sbjct  47    KHLHARLLRLGLNGDQYLLNLLLRSSFDSDQPAHALLLFHRTDHPNLYLWNTMVRGLVAA  106

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              R ++A  L+ DM   G  P+NFTF  +L+AC+   D      +H   + +G +LD    
Sbjct  107   DRMADAVHLYTDMRHEGLSPNNFTFPFVLKACARLLDLDTGVKIHAHALKAGFDLDVFVK  166

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + L+S Y+K G L+EA ++FD I   ++V W ++ISG+   G  ++AL +F +   M  +
Sbjct  167   TSLLSLYAKCGRLDEAQRLFDEIPVRNVVSWTAIISGYMGEGRLEEALDMFRRSLEMDLR  226

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PDSFT V ++        L+ GK +H      G   N  V + LV MY++C  M  A  +
Sbjct  227   PDSFTLVRVLTACSQLGDLKAGKWIHQYIEDKGMGMNVFVATSLVDMYTKCGSMDKARAV  286

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD ++E D+V+WSAMI G S +G   +AL+ F +M     + D   +  VLSA A+L  +
Sbjct  287   FDGMVEKDVVSWSAMIGGYSSNGLPQEALELFFQMQAANVRPDCYTMVGVLSACARLGAL  346

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G++         +     + +ALIDMY+KCG       VF+ M  K++I +N+MI+ L
Sbjct  347   ELGQQVSRLMDMSDFLSNPVLGTALIDMYAKCGSTAHAWTVFERMMEKDLIVWNAMITGL  406

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
              + G+   +F +F ++ EK    PD  TF  +LC+C HTGLV DGR+YF  MN  + + P
Sbjct  407   AMTGHGKVSFGLFAQI-EKMGIQPDGNTFIGILCSCTHTGLVEDGRKYFYSMNQVYNLTP  465

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
             + EHY  MV LLG AG LEEA+ LI+ +    +  +WGALL  C IH + +L  +V K L
Sbjct  466   RIEHYGCMVDLLGRAGLLEEAHRLIKEMPMEANAVVWGALLGGCRIHRHTQLAELVLKQL  525

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWIS  1797
              + + + S   V++SN+YA  GRWE   KLR+ M   KG  K PG+SW+ 
Sbjct  526   IELEPQNSGNYVLLSNIYATSGRWEDAAKLRLVMNE-KGIQKTPGRSWVE  574


 Score =   193 bits (490),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 127/463 (27%), Positives = 228/463 (49%), Gaps = 12/463 (3%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             + T   +HA  LK       F  T ++  YA    +  A+RLFDE P R++  W +II  
Sbjct  144   LDTGVKIHAHALKAGFDLDVFVKTSLLSLYAKCGRLDEAQRLFDEIPVRNVVSWTAIISG  203

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             Y    R   A  +F+  L+   RPD+FT   +L ACS   D    + +H  +   G+ ++
Sbjct  204   YMGEGRLEEALDMFRRSLEMDLRPDSFTLVRVLTACSQLGDLKAGKWIHQYIEDKGMGMN  263

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
                ++ LV  Y+K G +++A  VFDG+ E D+V W++MI G+   G  ++AL LF +MQ 
Sbjct  264   VFVATSLVDMYTKCGSMDKARAVFDGMVEKDVVSWSAMIGGYSSNGLPQEALELFFQMQA  323

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
                +PD +T VG++        L +G+ V  L     F SN  +G+ L+ MY++C     
Sbjct  324   ANVRPDCYTMVGVLSACARLGALELGQQVSRLMDMSDFLSNPVLGTALIDMYAKCGSTAH  383

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F+ ++E D++ W+AMI GL+ +G    +   F ++   G + D      +L +   
Sbjct  384   AWTVFERMMEKDLIVWNAMITGLAMTGHGKVSFGLFAQIEKMGIQPDGNTFIGILCSCTH  443

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFLNLGIQVFKAMP-SKNIISY  1272
               +V+ GR+ + +++   Y+L   +     ++D+  + G L    ++ K MP   N + +
Sbjct  444   TGLVEDGRK-YFYSMNQVYNLTPRIEHYGCMVDLLGRAGLLEEAHRLIKEMPMEANAVVW  502

Query  1273  NSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMN  1452
              +++    +H +   A  + ++++E E   P  +    LL     T    +     R++ 
Sbjct  503   GALLGGCRIHRHTQLAELVLKQLIELE---PQNSGNYVLLSNIYATSGRWEDAAKLRLVM  559

Query  1453  DEFGIQPKTEHYVYMVKLLGMAGEL---EEAYELIQSIQGPVD  1572
             +E GIQ KT    + V+L G+  E    ++++ L + I   +D
Sbjct  560   NEKGIQ-KTPGRSW-VELKGVVHEFHVGDKSHPLSKQIYSKLD  600


 Score =   147 bits (372),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/378 (27%), Positives = 190/378 (50%), Gaps = 15/378 (4%)
 Frame = +1

Query  505   FSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISG  684
             F  L+ +H  ++  GL  D    + L+ +         A+ +F     P+L  WN+M+ G
Sbjct  43    FQELKHLHARLLRLGLNGDQYLLNLLLRSSFDSDQPAHALLLFHRTDHPNLYLWNTMVRG  102

Query  685   HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFD  858
                      A+ L+  M+  G  P++FT+  ++    C  LL +  G  +H+  LK GFD
Sbjct  103   LVAADRMADAVHLYTDMRHEGLSPNNFTFPFVLKA--CARLLDLDTGVKIHAHALKAGFD  160

Query  859   SNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFR--  1032
              +  V + L+S+Y++C  +  A R+FD +   ++V+W+A+I G    G + +ALD FR  
Sbjct  161   LDVFVKTSLLSLYAKCGRLDEAQRLFDEIPVRNVVSWTAIISGYMGEGRLEEALDMFRRS  220

Query  1033  -EMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
              EM+++    D   +  VL+A +QL  ++ G+  H +    G  + V V+++L+DMY+KC
Sbjct  221   LEMDLRP---DSFTLVRVLTACSQLGDLKAGKWIHQYIEDKGMGMNVFVATSLVDMYTKC  277

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
             G ++    VF  M  K+++S+++MI     +G   EA ++F + ++     PD  T   +
Sbjct  278   GSMDKARAVFDGMVEKDVVSWSAMIGGYSSNGLPQEALELFFQ-MQAANVRPDCYTMVGV  336

Query  1390  LCACCHTGLVCDGRRYFRIMN-DEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGP  1566
             L AC   G +  G++  R+M+  +F   P       ++ +    G    A+ + + +   
Sbjct  337   LSACARLGALELGQQVSRLMDMSDFLSNPVLG--TALIDMYAKCGSTAHAWTVFERMMEK  394

Query  1567  VDFGIWGALLSCCDIHGN  1620
              D  +W A+++   + G+
Sbjct  395   -DLIVWNAMITGLAMTGH  411



>gb|ABR17838.1| unknown [Picea sitchensis]
Length=795

 Score =   345 bits (884),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/538 (34%), Positives = 301/538 (56%), Gaps = 4/538 (1%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S   +   + +H  I+           T +   Y     + +AR++FD  P+R +  WN+
Sbjct  132   SQSDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNA  191

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             II  Y++  +   A  LF +M  +G +P++ T   ++  C+        + +H   + SG
Sbjct  192   IIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSG  251

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             +E D +  + LV+ Y+K G +  A K+F+ +   D+  WN++I G+       +AL  F 
Sbjct  252   IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFN  311

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
             +MQ  G KP+S T V ++        L  G+ +H   ++ GF+SN  VG+ LV+MY++C 
Sbjct  312   RMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCG  371

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              + SA ++F+ + + ++V W+A+I G SQ G   +AL  F EM  +G K D   I SVL 
Sbjct  372   NVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLP  431

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A    ++ G++ HG+ +R G+   V V + L+D+Y+KCG +N   ++F+ MP ++++S
Sbjct  432   ACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVS  491

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             + +MI   G+HG+  +A  +F + +++     D   F+A+L AC H GLV  G +YF+ M
Sbjct  492   WTTMILAYGIHGHGEDALALFSK-MQETGTKLDHIAFTAILTACSHAGLVDQGLQYFQCM  550

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
               ++G+ PK EHY  +V LLG AG L+EA  +I+++    D  +WGALL  C IH N  L
Sbjct  551   KSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPDANVWGALLGACRIHCNIEL  610

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWIS  1797
             G   AKHLF+   + + Y V++SN+YA   RWE V KLR  M+  KG  K PG S ++
Sbjct  611   GEQAAKHLFELDPDNAGYYVLLSNIYAEAQRWEDVAKLRKMMKE-KGVKKQPGCSVVA  667


 Score =   231 bits (588),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/363 (34%), Positives = 209/363 (58%), Gaps = 6/363 (2%)
 Frame = +1

Query  328   FDETPQRS-IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFD  504
             F +T  R+   +W   I  Y +   ++ A +L+  M  +G  PD   F  +++AC  + D
Sbjct  76    FTQTDIRNNAVVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSD  135

Query  505   FSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISG  684
                 R VH  ++  G E D I  + L S Y+K G LE A +VFD + + D+V WN++I+G
Sbjct  136   LQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAG  195

Query  685   HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFD  858
             +   G   +AL LF +MQ  G KP+S T V ++    C  LL +  GK +H   ++ G +
Sbjct  196   YSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPV--CAHLLALEQGKQIHCYAIRSGIE  253

Query  859   SNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREM  1038
             S+  V + LV+MY++C  + +A ++F+ +   D+ +W+A+I G S +    +AL FF  M
Sbjct  254   SDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNRM  313

Query  1039  NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFL  1218
              ++G K + + + SVL A A L  ++ G++ HG+A+R G+     V +AL++MY+KCG +
Sbjct  314   QVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNV  373

Query  1219  NLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             N   ++F+ MP KN++++N++IS    HG+ +EA  +F E ++ +   PD     ++L A
Sbjct  374   NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIE-MQAQGIKPDSFAIVSVLPA  432

Query  1399  CCH  1407
             C H
Sbjct  433   CAH  435


 Score =   171 bits (433),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/376 (28%), Positives = 191/376 (51%), Gaps = 13/376 (3%)
 Frame = +1

Query  499   FDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMI  678
             F F G   +    VV+ L  + + +++ VSA +      +           + V W   I
Sbjct  39    FYFYGPSPLPTSTVVAQLRRNKVKTTREVSACANQTQFTQTD------IRNNAVVWKETI  92

Query  679   SGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFD  858
              G+   G W KAL L+ +MQR G  PD   ++ +I      S L+ G+ VH   +  GF+
Sbjct  93    IGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFE  152

Query  859   SNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREM  1038
             S+  VG+ L SMY++C  + +A ++FD + + D+V+W+A+I G SQ+G   +AL  F EM
Sbjct  153   SDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEM  212

Query  1039  NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFL  1218
              + G K +   + SV+   A L  ++ G++ H +A+R G   +V V + L++MY+KCG +
Sbjct  213   QVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNV  272

Query  1219  NLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             N   ++F+ MP +++ S+N++I    L+   +EA   F   ++     P+  T  ++L A
Sbjct  273   NTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNR-MQVRGIKPNSITMVSVLPA  331

Query  1399  CCHTGLVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVD  1572
             C H   +  G++   + I +   G +        +V +    G +  AY+L + +    +
Sbjct  332   CAHLFALEQGQQIHGYAIRS---GFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKK-N  387

Query  1573  FGIWGALLSCCDIHGN  1620
                W A++S    HG+
Sbjct  388   VVAWNAIISGYSQHGH  403



>ref|XP_004158080.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Cucumis sativus]
Length=762

 Score =   343 bits (881),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 190/526 (36%), Positives = 284/526 (54%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH I +   L      A  ++  Y+  + + +AR+LFD  PQ  +  WN II  Y +   
Sbjct  181   LHGIAVGCGLELDSPVANTLLAMYSKCQCLQAARKLFDTLPQSDLVSWNGIISGYVQNGL  240

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A  LF+ M+ +G +PD+ TFA  L   ++       + +HG ++   + LD    S 
Sbjct  241   MGEAEHLFRGMISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSA  300

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A K     +  D V   +MISG+   G  K+AL  F  + +   KP 
Sbjct  301   LIDIYFKCRDVEMAQKNLCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPT  360

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T+  +       + L +GK +H   +K   D   HVGS ++ MY++C  +  ACR+F+
Sbjct  361   SVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFN  420

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D + W++MI   SQ+G   +A++ FR+M M+G + D + I+  LSA A L  +  
Sbjct  421   RITEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGTRYDCVSISGALSACANLPALHY  480

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  ++     ++   S+LIDMY+KCG LN   +VF  M  KN +S+NS+IS  G 
Sbjct  481   GKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRRVFDRMQEKNEVSWNSIISAYGN  540

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG+  E   +F E+L +    PD  TF  ++ AC H G V +G RY+ +M +E+GI  + 
Sbjct  541   HGDLKECLALFHEML-RNGIQPDHVTFLGIISACGHAGQVDEGIRYYHLMTEEYGIPARM  599

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  +  + G AG L EA+E I S+  P D G+WG LL  C IHGN  L  + +KHLFD
Sbjct  600   EHYACVADMFGRAGRLHEAFETINSMPFPPDAGVWGTLLGACHIHGNVELAEVASKHLFD  659

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                  S Y V+++N+ AG G+W  V K+R  M E    K+PG SWI
Sbjct  660   LDPLNSGYYVLLANVQAGAGKWRKVLKVRSIMKERGVRKVPGYSWI  705


 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/419 (31%), Positives = 214/419 (51%), Gaps = 3/419 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K++H  +    L    F  + +I+ YA N  +  A+ LFD  PQ+   LWN ++
Sbjct  72    KSVKMGKIVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVML  131

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +     NA ++F +M  S  +P++ TFAC+L  C+ +        +HG  V  GLE
Sbjct  132   NGYVKNGDSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQLHGIAVGCGLE  191

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LDS  ++ L++ YSK   L+ A K+FD + + DLV WN +ISG+   G   +A  LF  M
Sbjct  192   LDSPVANTLLAMYSKCQCLQAARKLFDTLPQSDLVSWNGIISGYVQNGLMGEAEHLFRGM  251

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                G KPDS T+   + C++    L+  K +H   ++     +  + S L+ +Y +C+ +
Sbjct  252   ISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSALIDIYFKCRDV  311

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A +        D V  + MI G   +G   +AL+ FR +  +  K   +  +S+  A 
Sbjct  312   EMAQKNLCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQERMKPTSVTFSSIFPAF  371

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A LA +  G+E HG  ++     +  V SA++DMY+KCG L+L  +VF  +  K+ I +N
Sbjct  372   AGLAALNLGKELHGSIIKTKLDEKCHVGSAILDMYAKCGRLDLACRVFNRITEKDAICWN  431

Query  1276  SMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             SMI++   +G   EA  +F ++ +E   Y  D  + S  L AC +   +  G+    +M
Sbjct  432   SMITSCSQNGRPGEAINLFRQMGMEGTRY--DCVSISGALSACANLPALHYGKEIHGLM  488


 Score =   191 bits (484),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/370 (30%), Positives = 195/370 (53%), Gaps = 1/370 (0%)
 Frame = +1

Query  289   YALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTF  468
             Y     +  A+ LF          WN +IR +    +F+ A   +  ML +G  PD +TF
Sbjct  2     YVRTGSLKDAKNLFYTLQLGCTSAWNWMIRGFTMMGQFNYALLFYLKMLGAGVSPDKYTF  61

Query  469   ACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAE  648
               +++AC         ++VH  V + GL+ D    S L+  Y++ G L +A  +FD I +
Sbjct  62    PYVVKACCGLKSVKMGKIVHETVNLMGLKEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQ  121

Query  649   PDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
              D V WN M++G+   GD   A+ +F++M+    KP+S T+  ++      ++L +G  +
Sbjct  122   KDSVLWNVMLNGYVKNGDSGNAIKIFLEMRHSEIKPNSVTFACVLSVCASEAMLDLGTQL  181

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             H + +  G + ++ V + L++MYS+C+C+ +A ++FD+L + D+V+W+ +I G  Q+G +
Sbjct  182   HGIAVGCGLELDSPVANTLLAMYSKCQCLQAARKLFDTLPQSDLVSWNGIISGYVQNGLM  241

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
              +A   FR M   G K D +  AS L    +L  ++  +E HG+ +R    L+V + SAL
Sbjct  242   GEAEHLFRGMISAGIKPDSITFASFLPCVNELLSLKHCKEIHGYIIRHAVVLDVFLKSAL  301

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             ID+Y KC  + +  +      S + +   +MIS   L+G   EA + F  +++ E   P 
Sbjct  302   IDIYFKCRDVEMAQKNLCQSSSFDTVVCTTMISGYVLNGKNKEALEAFRWLVQ-ERMKPT  360

Query  1369  EATFSALLCA  1398
               TFS++  A
Sbjct  361   SVTFSSIFPA  370


 Score =   129 bits (325),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 95/393 (24%), Positives = 180/393 (46%), Gaps = 9/393 (2%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K +H  I++  +    F  + +I  Y    D+  A++   ++      +  ++I 
Sbjct  275   SLKHCKEIHGYIIRHAVVLDVFLKSALIDIYFKCRDVEMAQKNLCQSSSFDTVVCTTMIS  334

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y    +   A + F+ ++    +P + TF+ I  A +     +  + +HG ++ + L+ 
Sbjct  335   GYVLNGKNKEALEAFRWLVQERMKPTSVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDE  394

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
                  S ++  Y+K G L+ A +VF+ I E D + WNSMI+     G   +A+ LF +M 
Sbjct  395   KCHVGSAILDMYAKCGRLDLACRVFNRITEKDAICWNSMITSCSQNGRPGEAINLFRQMG  454

Query  739   RMGEKPDSFTYVG-LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
               G + D  +  G L  C + P+ L  GK +H L +K    S+ +  S L+ MY++C  +
Sbjct  455   MEGTRYDCVSISGALSACANLPA-LHYGKEIHGLMIKGPLRSDLYAESSLIDMYAKCGNL  513

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               + R+FD + E + V+W+++I      GD+ + L  F EM   G + D +    ++SA 
Sbjct  514   NFSRRVFDRMQEKNEVSWNSIISAYGNHGDLKECLALFHEMLRNGIQPDHVTFLGIISAC  573

Query  1096  AQLAIVQPG-RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIIS  1269
                  V  G R  H      G    +   + + DM+ + G L+   +   +MP   +   
Sbjct  574   GHAGQVDEGIRYYHLMTEEYGIPARMEHYACVADMFGRAGRLHEAFETINSMPFPPDAGV  633

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             + +++    +HGN   A     EV  K  ++ D
Sbjct  634   WGTLLGACHIHGNVELA-----EVASKHLFDLD  661



>ref|XP_010922662.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Elaeis guineensis]
Length=692

 Score =   340 bits (872),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 195/536 (36%), Positives = 296/536 (55%), Gaps = 4/536 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             ++    K LHA +L+  L    +    ++R    +     A  LF  T   +++LWN+++
Sbjct  31    RSFQELKHLHARLLRLGLDGDQYLLNLLLRSSFDSGQPAHALLLFRRTDHPNLYLWNNMV  90

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             R    A   ++A  L+ DM   G  P+NFTF  +L+AC+  FD      +H  V+ +G E
Sbjct  91    RGLVAADNMADAVHLYTDMRREGLSPNNFTFPFVLKACARLFDLDTGVKIHAHVLKAGFE  150

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LD    + L+  Y+K G L+EA ++FD +   ++V W ++ISG+   G   +AL +F + 
Sbjct  151   LDVFVKTSLLCLYAKCGLLDEAQRLFDEMPVRNVVSWTAIISGYMGEGRLVEALDMFRRS  210

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
               M  +PDSFT V ++        L+ G+ +H      G + N  V + LV MY++C  M
Sbjct  211   LEMDLRPDSFTLVRVLTACSQLGDLKTGEWIHQYIEDKGMEKNVFVATSLVDMYTKCGSM  270

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A  +FD ++E D+V+WSAMI G S SG   +AL+ F +M     + D   +  VLSA 
Sbjct  271   DKARAVFDGMVEKDVVSWSAMIGGYSSSGLPQEALELFFQMQAVNVRPDCFTMVGVLSAC  330

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A+L  ++ G++         +     + +ALIDMY+KCG       VFK M  K++I +N
Sbjct  331   ARLGALELGQQVSRQMDMNVFLSNPVLGTALIDMYAKCGSTAQAWTVFKRMMEKDVIVWN  390

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMND  1455
             +MI+ L + G+   +F +F ++ EK    PD  TF  +LC+C HTGLV DGR+YF  MN 
Sbjct  391   AMITGLAMTGHGKVSFGLFAQI-EKMGVQPDGNTFIGILCSCTHTGLVEDGRKYFYSMNR  449

Query  1456  EFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGG  1635
              + + P+ EHY  MV LLG AG LEEA+ LI+ +    +  +WGALL  C IH N +L  
Sbjct  450   VYNLTPRIEHYGCMVDLLGRAGLLEEAHRLIKEMPMEANAVVWGALLGGCRIHRNTQLAE  509

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWIS  1797
             +V K L + +   S   V++SN+YA  G+WE   KLR+ M+  KG  K PG+SWI 
Sbjct  510   LVLKQLIELEPRNSGNYVLLSNIYATSGKWEDAAKLRLVMKE-KGIQKTPGRSWIE  564



>ref|XP_008791010.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Phoenix dactylifera]
Length=696

 Score =   340 bits (872),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 192/527 (36%), Positives = 288/527 (55%), Gaps = 3/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +HA +LK+        ++ ++  YA      SA ++FDE P+R +  WN+++  Y +  +
Sbjct  128   IHANVLKSGFGSDIVVSSSLVGMYAKCYRYESAIQVFDEMPERDVACWNTVMSCYYQDGQ  187

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
              S   ++F  M   G  PD+ T+  +  AC+   D    R VH  +  +G  LD   SS 
Sbjct  188   ASRVLEVFGMMKSCGFEPDSVTYTTVFSACARLLDLETGRRVHEELARTGFVLDGFISSA  247

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             +V  Y K G L  A +VF+ I    +V WNSMI G+   GD    L LF +M   G +P 
Sbjct  248   IVDMYGKCGCLGSAREVFEQITTKSVVSWNSMIGGYSLKGDSNSCLELFSRMNMEGIRPT  307

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T   L++     S +R GK +H   ++   D +  + S LV +Y +C  +  A  +F 
Sbjct  308   STTMSSLLIACSRTSDIRCGKFIHGYLVRNHIDVDIFIASSLVDLYFKCANVAYAESVFK  367

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
             ++ + + V+W+ MI G + +G   KALDFF EM++ G ++D    ASVLSA AQL  ++ 
Sbjct  368   AMPKANAVSWNVMISGYATTGCYFKALDFFNEMSVYGARLDAFTFASVLSACAQLVALEQ  427

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             GRE H             V  AL+DMY+KCG +     VF  +P K+I+S+ SMI   G 
Sbjct  428   GREIHKQVRDHSLESNEMVMCALVDMYAKCGAVRDAKLVFDRLPVKDIVSWTSMIMAYGS  487

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG ++EA ++F E ++K    PD  TF A++ AC H GLV +GR YF  M   +GI+P  
Sbjct  488   HGRSDEALELFSE-MQKANVKPDRVTFLAVISACSHGGLVDEGRYYFNQMMYHYGIKPGI  546

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQG-PVDFGIWGALLSCCDIHGNYRLGGIVAKHLF  1656
             EHY  ++ LLG +G L+EAY ++++  G   D G+ G+L S C +H N  LG  VA+ L 
Sbjct  547   EHYSCLIDLLGRSGRLQEAYGILKNTPGLKADAGLLGSLFSACSLHRNLELGEEVARLLV  606

Query  1657  DNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             +   +  S  V++SNMYA  GRW+ V+K+R  +   +  K PG SWI
Sbjct  607   EMDPDDHSTYVVLSNMYASAGRWDDVRKVRAMIRDRRLKKNPGCSWI  653


 Score =   207 bits (526),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 247/497 (50%), Gaps = 15/497 (3%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M +   S L +   + ++++  KLLH+  +   L+ + + A  +I FY       SA  +
Sbjct  1     MDVEILSGLLKACVAGKSLAQGKLLHSKSISLGLNTNTYLAKDLINFYFSFNLFDSAWLV  60

Query  328   FDETPQRS-IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGT-RPDNFTFACILRACSDKF  501
             F+  P  S I LWN ++ AY++   +  A +LF  +L     +PD++T+   L+AC    
Sbjct  61    FESIPNPSGISLWNGLLSAYSKNRMYDEALRLFDRLLLFPRLKPDSYTYPSALKACGGLG  120

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
                    +H  V+ SG   D + SS LV  Y+K    E AI+VFD + E D+  WN+++S
Sbjct  121   AAKKGGSIHANVLKSGFGSDIVVSSSLVGMYAKCYRYESAIQVFDEMPERDVACWNTVMS  180

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGF  855
              +   G   + L +F  M+  G +PDS TY  +     C  LL +  G+ VH    + GF
Sbjct  181   CYYQDGQASRVLEVFGMMKSCGFEPDSVTYTTVFSA--CARLLDLETGRRVHEELARTGF  238

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
               +  + S +V MY +C C+GSA  +F+ +    +V+W++MI G S  GD    L+ F  
Sbjct  239   VLDGFISSAIVDMYGKCGCLGSAREVFEQITTKSVVSWNSMIGGYSLKGDSNSCLELFSR  298

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             MNM+G +     ++S+L A ++ + ++ G+  HG+ VR    +++ ++S+L+D+Y KC  
Sbjct  299   MNMEGIRPTSTTMSSLLIACSRTSDIRCGKFIHGYLVRNHIDVDIFIASSLVDLYFKCAN  358

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP--DEATFSAL  1389
             +     VFKAMP  N +S+N MIS     G   +A   F E+     Y    D  TF+++
Sbjct  359   VAYAESVFKAMPKANAVSWNVMISGYATTGCYFKALDFFNEM---SVYGARLDAFTFASV  415

Query  1390  LCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPV  1569
             L AC     +  GR   + + D   ++        +V +    G + +A  +   +  PV
Sbjct  416   LSACAQLVALEQGREIHKQVRDH-SLESNEMVMCALVDMYAKCGAVRDAKLVFDRL--PV  472

Query  1570  -DFGIWGALLSCCDIHG  1617
              D   W +++     HG
Sbjct  473   KDIVSWTSMIMAYGSHG  489


 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 117/427 (27%), Positives = 194/427 (45%), Gaps = 17/427 (4%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             + T + +H  + +T      F ++ I+  Y     + SAR +F++   +S+  WNS+I  
Sbjct  223   LETGRRVHEELARTGFVLDGFISSAIVDMYGKCGCLGSAREVFEQITTKSVVSWNSMIGG  282

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             Y+     ++  +LF  M   G RP + T + +L ACS   D    + +HG +V + +++D
Sbjct  283   YSLKGDSNSCLELFSRMNMEGIRPTSTTMSSLLIACSRTSDIRCGKFIHGYLVRNHIDVD  342

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
                +S LV  Y K   +  A  VF  + + + V WN MISG+   G + KAL  F +M  
Sbjct  343   IFIASSLVDLYFKCANVAYAESVFKAMPKANAVSWNVMISGYATTGCYFKALDFFNEMSV  402

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              G + D+FT+  ++        L  G+ +H        +SN  V   LV MY++C  +  
Sbjct  403   YGARLDAFTFASVLSACAQLVALEQGREIHKQVRDHSLESNEMVMCALVDMYAKCGAVRD  462

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +FD L   D+V+W++MI      G   +AL+ F EM     K D +   +V+SA + 
Sbjct  463   AKLVFDRLPVKDIVSWTSMIMAYGSHGRSDEALELFSEMQKANVKPDRVTFLAVISACSH  522

Query  1102  LAIVQPGRE-----THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
               +V  GR       + + ++ G    +   S LID+  + G L     + K  P     
Sbjct  523   GGLVDEGRYYFNQMMYHYGIKPG----IEHYSCLIDLLGRSGRLQEAYGILKNTPGLKAD  578

Query  1267  S--YNSMISNLGLHGNANEAFQIFEEV--LEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             +    S+ S   LH N     ++ EEV  L  E    D +T+  L       G   D R+
Sbjct  579   AGLLGSLFSACSLHRN----LELGEEVARLLVEMDPDDHSTYVVLSNMYASAGRWDDVRK  634

Query  1435  YFRIMND  1455
                ++ D
Sbjct  635   VRAMIRD  641



>ref|XP_007216378.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica]
 gb|EMJ17577.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica]
Length=710

 Score =   340 bits (872),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 196/550 (36%), Positives = 316/550 (57%), Gaps = 16/550 (3%)
 Frame = +1

Query  196   QTISTTK------LLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSI  354
             Q+++ TK       LHA+++ + +L ++ + +T++  FYA    +  A+ +FD    ++ 
Sbjct  41    QSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKLAAFYANCGRMAQAQVIFDGILLKNS  100

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             FLWN +IR YA       A  L+++ML  G + DNFT+  +L+AC D       R VH  
Sbjct  101   FLWNFMIRGYACNECSLKALVLYREMLSFGQKADNFTYPFVLKACGDLLLVETGRRVHSE  160

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             VVVSGLE D   ++ L++ YSK G +  A  +FD + E DL+ WN+MISG+    + +KA
Sbjct  161   VVVSGLESDIYVANALLAMYSKFGHMGLARMLFDRMLERDLISWNTMISGYVKNNNPRKA  220

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSL--LRIGKNVHSLCLKFGFD-SNAHVGSLL  885
             L +F +M + G K D  T +G++    C  L  L++GK +H+  ++   +  N  + + L
Sbjct  221   LEVFEEMGKAGLKADGTTLLGILSA--CAELLALKLGKEIHAYVVRKSVEIHNEFLTNSL  278

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             + MY  CK +  + R+FD +   D V+W+ MI G  Q+GD  ++L  F  M M+G +VD 
Sbjct  279   IEMYCNCKSLAYSRRLFDGVKWKDTVSWNCMIRGYEQNGDAFESLRLFCRMVMEGAEVDE  338

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
             + I ++L A  Q+  +Q G   H   V+ G+   + V +ALIDMYSKCG L+   +VF  
Sbjct  339   VTIITILGACDQINALQFGMSVHSCLVKKGFGANIIVGTALIDMYSKCGSLSCSRRVFDE  398

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
             +P KN++++++MIS  G HG   EA   + E++    + PDE   +++L AC H GLV +
Sbjct  399   IPRKNLVAWSAMISGYGAHGRGEEAISCYHELVANN-FTPDEGVLTSVLSACSHAGLVNE  457

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
             G+  F  M  E+ ++P   HY  +V LLG AG ++EAYELI++++      IW A LS C
Sbjct  458   GKHIFNRMTIEYNVKPGLAHYSCLVDLLGRAGHVDEAYELIKTMEVKPSSDIWAAFLSAC  517

Query  1606  DIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMP  1779
              +H N +L  + A+ +F+   +     + +SN+YA + RW+ V+++R  M   KG  K P
Sbjct  518   RLHKNVKLAEVSAQKVFEMHPKGVGSYICLSNIYASEKRWDDVERVRA-MVRSKGLKKPP  576

Query  1780  GKSWISNIKM  1809
             G S++   KM
Sbjct  577   GCSFVEVDKM  586


 Score =   160 bits (404),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 172/311 (55%), Gaps = 3/311 (1%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSI-CSSQLVSAYSKLGPLEEAIKVFDGIAEP  651
             IL++ ++   F   + +H  +V SG  L++   S++L + Y+  G + +A  +FDGI   
Sbjct  39    ILQSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKLAAFYANCGRMAQAQVIFDGILLK  98

Query  652   DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVH  831
             +   WN MI G+ C     KAL+L+ +M   G+K D+FTY  ++       L+  G+ VH
Sbjct  99    NSFLWNFMIRGYACNECSLKALVLYREMLSFGQKADNFTYPFVLKACGDLLLVETGRRVH  158

Query  832   SLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIM  1011
             S  +  G +S+ +V + L++MYS+   MG A  +FD +LE D+++W+ MI G  ++ +  
Sbjct  159   SEVVVSGLESDIYVANALLAMYSKFGHMGLARMLFDRMLERDLISWNTMISGYVKNNNPR  218

Query  1012  KALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS-VSSAL  1188
             KAL+ F EM   G K D   +  +LSA A+L  ++ G+E H + VR    +    ++++L
Sbjct  219   KALEVFEEMGKAGLKADGTTLLGILSACAELLALKLGKEIHAYVVRKSVEIHNEFLTNSL  278

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             I+MY  C  L    ++F  +  K+ +S+N MI     +G+A E+ ++F  ++  E    D
Sbjct  279   IEMYCNCKSLAYSRRLFDGVKWKDTVSWNCMIRGYEQNGDAFESLRLFCRMV-MEGAEVD  337

Query  1369  EATFSALLCAC  1401
             E T   +L AC
Sbjct  338   EVTIITILGAC  348



>emb|CBI31086.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   342 bits (876),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/536 (37%), Positives = 298/536 (56%), Gaps = 4/536 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
              +++  +++H  I         F  + +I+FY+ N  I  AR LFD  P +   LWN ++
Sbjct  161   NSVALGRVVHDKIQFMGFELDVFVGSSLIKFYSENGCIHDARYLFDRMPSKDGVLWNVML  220

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +   + NA  +F +M  + T P++ TFAC+L  C+ +   +    +HG VV SGLE
Sbjct  221   NGYVKNGDWDNATGVFMEMRRTETNPNSVTFACVLSVCASEIMINFGSQLHGLVVSSGLE  280

Query  556   LDSICSSQ--LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             +DS  ++   L+  Y K   +E A K+FD     D+V   +MISG+   G    AL +F 
Sbjct  281   MDSPVANTFALIDIYFKCRDVEMARKIFDQRTPVDIVVCTAMISGYVLNGMNNNALEIFR  340

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              + +   + +S T   ++      + L +GK +H   LK G   + +VGS ++ MY++C 
Sbjct  341   WLLQERMRANSVTLASVLPACAGLAALTLGKELHGHILKNGHGGSCYVGSAIMDMYAKCG  400

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +  A + F  + + D V W++MI   SQ+G   +A+D FR+M M G K D + I++ LS
Sbjct  401   RLDLAHQTFIGISDKDAVCWNSMITSCSQNGKPEEAIDLFRQMGMAGTKYDCVSISAALS  460

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A L  +  G+E H F +R  +  ++   SALIDMYSKCG L+L  +VF  M  KN +S
Sbjct  461   ACANLPALHYGKEIHAFMMRGAFRSDLFAESALIDMYSKCGNLDLACRVFDTMEEKNEVS  520

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +NS+I+  G HG   ++  +F  +L  +   PD  TF A++ AC H G V +G  YFR M
Sbjct  521   WNSIIAAYGNHGRLKDSLNLFHGML-GDGIQPDHVTFLAIISACGHAGQVDEGIHYFRCM  579

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              +E GI  + EHY  MV L G AG L EA+ +I S+    D G+WG LL  C +HGN  L
Sbjct  580   TEELGIMARMEHYACMVDLFGRAGRLNEAFGMINSMPFSPDAGVWGTLLGACRLHGNVEL  639

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
               + +++LFD   + S Y V++SN++A  G+WE V K+R  M E    K+PG SWI
Sbjct  640   AEVASRNLFDLDPQNSGYYVLLSNVHANAGQWESVLKIRSLMKERGVQKVPGCSWI  695


 Score =   196 bits (499),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 214/423 (51%), Gaps = 11/423 (3%)
 Frame = +1

Query  166   SLLTQLSRSNQT------ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             SL  QL    QT      +S  +  HA +L   + ++    T+++  Y L    + A+ +
Sbjct  44    SLAPQLVSILQTCTDPSGLSQGRQAHAQMLVNGIGYNGILGTKLLGMYVLCGAFLDAKNI  103

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             F +        WN +IR +    +F  A   +  ML  GT PD +TF  +++AC      
Sbjct  104   FYQLRLWCSEPWNWMIRGFTMMGQFDFALLFYFKMLGCGTLPDKYTFPYVIKACGGLNSV  163

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
             +  RVVH  +   G ELD    S L+  YS+ G + +A  +FD +   D V WN M++G+
Sbjct  164   ALGRVVHDKIQFMGFELDVFVGSSLIKFYSENGCIHDARYLFDRMPSKDGVLWNVMLNGY  223

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                GDW  A  +F++M+R    P+S T+  ++       ++  G  +H L +  G + ++
Sbjct  224   VKNGDWDNATGVFMEMRRTETNPNSVTFACVLSVCASEIMINFGSQLHGLVVSSGLEMDS  283

Query  868   HVGSL--LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMN  1041
              V +   L+ +Y +C+ +  A +IFD     D+V  +AMI G   +G    AL+ FR + 
Sbjct  284   PVANTFALIDIYFKCRDVEMARKIFDQRTPVDIVVCTAMISGYVLNGMNNNALEIFRWLL  343

Query  1042  MKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
              +  + + + +ASVL A A LA +  G+E HG  ++ G+     V SA++DMY+KCG L+
Sbjct  344   QERMRANSVTLASVLPACAGLAALTLGKELHGHILKNGHGGSCYVGSAIMDMYAKCGRLD  403

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCA  1398
             L  Q F  +  K+ + +NSMI++   +G   EA  +F ++ +    Y  D  + SA L A
Sbjct  404   LAHQTFIGISDKDAVCWNSMITSCSQNGKPEEAIDLFRQMGMAGTKY--DCVSISAALSA  461

Query  1399  CCH  1407
             C +
Sbjct  462   CAN  464



>ref|XP_002284799.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Vitis vinifera]
 emb|CBI18896.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   340 bits (871),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/532 (37%), Positives = 301/532 (57%), Gaps = 10/532 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             +L HA+ +K       F  + ++  Y        AR++FD  P+R+   W ++I  YA  
Sbjct  128   RLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVFDTMPERNSVSWATMISGYASQ  187

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                + A  LF+ M       + F F  +L A +     +  + +H   V +GL       
Sbjct  188   KLAAEALGLFRLMRREEEGENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVG  247

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + LV+ Y+K G L++A++ F+  ++ + + W++MI+G+   GD  KAL LF  M   G +
Sbjct  248   NALVTMYAKCGSLDDALQTFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSMHLSGIR  307

Query  754   PDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
             P  FT+VG+I  C D  +    GK VH   LK GF+S  +V + LV MY++C  +  A +
Sbjct  308   PSEFTFVGVINACSDLGAAWE-GKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARK  366

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
              FD L EPD+V W++MI G  Q+G+   AL  +  M M+G   + L +ASVL A + LA 
Sbjct  367   GFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMASVLKACSSLAA  426

Query  1111  VQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISN  1290
             ++ G++ H   V+ G+ LEV + SAL  MY+KCG L  G  VF+ MP++++IS+N+MIS 
Sbjct  427   LEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDGTLVFRRMPARDVISWNAMISG  486

Query  1291  LGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQ  1470
             L  +G   EA ++FEE ++ E   PD  TF  +L AC H GLV  G  YFR+M DEFG+ 
Sbjct  487   LSQNGCGKEALELFEE-MQLEGTKPDYVTFVNILSACSHMGLVERGWGYFRMMFDEFGMD  545

Query  1471  PKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVA  1644
             P+ EHY  MV +L  AG+L+EA E  +S    +D G  +W  +L  C  + NY LG    
Sbjct  546   PRVEHYACMVDILSRAGKLKEAIEFTES--ATIDHGMCLWRIILGACRNYRNYELGAYAG  603

Query  1645  KHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             + L +   ++SS  V++S++Y+  GRWE V+++R  M  ++G  K PG SWI
Sbjct  604   EKLMELGSQESSAYVLLSSIYSALGRWEDVERVR-RMMKLRGVSKEPGCSWI  654


 Score =   212 bits (540),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 132/441 (30%), Positives = 225/441 (51%), Gaps = 7/441 (2%)
 Frame = +1

Query  163   RSLLTQLSR--SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
             RS  T L +   N+++   K LHA I+K+  S   + A  ++  YA  + +  A+ +F+ 
Sbjct  7     RSFFTALLQYTHNRSLQKGKALHAQIIKSS-SSCVYIANSLVNLYAKCQRLREAKFVFER  65

Query  337   TPQRSIFLWNSIIRAYAR--AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFS  510
                + +  WN II  Y++      S+  +LF+ M    T P+  TFA +  A S   D +
Sbjct  66    IQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTAASTLVDAA  125

Query  511   GLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHG  690
             G R+ H   +      D    S L++ Y K G   EA KVFD + E + V W +MISG+ 
Sbjct  126   GGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVFDTMPERNSVSWATMISGYA  185

Query  691   CLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
                   +AL LF  M+R  E  + F +  ++  L  P L+  GK +H + +K G  S   
Sbjct  186   SQKLAAEALGLFRLMRREEEGENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVS  245

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
             VG+ LV+MY++C  +  A + F++  + + +TWSAMI G +QSGD  KAL  F  M++ G
Sbjct  246   VGNALVTMYAKCGSLDDALQTFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSMHLSG  305

Query  1051  GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGI  1230
              +        V++A + L     G++ H + ++ G+  ++ V +AL+DMY+KC  +    
Sbjct  306   IRPSEFTFVGVINACSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDAR  365

Query  1231  QVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHT  1410
             + F  +   +I+ + SMI     +G   +A  ++   +E E   P+E T +++L AC   
Sbjct  366   KGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGR-MEMEGILPNELTMASVLKACSSL  424

Query  1411  GLVCDGRR-YFRIMNDEFGIQ  1470
               +  G++ + R +   FG++
Sbjct  425   AALEQGKQIHARTVKYGFGLE  445



>ref|XP_006594225.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
isoform X1 [Glycine max]
Length=735

 Score =   340 bits (873),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 204/569 (36%), Positives = 317/569 (56%), Gaps = 15/569 (3%)
 Frame = +1

Query  118   VWRSYQLLHQMFIAFRSLLTQLSRSNQTISTTKL---LHAIILKTHLSHHPFYATRIIRF  288
             ++R   + H+  +     LT +  +  T+S ++     HA+ +KT  SH  F A+ ++  
Sbjct  101   LFRQLVMAHKTIVPNAHTLTGVFTAASTLSDSRAGRQAHALAVKTACSHDVFAASSLLNM  160

Query  289   YALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDML--DSGTRPDNF  462
             Y     +  AR LFDE P+R+   W ++I  YA       AF+LFK M   + G   + F
Sbjct  161   YCKTGLVFEARDLFDEMPERNAVSWATMISGYASQELADEAFELFKLMRHEEKGKNENEF  220

Query  463   TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
              F  +L A +     +  R VH   + +GL      ++ LV+ Y K G LE+A+K F+  
Sbjct  221   VFTSVLSALTCYMLVNTGRQVHSLAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFELS  280

Query  643   AEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIG  819
                + + W++M++G    GD  KAL LF  M + GE P  FT VG+I  C D  +++  G
Sbjct  281   GNKNSITWSAMVTGFAQFGDSDKALKLFYDMHQSGELPSEFTLVGVINACSDACAIVE-G  339

Query  820   KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQS  999
             + +H   LK G++   +V S LV MY++C  +  A + F+ + +PD+V W+++I G  Q+
Sbjct  340   RQMHGYSLKLGYELQLYVLSALVDMYAKCGSIVDARKGFECIQQPDVVLWTSIITGYVQN  399

Query  1000  GDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS  1179
             GD   AL+ + +M + G   + L +ASVL A + LA +  G++ H   ++  + LE+ + 
Sbjct  400   GDYEGALNLYGKMQLGGVIPNDLTMASVLKACSNLAALDQGKQMHAGIIKYNFSLEIPIG  459

Query  1180  SALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY  1359
             SAL  MY+KCG L+ G ++F  MP++++IS+N+MIS L  +G  NE  ++FE++   E  
Sbjct  460   SALSAMYAKCGSLDDGYRIFWRMPARDVISWNAMISGLSQNGRGNEGLELFEKMC-LEGT  518

Query  1360  NPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAY  1539
              PD  TF  LL AC H GLV  G  YF++M DEF I P  EHY  MV +L  AG+L EA 
Sbjct  519   KPDNVTFVNLLSACSHMGLVDRGWVYFKMMFDEFNIAPTVEHYACMVDILSRAGKLHEAK  578

Query  1540  ELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAG  1713
             E I+S    VD G  +W  LL+    H +Y LG    + L +    +SS  V++S++Y  
Sbjct  579   EFIES--ATVDHGLCLWRILLAASKNHRDYDLGAYAGEKLMELGSLESSAYVLLSSIYTA  636

Query  1714  DGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              G+WE V+++R  M+A +G  K PG SWI
Sbjct  637   LGKWEDVERVRGMMKA-RGVTKEPGCSWI  664


 Score =   182 bits (462),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/440 (28%), Positives = 213/440 (48%), Gaps = 10/440 (2%)
 Frame = +1

Query  136   LLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVS  315
             L HQ     R+L+   +R  Q +   + LHA IL T        A  +I  YA       
Sbjct  6     LSHQHLQVLRALV-HCTRHKQ-LRKGRALHARILVTGSFSSTQIANSLINLYAKCSHFSK  63

Query  316   ARRLFDETPQRSIFLWNSIIRAYA--RAHRFS-NAFQLFKD--MLDSGTRPDNFTFACIL  480
             A  +FD    + +  WN +I A++  +AH  S +   LF+   M      P+  T   + 
Sbjct  64    ANLVFDSINNKDVVSWNCLINAFSQQQAHAPSLHVMHLFRQLVMAHKTIVPNAHTLTGVF  123

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
              A S   D    R  H   V +    D   +S L++ Y K G + EA  +FD + E + V
Sbjct  124   TAASTLSDSRAGRQAHALAVKTACSHDVFAASSLLNMYCKTGLVFEARDLFDEMPERNAV  183

Query  661   QWNSMISGHGC--LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHS  834
              W +MISG+    L D    L   ++ +  G+  + F +  ++  L C  L+  G+ VHS
Sbjct  184   SWATMISGYASQELADEAFELFKLMRHEEKGKNENEFVFTSVLSALTCYMLVNTGRQVHS  243

Query  835   LCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMK  1014
             L +K G      V + LV+MY +C  +  A + F+     + +TWSAM+ G +Q GD  K
Sbjct  244   LAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFELSGNKNSITWSAMVTGFAQFGDSDK  303

Query  1015  ALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALID  1194
             AL  F +M+  G       +  V++A +    +  GR+ HG++++ GY L++ V SAL+D
Sbjct  304   ALKLFYDMHQSGELPSEFTLVGVINACSDACAIVEGRQMHGYSLKLGYELQLYVLSALVD  363

Query  1195  MYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEA  1374
             MY+KCG +    + F+ +   +++ + S+I+    +G+   A  ++ + ++     P++ 
Sbjct  364   MYAKCGSIVDARKGFECIQQPDVVLWTSIITGYVQNGDYEGALNLYGK-MQLGGVIPNDL  422

Query  1375  TFSALLCACCHTGLVCDGRR  1434
             T +++L AC +   +  G++
Sbjct  423   TMASVLKACSNLAALDQGKQ  442


 Score =   137 bits (344),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 102/413 (25%), Positives = 195/413 (47%), Gaps = 23/413 (6%)
 Frame = +1

Query  475   ILRA---CSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             +LRA   C+        R +H  ++V+G    +  ++ L++ Y+K     +A  VFD I 
Sbjct  13    VLRALVHCTRHKQLRKGRALHARILVTGSFSSTQIANSLINLYAKCSHFSKANLVFDSIN  72

Query  646   EPDLVQWNSMISGHGCLGDWKKAL--LLFIKMQRMGEK---PDSFTYVGLIMCLDCPSLL  810
               D+V WN +I+          +L  +   +   M  K   P++ T  G+       S  
Sbjct  73    NKDVVSWNCLINAFSQQQAHAPSLHVMHLFRQLVMAHKTIVPNAHTLTGVFTAASTLSDS  132

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
             R G+  H+L +K     +    S L++MY +   +  A  +FD + E + V+W+ MI G 
Sbjct  133   RAGRQAHALAVKTACSHDVFAASSLLNMYCKTGLVFEARDLFDEMPERNAVSWATMISGY  192

Query  991   SQSGDIMKALDFFREM--NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHL  1164
             +      +A + F+ M    KG   +  +  SVLSA     +V  GR+ H  A++ G   
Sbjct  193   ASQELADEAFELFKLMRHEEKGKNENEFVFTSVLSALTCYMLVNTGRQVHSLAMKNGLVC  252

Query  1165  EVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVL  1344
              VSV++AL+ MY KCG L   ++ F+   +KN I++++M++     G++++A ++F + +
Sbjct  253   IVSVANALVTMYVKCGSLEDALKTFELSGNKNSITWSAMVTGFAQFGDSDKALKLFYD-M  311

Query  1345  EKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGE  1524
              +    P E T   ++ AC     + +GR+     + + G + +      +V +    G 
Sbjct  312   HQSGELPSEFTLVGVINACSDACAIVEGRQ-MHGYSLKLGYELQLYVLSALVDMYAKCGS  370

Query  1525  LEEAYELIQSIQGPVDFGIWGALLS----------CCDIHGNYRLGGIVAKHL  1653
             + +A +  + IQ P D  +W ++++            +++G  +LGG++   L
Sbjct  371   IVDARKGFECIQQP-DVVLWTSIITGYVQNGDYEGALNLYGKMQLGGVIPNDL  422



>ref|XP_008245930.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like, 
partial [Prunus mume]
Length=643

 Score =   337 bits (864),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 287/526 (55%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +I+ + L      A  ++  Y+  + +  AR+LFD  PQ  +  WN +I  Y +   
Sbjct  66    LHGLIVASGLELDSPVANTLLAMYSKCQCLSEARKLFDMMPQTDLVTWNGMISGYIQNGF  125

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A +LF+ M+ S  +PD+ TFA  L + ++       + +HG +V   + LD    S 
Sbjct  126   MVEASRLFQAMISSSVKPDSITFASFLPSVAELASLKQGKEIHGYIVRHCVPLDVFLKSA  185

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   ++ A K+F+     D+V   +MISG    G    AL +F  + +   +P+
Sbjct  186   LIDVYFKCRNVDMARKIFNQSTRTDVVMCTAMISGLVLNGMNNDALDIFRWLLKEKMRPN  245

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T   ++        L++GK +H   LK G D   H+GS L  MY++   +  A ++F+
Sbjct  246   SLTLASVLPACAGLVALKLGKELHGNILKHGLDGRLHLGSALTDMYAKSGRLDLAHQVFE  305

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D + W++MI   SQ+G   +A+D FR+M M G K D + I++ LSA   L  +  
Sbjct  306   RMFERDTICWNSMITSYSQNGKPEEAIDIFRQMGMAGAKYDCVSISAALSACGNLPALHY  365

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HGF +R  +  ++   SALID+Y+KCG L L  +VF  M  KN +S+NS+IS  G 
Sbjct  366   GKEIHGFMIRSAFRSDLFAESALIDVYAKCGNLVLARRVFDMMEEKNEVSWNSIISAYGS  425

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   ++  +F E+L      PD  TF  +L AC H G V DG  YFR M +E+GI  + 
Sbjct  426   HGCLQDSVVLFREMLGNGIL-PDHVTFLGILSACGHAGQVDDGIFYFRCMIEEYGIPARL  484

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV L G AG L EA+E I+S+    D G+WG LL  C +HGN  L    ++HLFD
Sbjct  485   EHYACMVDLFGRAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFD  544

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
              + + S Y +++SN++A  G+W  V K+R  M E    K+PG SWI
Sbjct  545   VEPQNSGYYILLSNIHADAGKWGSVLKVRSLMKERGVQKVPGYSWI  590


 Score =   200 bits (509),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 194/359 (54%), Gaps = 3/359 (1%)
 Frame = +1

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             F E P +   LWN ++  Y +     NA  +F +M +S  +P+  TFACIL  C+ +   
Sbjct  1     FVEMPHKDGVLWNVMLHGYVKNGESKNAVGMFLEMRNSEIKPNAVTFACILSVCASEAMI  60

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
                  +HG +V SGLELDS  ++ L++ YSK   L EA K+FD + + DLV WN MISG+
Sbjct  61    GFGTQLHGLIVASGLELDSPVANTLLAMYSKCQCLSEARKLFDMMPQTDLVTWNGMISGY  120

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G   +A  LF  M     KPDS T+   +  +   + L+ GK +H   ++     + 
Sbjct  121   IQNGFMVEASRLFQAMISSSVKPDSITFASFLPSVAELASLKQGKEIHGYIVRHCVPLDV  180

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              + S L+ +Y +C+ +  A +IF+     D+V  +AMI GL  +G    ALD FR +  +
Sbjct  181   FLKSALIDVYFKCRNVDMARKIFNQSTRTDVVMCTAMISGLVLNGMNNDALDIFRWLLKE  240

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               + + L +ASVL A A L  ++ G+E HG  ++ G    + + SAL DMY+K G L+L 
Sbjct  241   KMRPNSLTLASVLPACAGLVALKLGKELHGNILKHGLDGRLHLGSALTDMYAKSGRLDLA  300

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCAC  1401
              QVF+ M  ++ I +NSMI++   +G   EA  IF ++ +    Y  D  + SA L AC
Sbjct  301   HQVFERMFERDTICWNSMITSYSQNGKPEEAIDIFRQMGMAGAKY--DCVSISAALSAC  357


 Score =   135 bits (341),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/410 (25%), Positives = 193/410 (47%), Gaps = 13/410 (3%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  ++    ++   K +H  I++  +    F  + +I  Y    ++  AR++F+
Sbjct  146   ITFASFLPSVAEL-ASLKQGKEIHGYIVRHCVPLDVFLKSALIDVYFKCRNVDMARKIFN  204

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             ++ +  + +  ++I         ++A  +F+ +L    RP++ T A +L AC+       
Sbjct  205   QSTRTDVVMCTAMISGLVLNGMNNDALDIFRWLLKEKMRPNSLTLASVLPACAGLVALKL  264

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG ++  GL+      S L   Y+K G L+ A +VF+ + E D + WNSMI+ +  
Sbjct  265   GKELHGNILKHGLDGRLHLGSALTDMYAKSGRLDLAHQVFERMFERDTICWNSMITSYSQ  324

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              G  ++A+ +F +M   G K D  +    L  C + P+ L  GK +H   ++  F S+  
Sbjct  325   NGKPEEAIDIFRQMGMAGAKYDCVSISAALSACGNLPA-LHYGKEIHGFMIRSAFRSDLF  383

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
               S L+ +Y++C  +  A R+FD + E + V+W+++I      G +  ++  FREM   G
Sbjct  384   AESALIDVYAKCGNLVLARRVFDMMEEKNEVSWNSIISAYGSHGCLQDSVVLFREMLGNG  443

Query  1051  GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRC-----GYHLEVSVSSALIDMYSKCGF  1215
                D +    +LSA      V  G     F  RC     G    +   + ++D++ + G 
Sbjct  444   ILPDHVTFLGILSACGHAGQVDDGI----FYFRCMIEEYGIPARLEHYACMVDLFGRAGR  499

Query  1216  LNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
             L+   +  K+MP S +   + +++    +HGN   A +    + + E  N
Sbjct  500   LSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDVEPQN  549



>ref|XP_008379914.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Malus domestica]
 ref|XP_008365536.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Malus domestica]
Length=711

 Score =   339 bits (869),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 200/553 (36%), Positives = 311/553 (56%), Gaps = 16/553 (3%)
 Frame = +1

Query  103   FSRDIVWRSYQLLHQ-MFIAFRSLLTQLSRSNQTISTTK------LLHAI-ILKTHLSHH  258
               + I   +  L HQ +   F SL  Q     Q+++ TK       LHA+ +   +L ++
Sbjct  12    LKKSICSSTLHLKHQSLSPPFTSL--QCGTIFQSLTKTKSFPKGQQLHAVAVTAGNLINN  69

Query  259   PFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLD  438
              + +T++  FYA    +  A+ +FD    ++ FLWN +IR YA       +  L+++ML 
Sbjct  70    TYLSTKLAAFYANCGKMPQAQLIFDGILLKNSFLWNFMIRGYACNGCPIKSLVLYREMLS  129

Query  439   SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEE  618
              G + DNFT+  +L+AC D       R VHG VVVSGLE D    + L++ YSK G +  
Sbjct  130   FGQKADNFTYPFVLKACGDLLVVEIGRTVHGEVVVSGLESDVYVGNALLAMYSKFGDMRL  189

Query  619   AIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDC  798
             A  VFD + E DL  WN+MISG    GD ++ L++F +M + G + D  + +G++    C
Sbjct  190   AGMVFDRMPERDLTSWNTMISGCVKNGDPREGLMIFEEMGKAGLRADGTSLLGILS--GC  247

Query  799   PSL--LRIGKNVHSLCLK-FGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTW  969
               L  L+ GK VH+  ++  G   N  + + L+ MY +CK    + R+FD +   D V+W
Sbjct  248   AELMALKEGKAVHAYVVRNSGEIHNEFLTNSLIEMYCKCKSAAYSRRLFDGVKLKDTVSW  307

Query  970   SAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVR  1149
             ++MI G  Q+GD  ++L  F +M M+G +VD + + SVL A  Q++ +Q G   H   V+
Sbjct  308   NSMISGYEQNGDAFESLRLFCQMVMEGAEVDEVTVTSVLGACDQISALQFGMSVHSCIVK  367

Query  1150  CGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQI  1329
              G+   + V +ALIDMYSKCG L+    VF  MP KN++S+++M+S  G HG   EA   
Sbjct  368   KGFGGNIFVGTALIDMYSKCGSLSCSRCVFDEMPVKNLVSWSAMVSGYGAHGRGEEAISC  427

Query  1330  FEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLL  1509
             + E++    + PDE   +++L AC H GLV +G+  F  M  E+ ++P   HY  +V LL
Sbjct  428   YHELVANN-FTPDEGVLTSVLSACSHAGLVNEGKDIFNRMTVEYNVKPGLAHYSCLVDLL  486

Query  1510  GMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGV  1689
             G AG ++EAYELI+S+Q      IW ALLS C +H N +L  I A+++F+   +     +
Sbjct  487   GRAGRIDEAYELIKSMQVEPSSDIWAALLSACRLHKNVKLAEIAAQNVFEMNPKGVGSYI  546

Query  1690  MVSNMYAGDGRWE  1728
              +SN+YA + RW+
Sbjct  547   CLSNIYASEKRWD  559



>ref|XP_008459124.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Cucumis melo]
Length=846

 Score =   342 bits (877),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 188/526 (36%), Positives = 286/526 (54%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH I +   L      A  ++  Y+  + + +AR+LFD  PQ  +  WN II  Y +   
Sbjct  265   LHGIAVSCGLELDSPVANTLLAMYSKCQCLQAARKLFDRMPQSDLVSWNGIISGYVQNGL  324

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
              S A  LF+ M+ +G +PD+ TFA  L   S+       + +HG +V   + LD    S 
Sbjct  325   MSEAENLFRGMISAGIKPDSITFASFLPCVSELLSLKHCKEIHGYIVRHAVVLDVFLKSA  384

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   ++ A K+    +  D V   +MISG+   G  K+AL  F  + +   KP 
Sbjct  385   LIDIYCKCRNMKMAQKILCQSSSFDTVVCTTMISGYVLNGMNKEALEAFRWLLQERLKPT  444

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T+  +       + L +GK +H   +K   D   HVGS ++ MY++C  +  ACR+F+
Sbjct  445   SVTFSSIFPAFAGLAALNLGKELHGSIIKTKLDEKCHVGSAVLDMYAKCGRLDLACRVFN  504

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D + W++MI   SQ+G   +A++ FR+M M+G + D + I+  LSA A L  +  
Sbjct  505   RMTEKDAICWNSMITSCSQNGRPGEAINLFRQMGMEGNRYDCVSISGALSACANLPALHY  564

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G++ HG  ++     ++   S+LIDMY+KCG LN   +VF  M  KN +S+NS+I   G 
Sbjct  565   GKQIHGLMIKGPLRSDLYAESSLIDMYAKCGNLNFSRRVFDRMQEKNEVSWNSIICAYGN  624

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG+  E   +F E+L +    PD  TF +++ AC H G V +G RY+ +M +E+GI  + 
Sbjct  625   HGDLKECLALFHEML-RNGIQPDHVTFLSIISACGHAGQVDEGIRYYHLMTEEYGIPARM  683

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
              HY  M  L G AG L+EA+E I S+  P D G+WG LL  C +HGN  L  + +K+LF+
Sbjct  684   HHYACMADLFGRAGRLDEAFETINSMPFPPDAGVWGTLLGACHVHGNVELAEVASKYLFE  743

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                  S Y V+++N+ AG G+W  V K+R  M E    K+PG SWI
Sbjct  744   LDPLNSGYYVLLANVQAGAGKWRKVLKVRSKMKERGVRKVPGYSWI  789


 Score =   208 bits (529),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 132/419 (32%), Positives = 215/419 (51%), Gaps = 3/419 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K++H  +    L    F  + +I+ YA N  +  A+ LFD  PQ+   LWN ++
Sbjct  156   KSVKMGKIVHETVNLMGLMEDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVML  215

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +     NA ++F +M  S  +P++ TFACIL  C+ +        +HG  V  GLE
Sbjct  216   NGYVKNGDSGNAIEIFLEMRHSEIKPNSVTFACILSVCASEAMLDLGTQLHGIAVSCGLE  275

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             LDS  ++ L++ YSK   L+ A K+FD + + DLV WN +ISG+   G   +A  LF  M
Sbjct  276   LDSPVANTLLAMYSKCQCLQAARKLFDRMPQSDLVSWNGIISGYVQNGLMSEAENLFRGM  335

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                G KPDS T+   + C+     L+  K +H   ++     +  + S L+ +Y +C+ M
Sbjct  336   ISAGIKPDSITFASFLPCVSELLSLKHCKEIHGYIVRHAVVLDVFLKSALIDIYCKCRNM  395

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A +I       D V  + MI G   +G   +AL+ FR +  +  K   +  +S+  A 
Sbjct  396   KMAQKILCQSSSFDTVVCTTMISGYVLNGMNKEALEAFRWLLQERLKPTSVTFSSIFPAF  455

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A LA +  G+E HG  ++     +  V SA++DMY+KCG L+L  +VF  M  K+ I +N
Sbjct  456   AGLAALNLGKELHGSIIKTKLDEKCHVGSAVLDMYAKCGRLDLACRVFNRMTEKDAICWN  515

Query  1276  SMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             SMI++   +G   EA  +F ++ +E   Y  D  + S  L AC +   +  G++   +M
Sbjct  516   SMITSCSQNGRPGEAINLFRQMGMEGNRY--DCVSISGALSACANLPALHYGKQIHGLM  572


 Score =   201 bits (511),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 208/399 (52%), Gaps = 1/399 (0%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   K  HA  +   L+ + +   R++  Y     +  A+ LF          WN +IR 
Sbjct  57    LPQAKQSHAQTIVRGLAQNGYLGPRVLGMYVRAGSLKDAKNLFYTLQLGCTSAWNWMIRG  116

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             +    +F+ A   +  ML +G  PD +TF  +++AC         ++VH  V + GL  D
Sbjct  117   FTMMGQFNYALLFYLKMLGAGVSPDKYTFPYVVKACCGLKSVKMGKIVHETVNLMGLMED  176

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
                 S L+  Y++ G L +A  +FD I + D V WN M++G+   GD   A+ +F++M+ 
Sbjct  177   VFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVMLNGYVKNGDSGNAIEIFLEMRH  236

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
                KP+S T+  ++      ++L +G  +H + +  G + ++ V + L++MYS+C+C+ +
Sbjct  237   SEIKPNSVTFACILSVCASEAMLDLGTQLHGIAVSCGLELDSPVANTLLAMYSKCQCLQA  296

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A ++FD + + D+V+W+ +I G  Q+G + +A + FR M   G K D +  AS L   ++
Sbjct  297   ARKLFDRMPQSDLVSWNGIISGYVQNGLMSEAENLFRGMISAGIKPDSITFASFLPCVSE  356

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
             L  ++  +E HG+ VR    L+V + SALID+Y KC  + +  ++     S + +   +M
Sbjct  357   LLSLKHCKEIHGYIVRHAVVLDVFLKSALIDIYCKCRNMKMAQKILCQSSSFDTVVCTTM  416

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             IS   L+G   EA + F  +L+ E   P   TFS++  A
Sbjct  417   ISGYVLNGMNKEALEAFRWLLQ-ERLKPTSVTFSSIFPA  454


 Score =   130 bits (327),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 96/392 (24%), Positives = 182/392 (46%), Gaps = 5/392 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  +S    ++   K +H  I++  +    F  + +I  Y    ++  A+++  
Sbjct  345   ITFASFLPCVSEL-LSLKHCKEIHGYIVRHAVVLDVFLKSALIDIYCKCRNMKMAQKILC  403

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             ++      +  ++I  Y        A + F+ +L    +P + TF+ I  A +     + 
Sbjct  404   QSSSFDTVVCTTMISGYVLNGMNKEALEAFRWLLQERLKPTSVTFSSIFPAFAGLAALNL  463

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG ++ + L+      S ++  Y+K G L+ A +VF+ + E D + WNSMI+    
Sbjct  464   GKELHGSIIKTKLDEKCHVGSAVLDMYAKCGRLDLACRVFNRMTEKDAICWNSMITSCSQ  523

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVG-LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              G   +A+ LF +M   G + D  +  G L  C + P+ L  GK +H L +K    S+ +
Sbjct  524   NGRPGEAINLFRQMGMEGNRYDCVSISGALSACANLPA-LHYGKQIHGLMIKGPLRSDLY  582

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
               S L+ MY++C  +  + R+FD + E + V+W+++IC     GD+ + L  F EM   G
Sbjct  583   AESSLIDMYAKCGNLNFSRRVFDRMQEKNEVSWNSIICAYGNHGDLKECLALFHEMLRNG  642

Query  1051  GKVDPLLIASVLSAAAQLAIVQPG-RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
              + D +   S++SA      V  G R  H      G    +   + + D++ + G L+  
Sbjct  643   IQPDHVTFLSIISACGHAGQVDEGIRYYHLMTEEYGIPARMHHYACMADLFGRAGRLDEA  702

Query  1228  IQVFKAMP-SKNIISYNSMISNLGLHGNANEA  1320
              +   +MP   +   + +++    +HGN   A
Sbjct  703   FETINSMPFPPDAGVWGTLLGACHVHGNVELA  734


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 95/206 (46%), Gaps = 1/206 (0%)
 Frame = +1

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             +LL   K  H+  +  G   N ++G  ++ MY R   +  A  +F +L       W+ MI
Sbjct  55    TLLPQAKQSHAQTIVRGLAQNGYLGPRVLGMYVRAGSLKDAKNLFYTLQLGCTSAWNWMI  114

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G +  G    AL F+ +M   G   D      V+ A   L  V+ G+  H      G  
Sbjct  115   RGFTMMGQFNYALLFYLKMLGAGVSPDKYTFPYVVKACCGLKSVKMGKIVHETVNLMGLM  174

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
              +V V S+LI +Y++ G L+    +F  +P K+ + +N M++    +G++  A +IF E+
Sbjct  175   EDVFVGSSLIKLYAENGHLSDAQYLFDNIPQKDSVLWNVMLNGYVKNGDSGNAIEIFLEM  234

Query  1342  LEKEYYNPDEATFSALLCACCHTGLV  1419
                E   P+  TF+ +L  C    ++
Sbjct  235   RHSE-IKPNSVTFACILSVCASEAML  259



>ref|XP_010920030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Elaeis guineensis]
Length=696

 Score =   338 bits (867),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 195/528 (37%), Positives = 287/528 (54%), Gaps = 5/528 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +HA +LK+        ++ ++  YA      SA ++FDE P+R +  WN+++  Y +  +
Sbjct  128   IHANVLKSGFGSDIVVSSSLVGVYAKCHRYESAIQVFDEMPERDVACWNTVMSCYYQDGQ  187

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
              S   ++F  M   G +PD+ T+  +  AC+   D      VH  +V +G  LD   SS 
Sbjct  188   ASKVLEVFGMMKSCGFKPDSVTYTTVFSACARLLDLETGWRVHEELVRTGFVLDGFVSSA  247

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             +V  Y K G L  A +VF+ I    +V WNSMI G+   GD    L LF +M   G +P 
Sbjct  248   IVDMYGKCGCLGSAREVFEQIPTKSVVSWNSMIGGYSLKGDSNSCLELFSRMNMEGVRPT  307

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T   L++     S +R GK +H   L+   D +  + S L+ +Y +C  +  A  +F 
Sbjct  308   STTMSSLLIACSRTSDMRRGKFIHGYLLRNLIDVDIFIASSLIDLYFKCANVAYAESVFK  367

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
             ++ + ++V+W+ MI G   +G   KALDFF EM + G + D    ASVLSA AQ+A ++ 
Sbjct  368   TMPKANVVSWNVMISGYVTAGCYFKALDFFNEMRVYGVRPDAFTFASVLSACAQVAALEQ  427

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             GRE H             V  AL+DMY+KCG +     VF  +P K+I+S+ SMI   G 
Sbjct  428   GREIHKQVSDHCLESNEMVMCALVDMYAKCGAVRDAKLVFDKLPVKDIVSWTSMIMAYGS  487

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG + EA ++F E ++K    PD  TF A + AC H GLV +GR YF  M   +GI+P  
Sbjct  488   HGQSTEALELFSE-MQKANVKPDRVTFLAAISACSHGGLVDEGRYYFNQMTRLYGIKPGI  546

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQG-PVDFGIWGALLSCCDIHGNYRLGGIVAKHLF  1656
             EHY  +V LLG +G L+EAY ++++  G   D G+ G+L S C +H N  LG  VA+ L 
Sbjct  547   EHYSCLVDLLGRSGRLQEAYSILKNTPGLKADAGLLGSLFSACSLHRNLELGEEVARLLV  606

Query  1657  DNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             +   +  S  +++SNMYA  GRW+ V+KLR  M   +G  K PG SWI
Sbjct  607   EMDPDDHSTYIVLSNMYASAGRWDDVRKLRA-MIRDRGLKKKPGCSWI  653


 Score =   221 bits (563),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 139/441 (32%), Positives = 231/441 (52%), Gaps = 9/441 (2%)
 Frame = +1

Query  148   MFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             M +   S L +   + ++++  KLLH+  +   L+ + + A  +I  Y       +AR +
Sbjct  1     MDVEMLSGLLKACVAGKSLAQGKLLHSKSISLGLNTNTYLAKALINLYVSFNLFDAARLV  60

Query  328   FDETPQRS-IFLWNSIIRAYARAHRFSNAFQLF-KDMLDSGTRPDNFTFACILRACSDKF  501
             F+     S I LWN ++ AY++ H +  A  LF + +L    +PD++T+  +L+AC    
Sbjct  61    FESVRNPSDISLWNGLLSAYSKNHMYDEALHLFDRLLLFPRLKPDSYTYPSVLKACGGLV  120

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
                    +H  V+ SG   D + SS LV  Y+K    E AI+VFD + E D+  WN+++S
Sbjct  121   AAKKGESIHANVLKSGFGSDIVVSSSLVGVYAKCHRYESAIQVFDEMPERDVACWNTVMS  180

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGF  855
              +   G   K L +F  M+  G KPDS TY  +     C  LL +  G  VH   ++ GF
Sbjct  181   CYYQDGQASKVLEVFGMMKSCGFKPDSVTYTTVFSA--CARLLDLETGWRVHEELVRTGF  238

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
               +  V S +V MY +C C+GSA  +F+ +    +V+W++MI G S  GD    L+ F  
Sbjct  239   VLDGFVSSAIVDMYGKCGCLGSAREVFEQIPTKSVVSWNSMIGGYSLKGDSNSCLELFSR  298

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             MNM+G +     ++S+L A ++ + ++ G+  HG+ +R    +++ ++S+LID+Y KC  
Sbjct  299   MNMEGVRPTSTTMSSLLIACSRTSDMRRGKFIHGYLLRNLIDVDIFIASSLIDLYFKCAN  358

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY-YNPDEATFSALL  1392
             +     VFK MP  N++S+N MIS     G   +A   F E+  + Y   PD  TF+++L
Sbjct  359   VAYAESVFKTMPKANVVSWNVMISGYVTAGCYFKALDFFNEM--RVYGVRPDAFTFASVL  416

Query  1393  CACCHTGLVCDGRRYFRIMND  1455
              AC     +  GR   + ++D
Sbjct  417   SACAQVAALEQGREIHKQVSD  437


 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 141/323 (44%), Gaps = 35/323 (11%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             SLL   SR++  +   K +H  +L+  +    F A+ +I  Y    ++  A  +F   P+
Sbjct  313   SLLIACSRTSD-MRRGKFIHGYLLRNLIDVDIFIASSLIDLYFKCANVAYAESVFKTMPK  371

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
              ++  WN +I  Y  A  +  A   F +M   G RPD FTFA +L AC+        R +
Sbjct  372   ANVVSWNVMISGYVTAGCYFKALDFFNEMRVYGVRPDAFTFASVLSACAQVAALEQGREI  431

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             H  V    LE + +    LV  Y+K G + +A  VFD +   D+V W SMI  +G  G  
Sbjct  432   HKQVSDHCLESNEMVMCALVDMYAKCGAVRDAKLVFDKLPVKDIVSWTSMIMAYGSHGQS  491

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGF-DSNAHVGSL  882
              +AL LF +MQ+   KPD  T++  I                S C   G  D   +  + 
Sbjct  492   TEALELFSEMQKANVKPDRVTFLAAI----------------SACSHGGLVDEGRYYFNQ  535

Query  883   LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVD  1062
             +  +Y                ++P +  +S ++  L +SG + +A    +  N  G K D
Sbjct  536   MTRLYG---------------IKPGIEHYSCLVDLLGRSGRLQEAYSILK--NTPGLKAD  578

Query  1063  PLLIASVLSAAAQLAIVQPGRET  1131
               L+ S+ SA +    ++ G E 
Sbjct  579   AGLLGSLFSACSLHRNLELGEEV  601



>ref|XP_002275537.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Vitis vinifera]
Length=694

 Score =   338 bits (867),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 180/529 (34%), Positives = 294/529 (56%), Gaps = 3/529 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K++H  ++K+  +      +  +  YA       A +LFDE P+R +  WN++I  Y + 
Sbjct  126   KMVHTHVIKSGFAMDVVVMSSAVGMYAKCNVFEDAIKLFDEMPERDVASWNNVISCYYQD  185

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +   A +LF++M  SG +PD+ T   ++ +C+   D    + +H  +V SG  LD   S
Sbjct  186   GQPEKALELFEEMKVSGFKPDSVTLTTVISSCARLLDLERGKEIHMELVRSGFALDGFVS  245

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S LV  Y K G LE A +VF+ I   ++V WNSMI+G+   GD K  + LF +M   G +
Sbjct  246   SALVDMYGKCGCLEMAKEVFEQIQRKNVVSWNSMIAGYSLKGDSKSCIELFRRMDEEGIR  305

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P   T   ++M       L++GK +H   ++   +++  V S L+ +Y +C  +GSA  +
Sbjct  306   PTLTTLSSILMACSRSVNLQLGKFIHGYIIRNRVEADIFVNSSLIDLYFKCGNIGSAENV  365

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F ++ + ++V+W+ MI G  + G  ++AL  F +M   G K D +   SVL A +QLA++
Sbjct  366   FQNMPKTNVVSWNVMISGYVKVGSYLEALVIFTDMRKAGVKPDAITFTSVLPACSQLAVL  425

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E H F +     +   V  AL+DMY+KCG ++  + +F  +P ++ +S+ SMI+  
Sbjct  426   EKGKEIHNFIIESKLEINEVVMGALLDMYAKCGAVDEALHIFNQLPERDFVSWTSMIAAY  485

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG A EA ++FE+ +++    PD+ TF A+L AC H GLV +G  YF  M  E+G +P
Sbjct  486   GSHGQAFEALKLFEK-MQQSDAKPDKVTFLAILSACSHAGLVDEGCYYFNQMIAEYGFKP  544

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQG-PVDFGIWGALLSCCDIHGNYRLGGIVAKH  1650
               EHY  ++ LLG  G L EAYE++Q       D G+   L S C +H    LG  + + 
Sbjct  545   AVEHYSCLIDLLGRVGRLREAYEILQRTPDIREDVGLLSTLFSACHLHKKLDLGEQIGRL  604

Query  1651  LFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             L +   +  S  +++SNMYA   +W+ V+K+R+ ++ +   K PG SWI
Sbjct  605   LIEKDPDDPSTYIILSNMYASVKKWDEVRKVRLKIKELGLKKNPGCSWI  653


 Score =   221 bits (562),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 154/478 (32%), Positives = 246/478 (51%), Gaps = 19/478 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD--ETPQRSIFLWNSIIRAYA  387
             KL+H  I+   L ++      +I  Y       SA+ +F   E P   I LWN ++ A  
Sbjct  23    KLIHQKIVSLGLQNNITLCKSLINLYFSCHLFQSAKLVFQTIENP-LDITLWNGLMAACT  81

Query  388   RAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDS  564
             +   F    ++F  +L     +PD FT+  +L+ACS        ++VH  V+ SG  +D 
Sbjct  82    KNFIFIEGLEVFHRLLHFPYLKPDAFTYPSVLKACSGLGRVGYGKMVHTHVIKSGFAMDV  141

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
             +  S  V  Y+K    E+AIK+FD + E D+  WN++IS +   G  +KAL LF +M+  
Sbjct  142   VVMSSAVGMYAKCNVFEDAIKLFDEMPERDVASWNNVISCYYQDGQPEKALELFEEMKVS  201

Query  745   GEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             G KPDS T   +I    C  LL +  GK +H   ++ GF  +  V S LV MY +C C+ 
Sbjct  202   GFKPDSVTLTTVIS--SCARLLDLERGKEIHMELVRSGFALDGFVSSALVDMYGKCGCLE  259

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A  +F+ +   ++V+W++MI G S  GD    ++ FR M+ +G +     ++S+L A +
Sbjct  260   MAKEVFEQIQRKNVVSWNSMIAGYSLKGDSKSCIELFRRMDEEGIRPTLTTLSSILMACS  319

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             +   +Q G+  HG+ +R     ++ V+S+LID+Y KCG +     VF+ MP  N++S+N 
Sbjct  320   RSVNLQLGKFIHGYIIRNRVEADIFVNSSLIDLYFKCGNIGSAENVFQNMPKTNVVSWNV  379

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MIS     G+  EA  IF + + K    PD  TF+++L AC    ++  G+    I N  
Sbjct  380   MISGYVKVGSYLEALVIFTD-MRKAGVKPDAITFTSVLPACSQLAVLEKGK---EIHN--  433

Query  1459  FGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
             F I+ K E + V M  LL M    G ++EA  +   +    DF  W ++++    HG 
Sbjct  434   FIIESKLEINEVVMGALLDMYAKCGAVDEALHIFNQLP-ERDFVSWTSMIAAYGSHGQ  490


 Score =   165 bits (417),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/323 (32%), Positives = 170/323 (53%), Gaps = 7/323 (2%)
 Frame = +1

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF  633
             D      +L+ C D       +++H  +V  GL+ +      L++ Y      + A  VF
Sbjct  2     DTTKLLSLLKTCIDSKYLKQGKLIHQKIVSLGLQNNITLCKSLINLYFSCHLFQSAKLVF  61

Query  634   DGIAEP-DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE-KPDSFTYVGLIMCLDCPSL  807
               I  P D+  WN +++       + + L +F ++      KPD+FTY  ++    C  L
Sbjct  62    QTIENPLDITLWNGLMAACTKNFIFIEGLEVFHRLLHFPYLKPDAFTYPSVLKA--CSGL  119

Query  808   LRIG--KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
              R+G  K VH+  +K GF  +  V S  V MY++C     A ++FD + E D+ +W+ +I
Sbjct  120   GRVGYGKMVHTHVIKSGFAMDVVVMSSAVGMYAKCNVFEDAIKLFDEMPERDVASWNNVI  179

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
                 Q G   KAL+ F EM + G K D + + +V+S+ A+L  ++ G+E H   VR G+ 
Sbjct  180   SCYYQDGQPEKALELFEEMKVSGFKPDSVTLTTVISSCARLLDLERGKEIHMELVRSGFA  239

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
             L+  VSSAL+DMY KCG L +  +VF+ +  KN++S+NSMI+   L G++    ++F   
Sbjct  240   LDGFVSSALVDMYGKCGCLEMAKEVFEQIQRKNVVSWNSMIAGYSLKGDSKSCIELFRR-  298

Query  1342  LEKEYYNPDEATFSALLCACCHT  1410
             +++E   P   T S++L AC  +
Sbjct  299   MDEEGIRPTLTTLSSILMACSRS  321



>gb|EYU38224.1| hypothetical protein MIMGU_mgv1a019053mg, partial [Erythranthe 
guttata]
Length=628

 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 198/531 (37%), Positives = 304/531 (57%), Gaps = 11/531 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             H++++K   S   F  + ++  YA    +  AR +FDE P R+   W+++I  YA     
Sbjct  63    HSLVVKLVESADVFVYSSMVNVYAKLGFLDEARNVFDEMPVRNSITWSTMISGYASRRLA  122

Query  403   SNAFQLFKDMLDSGTRPDN--FTFACILRACSDKFDFSGL-RVVHGGVVVSGLELDSICS  573
               AF +F+ ML  G   ++  F F  +L A +   +F  L + VH   + +GL       
Sbjct  123   DKAFGIFRWMLSGGAEEESNEFVFTSVLSAFTSP-EFVNLGKQVHCLAIKNGLSEIVSVG  181

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + +V+ Y+K G L+ +I++F+   E + + W++MI+GH   G+ +KAL LF  M   G K
Sbjct  182   NAVVTMYAKCGSLKNSIQMFELSTEKNSITWSAMITGHAHNGEGEKALALFHDMHSHGMK  241

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P  +T VG++        + IGK VH+  +K GF+   ++ + LV MY++C  +  A + 
Sbjct  242   PSEYTLVGVLNSCSDTEQINIGKQVHAYLVKAGFEHQMYITTSLVDMYAKCGYIVEAQKG  301

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD L EPD+V W++MI G  Q+GD  KA   +  M  KG   + L +ASVL A + L+ +
Sbjct  302   FDYLHEPDLVLWTSMIGGYVQNGDNEKAFSLYCTMQTKGIAPNELTMASVLKACSSLSSL  361

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G++ H   V+ G+ LEV + SAL  MYSKCG L+ G  VF+ MPS ++IS+N+MIS L
Sbjct  362   EQGKQVHAHVVKNGFSLEVPIGSALSTMYSKCGALDDGYSVFRRMPSVDVISWNAMISGL  421

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G  NEA ++FEE ++ E   PD  TF  +L AC H GLV  GR YF +M D+FG+ P
Sbjct  422   AQNGFGNEALELFEE-MQWENAKPDYVTFVNVLSACSHMGLVDRGREYFELMLDKFGLAP  480

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAK  1647
             + EHY  MV +LG AG+L EA E I+S    +D G  +W  LLS    + ++ +G    +
Sbjct  481   RVEHYACMVDVLGRAGKLLEAREFIES-AANIDHGLCLWRILLSASRNYRDFEMGIYAGE  539

Query  1648  HLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              L +    +SS  V++S++Y+  GR E V+++R  M   +G  K PG SWI
Sbjct  540   KLVELGSSESSAYVLLSSIYSALGRLEDVERVRRVMNT-RGVSKEPGCSWI  589


 Score =   186 bits (473),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 115/420 (27%), Positives = 217/420 (52%), Gaps = 10/420 (2%)
 Frame = +1

Query  358   LWNSIIRAYAR---AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             LWN +I  Y++   AH   ++ QLFK ML  G+ P++ TFA +  A     D       H
Sbjct  4     LWNVLINNYSQLGLAHHSLSSLQLFKQMLRHGSLPNSHTFAGVFSAAVVLEDAVMAHQAH  63

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               VV      D    S +V+ Y+KLG L+EA  VFD +   + + W++MISG+       
Sbjct  64    SLVVKLVESADVFVYSSMVNVYAKLGFLDEARNVFDEMPVRNSITWSTMISGYASRRLAD  123

Query  709   KALLLFIKMQRMG--EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSL  882
             KA  +F  M   G  E+ + F +  ++     P  + +GK VH L +K G      VG+ 
Sbjct  124   KAFGIFRWMLSGGAEEESNEFVFTSVLSAFTSPEFVNLGKQVHCLAIKNGLSEIVSVGNA  183

Query  883   LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVD  1062
             +V+MY++C  + ++ ++F+   E + +TWSAMI G + +G+  KAL  F +M+  G K  
Sbjct  184   VVTMYAKCGSLKNSIQMFELSTEKNSITWSAMITGHAHNGEGEKALALFHDMHSHGMKPS  243

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
                +  VL++ +    +  G++ H + V+ G+  ++ ++++L+DMY+KCG++    + F 
Sbjct  244   EYTLVGVLNSCSDTEQINIGKQVHAYLVKAGFEHQMYITTSLVDMYAKCGYIVEAQKGFD  303

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              +   +++ + SMI     +G+  +AF ++   ++ +   P+E T +++L AC     + 
Sbjct  304   YLHEPDLVLWTSMIGGYVQNGDNEKAFSLY-CTMQTKGIAPNELTMASVLKACSSLSSLE  362

Query  1423  DGRR-YFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              G++ +  ++ + F ++        +  +    G L++ Y + + +   VD   W A++S
Sbjct  363   QGKQVHAHVVKNGFSLEVPIGS--ALSTMYSKCGALDDGYSVFRRMP-SVDVISWNAMIS  419


 Score =   180 bits (457),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/323 (32%), Positives = 169/323 (52%), Gaps = 1/323 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F S+L+  + S + ++  K +H + +K  LS        ++  YA    + ++ ++F+ +
Sbjct  146   FTSVLSAFT-SPEFVNLGKQVHCLAIKNGLSEIVSVGNAVVTMYAKCGSLKNSIQMFELS  204

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
              +++   W+++I  +A       A  LF DM   G +P  +T   +L +CSD    +  +
Sbjct  205   TEKNSITWSAMITGHAHNGEGEKALALFHDMHSHGMKPSEYTLVGVLNSCSDTEQINIGK  264

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VH  +V +G E     ++ LV  Y+K G + EA K FD + EPDLV W SMI G+   G
Sbjct  265   QVHAYLVKAGFEHQMYITTSLVDMYAKCGYIVEAQKGFDYLHEPDLVLWTSMIGGYVQNG  324

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             D +KA  L+  MQ  G  P+  T   ++      S L  GK VH+  +K GF     +GS
Sbjct  325   DNEKAFSLYCTMQTKGIAPNELTMASVLKACSSLSSLEQGKQVHAHVVKNGFSLEVPIGS  384

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L +MYS+C  +     +F  +   D+++W+AMI GL+Q+G   +AL+ F EM  +  K 
Sbjct  385   ALSTMYSKCGALDDGYSVFRRMPSVDVISWNAMISGLAQNGFGNEALELFEEMQWENAKP  444

Query  1060  DPLLIASVLSAAAQLAIVQPGRE  1128
             D +   +VLSA + + +V  GRE
Sbjct  445   DYVTFVNVLSACSHMGLVDRGRE  467



>ref|XP_007212808.1| hypothetical protein PRUPE_ppa002835mg [Prunus persica]
 gb|EMJ14007.1| hypothetical protein PRUPE_ppa002835mg [Prunus persica]
Length=629

 Score =   335 bits (858),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/551 (34%), Positives = 303/551 (55%), Gaps = 17/551 (3%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD-ETPQRSI  354
             Q    ++++   K +HA +L     H P   T +I  Y+    +  A   F+ ++   ++
Sbjct  44    QACARHESLKKGKQIHAYMLTNGFLHSPLSITSLINMYSKCNQMDDAVSTFNYQSLDHNV  103

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             F +N++I  +       + F+ ++ M  +G  PD FTF C++RACS   +   +R +HG 
Sbjct  104   FAYNAVIAGFIANGLARHGFEFYRRMRLTGVVPDKFTFPCVIRACSGVLE---VRKIHGL  160

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             VV  GLELD    S LV+ Y KLG ++EA +VFD +   D+V WN+M++G   +G  ++A
Sbjct  161   VVKFGLELDVYIGSALVNTYLKLGLMDEAQEVFDELPVKDVVLWNAMVNGFAQIGRLEEA  220

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
             L++F  M   G  P  FT  G++           G+ VH   +K G+DS   V + L+ M
Sbjct  221   LVVFRMMGEEGVVPSRFTVTGVLSIFAVMGDFDNGRAVHGFAMKMGYDSGIEVLNALIDM  280

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +CKC+G A  IF+ ++E D+ +W++++    Q GD+   L  F  M   G   D + I
Sbjct  281   YGKCKCIGDALEIFEMMIEKDIYSWNSIMAVHEQCGDLDGTLRLFDRMLSAGVLPDLVTI  340

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS-------VSSALIDMYSKCGFLNLGIQ  1233
              +VL   + LA +  GRE HG+ ++ G   +V+       +++A++DMY+KCG +     
Sbjct  341   TTVLPVCSHLAALMHGREIHGYMIKNGLEKDVNEHVDDVQMTNAVMDMYAKCGSMRNAYM  400

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP-DEATFSALLCACCHT  1410
             +F  M +K++ S+N MI   G+HG  ++A  +F ++ E     P DE +F  +L AC H 
Sbjct  401   IFDKMRNKDVASWNIMIKGYGMHGYGSKALDMFSDMCEARI--PLDEVSFVGVLSACSHA  458

Query  1411  GLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGA  1590
             GLV +GR + R M  ++G+ P  EHY  +V +LG AG L+EAYEL+  +    +  +W A
Sbjct  459   GLVREGRDFLRQMKSKYGVVPNIEHYTCVVDMLGRAGHLQEAYELVLEMPIETNPVVWRA  518

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--EAI  1764
             LL+ C +HGN  L  + A+ + +     S   V++SN+Y  +GR+E V ++R  M  + +
Sbjct  519   LLAACRLHGNQDLAEVAAQKVNELDPGHSGNYVLMSNIYVANGRYEEVSEVRHTMRQQNV  578

Query  1765  KGKMPGKSWIS  1797
             K K PG SWI 
Sbjct  579   K-KTPGCSWIE  588


 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/393 (27%), Positives = 191/393 (49%), Gaps = 16/393 (4%)
 Frame = +1

Query  469   ACI--LRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
              CI  L+AC+        + +H  ++ +G     +  + L++ YSK   +++A+  F+  
Sbjct  38    TCISSLQACARHESLKKGKQIHAYMLTNGFLHSPLSITSLINMYSKCNQMDDAVSTFNYQ  97

Query  643   A-EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIG  819
             + + ++  +N++I+G    G  +     + +M+  G  PD FT+  +I    C  +L + 
Sbjct  98    SLDHNVFAYNAVIAGFIANGLARHGFEFYRRMRLTGVVPDKFTFPCVIRA--CSGVLEVR  155

Query  820   KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQS  999
             K +H L +KFG + + ++GS LV+ Y +   M  A  +FD L   D+V W+AM+ G +Q 
Sbjct  156   K-IHGLVVKFGLELDVYIGSALVNTYLKLGLMDEAQEVFDELPVKDVVLWNAMVNGFAQI  214

Query  1000  GDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS  1179
             G + +AL  FR M  +G       +  VLS  A +     GR  HGFA++ GY   + V 
Sbjct  215   GRLEEALVVFRMMGEEGVVPSRFTVTGVLSIFAVMGDFDNGRAVHGFAMKMGYDSGIEVL  274

Query  1180  SALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY  1359
             +ALIDMY KC  +   +++F+ M  K+I S+NS+++     G+ +   ++F+ +L     
Sbjct  275   NALIDMYGKCKCIGDALEIFEMMIEKDIYSWNSIMAVHEQCGDLDGTLRLFDRMLSAGVL  334

Query  1360  NPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMA-------  1518
              PD  T + +L  C H   +  GR     M    G++     +V  V++           
Sbjct  335   -PDLVTITTVLPVCSHLAALMHGREIHGYMIKN-GLEKDVNEHVDDVQMTNAVMDMYAKC  392

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             G +  AY +   ++   D   W  ++    +HG
Sbjct  393   GSMRNAYMIFDKMRNK-DVASWNIMIKGYGMHG  424



>ref|XP_007154904.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris]
 gb|ESW26898.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris]
Length=725

 Score =   337 bits (864),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 201/538 (37%), Positives = 297/538 (55%), Gaps = 12/538 (2%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +S  +L HA+ +KT  S   F A+ ++  Y     +  AR LFDE P R+   W ++I  
Sbjct  129   VSAGRLAHALAVKTACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMISG  188

Query  382   YARAHRFSNAFQLFKDML--DSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             YA       AF+LF+ +     G   + F F  +L A +        R VH   V +GL 
Sbjct  189   YASKEFVYEAFELFELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNGLV  248

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
                   + LV+ Y+K G LE+A+K F+     + + W++M++G    GD  KAL LF  M
Sbjct  249   CFVSVGNALVTMYAKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFYNM  308

Query  736   QRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
                G  P  +T VG+I  C D  + +  G+ +H   LK G++   +V S LV MY++C  
Sbjct  309   HHSGVLPSEYTLVGVINACSDVCATVE-GRQMHGYSLKLGYELQLYVLSALVDMYAKCGS  367

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP--LLIASVL  1086
             +G A + F+ + +PD+V W+++I G  Q+GD   AL+ + +M M  G+V P  L +ASVL
Sbjct  368   IGDARKGFEYIQQPDVVLWTSIITGYVQNGDYEGALNLYGKMQM--GRVIPNDLTMASVL  425

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
              A + LA +  G++ H   ++ G+ LE+ + SAL  MY+KCG L+ G ++F  MPS+++I
Sbjct  426   KACSNLAALDQGKQMHAGIIKYGFSLEIPIGSALSAMYAKCGSLDDGCRIFWRMPSRDVI  485

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             S+N+MIS L  +G   EA ++FEE+   E   PD  TF  LL AC H GLV  G  YF++
Sbjct  486   SWNAMISGLSQNGRGIEALKLFEEMC-SEGTKPDSVTFVNLLSACSHMGLVDRGWVYFKM  544

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M DEF I P  EHY  MV +L  AG+L EA E I+S        +W  LL  C  H NY 
Sbjct  545   MFDEFNIAPTVEHYACMVDILSRAGQLNEAKEFIESATVDHCLCLWRILLGACKNHRNYD  604

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             LG    + L +    +SS  V++S++Y   G+WE V+++R  M   +G  K PG SWI
Sbjct  605   LGAYAGEKLMELGSPESSAYVLLSSIYTALGKWEDVERVR-GMMKTRGVTKEPGCSWI  661


 Score =   197 bits (500),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/419 (28%), Positives = 216/419 (52%), Gaps = 6/419 (1%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N+ +S  ++LHA IL+         A  +I  YA    +  A  +FD    + +  WN +
Sbjct  22    NKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLVFDNIVHKDVVSWNCL  81

Query  373   IRAYARAHRFSN---AFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             I A+++    S+     +LF  M+   T P+  TFA +  A S+  D S  R+ H   V 
Sbjct  82    INAFSQQQAHSSSSHVMRLFHRMMACTTVPNAHTFAGVFTAASNLADVSAGRLAHALAVK  141

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +    D   +S L++ Y K G + EA ++FD +   + V W +MISG+       +A  L
Sbjct  142   TACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMISGYASKEFVYEAFEL  201

Query  724   F--IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
             F  ++ ++ G+  + F +  ++  L C   +  G+ VHSL +K G      VG+ LV+MY
Sbjct  202   FELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNGLVCFVSVGNALVTMY  261

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
             ++C  +  A + F+     + +TWSAM+ G +QSGD  KAL  F  M+  G       + 
Sbjct  262   AKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFYNMHHSGVLPSEYTLV  321

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
              V++A + +     GR+ HG++++ GY L++ V SAL+DMY+KCG +    + F+ +   
Sbjct  322   GVINACSDVCATVEGRQMHGYSLKLGYELQLYVLSALVDMYAKCGSIGDARKGFEYIQQP  381

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             +++ + S+I+    +G+   A  ++ + ++     P++ T +++L AC +   +  G++
Sbjct  382   DVVLWTSIITGYVQNGDYEGALNLYGK-MQMGRVIPNDLTMASVLKACSNLAALDQGKQ  439


 Score =   134 bits (336),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 97/397 (24%), Positives = 184/397 (46%), Gaps = 8/397 (2%)
 Frame = +1

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             P        L  C+   + S  RV+H  ++  G    +  ++ +++ Y+K G L EA  V
Sbjct  7     PQQVQVLRTLLHCTVNKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLV  66

Query  631   FDGIAEPDLVQWNSMISG---HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
             FD I   D+V WN +I+              + LF +M      P++ T+ G+       
Sbjct  67    FDNIVHKDVVSWNCLINAFSQQQAHSSSSHVMRLFHRMMACTTVPNAHTFAGVFTAASNL  126

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             + +  G+  H+L +K     +    S L+++Y +   +  A  +FD +   + V+W+ MI
Sbjct  127   ADVSAGRLAHALAVKTACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMI  186

Query  982   CGLSQSGDIMKALDFFREM--NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCG  1155
              G +    + +A + F  +    +G   +  +  SVLSA      V  GR+ H  AV+ G
Sbjct  187   SGYASKEFVYEAFELFELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNG  246

Query  1156  YHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFE  1335
                 VSV +AL+ MY+KCG L   ++ F+   +KN I++++M++     G+A++A ++F 
Sbjct  247   LVCFVSVGNALVTMYAKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFY  306

Query  1336  EVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGM  1515
               +      P E T   ++ AC       +GR+     + + G + +      +V +   
Sbjct  307   N-MHHSGVLPSEYTLVGVINACSDVCATVEGRQ-MHGYSLKLGYELQLYVLSALVDMYAK  364

Query  1516  AGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
              G + +A +  + IQ P D  +W ++++    +G+Y 
Sbjct  365   CGSIGDARKGFEYIQQP-DVVLWTSIITGYVQNGDYE  400



>gb|AEB39774.1| pentatricopeptide repeat protein 65 [Funaria hygrometrica]
Length=771

 Score =   338 bits (867),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/547 (34%), Positives = 301/547 (55%), Gaps = 3/547 (1%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             FR LL + +R  +++   + +HA ILK+ +  + +    ++  YA    +  ARR+FD  
Sbjct  99    FRGLLQECARL-RSLEQGREVHAAILKSGIQPNRYLENTLLSMYAKCGSLTDARRVFDGI  157

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               R+I  W ++I A+   ++   A++ ++ M  +G +PD  TF  +L A ++       +
Sbjct  158   RDRNIVSWTAMIEAFVAGNQNLEAYKCYETMKLAGCKPDKVTFVSLLNAFTNPELLQVGQ  217

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VH  +  +GLEL+    + LV  Y+K G + +A  +FD + E ++V W  +I+G+   G
Sbjct  218   KVHMEIAKAGLELEPRVGTSLVGMYAKCGDISKAQVIFDKLPEKNVVTWTLLIAGYAQQG  277

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
                 AL L  KMQ+    P+  TY  ++     P  L  GK VH   ++ G+     V +
Sbjct  278   QVDVALELLEKMQQAEVAPNKITYTSILQGCTTPLALEHGKKVHRYIIQSGYGREIWVVN  337

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L++MY +C  +  A ++F  L   D+VTW+AM+ G +Q G   +A+D FR M  +G K 
Sbjct  338   ALITMYCKCGGLKEARKLFGDLPHRDVVTWTAMVTGYAQLGFHDEAIDLFRRMQQQGIKP  397

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +   S L++ +  A +Q G+  H   V  GY L+V + SAL+ MY+KCG ++    VF
Sbjct  398   DKMTFTSALTSCSSPAFLQEGKSIHQQLVHAGYSLDVYLQSALVSMYAKCGSMDDARLVF  457

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               M  +N++++ +MI+    HG   EA + FE+ ++K+   PD+ TF+++L AC H GLV
Sbjct  458   NQMSERNVVAWTAMITGCAQHGRCREALEYFEQ-MKKQGIKPDKVTFTSVLSACTHVGLV  516

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +GR++FR M  ++GI+P  EHY   V LLG AG LEEA  +I ++       +WGALLS
Sbjct  517   EEGRKHFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLEEAENVILTMPFQPGPSVWGALLS  576

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKM  1776
              C IH +   G   A+++     +     V +SN+YA  GR+E  +K+R  ME     K 
Sbjct  577   ACRIHSDVERGERAAENVLKLDPDDDGAYVALSNIYAAAGRYEDAEKVRQVMEKRDVVKE  636

Query  1777  PGKSWIS  1797
             PG+SWI 
Sbjct  637   PGQSWIE  643


 Score =   201 bits (510),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/437 (28%), Positives = 220/437 (50%), Gaps = 9/437 (2%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F SLL   + + + +   + +H  I K  L   P   T ++  YA   DI  A+ +FD
Sbjct  198   VTFVSLLNAFT-NPELLQVGQKVHMEIAKAGLELEPRVGTSLVGMYAKCGDISKAQVIFD  256

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             + P++++  W  +I  YA+  +   A +L + M  +   P+  T+  IL+ C+       
Sbjct  257   KLPEKNVVTWTLLIAGYAQQGQVDVALELLEKMQQAEVAPNKITYTSILQGCTTPLALEH  316

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + VH  ++ SG   +    + L++ Y K G L+EA K+F  +   D+V W +M++G+  
Sbjct  317   GKKVHRYIIQSGYGREIWVVNALITMYCKCGGLKEARKLFGDLPHRDVVTWTAMVTGYAQ  376

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
             LG   +A+ LF +MQ+ G KPD  T+   +     P+ L+ GK++H   +  G+  + ++
Sbjct  377   LGFHDEAIDLFRRMQQQGIKPDKMTFTSALTSCSSPAFLQEGKSIHQQLVHAGYSLDVYL  436

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
              S LVSMY++C  M  A  +F+ + E ++V W+AMI G +Q G   +AL++F +M  +G 
Sbjct  437   QSALVSMYAKCGSMDDARLVFNQMSERNVVAWTAMITGCAQHGRCREALEYFEQMKKQGI  496

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFLNLG  1227
             K D +   SVLSA   + +V+ GR+ H  ++   Y ++  V   S  +D+  + G L   
Sbjct  497   KPDKVTFTSVLSACTHVGLVEEGRK-HFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLEEA  555

Query  1228  IQVFKAMPSKNIIS-YNSMISNLGLHGNANEAFQIFEEVLEKEYYNP-DEATFSALLCAC  1401
               V   MP +   S + +++S   +H +     +  E VL+    +P D+  + AL    
Sbjct  556   ENVILTMPFQPGPSVWGALLSACRIHSDVERGERAAENVLK---LDPDDDGAYVALSNIY  612

Query  1402  CHTGLVCDGRRYFRIMN  1452
                G   D  +  ++M 
Sbjct  613   AAAGRYEDAEKVRQVME  629


 Score =   192 bits (487),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/411 (27%), Positives = 208/411 (51%), Gaps = 5/411 (1%)
 Frame = +1

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
             R   A  +   M+  GTR  +  F  +L+ C+        R VH  ++ SG++ +    +
Sbjct  76    RLKEALGILNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLEN  135

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKP  756
              L+S Y+K G L +A +VFDGI + ++V W +MI          +A   +  M+  G KP
Sbjct  136   TLLSMYAKCGSLTDARRVFDGIRDRNIVSWTAMIEAFVAGNQNLEAYKCYETMKLAGCKP  195

Query  757   DSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
             D  T+V L+     P LL++G+ VH    K G +    VG+ LV MY++C  +  A  IF
Sbjct  196   DKVTFVSLLNAFTNPELLQVGQKVHMEIAKAGLELEPRVGTSLVGMYAKCGDISKAQVIF  255

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             D L E ++VTW+ +I G +Q G +  AL+   +M       + +   S+L        ++
Sbjct  256   DKLPEKNVVTWTLLIAGYAQQGQVDVALELLEKMQQAEVAPNKITYTSILQGCTTPLALE  315

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              G++ H + ++ GY  E+ V +ALI MY KCG L    ++F  +P ++++++ +M++   
Sbjct  316   HGKKVHRYIIQSGYGREIWVVNALITMYCKCGGLKEARKLFGDLPHRDVVTWTAMVTGYA  375

Query  1297  LHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR-YFRIMNDEFGIQP  1473
               G  +EA  +F   ++++   PD+ TF++ L +C     + +G+  + ++++  + +  
Sbjct  376   QLGFHDEAIDLFRR-MQQQGIKPDKMTFTSALTSCSSPAFLQEGKSIHQQLVHAGYSLDV  434

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
               +    +V +    G +++A  L+ +     +   W A+++ C  HG  R
Sbjct  435   YLQS--ALVSMYAKCGSMDDA-RLVFNQMSERNVVAWTAMITGCAQHGRCR  482


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 89/176 (51%), Gaps = 4/176 (2%)
 Frame = +1

Query  955   DMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETH  1134
             D +  S  +  L + G + +AL     M ++G +V   +   +L   A+L  ++ GRE H
Sbjct  60    DTLANSGDVSILCKQGRLKEALGILNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVH  119

Query  1135  GFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNAN  1314
                ++ G      + + L+ MY+KCG L    +VF  +  +NI+S+ +MI    + GN N
Sbjct  120   AAILKSGIQPNRYLENTLLSMYAKCGSLTDARRVFDGIRDRNIVSWTAMIEAF-VAGNQN  178

Query  1315  -EAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR-YFRIMNDEFGIQPK  1476
              EA++ + E ++     PD+ TF +LL A  +  L+  G++ +  I      ++P+
Sbjct  179   LEAYKCY-ETMKLAGCKPDKVTFVSLLNAFTNPELLQVGQKVHMEIAKAGLELEPR  233



>ref|XP_007154903.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris]
 gb|ESW26897.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris]
Length=732

 Score =   337 bits (864),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 201/538 (37%), Positives = 297/538 (55%), Gaps = 12/538 (2%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +S  +L HA+ +KT  S   F A+ ++  Y     +  AR LFDE P R+   W ++I  
Sbjct  129   VSAGRLAHALAVKTACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMISG  188

Query  382   YARAHRFSNAFQLFKDML--DSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             YA       AF+LF+ +     G   + F F  +L A +        R VH   V +GL 
Sbjct  189   YASKEFVYEAFELFELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNGLV  248

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
                   + LV+ Y+K G LE+A+K F+     + + W++M++G    GD  KAL LF  M
Sbjct  249   CFVSVGNALVTMYAKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFYNM  308

Query  736   QRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
                G  P  +T VG+I  C D  + +  G+ +H   LK G++   +V S LV MY++C  
Sbjct  309   HHSGVLPSEYTLVGVINACSDVCATVE-GRQMHGYSLKLGYELQLYVLSALVDMYAKCGS  367

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP--LLIASVL  1086
             +G A + F+ + +PD+V W+++I G  Q+GD   AL+ + +M M  G+V P  L +ASVL
Sbjct  368   IGDARKGFEYIQQPDVVLWTSIITGYVQNGDYEGALNLYGKMQM--GRVIPNDLTMASVL  425

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
              A + LA +  G++ H   ++ G+ LE+ + SAL  MY+KCG L+ G ++F  MPS+++I
Sbjct  426   KACSNLAALDQGKQMHAGIIKYGFSLEIPIGSALSAMYAKCGSLDDGCRIFWRMPSRDVI  485

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             S+N+MIS L  +G   EA ++FEE+   E   PD  TF  LL AC H GLV  G  YF++
Sbjct  486   SWNAMISGLSQNGRGIEALKLFEEMC-SEGTKPDSVTFVNLLSACSHMGLVDRGWVYFKM  544

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M DEF I P  EHY  MV +L  AG+L EA E I+S        +W  LL  C  H NY 
Sbjct  545   MFDEFNIAPTVEHYACMVDILSRAGQLNEAKEFIESATVDHCLCLWRILLGACKNHRNYD  604

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             LG    + L +    +SS  V++S++Y   G+WE V+++R  M   +G  K PG SWI
Sbjct  605   LGAYAGEKLMELGSPESSAYVLLSSIYTALGKWEDVERVR-GMMKTRGVTKEPGCSWI  661


 Score =   197 bits (500),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/419 (28%), Positives = 216/419 (52%), Gaps = 6/419 (1%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N+ +S  ++LHA IL+         A  +I  YA    +  A  +FD    + +  WN +
Sbjct  22    NKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLVFDNIVHKDVVSWNCL  81

Query  373   IRAYARAHRFSN---AFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             I A+++    S+     +LF  M+   T P+  TFA +  A S+  D S  R+ H   V 
Sbjct  82    INAFSQQQAHSSSSHVMRLFHRMMACTTVPNAHTFAGVFTAASNLADVSAGRLAHALAVK  141

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +    D   +S L++ Y K G + EA ++FD +   + V W +MISG+       +A  L
Sbjct  142   TACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMISGYASKEFVYEAFEL  201

Query  724   F--IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
             F  ++ ++ G+  + F +  ++  L C   +  G+ VHSL +K G      VG+ LV+MY
Sbjct  202   FELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNGLVCFVSVGNALVTMY  261

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
             ++C  +  A + F+     + +TWSAM+ G +QSGD  KAL  F  M+  G       + 
Sbjct  262   AKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFYNMHHSGVLPSEYTLV  321

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
              V++A + +     GR+ HG++++ GY L++ V SAL+DMY+KCG +    + F+ +   
Sbjct  322   GVINACSDVCATVEGRQMHGYSLKLGYELQLYVLSALVDMYAKCGSIGDARKGFEYIQQP  381

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             +++ + S+I+    +G+   A  ++ + ++     P++ T +++L AC +   +  G++
Sbjct  382   DVVLWTSIITGYVQNGDYEGALNLYGK-MQMGRVIPNDLTMASVLKACSNLAALDQGKQ  439


 Score =   133 bits (335),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 97/397 (24%), Positives = 184/397 (46%), Gaps = 8/397 (2%)
 Frame = +1

Query  451   PDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKV  630
             P        L  C+   + S  RV+H  ++  G    +  ++ +++ Y+K G L EA  V
Sbjct  7     PQQVQVLRTLLHCTVNKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLV  66

Query  631   FDGIAEPDLVQWNSMISG---HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
             FD I   D+V WN +I+              + LF +M      P++ T+ G+       
Sbjct  67    FDNIVHKDVVSWNCLINAFSQQQAHSSSSHVMRLFHRMMACTTVPNAHTFAGVFTAASNL  126

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             + +  G+  H+L +K     +    S L+++Y +   +  A  +FD +   + V+W+ MI
Sbjct  127   ADVSAGRLAHALAVKTACSEDVFAASSLLNLYCKTGLVAEARELFDEMPVRNAVSWATMI  186

Query  982   CGLSQSGDIMKALDFFREM--NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCG  1155
              G +    + +A + F  +    +G   +  +  SVLSA      V  GR+ H  AV+ G
Sbjct  187   SGYASKEFVYEAFELFELLRREKEGDNENEFVFTSVLSALTCHVFVDTGRQVHSLAVKNG  246

Query  1156  YHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFE  1335
                 VSV +AL+ MY+KCG L   ++ F+   +KN I++++M++     G+A++A ++F 
Sbjct  247   LVCFVSVGNALVTMYAKCGSLEDALKTFELSGNKNSITWSAMVTGFAQSGDADKALKLFY  306

Query  1336  EVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGM  1515
               +      P E T   ++ AC       +GR+     + + G + +      +V +   
Sbjct  307   N-MHHSGVLPSEYTLVGVINACSDVCATVEGRQ-MHGYSLKLGYELQLYVLSALVDMYAK  364

Query  1516  AGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
              G + +A +  + IQ P D  +W ++++    +G+Y 
Sbjct  365   CGSIGDARKGFEYIQQP-DVVLWTSIITGYVQNGDYE  400



>ref|XP_004150613.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like 
[Cucumis sativus]
 gb|KGN54641.1| hypothetical protein Csa_4G414410 [Cucumis sativus]
Length=603

 Score =   333 bits (854),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 192/549 (35%), Positives = 298/549 (54%), Gaps = 14/549 (3%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLF-DETPQRSI  354
             Q    +Q ++  K LH++++    S  P   T +I  Y+    +  A  +F D   +R++
Sbjct  19    QSCADHQNLNKGKQLHSLMITYGFSPSPPSITSLINMYSKCGQMGEAILVFYDPCHERNV  78

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             F +N+II  +      S  FQ +K M   G  PD +TF C++R C +  +   ++ +HG 
Sbjct  79    FAYNAIISGFVSNGLASKGFQFYKKMRLEGVMPDKYTFPCVVRTCCEVME---VKKIHGC  135

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             ++  GLELD    S LV+ Y K G +E+A KVF  ++  D+V WN+MI+G+  +G   +A
Sbjct  136   LLKMGLELDVFVGSALVNTYLKNGSMEDAQKVFGELSIRDVVLWNAMINGYAKIGCLDEA  195

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
             L +F +M   G  P  FT  G++        L  GK VH + +K G+DS   V + L+ M
Sbjct  196   LEVFRRMHVKGVAPSRFTITGILSVFASRGDLDNGKTVHGIVMKMGYDSGVSVSNALIDM  255

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +CK +G A  IF+ + E D+ +W+++I    Q GD    L  F +M   G   D + I
Sbjct  256   YGKCKHIGDALIIFEMINEKDIFSWNSIISVHEQCGDHDGTLRLFDKMLGSGILPDLVTI  315

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLE--------VSVSSALIDMYSKCGFLNLGI  1230
              +VL A + LA +  GRE HG+ +  G   +        + VS+A++DMY+KCG +N  +
Sbjct  316   TTVLPACSHLAALMHGREIHGYMIINGLGKDDENGAVDNLLVSNAVMDMYAKCGSMNNAL  375

Query  1231  QVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHT  1410
             ++F +M  K++ S+N MI   G+HG A EA  +F ++ E E + P+E T   +L AC H 
Sbjct  376   KIFDSMSKKDVASWNIMIMGYGMHGYALEALGMFSQMCEAE-FKPNEVTLVGVLSACNHA  434

Query  1411  GLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGA  1590
             G V  GR +   M   FG+ P  EHY  ++ +LG AG LE+AYE++Q +    +  +W A
Sbjct  435   GFVSHGRLFLAQMESTFGVIPTIEHYTCVIDMLGRAGHLEDAYEIVQKMPIQANPVVWRA  494

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIK  1767
             LL  C +HGN  L  I A+ +   + E     V++SN+Y   GR+E V ++R  M E   
Sbjct  495   LLGACRLHGNAELAEIAARQVLQLEPEHCGSYVLMSNVYGVIGRYEEVLEVRKTMKEQNV  554

Query  1768  GKMPGKSWI  1794
              K PG SWI
Sbjct  555   KKTPGCSWI  563


 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/388 (29%), Positives = 192/388 (49%), Gaps = 13/388 (3%)
 Frame = +1

Query  478   LRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF-DGIAEPD  654
             L++C+D  + +  + +H  ++  G        + L++ YSK G + EAI VF D   E +
Sbjct  18    LQSCADHQNLNKGKQLHSLMITYGFSPSPPSITSLINMYSKCGQMGEAILVFYDPCHERN  77

Query  655   LVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHS  834
             +  +N++ISG    G   K    + KM+  G  PD +T+  ++    C  ++ + K +H 
Sbjct  78    VFAYNAIISGFVSNGLASKGFQFYKKMRLEGVMPDKYTFPCVVR--TCCEVMEV-KKIHG  134

Query  835   LCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMK  1014
               LK G + +  VGS LV+ Y +   M  A ++F  L   D+V W+AMI G ++ G + +
Sbjct  135   CLLKMGLELDVFVGSALVNTYLKNGSMEDAQKVFGELSIRDVVLWNAMINGYAKIGCLDE  194

Query  1015  ALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALID  1194
             AL+ FR M++KG       I  +LS  A    +  G+  HG  ++ GY   VSVS+ALID
Sbjct  195   ALEVFRRMHVKGVAPSRFTITGILSVFASRGDLDNGKTVHGIVMKMGYDSGVSVSNALID  254

Query  1195  MYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEA  1374
             MY KC  +   + +F+ +  K+I S+NS+IS     G+ +   ++F+++L      PD  
Sbjct  255   MYGKCKHIGDALIIFEMINEKDIFSWNSIISVHEQCGDHDGTLRLFDKMLGSGIL-PDLV  313

Query  1375  TFSALLCACCHTGLVCDGRRY--FRIMN-----DEFGIQPKTEHYVYMVKLLGMAGELEE  1533
             T + +L AC H   +  GR    + I+N     DE G          ++ +    G +  
Sbjct  314   TITTVLPACSHLAALMHGREIHGYMIINGLGKDDENGAVDNLLVSNAVMDMYAKCGSMNN  373

Query  1534  AYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             A ++  S+    D   W  ++    +HG
Sbjct  374   ALKIFDSMSKK-DVASWNIMIMGYGMHG  400



>ref|XP_011101861.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Sesamum indicum]
Length=805

 Score =   337 bits (865),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 191/545 (35%), Positives = 303/545 (56%), Gaps = 4/545 (1%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             S L +    N  +   K +HA ++    S + +  T ++  YA    I  A ++F   P+
Sbjct  135   SYLLKACADNFDVRRGKEIHAQLILNGFSANLYAMTSVMNLYAKCGLIHEAYKMFYRMPE  194

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             R +  WN++I  +A+      A +L   M D G +PD  T   IL A +   +    R +
Sbjct  195   RDLVCWNTVIAGFAQNGMPKRALELVMMMQDEGHKPDMVTVVSILPASASIGNLRIGRSI  254

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             H  V+  GLE     ++ L+  Y+K G +  A ++FDG+    +V WNSM+ GH   G  
Sbjct  255   HTYVLRHGLESYVNIATALLDMYAKCGLIGTARRIFDGMGSRTVVSWNSMLDGHAQSGHS  314

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
             ++AL LF KM   G  P + T +G +      S ++ G+ +H L  + G  S+  V + L
Sbjct  315   EEALDLFQKMLDEGFNPSNVTVMGALHACANLSDIKRGQFIHELVDRLGLGSDVSVMNSL  374

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             +SMY +CK +  A  +F  L E  +V+W+AMI G +Q+G  ++A+  F +M  +  K+D 
Sbjct  375   ISMYCKCKRVDLAAELFYKLKEKTLVSWNAMILGYAQNGRTIEAITLFCKMQQQNMKLDS  434

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
               + SV++A A+L+ ++  +  HG A R   H  V V++AL+DMY+KCG ++   ++F  
Sbjct  435   FTLVSVITAVAELSGLRQAKWIHGLATRTCLHKNVFVTTALVDMYAKCGAVHTARKLFDM  494

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
             M  +++ ++N+MI   G HG   EA ++F+E+  K   NP++ TF  ++ AC H+GLV D
Sbjct  495   MDERHVTTWNAMIDGYGTHGFGKEAVELFDEMC-KGNINPNDVTFLCIISACSHSGLVRD  553

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
             GRRYF IM +E+G++P  +HY  +V LLG AG+LEEA++ IQ +       ++GA+L  C
Sbjct  554   GRRYFTIMKEEYGLEPSMDHYGAVVDLLGRAGQLEEAWDFIQEMPVEPGLNVYGAMLGAC  613

Query  1606  DIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMP  1779
              IH N  LG   A  LFD + +   Y V+++N+YA    WE V K+R  ME  KG  K P
Sbjct  614   KIHKNVDLGEKAADKLFDLEPDDGGYHVLLANIYAIASMWEKVAKVRTLMEK-KGIQKTP  672

Query  1780  GKSWI  1794
             G S +
Sbjct  673   GCSSV  677


 Score =   203 bits (517),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 202/368 (55%), Gaps = 0/368 (0%)
 Frame = +1

Query  229   IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSN  408
             +I+K  L H   + T+++  +     +  A ++FD    +   L++++++ YA+      
Sbjct  55    LIIKNGLYHEHLFQTKLVSLFCKFGSLNDAVKVFDPIESKIDPLYHTLLKGYAQQSNLDA  114

Query  409   AFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVS  588
             A + F  M   G     + F+ +L+AC+D FD    + +H  ++++G   +    + +++
Sbjct  115   ALKFFCRMKYDGVAQVVYNFSYLLKACADNFDVRRGKEIHAQLILNGFSANLYAMTSVMN  174

Query  589   AYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFT  768
              Y+K G + EA K+F  + E DLV WN++I+G    G  K+AL L + MQ  G KPD  T
Sbjct  175   LYAKCGLIHEAYKMFYRMPERDLVCWNTVIAGFAQNGMPKRALELVMMMQDEGHKPDMVT  234

Query  769   YVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLL  948
              V ++        LRIG+++H+  L+ G +S  ++ + L+ MY++C  +G+A RIFD + 
Sbjct  235   VVSILPASASIGNLRIGRSIHTYVLRHGLESYVNIATALLDMYAKCGLIGTARRIFDGMG  294

Query  949   EPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRE  1128
                +V+W++M+ G +QSG   +ALD F++M  +G     + +   L A A L+ ++ G+ 
Sbjct  295   SRTVVSWNSMLDGHAQSGHSEEALDLFQKMLDEGFNPSNVTVMGALHACANLSDIKRGQF  354

Query  1129  THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGN  1308
              H    R G   +VSV ++LI MY KC  ++L  ++F  +  K ++S+N+MI     +G 
Sbjct  355   IHELVDRLGLGSDVSVMNSLISMYCKCKRVDLAAELFYKLKEKTLVSWNAMILGYAQNGR  414

Query  1309  ANEAFQIF  1332
               EA  +F
Sbjct  415   TIEAITLF  422



>ref|XP_004499531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
[Cicer arietinum]
Length=697

 Score =   334 bits (857),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 190/532 (36%), Positives = 289/532 (54%), Gaps = 7/532 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K++H  ++KT L       + ++  YA       A ++FDE P + +  WN++I  Y ++
Sbjct  126   KMIHTCLMKTGLMVDIVVGSSLVGMYAKCNAFEYAVKMFDEMPDKDVACWNTVISCYYQS  185

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +F  A + F  M   G  PD+ T    + +C+  FD    R +H  ++ SG ELDS  S
Sbjct  186   GKFEEALRYFGMMRRFGFMPDSVTITTAISSCARLFDLERGREIHKELINSGFELDSFVS  245

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S LV  Y K G LE AI+VF+ + +  +V WNSMI+G+G  GD    + LF +M   G K
Sbjct  246   SALVDMYGKCGHLEMAIEVFEQMPKKTVVAWNSMITGYGFKGDCFSCIQLFKRMYDEGVK  305

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P   T   +IM       L  GK VH   ++     +  + S L+ +Y +C+ + SA  I
Sbjct  306   PTLTTLSSIIMACSRSVRLLEGKFVHGYIIRNRIQPDIFINSSLMDLYFKCRKVESAENI  365

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F  + +   V W+ MI G +  G + +AL+ F EM     + D +   SV++A +QLA +
Sbjct  366   FKLIPKTTAVYWNVMISGYATEGRLFEALNLFSEMRQSYAEPDAITFTSVVAACSQLAAL  425

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E H   +         V  AL+DMY+KCG ++    VFK +P ++++S+ SMI+  
Sbjct  426   EKGKEIHNLIIEKNLGNNEVVMGALLDMYAKCGAVDEAFGVFKCLPERDLVSWTSMITAY  485

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG   EA ++F E+L+     PD  TF A+L AC H GLV DG  +F  M + +GI+P
Sbjct  486   GSHGRVYEALKLFAEMLQSN-VKPDRVTFLAILSACGHAGLVDDGFYHFNQMINVYGIKP  544

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPV---DFGIWGALLSCCDIHGNYRLGGIVA  1644
             + EHY  ++ LLG AG L EAYE++Q  + P    D G+   L S C +H +  LG  +A
Sbjct  545   RVEHYSCLIALLGRAGRLHEAYEILQ--RNPEIRDDVGLLSTLFSACRLHRHLDLGVEIA  602

Query  1645  KHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWIS  1797
             + L D   + SS  +++SNMYA  GRW+ V+ +R  M+ +   K PG SWI 
Sbjct  603   EKLIDKDPDDSSTYIILSNMYASFGRWDEVRMVRSKMKELGLKKNPGCSWIE  654


 Score =   198 bits (504),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/485 (27%), Positives = 240/485 (49%), Gaps = 19/485 (4%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD--ETPQRSIFLW  363
             ++++++  KL+H  ++   L +  F+   +I  Y        A+ +FD  E P   I LW
Sbjct  15    NSKSLNQGKLIHQKVITFGLQNDVFFCKNLISLYVSCHMYDYAKHVFDAVENPCE-ISLW  73

Query  364   NSIIRAYARAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             N ++  Y + + +  A +LF  ++     +PD++T+  +L+AC         +++H  ++
Sbjct  74    NGLMAGYTKNYMYVEALELFDKLMHYPYLKPDSYTYPSVLKACGGLCRVVLGKMIHTCLM  133

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
              +GL +D +  S LV  Y+K    E A+K+FD + + D+  WN++IS +   G +++AL 
Sbjct  134   KTGLMVDIVVGSSLVGMYAKCNAFEYAVKMFDEMPDKDVACWNTVISCYYQSGKFEEALR  193

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSL--LRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
              F  M+R G  PDS T    I    C  L  L  G+ +H   +  GF+ ++ V S LV M
Sbjct  194   YFGMMRRFGFMPDSVTITTAIS--SCARLFDLERGREIHKELINSGFELDSFVSSALVDM  251

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +C  +  A  +F+ + +  +V W++MI G    GD    +  F+ M  +G K     +
Sbjct  252   YGKCGHLEMAIEVFEQMPKKTVVAWNSMITGYGFKGDCFSCIQLFKRMYDEGVKPTLTTL  311

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS  1254
             +S++ A ++   +  G+  HG+ +R     ++ ++S+L+D+Y KC  +     +FK +P 
Sbjct  312   SSIIMACSRSVRLLEGKFVHGYIIRNRIQPDIFINSSLMDLYFKCRKVESAENIFKLIPK  371

Query  1255  KNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
                + +N MIS     G   EA  +F E + + Y  PD  TF++++ AC     +  G+ 
Sbjct  372   TTAVYWNVMISGYATEGRLFEALNLFSE-MRQSYAEPDAITFTSVVAACSQLAALEKGKE  430

Query  1435  YFR-IMNDEFGIQPKTEHYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSC  1602
                 I+    G      + V M  LL M    G ++EA+ + + +    D   W ++++ 
Sbjct  431   IHNLIIEKNLG-----NNEVVMGALLDMYAKCGAVDEAFGVFKCLP-ERDLVSWTSMITA  484

Query  1603  CDIHG  1617
                HG
Sbjct  485   YGSHG  489


 Score =   177 bits (450),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/323 (33%), Positives = 175/323 (54%), Gaps = 7/323 (2%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEP-  651
             +LRAC +    +  +++H  V+  GL+ D      L+S Y      + A  VFD +  P 
Sbjct  9     LLRACVNSKSLNQGKLIHQKVITFGLQNDVFFCKNLISLYVSCHMYDYAKHVFDAVENPC  68

Query  652   DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE-KPDSFTYVGLIMCLDCPSLLRI--GK  822
             ++  WN +++G+     + +AL LF K+      KPDS+TY  ++    C  L R+  GK
Sbjct  69    EISLWNGLMAGYTKNYMYVEALELFDKLMHYPYLKPDSYTYPSVLKA--CGGLCRVVLGK  126

Query  823   NVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSG  1002
              +H+  +K G   +  VGS LV MY++C     A ++FD + + D+  W+ +I    QSG
Sbjct  127   MIHTCLMKTGLMVDIVVGSSLVGMYAKCNAFEYAVKMFDEMPDKDVACWNTVISCYYQSG  186

Query  1003  DIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSS  1182
                +AL +F  M   G   D + I + +S+ A+L  ++ GRE H   +  G+ L+  VSS
Sbjct  187   KFEEALRYFGMMRRFGFMPDSVTITTAISSCARLFDLERGREIHKELINSGFELDSFVSS  246

Query  1183  ALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
             AL+DMY KCG L + I+VF+ MP K ++++NSMI+  G  G+     Q+F+ + + E   
Sbjct  247   ALVDMYGKCGHLEMAIEVFEQMPKKTVVAWNSMITGYGFKGDCFSCIQLFKRMYD-EGVK  305

Query  1363  PDEATFSALLCACCHTGLVCDGR  1431
             P   T S+++ AC  +  + +G+
Sbjct  306   PTLTTLSSIIMACSRSVRLLEGK  328



>ref|XP_010250424.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Nelumbo nucifera]
Length=724

 Score =   335 bits (859),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 189/547 (35%), Positives = 314/547 (57%), Gaps = 7/547 (1%)
 Frame = +1

Query  157   AFRS--LLTQLSRSNQTISTTKLLHAIILKTHL-SHHPFYATRIIRFYALNEDIVSARRL  327
             AF S  L + L  S  T+++ K +H+ +  T L   +P  + +II  Y+   D  SAR L
Sbjct  46    AFESGCLYSHLLHSCNTLNSLKQIHSSLSTTGLIKQNPHLSAQIIIKYSKFGDPGSARSL  105

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD     + FLWN++IRAYA  +      +L+  M  +G  P+N+TF  +L A + +   
Sbjct  106   FDVIRGSNSFLWNTMIRAYALGNHSIETIELYLLMRKTGVGPNNYTFPFVLNAYASRSSL  165

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
                ++VHG V+ +G E D    + LV  Y+K G  ++  +VFD +++ DLV W +MI+ +
Sbjct  166   FEGKMVHGDVIRTGFESDMFVEAALVDMYAKCGDTDDGWRVFDKMSKRDLVSWTAMITAY  225

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                   +++L+LF KMQ+ G   DS   V +   +     +R  ++VH   ++ GF  + 
Sbjct  226   EQSEKAEESLVLFQKMQQEGFLADSVAMVSVASAVSQLGDVRRAQSVHGYIIRNGFLEDV  285

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              VG+ +++MY++C  +  A  IFD + E D ++W++M+ G +Q+G   +AL  F +M + 
Sbjct  286   FVGNSIIAMYAKCGNVEGARLIFDLMKERDGISWNSMLSGYTQNGQASEALLLFDQMQVL  345

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K  P+    V+S+ A L  +  G++ HGF +     +++++ +A+IDMY+KCG L+  
Sbjct  346   GVKPSPVTALIVVSSCAYLGSLHLGKKIHGFIINSKMGVDITLWNAIIDMYAKCGDLDSA  405

Query  1228  IQVFKAMPS--KNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             IQ+F   P   +N+IS+N MI+  G+HG   EA +++ + ++++   P+  TF+++L AC
Sbjct  406   IQMFNNSPQGERNVISWNVMITAYGVHGCGQEALKLYSQ-MQEQGIEPNHITFTSILSAC  464

Query  1402  CHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI  1581
              H GLV +GR+ F  M  +  ++ + +HY  MV +LG AG L+EA +LI  +       +
Sbjct  465   SHNGLVSEGRKIFEDMR-KLSVKHEVKHYACMVDMLGRAGFLDEALDLIMEMPSEPSDEV  523

Query  1582  WGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEA  1761
             WGALL  C IHG   LG   AK+LF  + + + Y V++SN+YA   RW+ V KLR DM++
Sbjct  524   WGALLLACRIHGKTELGEFAAKNLFHLEPDHTGYYVLMSNIYAASSRWQDVGKLRQDMKS  583

Query  1762  IKGKMPG  1782
                K P 
Sbjct  584   KGLKKPA  590



>ref|XP_009342639.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Pyrus x bretschneideri]
Length=840

 Score =   338 bits (866),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/548 (36%), Positives = 296/548 (54%), Gaps = 3/548 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F  +L+ L  S   I     LH +++   L      A  ++  Y+  +    AR+LFD
Sbjct  242   VTFACILS-LCASEAMIGFGTQLHGLVVACGLESDSPVANTLLAMYSKCQCFSDARKLFD  300

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
               P+  +  WN +I  Y ++     A +LF+DM+ +  +PD+ TFA  L + ++      
Sbjct  301   MMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDSITFASFLPSVAELGSLKQ  360

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG +V   + LD      L+  Y K   ++ A K+F      D+V   +MISG   
Sbjct  361   GKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMACKIFSKSTRTDVVICTAMISGFVL  420

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
              G    AL +F ++ +   +P+S T   ++      + L+ GK +H   LK G D+  +V
Sbjct  421   NGMNCDALEIFRRLLKEKMRPNSLTLASVLPACAGLAALKFGKELHGNILKHGLDARCYV  480

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
             GS L  MY++   +  A R+F  L E D V W++MI   SQ+G   +A+D FR+M  +G 
Sbjct  481   GSALTDMYAKSGRLDLAHRVFQRLSERDAVCWNSMITSYSQNGKPEEAIDLFRQMGTEGA  540

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
             K D + I++ LSA A L  +  G+E H F +R  +  ++   SALIDMY+KCG L+L  +
Sbjct  541   KYDCVSISAALSACANLPALHYGKEIHSFMIRSAFSSDLFAESALIDMYAKCGNLDLACR  600

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTG  1413
             VF  M  KN +S+NS+IS  G HG   E+  +F E+L K    PD  TF  +L AC H G
Sbjct  601   VFDMMEEKNEVSWNSIISAYGNHGRLKESLVLFHEMLSKGIL-PDHVTFLGILSACGHAG  659

Query  1414  LVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGAL  1593
              V DG  YFR M +E+ I  + EHY  MV LLG AG L EA+E I+S+    D G+WG +
Sbjct  660   AVDDGILYFRCMIEEYRIPARLEHYACMVDLLGRAGHLREAFETIKSMPFSPDSGVWGTM  719

Query  1594  LSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-G  1770
             L  C +HGN  L   V+++LF+   + S Y +++SN+ A  G+W  V K+R  M+  +  
Sbjct  720   LGACRLHGNVELAEEVSRYLFELAPQNSGYYILLSNILADAGKWGSVLKVRTLMKNREVQ  779

Query  1771  KMPGKSWI  1794
             K+PG SWI
Sbjct  780   KIPGYSWI  787


 Score =   207 bits (526),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/414 (29%), Positives = 215/414 (52%), Gaps = 2/414 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F S+L Q       I   + +HA ++ + L  +    T+I+  Y L   I+ A  +F + 
Sbjct  42    FASIL-QACSDQSLIQQGRQVHAHVICSGLVKNSLIGTKILGLYFLCGSIMDAMNMFCQL  100

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               +    WNS+IR +     F  A   +  ML SG  PD +TF  +++AC    +    +
Sbjct  101   DLKYTLPWNSLIRGFTMMGYFDYALLFYFKMLSSGVSPDKYTFLSVIKACGGVNNVRLGK  160

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              V+  +   G  +D    S L+  Y   G +++A  +F  +   D V WN M+ G+   G
Sbjct  161   AVYDTIQFMGYGVDIFVGSSLIRLYVDNGCIQDAWSLFVKMPVKDCVLWNVMLHGYVKNG  220

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             +   ++ +F++M+    KP++ T+  ++      +++  G  +H L +  G +S++ V +
Sbjct  221   ELNNSVRMFLEMRSSEVKPNAVTFACILSLCASEAMIGFGTQLHGLVVACGLESDSPVAN  280

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L++MYS+C+C   A ++FD +   D+VTW+ MI G  QSG +++A   F++M     K 
Sbjct  281   TLLAMYSKCQCFSDARKLFDMMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKP  340

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +  AS L + A+L  ++ G+E HG+ VR    L+V +  ALID+Y KC  +++  ++F
Sbjct  341   DSITFASFLPSVAELGSLKQGKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMACKIF  400

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                   +++   +MIS   L+G   +A +IF  +L KE   P+  T +++L AC
Sbjct  401   SKSTRTDVVICTAMISGFVLNGMNCDALEIFRRLL-KEKMRPNSLTLASVLPAC  453


 Score =   203 bits (516),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 126/382 (33%), Positives = 198/382 (52%), Gaps = 1/382 (0%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             F  + +IR Y  N  I  A  LF + P +   LWN ++  Y +    +N+ ++F +M  S
Sbjct  176   FVGSSLIRLYVDNGCIQDAWSLFVKMPVKDCVLWNVMLHGYVKNGELNNSVRMFLEMRSS  235

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               +P+  TFACIL  C+ +        +HG VV  GLE DS  ++ L++ YSK     +A
Sbjct  236   EVKPNAVTFACILSLCASEAMIGFGTQLHGLVVACGLESDSPVANTLLAMYSKCQCFSDA  295

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD +   DLV WN MISG+   G   +A  LF  M     KPDS T+   +  +   
Sbjct  296   RKLFDMMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDSITFASFLPSVAEL  355

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
               L+ GK +H   ++     +  +   L+ +Y +C+ +  AC+IF      D+V  +AMI
Sbjct  356   GSLKQGKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMACKIFSKSTRTDVVICTAMI  415

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G   +G    AL+ FR +  +  + + L +ASVL A A LA ++ G+E HG  ++ G  
Sbjct  416   SGFVLNGMNCDALEIFRRLLKEKMRPNSLTLASVLPACAGLAALKFGKELHGNILKHGLD  475

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 V SAL DMY+K G L+L  +VF+ +  ++ + +NSMI++   +G   EA  +F + 
Sbjct  476   ARCYVGSALTDMYAKSGRLDLAHRVFQRLSERDAVCWNSMITSYSQNGKPEEAIDLFRQ-  534

Query  1342  LEKEYYNPDEATFSALLCACCH  1407
             +  E    D  + SA L AC +
Sbjct  535   MGTEGAKYDCVSISAALSACAN  556



>ref|XP_004289150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Fragaria vesca subsp. vesca]
Length=710

 Score =   334 bits (857),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 198/564 (35%), Positives = 319/564 (57%), Gaps = 7/564 (1%)
 Frame = +1

Query  133   QLLHQMFIAFR--SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNED  306
             QLL   F + R  ++L  L+ +       KL   +    +L H+ +  T++  FYA    
Sbjct  25    QLLIPPFTSLRCGAILQSLTNTKSLPKGQKLHSLMATSGNLLHNTYLTTKLAAFYANCGQ  84

Query  307   IVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRA  486
             +  A  LFD    ++ FLWN +IR YA       +  ++++M++ G++ DNFT+  +L+A
Sbjct  85    MPQAHLLFDSVLFKNSFLWNFMIRGYACNGFGLESIVMYREMVNLGSKGDNFTYPFVLKA  144

Query  487   CSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQW  666
             C D       + VHG VVVSG   +    + L++ YSK G +  A +VFD + E DL  W
Sbjct  145   CGDLLAVEIGKRVHGEVVVSGFASNLYVGNALLAMYSKFGEMGYAYQVFDKMPERDLTTW  204

Query  667   NSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHS-LCL  843
             N+M+SG+   GD ++AL +F +M R G + D  + +G++        L++GK VH+ + L
Sbjct  205   NTMVSGYVRNGDPREALAVFERMGRFGVRADGTSLLGVVSGCGELVALKLGKAVHAYVVL  264

Query  844   KFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALD  1023
               G   N  + + L+ MY +C+C+  + R+F+ +   D V+W+ MI G  +SGD  ++L 
Sbjct  265   NGGEVWNEFLMNALIEMYWKCRCVAYSRRLFERVEVKDTVSWNTMIRGYERSGDAFESLR  324

Query  1024  FFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYS  1203
              F  M ++G +VD +   +VL++  Q++ +Q G   H + VR G+   V V +ALIDMYS
Sbjct  325   LFCLMVVEGVEVDEVTTVTVLTSCDQISALQFGMSVHSYLVRKGFGANVMVGTALIDMYS  384

Query  1204  KCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFS  1383
             KCG L+   + F  MP KN++S+++MIS  G HG   EA   + E++  + + PDE   +
Sbjct  385   KCGSLSCSRRFFYDMPRKNLVSWSAMISGYGAHGRGEEAISCYHELIANK-FTPDEGLLT  443

Query  1384  ALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQG  1563
             ++L AC H GLV +G+  F  M  E+ ++P   HY  +V LLG AG L+EAYELI+++  
Sbjct  444   SVLTACSHAGLVNEGKDMFNRMTREYRVKPTVAHYSCLVDLLGRAGCLDEAYELIKTMDV  503

Query  1564  PVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKL  1743
                  IW ALLS C +H N +L  I A+ +F+   +     + +SN+YA + RW+ V+++
Sbjct  504   EPSSDIWAALLSACRLHRNVKLAEISAQKIFEMNPKGVGSYICLSNIYAAEKRWDDVERV  563

Query  1744  RVDMEAIKG--KMPGKSWISNIKM  1809
             R  M   KG  K PG +++   KM
Sbjct  564   RA-MVRKKGLKKPPGCTFVELDKM  586



>emb|CAN83391.1| hypothetical protein VITISV_041405 [Vitis vinifera]
Length=886

 Score =   338 bits (868),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/529 (34%), Positives = 294/529 (56%), Gaps = 3/529 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K++H  ++K+  +      +  +  YA       A +LFDE P+R +  WN++I  Y + 
Sbjct  318   KMVHTHVIKSGFAMDVVVMSSAVGMYAKCNVFEDAIKLFDEMPERDVASWNNVISCYYQD  377

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +   A +LF++M  SG +PD+ T   ++ +C+   D    + +H  +V SG  LD   S
Sbjct  378   GQPEKALELFEEMKVSGFKPDSVTLTTVISSCARLLDLERGKEIHMELVRSGFALDGFVS  437

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S LV  Y K G LE A +VF+ I   ++V WNSMI+G+   GD K  + LF +M   G +
Sbjct  438   SALVDMYGKCGCLEMAKEVFEQIQRKNVVSWNSMIAGYSLKGDSKSCIELFRRMDEEGIR  497

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P   T   ++M       L++GK +H   ++   +++  V S L+ +Y +C  +GSA  +
Sbjct  498   PTLTTLSSILMACSRSVNLQLGKFIHGYIIRNRVEADIFVNSSLIDLYFKCGNIGSAENV  557

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F ++ + ++V+W+ MI G  + G  ++AL  F +M   G K D +   SVL A +QLA++
Sbjct  558   FQNMPKTNVVSWNVMISGYVKVGSYLEALVIFTDMRKAGVKPDAITFTSVLPACSQLAVL  617

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E H F +     +   V  AL+DMY+KCG ++  + +F  +P ++ +S+ SMI+  
Sbjct  618   EKGKEIHNFIIESKLEINEVVMGALLDMYAKCGAVDEALHIFNQLPERDFVSWTSMIAAY  677

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG A EA ++FE+ +++    PD+ TF A+L AC H GLV +G  YF  M  E+G +P
Sbjct  678   GSHGQAFEALKLFEK-MQQSDAKPDKVTFLAILSACSHAGLVDEGCYYFNQMIAEYGFKP  736

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQG-PVDFGIWGALLSCCDIHGNYRLGGIVAKH  1650
               EHY  ++ LLG  G L EAYE++Q       D G+   L S C +H    LG  + + 
Sbjct  737   AVEHYSCLIDLLGRVGRLREAYEILQRTPDIREDVGLLSTLFSACHLHKKLDLGEQIGRL  796

Query  1651  LFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             L +   +  S  +++SNMYA   +W+ V+K+R+ ++ +   K PG SWI
Sbjct  797   LIEKDPDDPSTYIILSNMYASVKKWDEVRKVRLKIKELGLKKNPGCSWI  845


 Score =   220 bits (561),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 154/478 (32%), Positives = 246/478 (51%), Gaps = 19/478 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD--ETPQRSIFLWNSIIRAYA  387
             KL+H  I+   L ++      +I  Y       SA+ +F   E P   I LWN ++ A  
Sbjct  215   KLIHQKIVSLGLQNNITLCKSLINLYFSCHLFQSAKLVFQTIENP-LDITLWNGLMAACT  273

Query  388   RAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDS  564
             +   F    ++F  +L     +PD FT+  +L+ACS        ++VH  V+ SG  +D 
Sbjct  274   KNFIFIEGLEVFHRLLHFPYLKPDAFTYPSVLKACSGLGRVGYGKMVHTHVIKSGFAMDV  333

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
             +  S  V  Y+K    E+AIK+FD + E D+  WN++IS +   G  +KAL LF +M+  
Sbjct  334   VVMSSAVGMYAKCNVFEDAIKLFDEMPERDVASWNNVISCYYQDGQPEKALELFEEMKVS  393

Query  745   GEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             G KPDS T   +I    C  LL +  GK +H   ++ GF  +  V S LV MY +C C+ 
Sbjct  394   GFKPDSVTLTTVIS--SCARLLDLERGKEIHMELVRSGFALDGFVSSALVDMYGKCGCLE  451

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A  +F+ +   ++V+W++MI G S  GD    ++ FR M+ +G +     ++S+L A +
Sbjct  452   MAKEVFEQIQRKNVVSWNSMIAGYSLKGDSKSCIELFRRMDEEGIRPTLTTLSSILMACS  511

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             +   +Q G+  HG+ +R     ++ V+S+LID+Y KCG +     VF+ MP  N++S+N 
Sbjct  512   RSVNLQLGKFIHGYIIRNRVEADIFVNSSLIDLYFKCGNIGSAENVFQNMPKTNVVSWNV  571

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MIS     G+  EA  IF + + K    PD  TF+++L AC    ++  G+    I N  
Sbjct  572   MISGYVKVGSYLEALVIFTD-MRKAGVKPDAITFTSVLPACSQLAVLEKGK---EIHN--  625

Query  1459  FGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
             F I+ K E + V M  LL M    G ++EA  +   +    DF  W ++++    HG 
Sbjct  626   FIIESKLEINEVVMGALLDMYAKCGAVDEALHIFNQLP-ERDFVSWTSMIAAYGSHGQ  682



>ref|XP_007132588.1| hypothetical protein PHAVU_011G107600g [Phaseolus vulgaris]
 gb|ESW04582.1| hypothetical protein PHAVU_011G107600g [Phaseolus vulgaris]
Length=700

 Score =   333 bits (855),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 192/551 (35%), Positives = 300/551 (54%), Gaps = 5/551 (1%)
 Frame = +1

Query  169   LLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             LL  LS S       +L   +     L H+ + AT++   YA    ++ A+ +FD+   +
Sbjct  27    LLQSLSNSKSLTQAQQLHAQVTTGGTLRHNTYLATKLAACYAACGHMLHAQLIFDQIVLK  86

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             + FLWNS+IR YA  H  + +  L++DML  G +PDNFT+  +L+AC D       R VH
Sbjct  87    NSFLWNSMIRGYACNHSPTKSLVLYRDMLRFGQKPDNFTYPFVLKACGDLLFRRIGRKVH  146

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               VVV GLE D    + ++S Y K G +  A  VFD +   DL  WN+M+SG    G+ +
Sbjct  147   ALVVVGGLEKDVYVGNSILSMYFKFGDVAAAQVVFDKMPMRDLTSWNTMVSGCVKNGEAE  206

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL-  885
              A  +F +M+R+G   D  T + L+        L++GK +H   ++ G +   H G L+ 
Sbjct  207   GAFEIFGEMRRVGVVGDGTTLLALLSACGDVMDLKMGKEIHGYVVRNGGNGRVHNGFLVN  266

Query  886   --VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
               + MY  C+ +  A ++F+ L+  D+V+W+++I G  + GD  + L+ F  M       
Sbjct  267   SVIDMYCNCESISCARKLFERLIVKDIVSWNSLISGYEKRGDAFEVLELFGRMVEGSAVP  326

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D + + SVL A  Q++ ++ G   H + V+ GY + V+V +ALI MY+ CG L     VF
Sbjct  327   DEVTVISVLGACNQISALRLGTSVHSYVVKRGYGVNVAVGTALIGMYANCGSLICACCVF  386

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               MP KN+  +  MI+  G+HG   EA  IF E+L      PDE  F+A+L AC H+GLV
Sbjct  387   DEMPEKNLAVWTVMITGFGIHGRGREAVSIFYEMLGTN-VTPDEGIFTAVLSACSHSGLV  445

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G+  F  +   + + P   HY  +V LLG AG L+EAY +I+S++   +  +W ALLS
Sbjct  446   DEGKEIFYKITRVYNVDPGPTHYSCLVDLLGRAGYLDEAYAVIESMKLEPNEDVWTALLS  505

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKM  1776
              C +H N +L  I A  LF+   + +S  V +SN+YA + RW+ V+ +R  ++  +  K 
Sbjct  506   ACRLHRNVKLAEISAHKLFELNPDGASGYVCLSNIYAAERRWKDVENVRALVKKSRLKKA  565

Query  1777  PGKSWISNIKM  1809
             P  S++   KM
Sbjct  566   PSYSFVELKKM  576



>ref|XP_004294643.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=870

 Score =   337 bits (865),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 191/527 (36%), Positives = 298/527 (57%), Gaps = 5/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  + K            ++ FY  N  + SAR++FD   +R +  WNS+I AY     
Sbjct  218   VHGYLYKLRFGSDSNVVNSLMAFYFKNGRVESARKVFDALRERDVVSWNSMISAYVSNGA  277

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                  ++F++M+ SG   D  T   +L ACSD  +    RVVHG  +  G ++D +  + 
Sbjct  278   PEKGIEIFREMVWSGIDVDLATIINVLMACSDCGNVVLGRVVHGYAMKGGFDVDVVLCNS  337

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  YSK G L +A++VF+ +    +V W SMI+G+   G   KA+ LF +M+  G  PD
Sbjct  338   VLDMYSKCGDLSDAVRVFEKMGRRSVVSWTSMIAGYVREGLSDKAIELFCEMETDGVIPD  397

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              +T   ++    C   L  GK++H    +   DS+  V + L+ MY++C  M  A  +F 
Sbjct  398   VYTITSILHACACSGSLEKGKDIHKYIREHDMDSSLFVCNSLMDMYAKCGSMEDADSVFS  457

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              +   D+V+W+ MI G S++    +AL+ F +M  K  K D + +ASVL A A LA +  
Sbjct  458   HMPMKDIVSWNTMIGGYSKNCLPNEALELFSDMQRKF-KPDSMTLASVLPACASLAALDR  516

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG+ +R GY L+  V++AL+DMY KCG L L   +F+ +P K++ISY  +I+  G+
Sbjct  517   GQEIHGYLLRHGYFLDQYVANALVDMYVKCGVLILARVLFEMIPVKDLISYTVIIAGYGM  576

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   EA   F E+ + E   PD  +F ++L AC H+GLV +G R+F IM +++ I+P  
Sbjct  577   HGFGKEAIAAFNEMTKAEI-EPDSISFISILYACSHSGLVQEGWRFFDIMRNDYKIEPML  635

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LL   G L +AY+ I  +    D  +WG+LL  C IH + +L   VA+H+F+
Sbjct  636   EHYACMVDLLARTGNLTKAYKFINMMPIEPDATVWGSLLCGCRIHHDVKLAEKVAEHVFE  695

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKL--RVDMEAIKGKMPGKSWI  1794
              + E + Y ++++N+YA   +WE VKKL  R+   ++K K PG SWI
Sbjct  696   LEPENTGYYILLANIYAEAEKWEEVKKLRERIGRRSLK-KNPGCSWI  741


 Score =   212 bits (540),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 224/422 (53%), Gaps = 17/422 (4%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
             A+ S+L +L   N+++   K +H+++ +  ++   +   +++  Y    D+  ARR+FD 
Sbjct  97    AYCSVL-ELCAGNKSLKDGKRVHSVLCEHGVNVDGYVGAKLVFMYVHCGDLREARRVFDA  155

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
                R +FLWN +I  YA+   F     LF  M++ G   +++TF+C+ +       F+ L
Sbjct  156   LSDRKVFLWNLMINEYAKVRDFREGVCLFGKMVECGVELNSYTFSCVFKC------FAAL  209

Query  517   RVVHGGVVVSG------LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMI  678
               V  G  V G         DS   + L++ Y K G +E A KVFD + E D+V WNSMI
Sbjct  210   GCVREGEWVHGYLYKLRFGSDSNVVNSLMAFYFKNGRVESARKVFDALRERDVVSWNSMI  269

Query  679   SGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGF  855
             S +   G  +K + +F +M   G   D  T + ++M C DC +++ +G+ VH   +K GF
Sbjct  270   SAYVSNGAPEKGIEIFREMVWSGIDVDLATIINVLMACSDCGNVV-LGRVVHGYAMKGGF  328

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
             D +  + + ++ MYS+C  +  A R+F+ +    +V+W++MI G  + G   KA++ F E
Sbjct  329   DVDVVLCNSVLDMYSKCGDLSDAVRVFEKMGRRSVVSWTSMIAGYVREGLSDKAIELFCE  388

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             M   G   D   I S+L A A    ++ G++ H +         + V ++L+DMY+KCG 
Sbjct  389   METDGVIPDVYTITSILHACACSGSLEKGKDIHKYIREHDMDSSLFVCNSLMDMYAKCGS  448

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLC  1395
             +     VF  MP K+I+S+N+MI     +   NEA ++F ++  K  + PD  T +++L 
Sbjct  449   MEDADSVFSHMPMKDIVSWNTMIGGYSKNCLPNEALELFSDMQRK--FKPDSMTLASVLP  506

Query  1396  AC  1401
             AC
Sbjct  507   AC  508


 Score =   172 bits (435),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 186/333 (56%), Gaps = 4/333 (1%)
 Frame = +1

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF  633
             D+  +  +L  C+        + VH  +   G+ +D    ++LV  Y   G L EA +VF
Sbjct  94    DSAAYCSVLELCAGNKSLKDGKRVHSVLCEHGVNVDGYVGAKLVFMYVHCGDLREARRVF  153

Query  634   DGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLR  813
             D +++  +  WN MI+ +  + D+++ + LF KM   G + +S+T+  +  C      +R
Sbjct  154   DALSDRKVFLWNLMINEYAKVRDFREGVCLFGKMVECGVELNSYTFSCVFKCFAALGCVR  213

Query  814   IGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLS  993
              G+ VH    K  F S+++V + L++ Y +   + SA ++FD+L E D+V+W++MI    
Sbjct  214   EGEWVHGYLYKLRFGSDSNVVNSLMAFYFKNGRVESARKVFDALRERDVVSWNSMISAYV  273

Query  994   QSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS  1173
              +G   K ++ FREM   G  VD   I +VL A +    V  GR  HG+A++ G+ ++V 
Sbjct  274   SNGAPEKGIEIFREMVWSGIDVDLATIINVLMACSDCGNVVLGRVVHGYAMKGGFDVDVV  333

Query  1174  VSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKE  1353
             + ++++DMYSKCG L+  ++VF+ M  ++++S+ SMI+     G +++A ++F E +E +
Sbjct  334   LCNSVLDMYSKCGDLSDAVRVFEKMGRRSVVSWTSMIAGYVREGLSDKAIELFCE-METD  392

Query  1354  YYNPDEATFSALLCACCHTGLVCDGR---RYFR  1443
                PD  T +++L AC  +G +  G+   +Y R
Sbjct  393   GVIPDVYTITSILHACACSGSLEKGKDIHKYIR  425



>ref|XP_010258697.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Nelumbo nucifera]
Length=860

 Score =   337 bits (865),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 195/559 (35%), Positives = 304/559 (54%), Gaps = 15/559 (3%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTT-------------KLLHAIILKTHLSHHPFYATRIIRFYALN  300
             FR++ T+++ ++ T++                 LH + ++  L   P  A  ++  Y+  
Sbjct  236   FRTMRTEMTPNSVTLACILSIYASKAIAKCGTQLHGLAIRCGLELDPPVANTLLALYSKC  295

Query  301   EDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACIL  480
               +  A +L D  PQ  +  WN +I  Y +      A  L   ML SG +PD+ T A  L
Sbjct  296   RHLSDAYKLLDLMPQIDLVAWNGMIAGYVQNGFMDEARGLLNKMLSSGFKPDSITLASFL  355

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
              + SD  +    + +HG ++  G+ LD   ++ L+  Y K   ++ A KVF+     D+V
Sbjct  356   PSVSDLANLKQCKEIHGYIIRHGVHLDVFLNNSLIDVYFKCRDVDLAEKVFNQANSLDVV  415

Query  661   QWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLC  840
                +MISG+   G    AL +F  + +M  KP+S T   ++        L++GK +H   
Sbjct  416   ICTTMISGYVLNGMNSDALGIFRCLLKMKMKPNSVTLASVLPSCAGLVALKLGKELHGNI  475

Query  841   LKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKAL  1020
             L+ G +   +V S L  MY++   +    RIF  ++E D V W++MI   SQ+G   +A+
Sbjct  476   LRNGHEGRCYVASALTDMYAKSGRLDIGHRIFWRMVERDTVCWNSMIANCSQNGKPEEAI  535

Query  1021  DFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMY  1200
             D FR+M  +G + D + I++ LSA A L  +  G++ HGF ++  +  ++   SALIDMY
Sbjct  536   DLFRQMGFEGVQYDCVSISAALSACANLPALNCGKQIHGFMMKGTFSSDLFAESALIDMY  595

Query  1201  SKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATF  1380
             +KCG L L  +VF  M  KN +S+NS+I+  G HG+  ++  +F ++LE E   PD  TF
Sbjct  596   AKCGNLVLARRVFDLMQVKNEVSWNSIIAAYGTHGHIKDSLDLFHKMLE-EGIQPDHVTF  654

Query  1381  SALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQ  1560
              A++ AC H G V +G  YFR+M + +GI  + EHY  MV L G AG L EA ++I+ + 
Sbjct  655   LAIISACDHVGNVDEGFHYFRVMTERYGIMARMEHYACMVDLFGRAGRLLEALDIIRRMP  714

Query  1561  GPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKK  1740
                D GIWGALL  C +HGN  L  + +KHLF+   + S Y V++SN++A  G+WECV K
Sbjct  715   FNADAGIWGALLGACRVHGNVELAELASKHLFELDPQNSGYYVLLSNVHADAGQWECVLK  774

Query  1741  LRVDM-EAIKGKMPGKSWI  1794
             +R  M E    K+PG SWI
Sbjct  775   VRSLMKERGVQKLPGYSWI  793


 Score =   197 bits (501),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/416 (29%), Positives = 219/416 (53%), Gaps = 4/416 (1%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             L Q      T+   + +HA ++   LS   F  T+I+  Y L + ++ A+ +F     R 
Sbjct  52    LAQSCSHPSTLRQGRQVHAQVVVNGLSESDFLETKILAMYVLCKSLIDAQNMFFRLDWRY  111

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
                WN +IR +        A   +  +L  G  PD +TF  +++AC      +  + +H 
Sbjct  112   PLPWNWMIRGFTMMGSLEFALLYYFKLLAYGVCPDKYTFLYVIKACCGLSAINLGKWIHK  171

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              + + G E+D   SS L+  Y++   +++A ++FD + + D V WN M++G+   GD  K
Sbjct  172   TIHLMGFEMDIFISSSLIKMYTENDSIDDAKRLFDIMPQKDSVLWNVMLNGYVRNGDADK  231

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
             A+ +F  M R    P+S T   ++      ++ + G  +H L ++ G + +  V + L++
Sbjct  232   AIEVFRTM-RTEMTPNSVTLACILSIYASKAIAKCGTQLHGLAIRCGLELDPPVANTLLA  290

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             +YS+C+ +  A ++ D + + D+V W+ MI G  Q+G + +A     +M   G K D + 
Sbjct  291   LYSKCRHLSDAYKLLDLMPQIDLVAWNGMIAGYVQNGFMDEARGLLNKMLSSGFKPDSIT  350

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
             +AS L + + LA ++  +E HG+ +R G HL+V ++++LID+Y KC  ++L  +VF    
Sbjct  351   LASFLPSVSDLANLKQCKEIHGYIIRHGVHLDVFLNNSLIDVYFKCRDVDLAEKVFNQAN  410

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
             S +++   +MIS   L+G  ++A  IF  +L K    P+  T +++L +C   GLV
Sbjct  411   SLDVVICTTMISGYVLNGMNSDALGIFRCLL-KMKMKPNSVTLASVLPSC--AGLV  463


 Score =   148 bits (374),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 160/309 (52%), Gaps = 2/309 (1%)
 Frame = +1

Query  466   FACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             FA + ++CS        R VH  VVV+GL       +++++ Y     L +A  +F  + 
Sbjct  49    FASLAQSCSHPSTLRQGRQVHAQVVVNGLSESDFLETKILAMYVLCKSLIDAQNMFFRLD  108

Query  646   EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKN  825
                 + WN MI G   +G  + ALL + K+   G  PD +T++ +I      S + +GK 
Sbjct  109   WRYPLPWNWMIRGFTMMGSLEFALLYYFKLLAYGVCPDKYTFLYVIKACCGLSAINLGKW  168

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             +H      GF+ +  + S L+ MY+    +  A R+FD + + D V W+ M+ G  ++GD
Sbjct  169   IHKTIHLMGFEMDIFISSSLIKMYTENDSIDDAKRLFDIMPQKDSVLWNVMLNGYVRNGD  228

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
               KA++ FR M  +    + + +A +LS  A  AI + G + HG A+RCG  L+  V++ 
Sbjct  229   ADKAIEVFRTMRTEMTP-NSVTLACILSIYASKAIAKCGTQLHGLAIRCGLELDPPVANT  287

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             L+ +YSKC  L+   ++   MP  +++++N MI+    +G  +EA  +  ++L    + P
Sbjct  288   LLALYSKCRHLSDAYKLLDLMPQIDLVAWNGMIAGYVQNGFMDEARGLLNKMLSSG-FKP  346

Query  1366  DEATFSALL  1392
             D  T ++ L
Sbjct  347   DSITLASFL  355


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/268 (22%), Positives = 125/268 (47%), Gaps = 6/268 (2%)
 Frame = +1

Query  799   PSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAM  978
             PS LR G+ VH+  +  G   +  + + +++MY  CK +  A  +F  L     + W+ M
Sbjct  59    PSTLRQGRQVHAQVVVNGLSESDFLETKILAMYVLCKSLIDAQNMFFRLDWRYPLPWNWM  118

Query  979   ICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGY  1158
             I G +  G +  AL ++ ++   G   D      V+ A   L+ +  G+  H      G+
Sbjct  119   IRGFTMMGSLEFALLYYFKLLAYGVCPDKYTFLYVIKACCGLSAINLGKWIHKTIHLMGF  178

Query  1159  HLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEE  1338
              +++ +SS+LI MY++   ++   ++F  MP K+ + +N M++    +G+A++A ++F  
Sbjct  179   EMDIFISSSLIKMYTENDSIDDAKRLFDIMPQKDSVLWNVMLNGYVRNGDADKAIEVFRT  238

Query  1339  VLEKEYYNPDEATFSALLCACCHTGLV-CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGM  1515
             +  +    P+  T + +L       +  C  + +   +     + P   +   ++ L   
Sbjct  239   M--RTEMTPNSVTLACILSIYASKAIAKCGTQLHGLAIRCGLELDPPVAN--TLLALYSK  294

Query  1516  AGELEEAYELIQSIQGPVDFGIWGALLS  1599
                L +AY+L+  +   +D   W  +++
Sbjct  295   CRHLSDAYKLLD-LMPQIDLVAWNGMIA  321



>ref|XP_008368655.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Malus domestica]
 ref|XP_008368656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Malus domestica]
 ref|XP_008368657.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Malus domestica]
Length=840

 Score =   337 bits (863),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 195/548 (36%), Positives = 296/548 (54%), Gaps = 3/548 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F  +L+ L  S   I     LH +++   L      A  ++  Y+  +    AR+LFD
Sbjct  242   VTFACILS-LCASEAMIGFGTQLHGLVVACGLESDSPVANTLLAMYSKCQCFSDARKLFD  300

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
               P+  +  WN +I  Y ++     A +LF+DM+ +  +PD+ TFA  L + ++      
Sbjct  301   MMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDSITFASFLPSVAELGSLKQ  360

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG +V   + LD      L+  Y K   ++ A K+F      D+V   +MISG   
Sbjct  361   GKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMARKIFSKSTRTDVVICTAMISGFVL  420

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
              G    AL +F ++ +   +P+S T   ++      + L+ GK +H   LK G D+  +V
Sbjct  421   NGMNCDALEIFRRLLKEKMRPNSLTLASVLPACAGLAALKFGKELHGNILKHGLDARCYV  480

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
             GS L  MY++   +  A R+F  L E D V W++MI   SQ+G   +A+D FR+M  +G 
Sbjct  481   GSALTDMYAKSGRLDLAHRVFQRLSERDAVCWNSMITSYSQNGKPEEAIDLFRQMGTEGA  540

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
             K D + I++ LSA A L  +  G+E H F +R  +  ++   SALIDMY+KCG L+L  +
Sbjct  541   KYDCVSISAALSACANLPALHYGKEIHSFMIRSAFSSDLFAESALIDMYAKCGNLDLARR  600

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTG  1413
             VF  M  KN +S+NS+IS  G HG   E+  +F E+L K    PD  TF  +L AC H G
Sbjct  601   VFDMMEEKNEVSWNSIISAYGNHGRLKESLVLFHEMLSKGIL-PDHVTFLGILSACGHAG  659

Query  1414  LVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGAL  1593
              V DG  YFR M +E+ I  + EHY  MV LLG AG L EA+E I+S+    D G+WG +
Sbjct  660   AVDDGILYFRCMIEEYRIPARLEHYACMVDLLGRAGHLREAFETIKSMPFSPDSGVWGTM  719

Query  1594  LSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-G  1770
             L  C +HGN  L   V+++LF+   + S Y +++SN+ A  G+W  V K+R  M+  +  
Sbjct  720   LGACRLHGNVELAEEVSRYLFELAPQNSGYYILLSNILADAGKWGSVLKVRTLMKNREVQ  779

Query  1771  KMPGKSWI  1794
             K+PG SWI
Sbjct  780   KVPGYSWI  787


 Score =   209 bits (532),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/414 (29%), Positives = 215/414 (52%), Gaps = 2/414 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F S+L Q       I   + +HA ++ + L  +    TRI+  Y L   I+ A+ +F + 
Sbjct  42    FASIL-QACNDESLIQQGRQVHAHVICSGLVKNSLVXTRILGMYFLCGSIMGAKNMFYQL  100

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               +    WNS+IR +     F  A   +  ML SG  PD +TF  +++AC    +    +
Sbjct  101   DLKYTLPWNSMIRGFTMMGYFDYALLFYFKMLSSGVSPDKYTFLSVIKACGGVNNVRLGK  160

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              V+  +   G  +D    S L+  Y   G +++A  +F  +   D V WN M+ G+   G
Sbjct  161   AVYDTIQFMGFGVDIFVGSSLIRLYVDNGCIQDAWSLFVKMPXKDCVLWNVMLHGYVKNG  220

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
                 ++ +F++M+    KP++ T+  ++      +++  G  +H L +  G +S++ V +
Sbjct  221   QLNNSVRMFLEMRSSEVKPNAVTFACILSLCASEAMIGFGTQLHGLVVACGLESDSPVAN  280

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L++MYS+C+C   A ++FD +   D+VTW+ MI G  QSG +++A   F++M     K 
Sbjct  281   TLLAMYSKCQCFSDARKLFDMMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKP  340

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +  AS L + A+L  ++ G+E HG+ VR    L+V +  ALID+Y KC  +++  ++F
Sbjct  341   DSITFASFLPSVAELGSLKQGKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMARKIF  400

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                   +++   +MIS   L+G   +A +IF  +L KE   P+  T +++L AC
Sbjct  401   SKSTRTDVVICTAMISGFVLNGMNCDALEIFRRLL-KEKMRPNSLTLASVLPAC  453


 Score =   199 bits (507),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 125/382 (33%), Positives = 198/382 (52%), Gaps = 1/382 (0%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             F  + +IR Y  N  I  A  LF + P +   LWN ++  Y +  + +N+ ++F +M  S
Sbjct  176   FVGSSLIRLYVDNGCIQDAWSLFVKMPXKDCVLWNVMLHGYVKNGQLNNSVRMFLEMRSS  235

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               +P+  TFACIL  C+ +        +HG VV  GLE DS  ++ L++ YSK     +A
Sbjct  236   EVKPNAVTFACILSLCASEAMIGFGTQLHGLVVACGLESDSPVANTLLAMYSKCQCFSDA  295

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD +   DLV WN MISG+   G   +A  LF  M     KPDS T+   +  +   
Sbjct  296   RKLFDMMPRTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDSITFASFLPSVAEL  355

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
               L+ GK +H   ++     +  +   L+ +Y +C+ +  A +IF      D+V  +AMI
Sbjct  356   GSLKQGKEIHGYIVRHCVPLDVFLQCALIDVYFKCRNVDMARKIFSKSTRTDVVICTAMI  415

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G   +G    AL+ FR +  +  + + L +ASVL A A LA ++ G+E HG  ++ G  
Sbjct  416   SGFVLNGMNCDALEIFRRLLKEKMRPNSLTLASVLPACAGLAALKFGKELHGNILKHGLD  475

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 V SAL DMY+K G L+L  +VF+ +  ++ + +NSMI++   +G   EA  +F + 
Sbjct  476   ARCYVGSALTDMYAKSGRLDLAHRVFQRLSERDAVCWNSMITSYSQNGKPEEAIDLFRQ-  534

Query  1342  LEKEYYNPDEATFSALLCACCH  1407
             +  E    D  + SA L AC +
Sbjct  535   MGTEGAKYDCVSISAALSACAN  556



>ref|XP_008225349.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730 
[Prunus mume]
Length=629

 Score =   331 bits (848),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 189/553 (34%), Positives = 305/553 (55%), Gaps = 21/553 (4%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD-ETPQRSI  354
             Q    ++++   K +HA +L     H P   T +I  Y+    +  A   F+ ++   ++
Sbjct  44    QACARHKSLKKGKQIHANMLTNGFLHSPLSITSLINMYSKCNQMDDAVSTFNYQSLDHNV  103

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             F +N++I  +       + F+ ++ M  +G  PD FTF C++RACS   +   +R +HG 
Sbjct  104   FAYNAVIAGFIANGLARHGFEFYRRMRLTGVVPDKFTFPCVIRACSGVLE---VRKIHGL  160

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             VV  GLELD    S LVS Y KLG +EEA +VF+ +   D+V WN+M++G   +G  ++A
Sbjct  161   VVKFGLELDVYIGSALVSTYLKLGLMEEAQEVFEELPVKDVVLWNAMVNGFAQIGRLEEA  220

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
             L++F  M   G  P  FT  G++           G+ VH   +K G+DS   V + L+ M
Sbjct  221   LVVFRMMGEEGVVPSRFTVTGVLSIFGVMGDFDNGRAVHGFAMKMGYDSGIEVLNALIDM  280

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +CKC+G A  IF+ ++E D+ +W++++    Q GD+   L  F  M   G   D + I
Sbjct  281   YGKCKCVGDALEIFEMMIEKDIYSWNSIMAVHEQCGDLDGTLRLFDRMLSAGVLPDLVTI  340

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS-------VSSALIDMYSKCGFLNLGIQ  1233
              +VL   + LA +  GRE HG+ ++ G   +V+       +++A++DMY+KCG +     
Sbjct  341   TTVLPVCSHLAALMHGREIHGYMIKNGLEKDVNENVDDVQMTNAVMDMYAKCGSMRNAYM  400

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP-DEATFSALLCACCHT  1410
             +F  M +K++ S+N MI   G+HG  ++A  +F ++ E     P DE +F  +L AC H 
Sbjct  401   IFDKMRNKDVASWNIMIKGYGMHGYGSKALDMFSDMCEARI--PLDEVSFVGVLSACSHA  458

Query  1411  GLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGA  1590
             GLV +GR + R M  ++G+ P  EHY  +V +LG AG L+EAYEL+  +    +  +W A
Sbjct  459   GLVREGREFLRQMKSKYGMAPTIEHYTCVVDMLGRAGHLQEAYELVLEMPIETNPVLWRA  518

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYG--VMVSNMYAGDGRWECVKKLRVDM--E  1758
             LL+ C +HGN  L  + A  L  N+++    G  V++SN+Y  +GR+E V ++R  M  +
Sbjct  519   LLAACRLHGNQDLAEVAA--LKVNELDPGHCGNYVLMSNIYVENGRYEEVSEVRHTMRQQ  576

Query  1759  AIKGKMPGKSWIS  1797
              +K K PG SWI 
Sbjct  577   NVK-KTPGCSWIE  588


 Score =   153 bits (386),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 105/393 (27%), Positives = 189/393 (48%), Gaps = 16/393 (4%)
 Frame = +1

Query  469   ACI--LRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
              CI  L+AC+        + +H  ++ +G     +  + L++ YSK   +++A+  F+  
Sbjct  38    TCISSLQACARHKSLKKGKQIHANMLTNGFLHSPLSITSLINMYSKCNQMDDAVSTFNYQ  97

Query  643   A-EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIG  819
             + + ++  +N++I+G    G  +     + +M+  G  PD FT+  +I    C  +L + 
Sbjct  98    SLDHNVFAYNAVIAGFIANGLARHGFEFYRRMRLTGVVPDKFTFPCVIRA--CSGVLEVR  155

Query  820   KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQS  999
             K +H L +KFG + + ++GS LVS Y +   M  A  +F+ L   D+V W+AM+ G +Q 
Sbjct  156   K-IHGLVVKFGLELDVYIGSALVSTYLKLGLMEEAQEVFEELPVKDVVLWNAMVNGFAQI  214

Query  1000  GDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS  1179
             G + +AL  FR M  +G       +  VLS    +     GR  HGFA++ GY   + V 
Sbjct  215   GRLEEALVVFRMMGEEGVVPSRFTVTGVLSIFGVMGDFDNGRAVHGFAMKMGYDSGIEVL  274

Query  1180  SALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY  1359
             +ALIDMY KC  +   +++F+ M  K+I S+NS+++     G+ +   ++F+ +L     
Sbjct  275   NALIDMYGKCKCVGDALEIFEMMIEKDIYSWNSIMAVHEQCGDLDGTLRLFDRMLSAGVL  334

Query  1360  NPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMA-------  1518
              PD  T + +L  C H   +  GR     M    G++      V  V++           
Sbjct  335   -PDLVTITTVLPVCSHLAALMHGREIHGYMIKN-GLEKDVNENVDDVQMTNAVMDMYAKC  392

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             G +  AY +   ++   D   W  ++    +HG
Sbjct  393   GSMRNAYMIFDKMRNK-DVASWNIMIKGYGMHG  424



>ref|XP_006470740.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
[Citrus sinensis]
Length=694

 Score =   333 bits (853),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 288/534 (54%), Gaps = 3/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             +++  K++H  ++KT        A+   R YA       A ++FDE  +R +  WN++I 
Sbjct  121   SVAIGKMIHTHLIKTGFLLDVVIASSTARMYAKCNSFECAVKMFDEMSERDVASWNTVIS  180

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y +  +   A +LFK M DSG +P++ T   ++ +C+   D    + +H   +  G   
Sbjct  181   CYYQDGQAEKALELFKKMRDSGVQPNSVTLTTVISSCARLMDLERGKEIHKEFIKDGFVS  240

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             DS  SS LV  Y K G LE A +VF+      +V WN++I+G+   GD K  + LF +M 
Sbjct  241   DSYISSALVDMYGKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVELFWRMN  300

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G KP   T   ++M       L+ GK VH   ++     +  + S L+ +Y +C  + 
Sbjct  301   EEGIKPTLTTISSVLMSCSRSGQLKHGKVVHGYIIRNKIQGDVFINSSLIDLYFKCGRVS  360

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             SA  +F+ + + D+V W+ MI G    GD  KAL  + +M   G K D +   SVL A +
Sbjct  361   SAENVFEKMSKTDVVYWNVMISGYVTVGDYFKALAIYSDMKEVGAKPDAVTFTSVLPACS  420

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             QLA ++ G+E H   +         V  AL+DMY+KCG ++   +VF  +P ++++S+ S
Sbjct  421   QLAALEKGKEIHNHIIESKLETNEIVMGALLDMYAKCGAVDEAFKVFNELPERDLVSWTS  480

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G HG A EA ++F E +++    PD  TF ALL AC H G V +G  YF  M  E
Sbjct  481   MIAAYGSHGRALEALKLFGE-MQQSNARPDSITFLALLSACSHAGWVDEGGYYFNQMISE  539

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI-QGPVDFGIWGALLSCCDIHGNYRLGG  1635
             + I+P+ EHY  ++ LLG AG L+EAY ++QS  +   D G+   L S C +H +  +G 
Sbjct  540   YNIKPRNEHYSCLIDLLGRAGRLQEAYGILQSTPEIREDAGLLSTLFSACRLHRDIEMGE  599

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
              +AK L +   + SS  +++SNMYA   +W+ V+K+R+ M+ +   K PG SWI
Sbjct  600   KIAKLLIEKDPDDSSTYIVLSNMYASVKKWDEVRKIRLKMKELGLRKNPGCSWI  653


 Score =   203 bits (516),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/484 (28%), Positives = 251/484 (52%), Gaps = 19/484 (4%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR-SIFLWNS  369
             ++++   K++H  ++   L ++      +I  Y   ++   A  +F        + LWN 
Sbjct  16    SKSLKEGKIIHQKVVTLGLQNNIALCKSLINLYFSCQNYDYAMLVFKTIDNPLDLSLWNG  75

Query  370   IIRAYARAHRFSNAFQLFKDML--DSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             ++ +Y + + +  A +LF DML  +   +PD++T+  +L+AC      +  +++H  ++ 
Sbjct  76    LMASYTKNYMYITALELF-DMLLQNPYLKPDSYTYPSVLKACGGLGSVAIGKMIHTHLIK  134

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +G  LD + +S     Y+K    E A+K+FD ++E D+  WN++IS +   G  +KAL L
Sbjct  135   TGFLLDVVIASSTARMYAKCNSFECAVKMFDEMSERDVASWNTVISCYYQDGQAEKALEL  194

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMY  897
             F KM+  G +P+S T   +I    C  L+ +  GK +H   +K GF S++++ S LV MY
Sbjct  195   FKKMRDSGVQPNSVTLTTVIS--SCARLMDLERGKEIHKEFIKDGFVSDSYISSALVDMY  252

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
              +C C+  A  +F+  +   +V W+A+I G S  GD    ++ F  MN +G K     I+
Sbjct  253   GKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVELFWRMNEEGIKPTLTTIS  312

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             SVL + ++   ++ G+  HG+ +R     +V ++S+LID+Y KCG ++    VF+ M   
Sbjct  313   SVLMSCSRSGQLKHGKVVHGYIIRNKIQGDVFINSSLIDLYFKCGRVSSAENVFEKMSKT  372

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +++ +N MIS     G+  +A  I+ ++ E     PD  TF+++L AC     +  G+  
Sbjct  373   DVVYWNVMISGYVTVGDYFKALAIYSDMKEVG-AKPDAVTFTSVLPACSQLAALEKGKEI  431

Query  1438  FRIMNDEFGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
                +     I+ K E + + M  LL M    G ++EA+++   +    D   W ++++  
Sbjct  432   HNHI-----IESKLETNEIVMGALLDMYAKCGAVDEAFKVFNELP-ERDLVSWTSMIAAY  485

Query  1606  DIHG  1617
               HG
Sbjct  486   GSHG  489


 Score =   150 bits (379),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 169/321 (53%), Gaps = 3/321 (1%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEP-  651
             +LR C+        +++H  VV  GL+ +      L++ Y      + A+ VF  I  P 
Sbjct  9     LLRTCTGSKSLKEGKIIHQKVVTLGLQNNIALCKSLINLYFSCQNYDYAMLVFKTIDNPL  68

Query  652   DLVQWNSMISGHGCLGDWKKALLLF-IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
             DL  WN +++ +     +  AL LF + +Q    KPDS+TY  ++        + IGK +
Sbjct  69    DLSLWNGLMASYTKNYMYITALELFDMLLQNPYLKPDSYTYPSVLKACGGLGSVAIGKMI  128

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             H+  +K GF  +  + S    MY++C     A ++FD + E D+ +W+ +I    Q G  
Sbjct  129   HTHLIKTGFLLDVVIASSTARMYAKCNSFECAVKMFDEMSERDVASWNTVISCYYQDGQA  188

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
              KAL+ F++M   G + + + + +V+S+ A+L  ++ G+E H   ++ G+  +  +SSAL
Sbjct  189   EKALELFKKMRDSGVQPNSVTLTTVISSCARLMDLERGKEIHKEFIKDGFVSDSYISSAL  248

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             +DMY KCG L +  +VF+    K+++++N++I+     G++    ++F   + +E   P 
Sbjct  249   VDMYGKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVELFWR-MNEEGIKPT  307

Query  1369  EATFSALLCACCHTGLVCDGR  1431
               T S++L +C  +G +  G+
Sbjct  308   LTTISSVLMSCSRSGQLKHGK  328



>ref|XP_007198953.1| hypothetical protein PRUPE_ppa018505mg [Prunus persica]
 gb|EMJ00152.1| hypothetical protein PRUPE_ppa018505mg [Prunus persica]
Length=758

 Score =   334 bits (857),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 191/536 (36%), Positives = 290/536 (54%), Gaps = 2/536 (0%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S   I     LH +I+   L      A  ++  Y+  + +  AR+LFD  P+  +  WN 
Sbjct  171   SEAMIGFGTQLHGLIVACGLELDSPVANTLLAMYSKCQCLSEARKLFDMMPRTDLVTWNG  230

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +I  Y +      A +LF+ M+ S  +PD+ TFA  L + ++  +    + ++G +V   
Sbjct  231   MISGYIQNGFMVEASRLFQAMISSSVKPDSITFASFLPSVAELANLKQGKEIYGYIVRHC  290

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             + LD    S L+  Y K   ++ A K+F+     D+V   +MISG    G    AL +F 
Sbjct  291   VPLDVFLKSALIDVYFKCRNVDMARKIFNQSTRTDIVMCTAMISGLVLNGMNHDALEIFR  350

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              + +   +P+S T   ++        L++GK +H   LK G D   H+GS L  MY++  
Sbjct  351   WLLKEKMRPNSLTLASVLPACAGLVALKLGKELHGNILKHGLDGRLHLGSALTDMYAKSG  410

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +  A ++F+ + E D + W++MI   SQ+G   +A+D FR+M M G K D + I++ LS
Sbjct  411   RLDLAHQVFERMFERDTICWNSMITSYSQNGKPEEAIDIFRQMGMAGAKYDCVSISAALS  470

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A L  +  G+E HGF +R  +  ++   SALID+Y+KCG L    +VF  M  KN +S
Sbjct  471   ACANLPALHYGKEIHGFMIRSAFSSDLFAESALIDVYAKCGNLVFARRVFDMMEEKNEVS  530

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +NS+IS  G HG   ++  +F E+L      PD  TF  +L AC H G V DG  YFR M
Sbjct  531   WNSIISAYGSHGCLQDSLVLFREMLGNGIL-PDHVTFLGILSACGHAGQVDDGIFYFRCM  589

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              +E+GI  ++EHY  MV L G AG L EA+E I+S+    D G+WG LL  C +HGN  L
Sbjct  590   IEEYGISARSEHYACMVDLFGRAGRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVEL  649

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                 ++HLFD + + S Y +++SN++A  G+W  V K+R  M E    K+PG SWI
Sbjct  650   AEEASRHLFDVEPQNSGYYILLSNIHADAGKWGSVLKVRSLMKERGVQKVPGYSWI  705


 Score =   202 bits (513),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 203/383 (53%), Gaps = 3/383 (1%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             F  + +I+ Y  N  I  A  LF E P +   LWN ++  Y +     NA  +F +M +S
Sbjct  94    FVGSSLIQLYVDNGCIHDAWCLFVEMPHKDCVLWNVMLHGYVKNGESKNAVGMFLEMRNS  153

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               +P+  TFACIL  C+ +        +HG +V  GLELDS  ++ L++ YSK   L EA
Sbjct  154   EIKPNAVTFACILSVCASEAMIGFGTQLHGLIVACGLELDSPVANTLLAMYSKCQCLSEA  213

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD +   DLV WN MISG+   G   +A  LF  M     KPDS T+   +  +   
Sbjct  214   RKLFDMMPRTDLVTWNGMISGYIQNGFMVEASRLFQAMISSSVKPDSITFASFLPSVAEL  273

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             + L+ GK ++   ++     +  + S L+ +Y +C+ +  A +IF+     D+V  +AMI
Sbjct  274   ANLKQGKEIYGYIVRHCVPLDVFLKSALIDVYFKCRNVDMARKIFNQSTRTDIVMCTAMI  333

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              GL  +G    AL+ FR +  +  + + L +ASVL A A L  ++ G+E HG  ++ G  
Sbjct  334   SGLVLNGMNHDALEIFRWLLKEKMRPNSLTLASVLPACAGLVALKLGKELHGNILKHGLD  393

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
               + + SAL DMY+K G L+L  QVF+ M  ++ I +NSMI++   +G   EA  IF ++
Sbjct  394   GRLHLGSALTDMYAKSGRLDLAHQVFERMFERDTICWNSMITSYSQNGKPEEAIDIFRQM  453

Query  1342  -LEKEYYNPDEATFSALLCACCH  1407
              +    Y  D  + SA L AC +
Sbjct  454   GMAGAKY--DCVSISAALSACAN  474


 Score =   195 bits (496),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 115/377 (31%), Positives = 202/377 (54%), Gaps = 3/377 (1%)
 Frame = +1

Query  289   YALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTF  468
             Y L   IV A+ +F +   +    WN +IR +     F  A   +  ML SG  PD +TF
Sbjct  2     YFLCGSIVDAKNIFYKLDLQYTLPWNWMIRGFTMMGYFEFALLFYFKMLGSGISPDKYTF  61

Query  469   ACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAE  648
               +++AC    +    + ++  +   G  +D    S L+  Y   G + +A  +F  +  
Sbjct  62    PSVIKACGGVNNVRLGKAIYDTIQFMGFGVDIFVGSSLIQLYVDNGCIHDAWCLFVEMPH  121

Query  649   PDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
              D V WN M+ G+   G+ K A+ +F++M+    KP++ T+  ++      +++  G  +
Sbjct  122   KDCVLWNVMLHGYVKNGESKNAVGMFLEMRNSEIKPNAVTFACILSVCASEAMIGFGTQL  181

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             H L +  G + ++ V + L++MYS+C+C+  A ++FD +   D+VTW+ MI G  Q+G +
Sbjct  182   HGLIVACGLELDSPVANTLLAMYSKCQCLSEARKLFDMMPRTDLVTWNGMISGYIQNGFM  241

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
             ++A   F+ M     K D +  AS L + A+LA ++ G+E +G+ VR    L+V + SAL
Sbjct  242   VEASRLFQAMISSSVKPDSITFASFLPSVAELANLKQGKEIYGYIVRHCVPLDVFLKSAL  301

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             ID+Y KC  +++  ++F      +I+   +MIS L L+G  ++A +IF  +L KE   P+
Sbjct  302   IDVYFKCRNVDMARKIFNQSTRTDIVMCTAMISGLVLNGMNHDALEIFRWLL-KEKMRPN  360

Query  1369  EATFSALLCACCHTGLV  1419
               T +++L AC   GLV
Sbjct  361   SLTLASVLPAC--AGLV  375


 Score =   137 bits (344),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 101/412 (25%), Positives = 194/412 (47%), Gaps = 17/412 (4%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  ++     +   K ++  I++  +    F  + +I  Y    ++  AR++F+
Sbjct  261   ITFASFLPSVAEL-ANLKQGKEIYGYIVRHCVPLDVFLKSALIDVYFKCRNVDMARKIFN  319

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             ++ +  I +  ++I          +A ++F+ +L    RP++ T A +L AC+       
Sbjct  320   QSTRTDIVMCTAMISGLVLNGMNHDALEIFRWLLKEKMRPNSLTLASVLPACAGLVALKL  379

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG ++  GL+      S L   Y+K G L+ A +VF+ + E D + WNSMI+ +  
Sbjct  380   GKELHGNILKHGLDGRLHLGSALTDMYAKSGRLDLAHQVFERMFERDTICWNSMITSYSQ  439

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              G  ++A+ +F +M   G K D  +    L  C + P+ L  GK +H   ++  F S+  
Sbjct  440   NGKPEEAIDIFRQMGMAGAKYDCVSISAALSACANLPA-LHYGKEIHGFMIRSAFSSDLF  498

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
               S L+ +Y++C  +  A R+FD + E + V+W+++I      G +  +L  FREM   G
Sbjct  499   AESALIDVYAKCGNLVFARRVFDMMEEKNEVSWNSIISAYGSHGCLQDSLVLFREMLGNG  558

Query  1051  GKVDPLLIASVLSAAAQLAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
                D +    +LSA      V  G        E +G + R  ++      + ++D++ + 
Sbjct  559   ILPDHVTFLGILSACGHAGQVDDGIFYFRCMIEEYGISARSEHY------ACMVDLFGRA  612

Query  1210  GFLNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
             G L+   +  K+MP S +   + +++    +HGN   A +    + + E  N
Sbjct  613   GRLSEAFETIKSMPFSPDSGVWGTLLGACRVHGNVELAEEASRHLFDVEPQN  664



>ref|XP_010270642.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Nelumbo nucifera]
Length=714

 Score =   333 bits (853),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 291/526 (55%), Gaps = 4/526 (1%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             H + +K   S   F    +I  Y  +  ++  RR+FD  P+R+   W ++I  YA     
Sbjct  132   HCVSIKIANSRDIFVGCSLINMYCKSGFVLEGRRVFDRMPERNSVSWTTMISGYAVERLT  191

Query  403   SNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQL  582
             + A  LFK M       + F F  IL A         ++ VH   + +GL       + L
Sbjct  192   AEAMLLFKLMRCEEGDENEFVFTSILSALVLPEHIDNVKQVHCVALRNGLVSFLSVRNAL  251

Query  583   VSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDS  762
             V++Y+K G   +A+ +F+   + + + W++MI+G+   G+ + AL LF KMQ  G +P  
Sbjct  252   VTSYTKSGNSNDALGMFESSTDRNTITWSAMITGYAQTGNSEDALCLFSKMQSFGIRPSK  311

Query  763   FTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDS  942
             FT+VG++        +R GK VH   LK GF+S   + + LV MY++C C+  A + FD 
Sbjct  312   FTFVGVLNACSDIGAVREGKQVHDYLLKLGFESQVFIRTALVDMYAKCGCVVDARKGFDQ  371

Query  943   LLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPG  1122
             L +PD+V W++MI G  Q+G+  +AL  +  M+M+G   + L +ASV+ A + LA ++ G
Sbjct  372   LQDPDIVLWTSMIGGYVQNGEYEEALSLYGRMDMEGIWPNELTLASVIRACSSLAALEQG  431

Query  1123  RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLH  1302
             ++ H   ++ G+ LE+ + SAL  MY+KC  L  G  +F+ MP ++++S+NSMIS L  +
Sbjct  432   KQIHARTIKLGFGLEIPIGSALSTMYAKCADLEDGSLIFRRMPCRDVVSWNSMISGLSQN  491

Query  1303  GNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTE  1482
             G   EA  +FEE +  E   PD  TF  LL AC H GLV  G  YF+ M  E+ + P+ E
Sbjct  492   GCGKEALDLFEE-MRMEGTKPDYVTFVNLLSACSHMGLVERGWAYFKSMFSEYVMAPRVE  550

Query  1483  HYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDN  1662
             HY  MV +L  AG+L EA ELI+S+    +  +W  LL  C  + N+ +G    + L   
Sbjct  551   HYACMVDILSRAGKLNEAKELIESVSSEYEMCLWRILLGACRNYRNFDIGAYAGERLMKL  610

Query  1663  KVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
               + SS  V++S++Y+  GRWE V+++R  M  ++G  K PG SWI
Sbjct  611   GTQDSSAYVLLSSIYSALGRWEDVERVRGVMR-LRGVNKEPGCSWI  655


 Score =   175 bits (444),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 214/447 (48%), Gaps = 7/447 (2%)
 Frame = +1

Query  148   MFIAFRSLLTQLSR--SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSAR  321
             M  A RS  T L      + +   + LHA I+K+ L    F A  ++ +YA    +V A+
Sbjct  1     MNFASRSFFTSLLHFTEQKNLHNGRTLHAQIVKSGLGSDLFLANSLVNYYAKCGHLVQAQ  60

Query  322   RLFDETPQRSIFLWNSIIRAYARAHR---FSNAFQLFKDMLDSGTRPDNFTFACILRACS  492
               F+E   + +  WN +I  Y++       S   QLF+ M      P+  T A +L   +
Sbjct  61    LQFEEIDNKDVISWNCLINGYSQQSSPEGSSLVVQLFQRMRTENVIPNAHTLAGVLTTAA  120

Query  493   DKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNS  672
             +  D S  +  H   +      D      L++ Y K G + E  +VFD + E + V W +
Sbjct  121   NLSDASFGQQAHCVSIKIANSRDIFVGCSLINMYCKSGFVLEGRRVFDRMPERNSVSWTT  180

Query  673   MISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFG  852
             MISG+       +A+LLF  M+      + F +  ++  L  P  +   K VH + L+ G
Sbjct  181   MISGYAVERLTAEAMLLFKLMRCEEGDENEFVFTSILSALVLPEHIDNVKQVHCVALRNG  240

Query  853   FDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFR  1032
               S   V + LV+ Y++      A  +F+S  + + +TWSAMI G +Q+G+   AL  F 
Sbjct  241   LVSFLSVRNALVTSYTKSGNSNDALGMFESSTDRNTITWSAMITGYAQTGNSEDALCLFS  300

Query  1033  EMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCG  1212
             +M   G +        VL+A + +  V+ G++ H + ++ G+  +V + +AL+DMY+KCG
Sbjct  301   KMQSFGIRPSKFTFVGVLNACSDIGAVREGKQVHDYLLKLGFESQVFIRTALVDMYAKCG  360

Query  1213  FLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
              +    + F  +   +I+ + SMI     +G   EA  ++   ++ E   P+E T ++++
Sbjct  361   CVVDARKGFDQLQDPDIVLWTSMIGGYVQNGEYEEALSLYGR-MDMEGIWPNELTLASVI  419

Query  1393  CACCHTGLVCDGRR-YFRIMNDEFGIQ  1470
              AC     +  G++ + R +   FG++
Sbjct  420   RACSSLAALEQGKQIHARTIKLGFGLE  446


 Score =   104 bits (259),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 140/311 (45%), Gaps = 10/311 (3%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  +LK       F  T ++  YA    +V AR+ FD+     I LW S+I  Y + 
Sbjct  331   KQVHDYLLKLGFESQVFIRTALVDMYAKCGCVVDARKGFDQLQDPDIVLWTSMIGGYVQN  390

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
               +  A  L+  M   G  P+  T A ++RACS        + +H   +  G  L+    
Sbjct  391   GEYEEALSLYGRMDMEGIWPNELTLASVIRACSSLAALEQGKQIHARTIKLGFGLEIPIG  450

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S L + Y+K   LE+   +F  +   D+V WNSMISG    G  K+AL LF +M+  G K
Sbjct  451   SALSTMYAKCADLEDGSLIFRRMPCRDVVSWNSMISGLSQNGCGKEALDLFEEMRMEGTK  510

Query  754   PDSFTYVGLIMCLDCPSLLRIG-KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
             PD  T+V L+       L+  G     S+  ++         + +V + SR   +  A  
Sbjct  511   PDYVTFVNLLSACSHMGLVERGWAYFKSMFSEYVMAPRVEHYACMVDILSRAGKLNEAKE  570

Query  931   IFDSL-LEPDMVTWSAMI--CGLSQSGDIMKALDFFREMNMKGGKVDP---LLIASVLSA  1092
             + +S+  E +M  W  ++  C   ++ DI     +  E  MK G  D    +L++S+ SA
Sbjct  571   LIESVSSEYEMCLWRILLGACRNYRNFDIGA---YAGERLMKLGTQDSSAYVLLSSIYSA  627

Query  1093  AAQLAIVQPGR  1125
               +   V+  R
Sbjct  628   LGRWEDVERVR  638



>ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Cicer arietinum]
Length=814

 Score =   335 bits (860),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 190/548 (35%), Positives = 296/548 (54%), Gaps = 9/548 (2%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             + L QL   N  +   + +H +++      + F  T ++  YA    I  A ++FD  PQ
Sbjct  143   TYLLQLCGDNLDLKKGREIHGMLIVNGYESNLFAMTAVVNLYAKCRQIDDAYKMFDRMPQ  202

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRV-  522
             + +  WN+++  YA+      A +L  DM ++G +PD+ T   IL A +D     GLR+ 
Sbjct  203   KDLVSWNTVVSGYAQNGFARKALKLVLDMQEAGQKPDSITLVSILPAVAD---IKGLRIG  259

Query  523   --VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
               +HG  V SG E     S+ L+  Y K G +E    VF  ++  ++V WN++I G    
Sbjct  260   RSIHGYAVRSGFESYVNVSTALLDMYFKCGSVETGRLVFRRMSSKNVVSWNTVIDGLAQN  319

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             G+ ++A   F+KM     +P + T +G +        L  G+ VH L  +   DSN  V 
Sbjct  320   GESEEAFATFLKMLDEKVEPTNVTMMGALHACSNLGDLERGRFVHRLLDERKLDSNVSVM  379

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + L+SMYS+CK +  A  IFD+L     VTW+AMI G +Q+G + +AL+ F  M  +G K
Sbjct  380   NSLISMYSKCKRVDVAASIFDNLKGKTNVTWNAMILGYAQNGCVNEALNLFCTMQSQGVK  439

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D     SV++A A L++ +  +  HG A+R      V V++AL+DMY+KCG +    ++
Sbjct  440   PDSFTFVSVITALADLSVTRQAKWIHGLAMRTNMDKNVFVATALVDMYAKCGAIETAREL  499

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  M  +++I++N+MI   G HG    A  +FE +  +    P+E TF +++ AC H+G 
Sbjct  500   FNKMQERHVITWNAMIDGYGTHGLGKAALDLFENMRNEVSVKPNEITFLSVISACSHSGF  559

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             V +G  YF+IM +++G++P  +HY  MV LLG AG+L+ A+  IQ I       + GA+L
Sbjct  560   VEEGLYYFKIMKEDYGLEPGMDHYGAMVDLLGRAGKLDSAWNFIQEIPIKPGITVLGAML  619

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--  1770
               C IH N  LG   A  LF+   E+  Y V+++NMYA    W+ V K+R  ME  KG  
Sbjct  620   GACKIHKNVELGEKAADKLFELDPEEGGYHVLLANMYASASMWDKVAKVRTAMEK-KGLQ  678

Query  1771  KMPGKSWI  1794
             K PG S +
Sbjct  679   KTPGCSLV  686


 Score =   201 bits (511),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 132/491 (27%), Positives = 242/491 (49%), Gaps = 14/491 (3%)
 Frame = +1

Query  205   STTKLLHAI---ILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             ++ K LH I   I+K    +   + T++I  +     I  A R+F+    +   L+++++
Sbjct  52    TSMKELHQILPLIIKNGFYNEHLFQTKLISLFCKYGSINEASRVFNPVENKLDVLYHTML  111

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             + YA+     ++   +K M     +P  + F  +L+ C D  D    R +HG ++V+G E
Sbjct  112   KGYAKNLTLCDSLVFYKRMQCDEVKPVVYDFTYLLQLCGDNLDLKKGREIHGMLIVNGYE  171

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              +    + +V+ Y+K   +++A K+FD + + DLV WN+++SG+   G  +KAL L + M
Sbjct  172   SNLFAMTAVVNLYAKCRQIDDAYKMFDRMPQKDLVSWNTVVSGYAQNGFARKALKLVLDM  231

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
             Q  G+KPDS T V ++  +     LRIG+++H   ++ GF+S  +V + L+ MY +C  +
Sbjct  232   QEAGQKPDSITLVSILPAVADIKGLRIGRSIHGYAVRSGFESYVNVSTALLDMYFKCGSV  291

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP--LLIASVLS  1089
              +   +F  +   ++V+W+ +I GL+Q+G+  +A   F  + M   KV+P  + +   L 
Sbjct  292   ETGRLVFRRMSSKNVVSWNTVIDGLAQNGESEEAFATF--LKMLDEKVEPTNVTMMGALH  349

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A + L  ++ GR  H           VSV ++LI MYSKC  +++   +F  +  K  ++
Sbjct  350   ACSNLGDLERGRFVHRLLDERKLDSNVSVMNSLISMYSKCKRVDVAASIFDNLKGKTNVT  409

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +N+MI     +G  NEA  +F   ++ +   PD  TF +++ A      V    ++   +
Sbjct  410   WNAMILGYAQNGCVNEALNLF-CTMQSQGVKPDSFTFVSVITALADLS-VTRQAKWIHGL  467

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
                  +         +V +    G +E A EL   +Q       W A++     HG    
Sbjct  468   AMRTNMDKNVFVATALVDMYAKCGAIETARELFNKMQ-ERHVITWNAMIDGYGTHG----  522

Query  1630  GGIVAKHLFDN  1662
              G  A  LF+N
Sbjct  523   LGKAALDLFEN  533



>ref|XP_008377650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Malus domestica]
 ref|XP_008377651.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Malus domestica]
Length=595

 Score =   329 bits (843),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 184/548 (34%), Positives = 302/548 (55%), Gaps = 7/548 (1%)
 Frame = +1

Query  151   FIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSARRL  327
             +++F   L   S    ++S  K +HA+I +   +     +T+++   + L   +  AR+L
Sbjct  30    YLSFNYFLNSCS----SLSNLKCIHALIFQHGSNQSLLLSTKLVTLASSLAPTMDYARKL  85

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD TP+R +FLWN++IR YA       A  L+++M  SG  PDN+TF  ++R+C+ +   
Sbjct  86    FDATPERDVFLWNTLIRGYADQGPCHEAIVLYRNMHRSGLSPDNYTFPFVVRSCAVQLAL  145

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
                + VH  V+  G   D    S LVS Y++ G   ++  VF  +   ++V W +MI+G+
Sbjct  146   REGKEVHCNVIKYGFHSDVFVQSALVSMYAQSGETLDSEIVFSEMVVKNIVSWTAMIAGY  205

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G +++ L +   M     +P+  T V ++        L +GK +H   +K G D + 
Sbjct  206   VQNGFYEEGLGVLRDMVASDTQPNVVTLVSVLPACASLEFLDLGKLIHGFGIKVGVDKDV  265

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              + + L++ Y +C  + +A  +FD +   ++V+W+AMI    Q+    +A++ FR M  +
Sbjct  266   ALMNALIACYGKCGNLDTARYLFDGMAVRNLVSWNAMIAAYEQNNSGTEAIELFRRMQTE  325

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               + D + + SV+SA   L  +  GR  H      G+    S+++ALIDMY+KCG +NL 
Sbjct  326   NVEYDYITLVSVISACTSLGALNTGRWLHELIRMKGFGTNASITNALIDMYAKCGNINLA  385

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF+ +P K+++S+ S+I     HG+ ++A ++F  ++E +   P+  TF+A+L AC H
Sbjct  386   KDVFQGLPHKSVVSWTSIIGACASHGHGDDALRLFSMMIE-QCVKPNSFTFTAVLTACRH  444

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV +GR++F  M  ++ I P  EHY  MV LLG AG L EAY+ I+ +    D G+WG
Sbjct  445   VGLVEEGRKHFESMIKDYSICPGLEHYACMVDLLGRAGCLLEAYKFIERMPVDPDVGVWG  504

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALLS C IHGN  L  +V  HL     +  +  V++SN+YA   RWE   +LR  M E  
Sbjct  505   ALLSACRIHGNVELAELVTAHLSHLDTQTVTSYVLMSNIYAEARRWEDEARLRNLMREKE  564

Query  1765  KGKMPGKS  1788
               K+PG+S
Sbjct  565   LMKLPGQS  572



>ref|XP_009357835.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Pyrus x bretschneideri]
Length=880

 Score =   335 bits (860),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 194/526 (37%), Positives = 285/526 (54%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +++   L      A  ++  Y+  +    AR+LFD  PQ  +  WN +I  Y ++  
Sbjct  303   LHGLVVAYGLESDSPVANTLLAMYSKCQYFSDARKLFDMMPQTDLVTWNGMISGYIQSGF  362

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A +LF+DM+ +  +PD  TFA  L + +++      + +H  +V   + LD    S 
Sbjct  363   MLEASRLFQDMISTSVKPDAITFASFLPSVAEQGSLKQCKEIHCYIVRHCVPLDVFLQSA  422

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A K+F+     D+V   +MISG    G    AL +F  + +   +P+
Sbjct  423   LIDVYFKCRNVEMARKIFNQSTRTDVVMCTAMISGFVLNGMNSDALDIFRWLLKQKMRPN  482

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T   ++      + L+ GK VH   LK GFD   +VGS L  MY++   +  A  +F 
Sbjct  483   SLTVATVLPACAGLAALKSGKEVHGNILKHGFDGRCYVGSALTDMYAKSGRLDLAHCVFQ  542

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L E D V W++MI   SQ+G   +A+D FR+M M G K D + I++ LSA A L     
Sbjct  543   RLTERDAVCWNSMITSFSQNGKPEEAVDLFRQMGMGGVKYDCVSISAALSACANLPAFHY  602

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E H F +R  +  ++   SALIDMY+KCG L+L   VF  M  KN +S+NS+IS  G 
Sbjct  603   GKEIHSFMIRNAFSSDLFAESALIDMYAKCGNLDLARHVFDMMEEKNEVSWNSIISAYGN  662

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG+  E+  +F E+L      PD  TF  +L AC H G V DG  YFR M +E+GI  + 
Sbjct  663   HGHLKESLVLFHEMLGNGIL-PDHVTFLGILSACGHAGAVDDGILYFRSMIEEYGIPARL  721

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LLG AG L EA+E I+S+    D G+WG +L  C +HGN  L   V+++LF+
Sbjct  722   EHYACMVDLLGRAGHLHEAFETIKSMPFSPDSGVWGTMLGACRLHGNVELAEEVSRYLFE  781

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
                  S Y +++SN+ A  G+W  V K+R  M+  +  K+PG SWI
Sbjct  782   LAPLNSGYYILLSNILADAGKWGSVLKVRTLMKNREVQKVPGYSWI  827


 Score =   200 bits (509),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/421 (27%), Positives = 216/421 (51%), Gaps = 1/421 (0%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + Q    +  +   + +HA ++ + L  +    T+I+  Y L   I+ A+ +F +   + 
Sbjct  85    IVQACSDHSLLQQGRQVHAHVICSGLVKNSLVGTKILGMYFLCGSIIDAKNMFYQLDLKY  144

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
                WN +IR +     F  A   +  MLDSG  PD +TF  +++AC    +    + V+ 
Sbjct  145   TLPWNWMIRGFTLTGYFDYALLFYFKMLDSGVSPDKYTFPSVIKACGGVNNVRLGKAVYD  204

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              + + G  +D    S L+  Y   G +++A  +F  + + D V WN M+ G+   G+   
Sbjct  205   TIQLMGFGIDIFVGSSLIQLYVDNGCIQDAWHLFVKMPDKDCVLWNVMLHGYVKNGESNN  264

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
             ++ +F++M+    KP++ T+  ++      +++  G  +H L + +G +S++ V + L++
Sbjct  265   SVRMFLEMRSSEVKPNAVTFACILSVCASEAMIGFGTQLHGLVVAYGLESDSPVANTLLA  324

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             MYS+C+    A ++FD + + D+VTW+ MI G  QSG +++A   F++M     K D + 
Sbjct  325   MYSKCQYFSDARKLFDMMPQTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDAIT  384

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
              AS L + A+   ++  +E H + VR    L+V + SALID+Y KC  + +  ++F    
Sbjct  385   FASFLPSVAEQGSLKQCKEIHCYIVRHCVPLDVFLQSALIDVYFKCRNVEMARKIFNQST  444

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
               +++   +MIS   L+G  ++A  IF  +L K+   P+  T + +L AC     +  G+
Sbjct  445   RTDVVMCTAMISGFVLNGMNSDALDIFRWLL-KQKMRPNSLTVATVLPACAGLAALKSGK  503

Query  1432  R  1434
              
Sbjct  504   E  504


 Score =   194 bits (494),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/470 (29%), Positives = 229/470 (49%), Gaps = 5/470 (1%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             F  + +I+ Y  N  I  A  LF + P +   LWN ++  Y +    +N+ ++F +M  S
Sbjct  216   FVGSSLIQLYVDNGCIQDAWHLFVKMPDKDCVLWNVMLHGYVKNGESNNSVRMFLEMRSS  275

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               +P+  TFACIL  C+ +        +HG VV  GLE DS  ++ L++ YSK     +A
Sbjct  276   EVKPNAVTFACILSVCASEAMIGFGTQLHGLVVAYGLESDSPVANTLLAMYSKCQYFSDA  335

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD + + DLV WN MISG+   G   +A  LF  M     KPD+ T+   +  +   
Sbjct  336   RKLFDMMPQTDLVTWNGMISGYIQSGFMLEASRLFQDMISTSVKPDAITFASFLPSVAEQ  395

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
               L+  K +H   ++     +  + S L+ +Y +C+ +  A +IF+     D+V  +AMI
Sbjct  396   GSLKQCKEIHCYIVRHCVPLDVFLQSALIDVYFKCRNVEMARKIFNQSTRTDVVMCTAMI  455

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G   +G    ALD FR +  +  + + L +A+VL A A LA ++ G+E HG  ++ G+ 
Sbjct  456   SGFVLNGMNSDALDIFRWLLKQKMRPNSLTVATVLPACAGLAALKSGKEVHGNILKHGFD  515

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 V SAL DMY+K G L+L   VF+ +  ++ + +NSMI++   +G   EA  +F + 
Sbjct  516   GRCYVGSALTDMYAKSGRLDLAHCVFQRLTERDAVCWNSMITSFSQNGKPEEAVDLFRQ-  574

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM-NDEFGIQPKTEHYVYMVKLLGMA  1518
             +       D  + SA L AC +      G+     M  + F      E    ++ +    
Sbjct  575   MGMGGVKYDCVSISAALSACANLPAFHYGKEIHSFMIRNAFSSDLFAES--ALIDMYAKC  632

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKV  1668
             G L+ A  +   ++   +   W +++S    HG+ +   ++   +  N +
Sbjct  633   GNLDLARHVFDMMEEKNEVS-WNSIISAYGNHGHLKESLVLFHEMLGNGI  681


 Score =   150 bits (378),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 158/316 (50%), Gaps = 1/316 (0%)
 Frame = +1

Query  466   FACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             FA I++ACSD       R VH  V+ SGL  +S+  ++++  Y   G + +A  +F  + 
Sbjct  82    FASIVQACSDHSLLQQGRQVHAHVICSGLVKNSLVGTKILGMYFLCGSIIDAKNMFYQLD  141

Query  646   EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKN  825
                 + WN MI G    G +  ALL + KM   G  PD +T+  +I      + +R+GK 
Sbjct  142   LKYTLPWNWMIRGFTLTGYFDYALLFYFKMLDSGVSPDKYTFPSVIKACGGVNNVRLGKA  201

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             V+      GF  +  VGS L+ +Y    C+  A  +F  + + D V W+ M+ G  ++G+
Sbjct  202   VYDTIQLMGFGIDIFVGSSLIQLYVDNGCIQDAWHLFVKMPDKDCVLWNVMLHGYVKNGE  261

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
                ++  F EM     K + +  A +LS  A  A++  G + HG  V  G   +  V++ 
Sbjct  262   SNNSVRMFLEMRSSEVKPNAVTFACILSVCASEAMIGFGTQLHGLVVAYGLESDSPVANT  321

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             L+ MYSKC + +   ++F  MP  +++++N MIS     G   EA ++F++++      P
Sbjct  322   LLAMYSKCQYFSDARKLFDMMPQTDLVTWNGMISGYIQSGFMLEASRLFQDMISTS-VKP  380

Query  1366  DEATFSALLCACCHTG  1413
             D  TF++ L +    G
Sbjct  381   DAITFASFLPSVAEQG  396


 Score =   142 bits (359),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 104/407 (26%), Positives = 188/407 (46%), Gaps = 17/407 (4%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  ++    ++   K +H  I++  +    F  + +I  Y    ++  AR++F+
Sbjct  383   ITFASFLPSVAEQG-SLKQCKEIHCYIVRHCVPLDVFLQSALIDVYFKCRNVEMARKIFN  441

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             ++ +  + +  ++I  +      S+A  +F+ +L    RP++ T A +L AC+       
Sbjct  442   QSTRTDVVMCTAMISGFVLNGMNSDALDIFRWLLKQKMRPNSLTVATVLPACAGLAALKS  501

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + VHG ++  G +      S L   Y+K G L+ A  VF  + E D V WNSMI+    
Sbjct  502   GKEVHGNILKHGFDGRCYVGSALTDMYAKSGRLDLAHCVFQRLTERDAVCWNSMITSFSQ  561

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              G  ++A+ LF +M   G K D  +    L  C + P+    GK +HS  ++  F S+  
Sbjct  562   NGKPEEAVDLFRQMGMGGVKYDCVSISAALSACANLPA-FHYGKEIHSFMIRNAFSSDLF  620

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
               S L+ MY++C  +  A  +FD + E + V+W+++I      G + ++L  F EM   G
Sbjct  621   AESALIDMYAKCGNLDLARHVFDMMEEKNEVSWNSIISAYGNHGHLKESLVLFHEMLGNG  680

Query  1051  GKVDPLLIASVLSAAAQLAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
                D +    +LSA      V  G        E +G   R  ++      + ++D+  + 
Sbjct  681   ILPDHVTFLGILSACGHAGAVDDGILYFRSMIEEYGIPARLEHY------ACMVDLLGRA  734

Query  1210  GFLNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLE  1347
             G L+   +  K+MP S +   + +M+    LHGN   A ++   + E
Sbjct  735   GHLHEAFETIKSMPFSPDSGVWGTMLGACRLHGNVELAEEVSRYLFE  781



>ref|XP_009388427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Musa acuminata subsp. malaccensis]
Length=714

 Score =   332 bits (850),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 195/530 (37%), Positives = 290/530 (55%), Gaps = 4/530 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             ++ HA ++K+  +     ++ ++  YA  +   SA +LFDE   +    WN+++  Y ++
Sbjct  137   EVFHAGLMKSGFAADVVISSSLVYMYAKCDRFSSAIQLFDEMTHKDAACWNTVMSCYYQS  196

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              + S A +LF++M   G  PD  T+     AC    D    R +H  +  SG ELD+  S
Sbjct  197   GQASKALELFEEMNRCGFEPDCVTYTTAFSACGRLQDLERGRKMHEMLNESGFELDAFIS  256

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S +V  Y+K G LE A  VF+ I    +V WNS+I G+   GD   +L+LF +M + G K
Sbjct  257   SAIVDMYAKCGCLESARDVFERIPSKSVVSWNSIIGGYSSAGDSHSSLILFRRMTKEGFK  316

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P S T   L+M     S  R GK +H   ++   +++  V S LV  Y +C     A  +
Sbjct  317   PTSTTISCLLMACSRSSNSRHGKFIHGYIVRNCMEADIFVVSSLVDFYFKCGIARHAESV  376

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F+ + + ++V+W+ MI G    G   KAL+ F +M + G   D +   SVLSA AQLA +
Sbjct  377   FEKMPKSNVVSWNVMISGYVTVGCFFKALELFHDMRVYGVSPDAITFISVLSACAQLAAL  436

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + GRE H      G      V   L+DMY+KCG ++   +VF  + +K+I+S+ SMI   
Sbjct  437   EQGREIHKQISNHGLECNEKVMCTLVDMYAKCGAISEAREVFDRLATKDILSWTSMIMAY  496

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG A+EAF++F E L+K     D  TF A+L AC H GLV +GR YF  M +E+GI+P
Sbjct  497   GSHGQASEAFKLFHE-LQKVKAKLDHVTFLAVLVACSHGGLVDEGRLYFDQMTNEYGIKP  555

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPV--DFGIWGALLSCCDIHGNYRLGGIVAK  1647
               EHY  ++ LLG +G L EAY +++     +  D G+ G+L S C +H N  LG  VAK
Sbjct  556   HIEHYSCLIDLLGRSGRLNEAYSVLKKSTPEIRADAGLLGSLFSACSLHRNLELGEEVAK  615

Query  1648  HLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
              L +   +  S  V ++NMYA  GRW+ V+K+R  + E    K PG SWI
Sbjct  616   LLVEVDPDDHSTYVTLANMYASVGRWDDVRKVRATVKERGLKKNPGCSWI  665


 Score =   194 bits (493),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 234/478 (49%), Gaps = 7/478 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             Q++++ KL+HA  +   L  +      ++ FY     +  A ++ +      +  WN+++
Sbjct  28    QSLASGKLVHAKSVSLGLQSNSLLCRALVGFYLSFHLLHPALKVLESNTSDDVSPWNALL  87

Query  376   RAYARAHRFSNAFQLFKDMLDSGTR--PDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
                ++    + A  LF+ +L    R  P+ FT+   ++AC+         V H G++ SG
Sbjct  88    SVCSKRQLHAQALCLFQKLLLLSPRLKPNAFTYPSAIKACAGLGAARNGEVFHAGLMKSG  147

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
                D + SS LV  Y+K      AI++FD +   D   WN+++S +   G   KAL LF 
Sbjct  148   FAADVVISSSLVYMYAKCDRFSSAIQLFDEMTHKDAACWNTVMSCYYQSGQASKALELFE  207

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
             +M R G +PD  TY            L  G+ +H +  + GF+ +A + S +V MY++C 
Sbjct  208   EMNRCGFEPDCVTYTTAFSACGRLQDLERGRKMHEMLNESGFELDAFISSAIVDMYAKCG  267

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
             C+ SA  +F+ +    +V+W+++I G S +GD   +L  FR M  +G K     I+ +L 
Sbjct  268   CLESARDVFERIPSKSVVSWNSIIGGYSSAGDSHSSLILFRRMTKEGFKPTSTTISCLLM  327

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A ++ +  + G+  HG+ VR     ++ V S+L+D Y KCG       VF+ MP  N++S
Sbjct  328   ACSRSSNSRHGKFIHGYIVRNCMEADIFVVSSLVDFYFKCGIARHAESVFEKMPKSNVVS  387

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEY-YNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             +N MIS     G   +A ++F ++  + Y  +PD  TF ++L AC     +  GR   + 
Sbjct  388   WNVMISGYVTVGCFFKALELFHDM--RVYGVSPDAITFISVLSACAQLAALEQGREIHKQ  445

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
             +++  G++   +    +V +    G + EA E+   +    D   W +++     HG 
Sbjct  446   ISNH-GLECNEKVMCTLVDMYAKCGAISEAREVFDRL-ATKDILSWTSMIMAYGSHGQ  501


 Score =   168 bits (425),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/400 (29%), Positives = 194/400 (49%), Gaps = 15/400 (4%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             Q +   + +H ++ ++      F ++ I+  YA    + SAR +F+  P +S+  WNSII
Sbjct  232   QDLERGRKMHEMLNESGFELDAFISSAIVDMYAKCGCLESARDVFERIPSKSVVSWNSII  291

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y+ A    ++  LF+ M   G +P + T +C+L ACS   +    + +HG +V + +E
Sbjct  292   GGYSSAGDSHSSLILFRRMTKEGFKPTSTTISCLLMACSRSSNSRHGKFIHGYIVRNCME  351

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              D    S LV  Y K G    A  VF+ + + ++V WN MISG+  +G + KAL LF  M
Sbjct  352   ADIFVVSSLVDFYFKCGIARHAESVFEKMPKSNVVSWNVMISGYVTVGCFFKALELFHDM  411

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
             +  G  PD+ T++ ++      + L  G+ +H      G + N  V   LV MY++C  +
Sbjct  412   RVYGVSPDAITFISVLSACAQLAALEQGREIHKQISNHGLECNEKVMCTLVDMYAKCGAI  471

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A  +FD L   D+++W++MI      G   +A   F E+     K+D +   +VL A 
Sbjct  472   SEAREVFDRLATKDILSWTSMIMAYGSHGQASEAFKLFHELQKVKAKLDHVTFLAVLVAC  531

Query  1096  AQLAIVQPGR-----ETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF-KAMPSK  1257
             +   +V  GR      T+ + ++   H+E    S LID+  + G LN    V  K+ P  
Sbjct  532   SHGGLVDEGRLYFDQMTNEYGIK--PHIE--HYSCLIDLLGRSGRLNEAYSVLKKSTPEI  587

Query  1258  NIIS--YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDE  1371
                +    S+ S   LH N     ++ + ++E    +PD+
Sbjct  588   RADAGLLGSLFSACSLHRNLELGEEVAKLLVE---VDPDD  624



>ref|XP_010936927.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Elaeis guineensis]
Length=599

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 184/541 (34%), Positives = 302/541 (56%), Gaps = 3/541 (1%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSARRLFDETPQRSIFLWN  366
             S  ++S  + LHA IL   LSHH   AT++I   A L+  +  AR+LFD  P R  F+WN
Sbjct  34    SCSSLSALQCLHAHILTQGLSHHLALATKLISLAAALSPTMDYARKLFDAAPHRDSFMWN  93

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             +++R YA +        L++ M   G  PDNFTF  ++R+C+        + VH  V+ +
Sbjct  94    TLLRGYADSGPCEEVPVLYRRMHRLGLSPDNFTFPFVVRSCAVLSALREGKEVHCNVIKT  153

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G + +    S LV+ YS+ G + ++  VF  +   ++V W +MI+G+     + KA+ +F
Sbjct  154   GFDSNVFLQSALVTMYSQNGEISDSELVFGDMTFRNIVSWTAMIAGYAQNCLFGKAVRVF  213

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
               M   G +P+  T V ++  L     L  G+++H   +K G DS+  + + L++MY +C
Sbjct  214   QWMVASGMQPNDVTLVSVLPALKGLECLHSGESIHGHIIKRGLDSHVSLMNALIAMYGKC  273

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
               +  A  +F+ +    +V+W+AMI    QSGD ++A+  FR M  +    + + + SV+
Sbjct  274   GSIDVARFLFNRMPVQSLVSWNAMIAAYEQSGDGIRAIKLFRGMLTEKVPFNSVTLVSVI  333

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             SA +    ++ G+  H  A   G   +V V +AL++MY+KCG ++   ++F+ +P + ++
Sbjct  334   SACSSSGALETGKWVHKLAKSRGLESDVRVGNALLNMYAKCGGVDPAREIFEELPWRGVV  393

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             S+++MI     HG+A  A ++F E ++ E   P+  TF+++L AC H+GLV +G ++F  
Sbjct  394   SWSAMIGAYATHGHAEMALELFSE-MQAEGVRPNTFTFTSVLAACSHSGLVDEGMKHFES  452

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M  ++ I P  EH   MV LLG AG L +AYE I+ +    D G+WGALL  C IHGN  
Sbjct  453   MEKDYAITPTVEHCACMVDLLGRAGRLVDAYEFIKRMGVEPDAGVWGALLGACRIHGNLE  512

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWISNI  1803
             L   VA+ LF       ++ V++SNMYA  GRWE   + R  M  ++  K+PG S ++  
Sbjct  513   LAEFVAEDLFRLGSHDVTFYVLMSNMYAEAGRWEDAARWRNMMRELELKKIPGCSLVNTQ  572

Query  1804  K  1806
             K
Sbjct  573   K  573



>ref|XP_009341462.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Pyrus x bretschneideri]
Length=711

 Score =   331 bits (848),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 190/521 (36%), Positives = 297/521 (57%), Gaps = 13/521 (2%)
 Frame = +1

Query  196   QTISTTK------LLHAI-ILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSI  354
             Q+++ TK       LHA+ +   +L ++ + +T++  FYA    +  A+ +FD    ++ 
Sbjct  42    QSLTKTKSFPKGQQLHAVCVTAGNLINNTYLSTKLAAFYANCGKMPQAQLIFDGILLKNS  101

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             FLWN +IR YA       +  L+++ML  G + DNFT+  +L+AC D       R VHG 
Sbjct  102   FLWNFMIRGYACNGCPFKSLVLYREMLSFGQKADNFTYPFVLKACGDLLVVEIGRRVHGE  161

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             VVVSGLE D    + L++ YSK G +  A  VFD +   DL  WN+MISG    GD  + 
Sbjct  162   VVVSGLESDVYVGNALLAMYSKFGDMRLAGMVFDRMPGRDLTSWNTMISGCVRNGDPTEG  221

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSL--LRIGKNVHSLCLK-FGFDSNAHVGSLL  885
             L +F +M + G + D  T +G++    C  L  L+ GK VH+  ++  G   N  + + L
Sbjct  222   LAVFEEMGKAGLRADGTTLLGILS--GCAELMALKEGKAVHAYVVRNSGEIHNEFLTNSL  279

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             + MY +CK    + R+FD +   D V+W++MI G  Q+GD  ++L  F +M M+G +VD 
Sbjct  280   IEMYCKCKSAAYSRRLFDGVKLKDTVSWNSMISGYEQNGDAFESLRLFCQMVMEGAEVDE  339

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
             + + SVL A  Q++ +Q G   H   V+ G+   + V +AL+DMYSKCG L+    VF  
Sbjct  340   VTVTSVLGACDQISALQFGMSVHSCIVKKGFGGNIFVGTALVDMYSKCGSLSCSRFVFDE  399

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
             MP KN++S+++M+S  G HG   EA   + E++    + PDE   +++L AC H GLV +
Sbjct  400   MPVKNLVSWSAMVSGYGAHGRGEEAISCYHELVANN-FTPDEGVLTSVLSACSHAGLVNE  458

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
             G+  F  M  E+ ++P   HY  +V LLG AG ++EAYELI+++Q      IW ALLS C
Sbjct  459   GKDIFNRMTVEYNVKPGLAHYSCLVDLLGRAGRVDEAYELIKTMQVEPSSDIWAALLSAC  518

Query  1606  DIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWE  1728
              +H N +L  I A+++F+   +     + +SN+YA + RW+
Sbjct  519   RLHMNVKLAEIAAQNVFEMNPKGVGSYICLSNIYASEKRWD  559



>ref|XP_010940790.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Elaeis guineensis]
Length=820

 Score =   333 bits (855),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 187/540 (35%), Positives = 300/540 (56%), Gaps = 12/540 (2%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
             N  +   + +H+ ++    S + F  T ++  YA    I  AR++FD  P+R    WN+I
Sbjct  159   NADLKRGREIHSQLISNGFSSNVFTMTAVVNMYAKCRRIDEARKMFDRMPERDSVAWNAI  218

Query  373   IRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGL  552
             +  YA+     +A  +   M + G  PD+ +    L AC++       + VHG  + +G 
Sbjct  219   VAGYAQNGLAESALGMVARMQEDGVTPDSISLVSALPACANIGSMRIGKSVHGVAIRAGF  278

Query  553   ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIK  732
             +     S+ LV  Y+K G +E+A  VFD +   ++V WNSMI G+G  GD ++A+ LF +
Sbjct  279   DSMVNISTALVDMYAKCGAIEKARLVFDRMRLKNVVSWNSMIDGYGQSGDAEEAIRLFKE  338

Query  733   MQRMGEKPDSFTYVGLIMCL--DCPSL--LRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
             M   G +P   T    IMC    C  L  L  G  VH + ++ G  S+A V + L++MYS
Sbjct  339   MLAEGFEPTDVT----IMCALHACGELGDLEEGTFVHEMLIRLGLGSDASVMNSLITMYS  394

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             +CK +  A  IF+ L    +V+W+AMI G +Q+G    AL  F +M  +  K D   + S
Sbjct  395   KCKRVDLAAEIFECLRAKTLVSWNAMIWGYAQNGRTDDALRLFSKMQWQNVKPDSFTLVS  454

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             V+ A A  ++++  +  HG+A+R      + V +ALID+Y+KCG +N+  ++F A   ++
Sbjct  455   VIPALADFSVLRQAKWVHGYAIRLCLDGNIFVRTALIDLYAKCGRVNIARKLFDATNERH  514

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYF  1440
             + ++N+MI   G HG    A ++FEE +++    P++ TF  +L AC H GLV +G++YF
Sbjct  515   VTTWNAMIDGYGTHGFGKSAIELFEE-MKRSPVKPNDITFLCVLSACSHAGLVDEGQKYF  573

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
               M  ++G +P  +HY  MV LLG AG+L+EA++ IQ +       ++GA+L  C I+ N
Sbjct  574   ASMKKDYGFEPGMDHYGSMVDLLGRAGKLDEAWDFIQKMPIKPSISVYGAMLGACKIYKN  633

Query  1621  YRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              +LG   AK LF+ + E   Y V+++N+YA    WE V ++R  ME  KG  K PG S+I
Sbjct  634   VQLGEAAAKRLFELEPEDGGYHVLLANIYATASMWEDVARVRTMMEK-KGLQKTPGSSFI  692


 Score =   204 bits (518),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/423 (28%), Positives = 227/423 (54%), Gaps = 6/423 (1%)
 Frame = +1

Query  133   QLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIV  312
             Q+   +F    SLL +L    + +   +    +++K  L H   + T+++  ++    + 
Sbjct  41    QISSHLFSHPSSLLLELCSDPREL---RQFLPLVVKHGLFHEHIFQTKLLGLFSRFGHLH  97

Query  313   SARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACS  492
              A  +FD    ++  L++S+++ +A+      A   F  M  +  RP  + F  +L++C 
Sbjct  98    EAALVFDSIVDKTDELYHSMLKGHAKHSPLDKALAFFCTMKHAHVRPVVYNFTYLLKSCG  157

Query  493   DKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNS  672
             D  D    R +H  ++ +G   +    + +V+ Y+K   ++EA K+FD + E D V WN+
Sbjct  158   DNADLKRGREIHSQLISNGFSSNVFTMTAVVNMYAKCRRIDEARKMFDRMPERDSVAWNA  217

Query  673   MISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYV-GLIMCLDCPSLLRIGKNVHSLCLKF  849
             +++G+   G  + AL +  +MQ  G  PDS + V  L  C +  S+ RIGK+VH + ++ 
Sbjct  218   IVAGYAQNGLAESALGMVARMQEDGVTPDSISLVSALPACANIGSM-RIGKSVHGVAIRA  276

Query  850   GFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFF  1029
             GFDS  ++ + LV MY++C  +  A  +FD +   ++V+W++MI G  QSGD  +A+  F
Sbjct  277   GFDSMVNISTALVDMYAKCGAIEKARLVFDRMRLKNVVSWNSMIDGYGQSGDAEEAIRLF  336

Query  1030  REMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
             +EM  +G +   + I   L A  +L  ++ G   H   +R G   + SV ++LI MYSKC
Sbjct  337   KEMLAEGFEPTDVTIMCALHACGELGDLEEGTFVHEMLIRLGLGSDASVMNSLITMYSKC  396

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
               ++L  ++F+ + +K ++S+N+MI     +G  ++A ++F + ++ +   PD  T  ++
Sbjct  397   KRVDLAAEIFECLRAKTLVSWNAMIWGYAQNGRTDDALRLFSK-MQWQNVKPDSFTLVSV  455

Query  1390  LCA  1398
             + A
Sbjct  456   IPA  458



>ref|XP_009386862.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Musa acuminata subsp. malaccensis]
Length=804

 Score =   333 bits (854),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/527 (34%), Positives = 297/527 (56%), Gaps = 4/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H+ ++ +    + F  T ++  YA    I  ARR+FD  P+R +  WN+I+  YA+   
Sbjct  152   IHSQLIASGFGSNVFAMTAVVNMYAKCRRIEEARRMFDRMPERDLVAWNAIVSGYAQNGM  211

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A ++   +   G +PD+ T    L AC++       + VH   + +G +     S+ 
Sbjct  212   AERALEMVIRLQKDGHKPDSITLVSALPACANVGSLKIGKTVHAFAMKAGFDSLVNVSTA  271

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             LV  YSK G +E A  VFD +   ++V WNSMI G+G  GD ++AL LF KM   G +  
Sbjct  272   LVDMYSKRGAIETARLVFDSMRLKNVVSWNSMIDGYGQNGDAEEALRLFKKMMADGIQAT  331

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
               T +G +        L  G++VH L  + GF+S+  V + L++MYS+CK +  A  +F+
Sbjct  332   DVTIMGALYACGELGDLEEGRHVHELLTRTGFESDVSVLNALITMYSKCKRIDLAEDVFE  391

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
             ++    +V+W+AMI G +Q+  +  AL  F +M  +  K D   + SV+ A A +++++ 
Sbjct  392   NMPVKSLVSWNAMILGYAQNDRVEDALRLFNKMQWENVKPDSFTMVSVIPALADISVLKQ  451

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
              +  HGFA+R      + + +AL+D+Y+KCG + +  ++F AM  +++ ++N+MI   G 
Sbjct  452   AKWIHGFAIRLCTDKNIFIMTALVDLYAKCGSVRIARRLFDAMEERHVTTWNAMIDGYGT  511

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG    A  +FE+ +++    P++ T  ++L AC H+GLV +G++YF  M +++G +P  
Sbjct  512   HGFGKSAIDLFEQ-MKRSSVKPNDITLLSVLSACGHSGLVQEGKKYFASMKEDYGFEPNM  570

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             +HY  MV LLG AG L+EA++ IQ +       ++GA+L  C IH N +LG   A+ LF+
Sbjct  571   DHYGCMVDLLGRAGRLDEAWDFIQKMPIRPGISVYGAMLGACKIHKNVKLGEEAAQRLFE  630

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              + ++  Y V+++N+YA    WE V ++R  ME  KG  K PG S I
Sbjct  631   LEPDEGGYHVLLANIYAAASMWEDVARVRTMMEK-KGLQKTPGYSSI  676


 Score =   234 bits (597),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 141/463 (30%), Positives = 246/463 (53%), Gaps = 15/463 (3%)
 Frame = +1

Query  244   HLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLF  423
             HL H   + T+++  ++   D+  A  +F     ++  L++S++R +A+     +A   F
Sbjct  61    HLEH--VFQTKLVALFSRFGDLRDATLVFGSVEDKTDELYHSLLRGHAKHSSLDDAVAFF  118

Query  424   KDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKL  603
             + M  +G RP   +F  +L+AC D+ D    R +H  ++ SG   +    + +V+ Y+K 
Sbjct  119   RAMRRAGVRPAVHSFTYLLKACGDRSDLGRGREIHSQLIASGFGSNVFAMTAVVNMYAKC  178

Query  604   GPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYV-GL  780
               +EEA ++FD + E DLV WN+++SG+   G  ++AL + I++Q+ G KPDS T V  L
Sbjct  179   RRIEEARRMFDRMPERDLVAWNAIVSGYAQNGMAERALEMVIRLQKDGHKPDSITLVSAL  238

Query  781   IMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDM  960
               C +  S L+IGK VH+  +K GFDS  +V + LV MYS+   + +A  +FDS+   ++
Sbjct  239   PACANVGS-LKIGKTVHAFAMKAGFDSLVNVSTALVDMYSKRGAIETARLVFDSMRLKNV  297

Query  961   VTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGF  1140
             V+W++MI G  Q+GD  +AL  F++M   G +   + I   L A  +L  ++ GR  H  
Sbjct  298   VSWNSMIDGYGQNGDAEEALRLFKKMMADGIQATDVTIMGALYACGELGDLEEGRHVHEL  357

Query  1141  AVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEA  1320
               R G+  +VSV +ALI MYSKC  ++L   VF+ MP K+++S+N+MI     +    +A
Sbjct  358   LTRTGFESDVSVLNALITMYSKCKRIDLAEDVFENMPVKSLVSWNAMILGYAQNDRVEDA  417

Query  1321  FQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVY--  1494
              ++F + ++ E   PD  T  +++ A     ++   +         F I+  T+  ++  
Sbjct  418   LRLFNK-MQWENVKPDSFTMVSVIPALADISVLKQAKWIH-----GFAIRLCTDKNIFIM  471

Query  1495  --MVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
               +V L    G +  A  L  +++       W A++     HG
Sbjct  472   TALVDLYAKCGSVRIARRLFDAME-ERHVTTWNAMIDGYGTHG  513


 Score =   179 bits (455),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/328 (33%), Positives = 181/328 (55%), Gaps = 8/328 (2%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPD  654
             +L  C+D+ +   +R+    VV  GL L+ +  ++LV+ +S+ G L +A  VF  + +  
Sbjct  38    LLDLCADRRE---VRLFLPQVVKRGLHLEHVFQTKLVALFSRFGDLRDATLVFGSVEDKT  94

Query  655   LVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKP--DSFTYVGLIMCLDCPSLLRIGKNV  828
                ++S++ GH        A+  F  M+R G +P   SFTY+ L  C D   L R G+ +
Sbjct  95    DELYHSLLRGHAKHSSLDDAVAFFRAMRRAGVRPAVHSFTYL-LKACGDRSDLGR-GREI  152

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             HS  +  GF SN    + +V+MY++C+ +  A R+FD + E D+V W+A++ G +Q+G  
Sbjct  153   HSQLIASGFGSNVFAMTAVVNMYAKCRRIEEARRMFDRMPERDLVAWNAIVSGYAQNGMA  212

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
              +AL+    +   G K D + + S L A A +  ++ G+  H FA++ G+   V+VS+AL
Sbjct  213   ERALEMVIRLQKDGHKPDSITLVSALPACANVGSLKIGKTVHAFAMKAGFDSLVNVSTAL  272

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             +DMYSK G +     VF +M  KN++S+NSMI   G +G+A EA ++F++++       D
Sbjct  273   VDMYSKRGAIETARLVFDSMRLKNVVSWNSMIDGYGQNGDAEEALRLFKKMMADGIQATD  332

Query  1369  EATFSALLCACCHTGLVCDGRRYFRIMN  1452
               T    L AC   G + +GR    ++ 
Sbjct  333   -VTIMGALYACGELGDLEEGRHVHELLT  359


 Score =   177 bits (450),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 125/433 (29%), Positives = 206/433 (48%), Gaps = 8/433 (2%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K +HA  +K         +T ++  Y+    I +AR +FD    +++  WNS+I 
Sbjct  246   SLKIGKTVHAFAMKAGFDSLVNVSTALVDMYSKRGAIETARLVFDSMRLKNVVSWNSMID  305

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y +      A +LFK M+  G +  + T    L AC +  D    R VH  +  +G E 
Sbjct  306   GYGQNGDAEEALRLFKKMMADGIQATDVTIMGALYACGELGDLEEGRHVHELLTRTGFES  365

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             D    + L++ YSK   ++ A  VF+ +    LV WN+MI G+      + AL LF KMQ
Sbjct  366   DVSVLNALITMYSKCKRIDLAEDVFENMPVKSLVSWNAMILGYAQNDRVEDALRLFNKMQ  425

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
                 KPDSFT V +I  L   S+L+  K +H   ++   D N  + + LV +Y++C  + 
Sbjct  426   WENVKPDSFTMVSVIPALADISVLKQAKWIHGFAIRLCTDKNIFIMTALVDLYAKCGSVR  485

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A R+FD++ E  + TW+AMI G    G    A+D F +M     K + + + SVLSA  
Sbjct  486   IARRLFDAMEERHVTTWNAMIDGYGTHGFGKSAIDLFEQMKRSSVKPNDITLLSVLSACG  545

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFLNLGIQVFKAMPSKNIIS-  1269
                +VQ G++    +++  Y  E ++     ++D+  + G L+      + MP +  IS 
Sbjct  546   HSGLVQEGKKYFA-SMKEDYGFEPNMDHYGCMVDLLGRAGRLDEAWDFIQKMPIRPGISV  604

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             Y +M+    +H N     +  + + E E   PDE  +  LL        + +     R M
Sbjct  605   YGAMLGACKIHKNVKLGEEAAQRLFELE---PDEGGYHVLLANIYAAASMWEDVARVRTM  661

Query  1450  NDEFGIQPKTEHY  1488
              ++ G+Q KT  Y
Sbjct  662   MEKKGLQ-KTPGY  673



>ref|XP_008455782.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like 
[Cucumis melo]
 ref|XP_008455783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like 
[Cucumis melo]
 ref|XP_008455784.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like 
[Cucumis melo]
Length=657

 Score =   329 bits (844),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 190/550 (35%), Positives = 295/550 (54%), Gaps = 14/550 (3%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLF-DETPQRSI  354
             Q    ++ ++  K  H++++    S  P   T +I  Y+    +  A  +F D   +R++
Sbjct  73    QSCADHKNLNKGKQFHSLMITYGFSLSPPSITSLINMYSKCGQMGEAILVFYDPCHERNV  132

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             F +N+II  +      S  FQ ++ M   G  PD +TF C++R C +      ++ +HG 
Sbjct  133   FAYNAIISGFVANGLASKGFQFYEKMRLEGVMPDKYTFPCVVRTCCE---VKEVKKIHGC  189

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
              +  GLELD    S LV+ Y K G +E+A KVF  +   D+V WN+MI+G+  +G   +A
Sbjct  190   SLKMGLELDVFVGSALVNTYLKNGSMEDAQKVFGELPMRDVVLWNAMINGYAKIGCLDEA  249

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
             L +F +M   G  P  FT  G++        L  GK VH + +K G+DS   V + L+ M
Sbjct  250   LEVFRRMHVEGIAPGRFTITGILSIFASRGDLDNGKTVHGIVVKMGYDSGVAVSNALIDM  309

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +CK +G A  IF+ + E D+ +W+++I    Q GD    L  F +M   G   D + I
Sbjct  310   YGKCKHIGDALIIFEMINEKDIFSWNSIISVHEQCGDHHGTLRLFDKMLGSGILPDLVTI  369

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHL--------EVSVSSALIDMYSKCGFLNLGI  1230
              +VL A + LA +  GRE HG+ +  G+          ++ VS+A++DMY+KCG +N  +
Sbjct  370   TTVLPACSHLAALMRGREIHGYMIINGFGKDDENGAIDDLHVSNAVMDMYAKCGSMNNAL  429

Query  1231  QVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHT  1410
             ++F +M +K++ S+N MI   G+HG A EA  +F  + E E + PDE T   +L AC H 
Sbjct  430   KIFDSMSNKDVASWNIMIMGYGMHGYALEALDMFSRMCEAE-FKPDEVTLVGVLSACNHA  488

Query  1411  GLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGA  1590
             G V  GR +F  M   FG+ P  EHY  ++ +LG AG LE+AYE+ Q +    +  +W A
Sbjct  489   GFVSQGRLFFAQMESTFGVIPTIEHYTCVIDMLGRAGHLEDAYEVAQKMPIQANPVVWRA  548

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIK  1767
             LL  C +HGN  L  + A+ +   + E     V++SN+Y   GR+E V ++R  M E   
Sbjct  549   LLGACRLHGNAELAEVAARQVLQLEPEHCGSYVLMSNVYGVIGRYEEVLEVRKTMKEQNV  608

Query  1768  GKMPGKSWIS  1797
              K PG SWI 
Sbjct  609   KKTPGCSWIE  618


 Score =   158 bits (400),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 118/399 (30%), Positives = 196/399 (49%), Gaps = 18/399 (5%)
 Frame = +1

Query  454   DNFTFACI--LRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIK  627
             DN T  CI  L++C+D  + +  +  H  ++  G  L     + L++ YSK G + EAI 
Sbjct  63    DNVT-KCIAFLQSCADHKNLNKGKQFHSLMITYGFSLSPPSITSLINMYSKCGQMGEAIL  121

Query  628   VF-DGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCP  801
             VF D   E ++  +N++ISG    G   K    + KM+  G  PD +T+  ++  C +  
Sbjct  122   VFYDPCHERNVFAYNAIISGFVANGLASKGFQFYEKMRLEGVMPDKYTFPCVVRTCCEVK  181

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
              +    K +H   LK G + +  VGS LV+ Y +   M  A ++F  L   D+V W+AMI
Sbjct  182   EV----KKIHGCSLKMGLELDVFVGSALVNTYLKNGSMEDAQKVFGELPMRDVVLWNAMI  237

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G ++ G + +AL+ FR M+++G       I  +LS  A    +  G+  HG  V+ GY 
Sbjct  238   NGYAKIGCLDEALEVFRRMHVEGIAPGRFTITGILSIFASRGDLDNGKTVHGIVVKMGYD  297

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
               V+VS+ALIDMY KC  +   + +F+ +  K+I S+NS+IS     G+ +   ++F+++
Sbjct  298   SGVAVSNALIDMYGKCKHIGDALIIFEMINEKDIFSWNSIISVHEQCGDHHGTLRLFDKM  357

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDGRRY--FRIMN-----DEFGIQPKTEHYVYMV  1500
             L      PD  T + +L AC H   +  GR    + I+N     DE G          ++
Sbjct  358   LGSGIL-PDLVTITTVLPACSHLAALMRGREIHGYMIINGFGKDDENGAIDDLHVSNAVM  416

Query  1501  KLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
              +    G +  A ++  S+    D   W  ++    +HG
Sbjct  417   DMYAKCGSMNNALKIFDSMSNK-DVASWNIMIMGYGMHG  454



>ref|XP_008797358.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Phoenix dactylifera]
Length=589

 Score =   327 bits (838),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 181/541 (33%), Positives = 299/541 (55%), Gaps = 3/541 (1%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFY-ALNEDIVSARRLFDETPQRSIFLWN  366
             S  ++S  + LHA IL   LSHH   AT++I    AL+  I  AR++FD  P R  F+WN
Sbjct  34    SCSSVSALQCLHARILTQGLSHHLALATKLISIASALSPTIDYARKIFDTAPHRDSFMWN  93

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             +++R YA +        L+K M   G  PD+FTF  ++R+C+        + VH   + +
Sbjct  94    TLLRGYADSGPCEEVPVLYKQMHRMGLSPDHFTFPFVVRSCAVISALREGKEVHCNAIKT  153

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G + ++   S LV+ YS+ G + ++  VF  +   ++V W +MI+G+       KA+ +F
Sbjct  154   GFDSNAFLQSALVTMYSQNGEISDSELVFSEMTSRNIVSWTAMIAGYAQNCLLGKAVRVF  213

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
              +M   G +P+  T   ++  L     L  G+++H   +K G DS+  + + L++MY +C
Sbjct  214   QRMLASGTQPNDVTLASVLPALKGLECLHSGESIHGYMIKRGLDSHVSLMNALIAMYGKC  273

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
               +  A  +F+ +    +V+W+ MI    QSGD M+A+  FR M  +    + + + SV+
Sbjct  274   GSIKVARFLFNRMPVRSLVSWNTMIAAYEQSGDGMQAVKLFRGMLTEKATFNSVTLVSVI  333

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             SA + L  ++ G   H  A   G   +V V +AL +MY+KCG ++   ++F+ +P + ++
Sbjct  334   SACSSLGALETGEWVHKLAKSRGLESDVIVGNALSNMYAKCGNVDSAREIFEKLPWRGVV  393

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             S+++MI     HG+A  A ++F + ++ E   P+  TF+++L AC H+GLV +G  +F  
Sbjct  394   SWSAMIGACAAHGHAEMALELFSK-MQAEGVRPNAFTFTSVLAACSHSGLVDEGMEHFES  452

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M  ++ I+P  EH   MV LLG AG L +AYE I+ +    D  +WGALL  C IHGN  
Sbjct  453   MEKDYAIKPTVEHCACMVDLLGRAGRLVDAYEFIKRMPVEPDASVWGALLGACRIHGNLE  512

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWISNI  1803
             L   VA+ LF      +++ V++SNMYA  GRWE   + R  M  ++  K+PG S ++  
Sbjct  513   LAEFVAEDLFRLGSHNATFYVLMSNMYAEAGRWEDAARSRNMMRELELKKIPGCSLVNTD  572

Query  1804  K  1806
             K
Sbjct  573   K  573


 Score =   178 bits (451),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/400 (29%), Positives = 204/400 (51%), Gaps = 13/400 (3%)
 Frame = +1

Query  445   TRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGP-LEEA  621
             T   +  F   L +CS     S L+ +H  ++  GL      +++L+S  S L P ++ A
Sbjct  21    TNCHSLPFNDFLNSCSS---VSALQCLHARILTQGLSHHLALATKLISIASALSPTIDYA  77

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD     D   WN+++ G+   G  ++  +L+ +M RMG  PD FT+  ++      
Sbjct  78    RKIFDTAPHRDSFMWNTLLRGYADSGPCEEVPVLYKQMHRMGLSPDHFTFPFVVRSCAVI  137

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             S LR GK VH   +K GFDSNA + S LV+MYS+   +  +  +F  +   ++V+W+AMI
Sbjct  138   SALREGKEVHCNAIKTGFDSNAFLQSALVTMYSQNGEISDSELVFSEMTSRNIVSWTAMI  197

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G +Q+  + KA+  F+ M   G + + + +ASVL A   L  +  G   HG+ ++ G  
Sbjct  198   AGYAQNCLLGKAVRVFQRMLASGTQPNDVTLASVLPALKGLECLHSGESIHGYMIKRGLD  257

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
               VS+ +ALI MY KCG + +   +F  MP ++++S+N+MI+     G+  +A ++F  +
Sbjct  258   SHVSLMNALIAMYGKCGSIKVARFLFNRMPVRSLVSWNTMIAAYEQSGDGMQAVKLFRGM  317

Query  1342  L-EKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMA  1518
             L EK  +N    T  +++ AC   G +  G    ++     G++        +  +    
Sbjct  318   LTEKATFN--SVTLVSVISACSSLGALETGEWVHKLAKSR-GLESDVIVGNALSNMYAKC  374

Query  1519  GELEEAYELIQSI--QGPVDFGIWGALLSCCDIHGNYRLG  1632
             G ++ A E+ + +  +G V    W A++  C  HG+  + 
Sbjct  375   GNVDSAREIFEKLPWRGVVS---WSAMIGACAAHGHAEMA  411



>ref|XP_009362516.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
 ref|XP_009362518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
 ref|XP_009362544.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
 ref|XP_009362545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
Length=595

 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 182/550 (33%), Positives = 304/550 (55%), Gaps = 7/550 (1%)
 Frame = +1

Query  151   FIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSARRL  327
             +++F   L   S    ++S  K +HA+I +   +     +T+++   + L   +  A++L
Sbjct  30    YLSFNYFLNSCS----SLSNLKCIHALIFQHGSNQSLLLSTKLVTLASSLAPTMDYAQKL  85

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             FD TP+R +FLWN++IR YA       A  L+++M  SG  PDN+TF  ++R+C+ +   
Sbjct  86    FDATPERDVFLWNTLIRGYADQGPCHEAIVLYRNMHRSGLSPDNYTFPFVVRSCAVQLAL  145

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
                + VH  V+  G   D    S LVS Y++ G   ++  +F  +   ++V W +MI+G+
Sbjct  146   REGKEVHCNVIKYGFHSDVFVQSALVSMYAQSGETLDSEILFSEMVVKNIVSWTAMIAGY  205

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                G +K+ L +   M     +P+  T V ++        L +GK +H   +K G D + 
Sbjct  206   VQNGFYKEGLSVLRDMVASDTQPNVVTLVSVLPACASLEFLDLGKLIHGFGIKVGVDKDV  265

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              + + L++ Y +C  + +A  +FD +   ++V+W+AMI    Q+    +A++ FR M  +
Sbjct  266   ALMNALIACYGKCGNLDTARYLFDGMAVRNLVSWNAMIAAYEQNNSGTEAIELFRRMQTE  325

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               + D + + SV+SA   L  +  GR  H      G+    S+++ALIDMY+KCG +NL 
Sbjct  326   NVEYDYITLVSVISACTSLGALNTGRWLHELIQMKGFGSNASITNALIDMYAKCGNINLA  385

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF+ +P K+++S+ S+I     HG+ ++A ++F  +++++   P+  TF+A+L AC H
Sbjct  386   KDVFQGLPHKSVVSWTSIIGACASHGHGDDALRLF-SMMKEQCIKPNSFTFTAVLTACRH  444

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV +GR++F  M  ++ I P  EHY  MV LLG AG L EAY+ I+ +    D G+WG
Sbjct  445   VGLVEEGRKHFESMIKDYSICPGLEHYACMVDLLGRAGCLLEAYKFIERMPVDPDVGVWG  504

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAI  1764
             ALLS C IHGN  L  +V  HL     +  +  V++SN+YA   RWE   +LR  M E  
Sbjct  505   ALLSACRIHGNVELAELVTAHLSHLDTQTVTSYVLMSNIYAEACRWEDEARLRNLMREKE  564

Query  1765  KGKMPGKSWI  1794
               K+PG+S +
Sbjct  565   LMKLPGQSSV  574



>ref|XP_010269696.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Nelumbo nucifera]
Length=823

 Score =   333 bits (855),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/535 (35%), Positives = 309/535 (58%), Gaps = 6/535 (1%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +S  + +H  I K  +    F A  ++  Y+    +  AR++FDE   R +  WN++I A
Sbjct  162   LSDGRKMHCWISKLGIGSDVFVAASLVHMYSRLGFVDDARKMFDEMTVRDMGSWNAMISA  221

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             Y +  + + A ++F++M   G + D  T + IL  C+   D     ++H  V+  GLE D
Sbjct  222   YCQNGKAAEALEVFEEMRLEGMKLDPVTISSILPVCAPLNDLLRGMLIHVYVIKHGLEFD  281

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
                S+ L++ Y+KLG L+ A +VFD +   DLV WNS+I+ +    D  +AL  F++M++
Sbjct  282   VFVSNALINMYAKLGSLDPARRVFDQMPVRDLVSWNSIIAAYEQNNDTTRALGFFVQMKQ  341

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFD-SNAHVGSLLVSMYSRCKCMG  918
              G +PD+ T V L   +      +  + +H+  ++ G+   +  +G+ +V MY++   + 
Sbjct  342   NGFQPDALTLVSLSSMVAQSGDSQNSRPIHAFMMRRGWLLEDIFLGNAVVDMYAKLGSIA  401

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV-DPLLIASVLSAA  1095
             SA + F+++ + D+++W+A+I G +Q+G   +A++ +  M    G V D   + S+L A 
Sbjct  402   SAQKAFEAMPDKDVISWNALITGYAQNGLASEAIEVYHMMEGCSGIVPDQGTLVSILPAL  461

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             + +  +Q G   HG A+R G HL+V V + LIDMYSKCG L+  I +F  +P  + + +N
Sbjct  462   SHIGALQQGMRIHGQAIRMGLHLDVFVGTCLIDMYSKCGRLDDAISLFLQVPRMSSVPWN  521

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMND  1455
             ++IS  G+HG+  +A ++F+E ++ E   PD  TF +LL AC H GLV  G+  F++M +
Sbjct  522   AIISGYGIHGHGEKALKLFQE-MQSEGVKPDHVTFVSLLSACSHAGLVDQGQWCFQLMQE  580

Query  1456  EFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGG  1635
             ++GI+P  +HY  MV LLG AG LE++Y  I+++    D  +WGALL  C IHGN+ LG 
Sbjct  581   DYGIKPNLKHYGCMVDLLGRAGHLEKSYAFIKNMPILPDSSVWGALLGACRIHGNFELGM  640

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
               +  LF+   E   Y V++SN+YA  G+W+ V K+R  +   +G  K PG S I
Sbjct  641   FASNRLFEVDSENVGYYVLLSNIYANVGKWDGVDKVR-SLAKDRGLKKTPGWSSI  694


 Score =   229 bits (584),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 252/474 (53%), Gaps = 11/474 (2%)
 Frame = +1

Query  211   TKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYAR  390
              K LHA +L +  + + F++TR++  YA   D+  +   F++ P++++F WNS+I  Y R
Sbjct  66    AKCLHAHLLVSGNARNIFFSTRLVNLYADLGDVSFSCLAFEQIPKKNVFAWNSMISGYVR  125

Query  391   AHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
                +  A   +  +L  SG RPD FTF  +L+AC   +D S  R +H  +   G+  D  
Sbjct  126   NGCYRQAVDCYSRLLTTSGVRPDFFTFPVVLKAC---WDLSDGRKMHCWISKLGIGSDVF  182

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
              ++ LV  YS+LG +++A K+FD +   D+  WN+MIS +   G   +AL +F +M+  G
Sbjct  183   VAASLVHMYSRLGFVDDARKMFDEMTVRDMGSWNAMISAYCQNGKAAEALEVFEEMRLEG  242

Query  748   EKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSA  924
              K D  T   ++ +C     LLR G  +H   +K G + +  V + L++MY++   +  A
Sbjct  243   MKLDPVTISSILPVCAPLNDLLR-GMLIHVYVIKHGLEFDVFVSNALINMYAKLGSLDPA  301

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQL  1104
              R+FD +   D+V+W+++I    Q+ D  +AL FF +M   G + D L + S+ S  AQ 
Sbjct  302   RRVFDQMPVRDLVSWNSIIAAYEQNNDTTRALGFFVQMKQNGFQPDALTLVSLSSMVAQS  361

Query  1105  AIVQPGRETHGFAVRCGYHLE-VSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
                Q  R  H F +R G+ LE + + +A++DMY+K G +    + F+AMP K++IS+N++
Sbjct  362   GDSQNSRPIHAFMMRRGWLLEDIFLGNAVVDMYAKLGSIASAQKAFEAMPDKDVISWNAL  421

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             I+    +G A+EA +++  +       PD+ T  ++L A  H G +  G R         
Sbjct  422   ITGYAQNGLASEAIEVYHMMEGCSGIVPDQGTLVSILPALSHIGALQQGMR-IHGQAIRM  480

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI-WGALLSCCDIHGN  1620
             G+         ++ +    G L++A  L   +Q P    + W A++S   IHG+
Sbjct  481   GLHLDVFVGTCLIDMYSKCGRLDDAISLF--LQVPRMSSVPWNAIISGYGIHGH  532


 Score =   108 bits (269),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/276 (29%), Positives = 131/276 (47%), Gaps = 5/276 (2%)
 Frame = +1

Query  166  SLLTQLSRSNQTISTTKLLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETP  342
            SL + +++S  +   ++ +HA +++   L    F    ++  YA    I SA++ F+  P
Sbjct  353  SLSSMVAQSGDS-QNSRPIHAFMMRRGWLLEDIFLGNAVVDMYAKLGSIASAQKAFEAMP  411

Query  343  QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLR  519
             + +  WN++I  YA+    S A +++  M   SG  PD  T   IL A S         
Sbjct  412  DKDVISWNALITGYAQNGLASEAIEVYHMMEGCSGIVPDQGTLVSILPALSHIGALQQGM  471

Query  520  VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
             +HG  +  GL LD    + L+  YSK G L++AI +F  +     V WN++ISG+G  G
Sbjct  472  RIHGQAIRMGLHLDVFVGTCLIDMYSKCGRLDDAISLFLQVPRMSSVPWNAIISGYGIHG  531

Query  700  DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLK-FGFDSNAHVG  876
              +KAL LF +MQ  G KPD  T+V L+       L+  G+    L  + +G   N    
Sbjct  532  HGEKALKLFQEMQSEGVKPDHVTFVSLLSACSHAGLVDQGQWCFQLMQEDYGIKPNLKHY  591

Query  877  SLLVSMYSRCKCMGSACRIFDSL-LEPDMVTWSAMI  981
              +V +  R   +  +     ++ + PD   W A++
Sbjct  592  GCMVDLLGRAGHLEKSYAFIKNMPILPDSSVWGALL  627



>emb|CBI15366.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   332 bits (852),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 193/567 (34%), Positives = 314/567 (55%), Gaps = 10/567 (2%)
 Frame = +1

Query  106   SRDIVWRSYQLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAII-LKTHLSHHPFYATRII  282
             S D+V  S Q    M      +L Q     + I   + LH ++   T   +     TRII
Sbjct  94    SDDVVLDSAQRSEAM-----GVLLQACGQRKDIEVGRRLHEMVSASTQFCNDFVLNTRII  148

Query  283   RFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLD-SGTRPDN  459
               Y++      +R +FD+  ++++F WN+I+ AY R   F +A  +F +++  +  +PDN
Sbjct  149   TMYSMCGSPSDSRMVFDKLRRKNLFQWNAIVSAYTRNELFEDAMSIFSELISVTEHKPDN  208

Query  460   FTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIK-VFD  636
             FT  C+++AC+   D    +++HG      L  D    + L++ Y K G +EEA+K VFD
Sbjct  209   FTLPCVIKACAGLLDLGLGQIIHGMATKMDLVSDVFVGNALIAMYGKCGLVEEAVKRVFD  268

Query  637   GIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI  816
              +    +  WN+++ G+    D +KAL L+++M   G  PD FT   L++       L  
Sbjct  269   LMDTKTVSSWNALLCGYAQNSDPRKALDLYLQMTDSGLDPDWFTIGSLLLACSRMKSLHY  328

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             G+ +H   L+ G   +  +G  L+S+Y  C    +A  +FD +    +V+W+ MI G SQ
Sbjct  329   GEEIHGFALRNGLAVDPFIGISLLSLYICCGKPFAAQVLFDGMEHRSLVSWNVMIAGYSQ  388

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
             +G   +A++ FR+M   G +   + I  V  A +QL+ ++ G+E H FA++     ++ V
Sbjct  389   NGLPDEAINLFRQMLSDGIQPYEIAIMCVCGACSQLSALRLGKELHCFALKAHLTEDIFV  448

Query  1177  SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY  1356
             SS++IDMY+K G + L  ++F  +  K++ S+N +I+  G+HG   EA ++FE++L +  
Sbjct  449   SSSIIDMYAKGGCIGLSQRIFDRLREKDVASWNVIIAGYGIHGRGKEALELFEKML-RLG  507

Query  1357  YNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEA  1536
               PD+ TF+ +L AC H GLV DG  YF  M +   I+PK EHY  +V +LG AG +++A
Sbjct  508   LKPDDFTFTGILMACSHAGLVEDGLEYFNQMLNLHNIEPKLEHYTCVVDMLGRAGRIDDA  567

Query  1537  YELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGD  1716
               LI+ + G  D  IW +LLS C IHGN  LG  VA  L + + EK    V++SN++AG 
Sbjct  568   LRLIEEMPGDPDSRIWSSLLSSCRIHGNLGLGEKVANKLLELEPEKPENYVLISNLFAGS  627

Query  1717  GRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             G+W+ V+++R  M+ I   K  G SWI
Sbjct  628   GKWDDVRRVRGRMKDIGLQKDAGCSWI  654



>ref|XP_009353237.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Pyrus x bretschneideri]
Length=711

 Score =   330 bits (846),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 194/539 (36%), Positives = 301/539 (56%), Gaps = 15/539 (3%)
 Frame = +1

Query  142   HQMFIAFRSLLTQLSRSNQTISTTK------LLHAI-ILKTHLSHHPFYATRIIRFYALN  300
             H +   F SL  Q     Q+++ TK       LHA+ +   +L ++ + +T++  FYA  
Sbjct  26    HSLSPPFTSL--QCGTIFQSLTKTKSFPKGQQLHAVSVTAGNLINNTYLSTKLAAFYANC  83

Query  301   EDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACIL  480
               +  A+ +FD    ++ FLWN +IR YA       +  L+++ML  G + DNFT+  +L
Sbjct  84    GKMPQAQLIFDGIVLKNSFLWNFMIRGYACNGCPFKSLVLYREMLSFGQKADNFTYPFVL  143

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
             +AC D       R VHG VVVSGLE D    + L++ YSK G +  A  VFD +   DL 
Sbjct  144   KACGDLLVVEIGRRVHGEVVVSGLESDVYVGNALLAMYSKFGDMRLAGMVFDRMPGRDLT  203

Query  661   QWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSL--LRIGKNVHS  834
              WN+MI+G    GD  + L +F +M + G + D  T +G++    C  L  L+ GK VH+
Sbjct  204   SWNTMIAGCVRNGDPTEGLAVFEEMGKAGLRADGTTLLGILS--GCAELMALKEGKAVHA  261

Query  835   LCLK-FGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIM  1011
               ++  G   N  + + L+ MY +CK    + R+FD +   D V+W++MI G  Q+GD  
Sbjct  262   YVVRNSGEIHNEFLTNSLIEMYCKCKSAAYSRRLFDGVKLKDTVSWNSMISGYEQNGDAF  321

Query  1012  KALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALI  1191
             + L  F +M M+G +VD + + SVL A  Q++ +Q G   H   V+ G+   + V +AL+
Sbjct  322   ETLRLFCQMVMEGAEVDEVTVTSVLGACDQISALQFGMSVHSCIVKKGFGGNIFVGTALV  381

Query  1192  DMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDE  1371
             DMYSKCG L+    VF  MP KN++S+++M+S  G HG   EA   + E++    + PDE
Sbjct  382   DMYSKCGSLSCSRFVFDEMPVKNLVSWSAMVSGYGAHGRGEEAISCYHELVANN-FTPDE  440

Query  1372  ATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQ  1551
                +++L AC H GLV +G+  F  M  E+ ++P   HY  +V LLG AG ++EAYELI+
Sbjct  441   GVLTSVLSACSHAGLVNEGKDIFNRMTVEYNVKPGLAHYSCLVDLLGRAGRVDEAYELIK  500

Query  1552  SIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWE  1728
             ++Q      IW ALLS C +H N  L  I A+++F+   +     + +SN+YA + RW+
Sbjct  501   TMQVEPSSDIWAALLSACRLHKNVMLAEIAAQNVFEMNPKGVGSYICLSNIYASEKRWD  559



>ref|XP_001754449.1| predicted protein [Physcomitrella patens]
 gb|EDQ80899.1| predicted protein [Physcomitrella patens]
Length=723

 Score =   330 bits (847),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 186/551 (34%), Positives = 306/551 (56%), Gaps = 10/551 (2%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             FR LL + +R  +++   + +HA ILK+ +  + +    ++  YA    +  ARR+FD  
Sbjct  50    FRGLLQECARL-RSLEQGREVHAAILKSGIQPNRYLENTLLSMYAKCGSLTDARRVFDSI  108

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               R+I  W ++I A+   ++   AF+ ++ M  +G +PD  TF  +L A ++       +
Sbjct  109   RDRNIVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCKPDKVTFVSLLNAFTNPELLQLGQ  168

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VH  +V +GLEL+    + LV  Y+K G + +A  +FD + E ++V W  +I+G+   G
Sbjct  169   KVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQG  228

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
                 AL L   MQ+    P+  T+  ++     P+ L  GK VH   ++ G+     V +
Sbjct  229   QVDVALELLETMQQAEVAPNKITFASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVN  288

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L++MY +C  +  A ++F  L   D+VTW+AM+ G +Q G   +A++ FR M  +G K 
Sbjct  289   SLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGFHDEAINLFRRMQQQGIKP  348

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D +   SVL++ +  A +Q G+  H   V  GY+L+V + SAL+ MY+KCG ++    VF
Sbjct  349   DKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDASLVF  408

Query  1240  KAMPSKNIISYNSMISNL-GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
               M  +N++++ ++I+     HG   EA + F++ ++K+   PD+ TF+++L AC H GL
Sbjct  409   NQMSERNVVAWTAIITGCCAQHGRCREALEYFDQ-MKKQGIKPDKVTFTSVLSACTHVGL  467

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQS---IQGPVDFGIWG  1587
             V +GR++FR M  ++GI+P  EHY   V LLG AG LEEA  +I S   I GP    +WG
Sbjct  468   VEEGRKHFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLEEAENVILSMPFIPGP---SVWG  524

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             ALLS C +H +   G   A+++     +     V +S++YA  GR+E  +K+R  ME   
Sbjct  525   ALLSACRVHSDVERGERAAENVLKLDPDDDGAYVALSSIYAAAGRYEDAEKVRQVMEKRD  584

Query  1768  -GKMPGKSWIS  1797
               K PG+SWI 
Sbjct  585   VVKEPGQSWIE  595


 Score =   199 bits (506),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 125/438 (29%), Positives = 222/438 (51%), Gaps = 10/438 (2%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F SLL   + + + +   + +H  I++  L   P   T ++  YA   DI  AR +FD
Sbjct  149   VTFVSLLNAFT-NPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFD  207

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
               P++++  W  +I  YA+  +   A +L + M  +   P+  TFA IL+ C+       
Sbjct  208   RLPEKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAPNKITFASILQGCTTPAALEH  267

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + VH  ++ SG   +    + L++ Y K G LEEA K+F  +   D+V W +M++G+  
Sbjct  268   GKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQ  327

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
             LG   +A+ LF +MQ+ G KPD  T+  ++     P+ L+ GK +H   +  G++ + ++
Sbjct  328   LGFHDEAINLFRRMQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYL  387

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICG-LSQSGDIMKALDFFREMNMKG  1050
              S LVSMY++C  M  A  +F+ + E ++V W+A+I G  +Q G   +AL++F +M  +G
Sbjct  388   QSALVSMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHGRCREALEYFDQMKKQG  447

Query  1051  GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFLNL  1224
              K D +   SVLSA   + +V+ GR+ H  ++   Y ++  V   S  +D+  + G L  
Sbjct  448   IKPDKVTFTSVLSACTHVGLVEEGRK-HFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLEE  506

Query  1225  GIQVFKAMPSKNIIS-YNSMISNLGLHGNANEAFQIFEEVLEKEYYNP-DEATFSALLCA  1398
                V  +MP     S + +++S   +H +     +  E VL+    +P D+  + AL   
Sbjct  507   AENVILSMPFIPGPSVWGALLSACRVHSDVERGERAAENVLK---LDPDDDGAYVALSSI  563

Query  1399  CCHTGLVCDGRRYFRIMN  1452
                 G   D  +  ++M 
Sbjct  564   YAAAGRYEDAEKVRQVME  581


 Score =   193 bits (490),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/412 (27%), Positives = 212/412 (51%), Gaps = 6/412 (1%)
 Frame = +1

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
             R   A  +   M+  GTR  +  F  +L+ C+        R VH  ++ SG++ +    +
Sbjct  27    RLKEALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLEN  86

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKP  756
              L+S Y+K G L +A +VFD I + ++V W +MI          +A   +  M+  G KP
Sbjct  87    TLLSMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCKP  146

Query  757   DSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
             D  T+V L+     P LL++G+ VH   ++ G +    VG+ LV MY++C  +  A  IF
Sbjct  147   DKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIF  206

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             D L E ++VTW+ +I G +Q G +  AL+    M       + +  AS+L      A ++
Sbjct  207   DRLPEKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAPNKITFASILQGCTTPAALE  266

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              G++ H + ++ GY  E+ V ++LI MY KCG L    ++F  +P ++++++ +M++   
Sbjct  267   HGKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYA  326

Query  1297  LHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR-YFRIMNDEFGIQP  1473
               G  +EA  +F   ++++   PD+ TF+++L +C     + +G+R + ++++  + +  
Sbjct  327   QLGFHDEAINLFRR-MQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDV  385

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS-CCDIHGNYR  1626
               +    +V +    G +++A  L+ +     +   W A+++ CC  HG  R
Sbjct  386   YLQS--ALVSMYAKCGSMDDA-SLVFNQMSERNVVAWTAIITGCCAQHGRCR  434



>ref|XP_002278128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Vitis vinifera]
Length=597

 Score =   327 bits (837),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 179/527 (34%), Positives = 293/527 (56%), Gaps = 3/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATR-IIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAH  396
             +HA+++      +   +T+ II    L   +  AR++FD+ P+R +FLWN++IR YA A 
Sbjct  48    IHALVVTNGCGQNLLLSTKLIITACCLAPTMDYARKMFDQMPKRDVFLWNTLIRGYADAG  107

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
                 A  L+ +M  +G  PDN+TF  ++R+C+        + VH  +V  G + D    S
Sbjct  108   PCEEALALYSNMHGAGLFPDNYTFPFVVRSCAVLSALREGKEVHCNIVKHGFDSDVFVQS  167

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKP  756
              LV+ YS+ G       VF  +   ++V W ++I+G+     +K+ L +F +M   G +P
Sbjct  168   SLVAMYSQSGETLGMELVFGEMVVRNIVSWTAVIAGYVQNRYFKEGLGVFREMVGSGTQP  227

Query  757   DSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
             ++ T V ++        L +GK +H   +K G D +  + + L+++Y +C  + +A  +F
Sbjct  228   NAVTLVSVLPACAGLEFLNLGKLIHGYGIKLGVDPDVSLTNALIALYGKCGNVETARSLF  287

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             D ++  ++V+W+AMI    Q+     A+  FR M  +    D + + SV+SA A L  + 
Sbjct  288   DGMVVQNLVSWNAMIAAYEQNNAGANAVKLFRRMQAEKVDFDYITMVSVISACASLGALN  347

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              GR  H    R G  + VS+++ALIDMY+KCG ++L  +VF+ +P ++++S+ SMI    
Sbjct  348   TGRWMHELVKRKGLEINVSITNALIDMYAKCGNIDLAREVFERLPCRSVVSWTSMIGACA  407

Query  1297  LHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPK  1476
              HG+  +A ++F   ++ E   P+  TF+A+  AC H+GLV +GR++F  M  ++ I P 
Sbjct  408   SHGHGEDALKLFSR-MKDEGVKPNSFTFAAVFTACRHSGLVEEGRKHFESMMRDYSIMPG  466

Query  1477  TEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLF  1656
              EH   MV LLG AG L EAYE I  +    D  +WGALL  C IH N  L  +VA+ LF
Sbjct  467   VEHCACMVDLLGRAGSLMEAYEFIDKMPVEPDVSVWGALLGSCRIHSNLELAELVAEKLF  526

Query  1657  DNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
                 +  ++ V++SN+YA  GRWE   +LR  ME  +  K+PG S +
Sbjct  527   LLDPQTVTFYVLMSNIYAEAGRWEDAARLRKLMEERELKKIPGHSLV  573


 Score =   149 bits (377),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 107/401 (27%), Positives = 199/401 (50%), Gaps = 17/401 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  I+K       F  + ++  Y+ + + +    +F E   R+I  W ++I  Y + 
Sbjct  148   KEVHCNIVKHGFDSDVFVQSSLVAMYSQSGETLGMELVFGEMVVRNIVSWTAVIAGYVQN  207

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL-RVVHGGVVVSGLELDSIC  570
               F     +F++M+ SGT+P+  T   +L AC+   +F  L +++HG  +  G++ D   
Sbjct  208   RYFKEGLGVFREMVGSGTQPNAVTLVSVLPACAG-LEFLNLGKLIHGYGIKLGVDPDVSL  266

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
             ++ L++ Y K G +E A  +FDG+   +LV WN+MI+ +        A+ LF +MQ   E
Sbjct  267   TNALIALYGKCGNVETARSLFDGMVVQNLVSWNAMIAAYEQNNAGANAVKLFRRMQ--AE  324

Query  751   KPDSFTYVGLIMCLD-CPSL--LRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
             K D F Y+ ++  +  C SL  L  G+ +H L  + G + N  + + L+ MY++C  +  
Sbjct  325   KVD-FDYITMVSVISACASLGALNTGRWMHELVKRKGLEINVSITNALIDMYAKCGNIDL  383

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F+ L    +V+W++MI   +  G    AL  F  M  +G K +    A+V +A   
Sbjct  384   AREVFERLPCRSVVSWTSMIGACASHGHGEDALKLFSRMKDEGVKPNSFTFAAVFTACRH  443

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFLNLGIQVFKAMPSKNIIS-Y  1272
               +V+ GR+ H  ++   Y +   V   + ++D+  + G L    +    MP +  +S +
Sbjct  444   SGLVEEGRK-HFESMMRDYSIMPGVEHCACMVDLLGRAGSLMEAYEFIDKMPVEPDVSVW  502

Query  1273  NSMISNLGLHGNANEAFQIFEEVLEKEY-YNPDEATFSALL  1392
              +++ +  +H N     ++ E V EK +  +P   TF  L+
Sbjct  503   GALLGSCRIHSN----LELAELVAEKLFLLDPQTVTFYVLM  539


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 78/173 (45%), Gaps = 24/173 (14%)
 Frame = +1

Query  199  TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++T + +H ++ +  L  +      +I  YA   +I  AR +F+  P RS+  W S+I 
Sbjct  345  ALNTGRWMHELVKRKGLEINVSITNALIDMYAKCGNIDLAREVFERLPCRSVVSWTSMIG  404

Query  379  AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE-  555
            A A      +A +LF  M D G +P++FTFA +  AC            H G+V  G + 
Sbjct  405  ACASHGHGEDALKLFSRMKDEGVKPNSFTFAAVFTACR-----------HSGLVEEGRKH  453

Query  556  LDSICSSQ-----------LVSAYSKLGPLEEAIKVFDGI-AEPDLVQWNSMI  678
             +S+               +V    + G L EA +  D +  EPD+  W +++
Sbjct  454  FESMMRDYSIMPGVEHCACMVDLLGRAGSLMEAYEFIDKMPVEPDVSVWGALL  506



>ref|XP_010107071.1| hypothetical protein L484_001394 [Morus notabilis]
 gb|EXC54206.1| hypothetical protein L484_001394 [Morus notabilis]
Length=719

 Score =   330 bits (846),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 295/529 (56%), Gaps = 9/529 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             HA+ +KT      F  + ++  Y     +  AR LFDE P+R+   W ++I  Y +A   
Sbjct  132   HALAIKTDCFKDVFVGSSLVSLYCKLSLLSDARTLFDEMPERNSVSWATMISGYGKARME  191

Query  403   SNAFQLFKDMLDSGTRPDN-FTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
               A  +F+ M       DN F F  +L A          + +H   V  GL       + 
Sbjct  192   REALGVFRAMRREEKGCDNEFCFTGVLSALRVPEVLDCGKQIHCLAVKKGLLCFVAVGNA  251

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             LV+ Y K G L++A+K+F  + + + + W++M++G    GD +KAL LF  M   G  P 
Sbjct  252   LVTMYGKCGSLDDALKMFLILDDKNSITWSAMVNGFAQSGDCEKALRLFCTMHVCGVTPS  311

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              FT+VG+I        + +G+ +H    K GF+S  +V + LV MY++C  +G A + FD
Sbjct  312   EFTFVGVINSCGNIGAIEVGRQLHGYSYKLGFESQMYVMTALVDMYAKCGGIGDARKGFD  371

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L  PD+V+W+++I G   +G+  +AL  +  M MKG   + L +ASVL A A LA ++ 
Sbjct  372   YLKHPDLVSWTSIIGGYVMNGENEEALSLYCRMQMKGIVPNELTMASVLKACANLAALEQ  431

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G++ H  A++ G+ LE+ + SAL  MY+KCG L  G  VF+ MP++++IS+N+MIS L  
Sbjct  432   GKQIHARAIKYGFSLEIPIGSALSTMYAKCGSLEDGDLVFRRMPTRDVISWNAMISGLSH  491

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             +G  NEAFQ+FEE+L  E   PD  TF  +L AC H GLV  GR YF +M  +FGI  K 
Sbjct  492   NGLGNEAFQLFEEML-LEGTKPDAITFLNVLSACSHFGLVDRGRSYFDMMIHDFGIALKV  550

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHL  1653
             EHY  MV +L  AG+L EA E I+S    +D G  +W  LLS C  H  Y+LG    + L
Sbjct  551   EHYACMVDVLSRAGKLREAKEFIES--ATIDHGMCLWRILLSACRNHREYKLGAYAGEKL  608

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              +    +SS  V++S++Y   GR + V+++R  M  ++G  K PG SWI
Sbjct  609   MELGSRESSAYVLLSSIYTALGRKKDVERVR-RMMKLRGVSKEPGCSWI  656


 Score =   206 bits (523),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 128/429 (30%), Positives = 221/429 (52%), Gaps = 8/429 (2%)
 Frame = +1

Query  163   RSLLTQL--SRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
             R   TQL  S   + +   + +HA I+++  S   + A  ++  YA   D+  A   FD 
Sbjct  9     RRFFTQLLESTKQKNLRKGQAVHAQIVQSSRSPCVYLANSLVNLYANCGDLTKAELAFDS  68

Query  337   TPQRSIFLWNSIIRAYARAHRF--SNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFS  510
             + ++ +  WN +I A+++      S   +L K M +  T PD +TFA +  A  D   F 
Sbjct  69    SERKDVVSWNCLINAFSQNAPSCSSPVRKLLKRMREENTMPDAYTFAAVFAAVDDDVVFC  128

Query  511   GLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHG  690
               R  H   + +    D    S LVS Y KL  L +A  +FD + E + V W +MISG+G
Sbjct  129   --RQAHALAIKTDCFKDVFVGSSLVSLYCKLSLLSDARTLFDEMPERNSVSWATMISGYG  186

Query  691   CLGDWKKALLLFIKMQRMGEKPDS-FTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                  ++AL +F  M+R  +  D+ F + G++  L  P +L  GK +H L +K G     
Sbjct  187   KARMEREALGVFRAMRREEKGCDNEFCFTGVLSALRVPEVLDCGKQIHCLAVKKGLLCFV  246

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              VG+ LV+MY +C  +  A ++F  L + + +TWSAM+ G +QSGD  KAL  F  M++ 
Sbjct  247   AVGNALVTMYGKCGSLDDALKMFLILDDKNSITWSAMVNGFAQSGDCEKALRLFCTMHVC  306

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G          V+++   +  ++ GR+ HG++ + G+  ++ V +AL+DMY+KCG +   
Sbjct  307   GVTPSEFTFVGVINSCGNIGAIEVGRQLHGYSYKLGFESQMYVMTALVDMYAKCGGIGDA  366

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              + F  +   +++S+ S+I    ++G   EA  ++  +  K    P+E T +++L AC +
Sbjct  367   RKGFDYLKHPDLVSWTSIIGGYVMNGENEEALSLYCRMQMKGIV-PNELTMASVLKACAN  425

Query  1408  TGLVCDGRR  1434
                +  G++
Sbjct  426   LAALEQGKQ  434


 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 172/358 (48%), Gaps = 10/358 (3%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F  +L+ L R  + +   K +H + +K  L         ++  Y     +  A ++F   
Sbjct  214   FTGVLSAL-RVPEVLDCGKQIHCLAVKKGLLCFVAVGNALVTMYGKCGSLDDALKMFLIL  272

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               ++   W++++  +A++     A +LF  M   G  P  FTF  ++ +C +       R
Sbjct  273   DDKNSITWSAMVNGFAQSGDCEKALRLFCTMHVCGVTPSEFTFVGVINSCGNIGAIEVGR  332

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG     G E      + LV  Y+K G + +A K FD +  PDLV W S+I G+   G
Sbjct  333   QLHGYSYKLGFESQMYVMTALVDMYAKCGGIGDARKGFDYLKHPDLVSWTSIIGGYVMNG  392

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             + ++AL L+ +MQ  G  P+  T   ++      + L  GK +H+  +K+GF     +GS
Sbjct  393   ENEEALSLYCRMQMKGIVPNELTMASVLKACANLAALEQGKQIHARAIKYGFSLEIPIGS  452

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L +MY++C  +     +F  +   D+++W+AMI GLS +G   +A   F EM ++G K 
Sbjct  453   ALSTMYAKCGSLEDGDLVFRRMPTRDVISWNAMISGLSHNGLGNEAFQLFEEMLLEGTKP  512

Query  1060  DPLLIASVLSAAAQLAIVQPGRE-----THGFAVRCGYHLEVSVSSALIDMYSKCGFL  1218
             D +   +VLSA +   +V  GR       H F    G  L+V   + ++D+ S+ G L
Sbjct  513   DAITFLNVLSACSHFGLVDRGRSYFDMMIHDF----GIALKVEHYACMVDVLSRAGKL  566


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/329 (25%), Positives = 135/329 (41%), Gaps = 64/329 (19%)
 Frame = +1

Query  808   LRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICG  987
             LR G+ VH+  ++       ++ + LV++Y+ C  +  A   FDS    D+V+W+ +I  
Sbjct  24    LRKGQAVHAQIVQSSRSPCVYLANSLVNLYANCGDLTKAELAFDSSERKDVVSWNCLINA  83

Query  988   LSQ-----SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRC  1152
              SQ     S  + K L   RE N      D    A+V +A     +    R+ H  A++ 
Sbjct  84    FSQNAPSCSSPVRKLLKRMREENTMP---DAYTFAAVFAAVDDDVVF--CRQAHALAIKT  138

Query  1153  GYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIF  1332
                 +V V S+L+ +Y K   L+    +F  MP +N +S+ +MIS  G      EA  +F
Sbjct  139   DCFKDVFVGSSLVSLYCKLSLLSDARTLFDEMPERNSVSWATMISGYGKARMEREALGVF  198

Query  1333  EEVLEKEYYNPDEATFSALL----------------CACCHTGLVC--------------  1422
               +  +E    +E  F+ +L                C     GL+C              
Sbjct  199   RAMRREEKGCDNEFCFTGVLSALRVPEVLDCGKQIHCLAVKKGLLCFVAVGNALVTMYGK  258

Query  1423  -----DGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQ----GPVDF  1575
                  D  + F I++D+  I      +  MV     +G+ E+A  L  ++      P +F
Sbjct  259   CGSLDDALKMFLILDDKNSIT-----WSAMVNGFAQSGDCEKALRLFCTMHVCGVTPSEF  313

Query  1576  GIWGALLSCCDI---------HG-NYRLG  1632
                G + SC +I         HG +Y+LG
Sbjct  314   TFVGVINSCGNIGAIEVGRQLHGYSYKLG  342



>ref|XP_008371575.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730 
[Malus domestica]
Length=627

 Score =   327 bits (839),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 191/574 (33%), Positives = 302/574 (53%), Gaps = 15/574 (3%)
 Frame = +1

Query  100   AFSRDIVWRSYQLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRI  279
             +FS        Q  H +     SL  Q     Q +   K +H+ +L       P   T +
Sbjct  20    SFSHSAARSPAQSPHDLAACIASL--QACARRQNLRKGKQVHSFMLANGFLRSPLSTTSL  77

Query  280   IRFYALNEDIVSARRLFD-ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPD  456
             I  Y+    +  A   F+ ++   ++F +N++I  +       + F+ ++ M  +G  PD
Sbjct  78    INMYSKCNQMDDAVSTFNYQSFDHNVFAYNAVIAGFIANGLGRDGFEFYRRMRFAGVXPD  137

Query  457   NFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFD  636
              FTF C++R CS   +   LR +HG VV  GLELD    S LV+ Y KLG +EEA +VFD
Sbjct  138   KFTFPCVIRGCSGVLE---LRKIHGLVVKFGLELDVYVGSALVNTYLKLGLMEEAQEVFD  194

Query  637   GIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI  816
              +   D+V WN+M++G   +G  ++AL +F  M   G  P  FT  G++           
Sbjct  195   ELPVRDVVLWNAMVNGFAQIGLLEEALAVFSMMGEEGVVPSRFTVTGVLSIFAVMGGFDN  254

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             G+ VH    K G+DS   V + L+ MY +CKC+G A +IF+ ++E D+ +W+++I     
Sbjct  255   GRAVHGFATKMGYDSGVEVLNALIDMYGKCKCVGDALKIFEMMVEKDIYSWNSIIAVHEH  314

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
              GD    L  F  M   G   D + I +VL   A+LA +  GRE HG+ ++ G   +V+V
Sbjct  315   CGDHDGTLRLFDRMLRGGVLPDLVTITTVLPVCARLAALMHGREIHGYMIKNGLEKDVNV  374

Query  1177  -----SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                  ++A++DMY+KCG +     VF  M +K++ S+N MI   G HG  ++A  +F ++
Sbjct  375   DDVQITNAVMDMYAKCGSMRNAYMVFNKMRNKDVASWNIMIMGYGXHGYGSKALDMFSDM  434

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAG  1521
               K     DE TF  +L AC HTGLV +GR + R M  ++G+ P  EHY  +V +LG AG
Sbjct  435   C-KVQMKLDEVTFVGVLSACSHTGLVREGREFLRQMKSKYGVVPTIEHYTCVVDMLGRAG  493

Query  1522  ELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSN  1701
              LEEAY+L+  +    +  +W ALL+ C +HGN  +  +    + +         V++SN
Sbjct  494   HLEEAYQLVLEMPIETNPVLWRALLAACRLHGNQDIAEVAVHKVIELDPGHCGNYVLMSN  553

Query  1702  MYAGDGRWECVKKLRVDM--EAIKGKMPGKSWIS  1797
             +Y  +G+++ V ++R  M  + +K K+PG SWI 
Sbjct  554   LYVANGQYDEVTEVRHSMSQQNVK-KIPGCSWIE  586



>ref|XP_006338058.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Solanum tuberosum]
Length=608

 Score =   327 bits (837),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 186/553 (34%), Positives = 305/553 (55%), Gaps = 13/553 (2%)
 Frame = +1

Query  145   QMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSAR  321
             Q F+ F  LL+    S  ++   K LH ++L T    +    T+I+     L+  +  AR
Sbjct  31    QPFLHFSYLLS----SCHSLPALKQLHTLVLTTGYHKNLLICTKIVSLGCFLSPTMDYAR  86

Query  322   RLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKF  501
             +LFD+ PQR +F WN++IR Y+       +  L+K+M   G  PDN+TF  +LR+CS   
Sbjct  87    KLFDQMPQRDVFAWNTLIRGYSNLGPCQESIFLYKEMHLQGILPDNYTFPFVLRSCSVLS  146

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
                  R +H  ++  G E D    S L++ Y++ G   ++  VFD +   ++V W +MI+
Sbjct  147   ALREGREIHCNIIKHGFESDVFVQSSLITLYAQSGETLDSELVFDQMRVRNIVSWTAMIA  206

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMC---LDCPSLLRIGKNVHSLCLKFG  852
             G+   G  +K L +F+KM   G  P++ T V ++     LDC   L +G  +H   +K G
Sbjct  207   GYVQNGIPEKGLGVFLKMVDSGTLPNAITLVSVLPACARLDC---LDLGMLIHGYSIKLG  263

Query  853   FDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFR  1032
              +++  + + LV+ Y +C  +  A  +FD + E  +V+W+A+I    Q+      +  F 
Sbjct  264   VETDVSLVNALVAFYGKCGLVDVAWSLFDQMKEHSVVSWNAIIAAYEQNDVGSSPIKLFH  323

Query  1033  EMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCG  1212
              M  +G + D + + +V+SA A+L  +  G+  H      G    V +++ALIDMY+KCG
Sbjct  324   RMLGQGVEFDYITVVTVISACARLGALGTGKWIHELVKSKGLECNVPITNALIDMYAKCG  383

Query  1213  FLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
              +     VF  +PS++++S++S+I     HG+  EA ++F   +++E   P+  TF+A+L
Sbjct  384   SIESARDVFDRLPSRSVVSWSSIIGACASHGHGREALELFSR-MKEEGVPPNSFTFTAVL  442

Query  1393  CACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVD  1572
              AC H+GLV +GRR+F  M  E+ I P  E    MV LLG +G+L EAYE I+++    D
Sbjct  443   TACRHSGLVEEGRRHFESMRMEYSIVPGVEQCACMVDLLGRSGQLLEAYEFIENMPIEPD  502

Query  1573  FGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVD  1752
               +WGALL  C IHGN  +   VA  LFD   +   + +++ N+YA  GRW+ V +L+  
Sbjct  503   ADVWGALLGACRIHGNLEMAEYVADRLFDFNPQAVPFYILMKNIYAEAGRWDDVARLKFL  562

Query  1753  MEAIK-GKMPGKS  1788
             +E ++  K+PGKS
Sbjct  563   LEELEVEKIPGKS  575



>ref|XP_008364184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like 
[Malus domestica]
Length=627

 Score =   327 bits (838),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/574 (33%), Positives = 302/574 (53%), Gaps = 15/574 (3%)
 Frame = +1

Query  100   AFSRDIVWRSYQLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRI  279
             +FS        Q  H +     SL  Q     Q +   K +H+ +L       P   T +
Sbjct  20    SFSHSAARSPAQSPHDLAACIASL--QACARRQNLRKGKQVHSFMLANGFLRSPLSTTSL  77

Query  280   IRFYALNEDIVSARRLFD-ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPD  456
             I  Y+    +  A   F+ ++   ++F +N++I  +       + F+ ++ M  +G  PD
Sbjct  78    INMYSKCNQMDDAVSTFNYQSFDHNVFAYNAVIAGFIANGLGRDGFEFYRRMRFAGVVPD  137

Query  457   NFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFD  636
              FTF C++R CS   +   LR +HG VV  GLELD    S LV+ Y KLG +EEA +VFD
Sbjct  138   KFTFPCVIRGCSGVLE---LRKIHGLVVKFGLELDVYVGSALVNTYLKLGLMEEAQEVFD  194

Query  637   GIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI  816
              +   D+V WN+M++G   +G  ++AL +F  M   G  P  FT  G++           
Sbjct  195   ELPVRDVVLWNAMVNGFAQIGLLEEALAVFSMMGEEGVVPSRFTVTGVLSIFAVMGGFDN  254

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             G+ VH    K G+DS   V + L+ MY +CKC+G A +IF+ ++E D+ +W+++I     
Sbjct  255   GRAVHGFATKMGYDSGVEVLNALIDMYGKCKCVGDALKIFEMMVEKDIYSWNSIIAVHEH  314

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
              GD    L  F  M   G   D + I +VL   A+LA +  GRE HG+ ++ G   +V+V
Sbjct  315   CGDHDGTLRLFDRMLRGGVLPDLVTITTVLPVCARLAALMHGREIHGYMIKNGLEKDVNV  374

Query  1177  -----SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                  ++A++DMY+KCG +     VF  M +K++ S+N MI   G HG  ++A  +F ++
Sbjct  375   DDVQITNAVMDMYAKCGSMRNAYMVFNKMRNKDVASWNIMIMGYGXHGYGSKALDMFSDM  434

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAG  1521
               K     DE TF  +L AC HTGLV +GR + R M  ++G+ P  EHY  +V +LG AG
Sbjct  435   C-KVQMKLDEVTFVGVLSACSHTGLVREGREFLRQMKSKYGVVPTIEHYTCVVDMLGRAG  493

Query  1522  ELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSN  1701
              LEEAY+L+  +    +  +W ALL+ C +HGN  +  +    + +         V++SN
Sbjct  494   HLEEAYQLVLEMPIETNPVLWRALLAACRLHGNQDIAEVAVHKVIELDPGHCGNYVLMSN  553

Query  1702  MYAGDGRWECVKKLRVDM--EAIKGKMPGKSWIS  1797
             +Y  +G+++ V ++R  M  + +K K+PG SWI 
Sbjct  554   LYVANGQYDEVTEVRHSMSQQNVK-KIPGCSWIE  586



>ref|XP_009388863.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g06140, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   328 bits (840),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 193/548 (35%), Positives = 307/548 (56%), Gaps = 8/548 (1%)
 Frame = +1

Query  169   LLTQLSRSNQTISTTKLLHA-IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             LL  L+ S +++   + LHA ++    L  + + +T++   Y+    +  AR +FD    
Sbjct  52    LLQSLTNS-RSLGQGRRLHAHMVASGVLLDNTYLSTKLCAMYSACGCVREARVIFDGIVL  110

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             +S FLWN +IR  A       +  L+++ML  G R DNFT+  +L AC D       R V
Sbjct  111   KSSFLWNVMIRGCACGGSPLESLLLYREMLKFGRRSDNFTYPFVLMACGDLCLVEVGRRV  170

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             H  ++V G E D   ++ L+S YSK G +E A K+FD +   DL  WN+MISG+    D 
Sbjct  171   HSEIIVCGYESDVFVANSLLSMYSKFGQMEIAQKLFDRMPVKDLTSWNTMISGYARNNDP  230

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSL  882
               +L LF      G + D  + +G++  C D  +L + G  +H+  L+ G + N  + + 
Sbjct  231   ATSLSLFADRPLTGSRLDEASLLGVLPACADLMAL-KQGMEIHACILRSGMEINGFLVNA  289

Query  883   LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVD  1062
             L+ +Y+  K +  A R+F ++   D V+W++MI G ++ GD  ++L  FR MN++G   D
Sbjct  290   LIDVYANSKFIVGAWRLFKNMCRKDTVSWNSMISGYARHGDAAESLSLFRRMNLEGVVPD  349

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
              + I +VL A  ++  ++ G   H + +  G+   V+V +AL+DMY+KCG L    QVF 
Sbjct  350   AVTIIAVLGACDRVGAMRFGTSLHAYLIGKGFENRVTVGTALVDMYAKCGSLECSRQVFD  409

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              MP KN +S+++MIS  GLHG   EA   F+E ++ +   PDE TF++ L AC HTGLV 
Sbjct  410   EMPVKNFVSWSAMISGYGLHGRGREALACFDE-MKAKGIRPDEITFASALSACGHTGLVR  468

Query  1423  DGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSC  1602
             +GR  F  M+  + ++PK +HY  +V +LG AG+LE AY+ I ++   +   +W ALLS 
Sbjct  469   EGREIFYQMSKAYCLKPKVDHYSCVVDILGRAGDLEGAYKFIMNMDAKLIADVWEALLSA  528

Query  1603  CDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR--VDMEAIKGKM  1776
             C IH N  L  I A+++   K E     V +S++YA D RW  V+++R    +  +K K 
Sbjct  529   CRIHHNVELAEIAARNIISLKPEHIGPYVTLSSLYAADKRWSDVERIRGLARLNGLK-KP  587

Query  1777  PGKSWISN  1800
             PG S++ +
Sbjct  588   PGCSFVES  595



>ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Cicer arietinum]
Length=875

 Score =   333 bits (853),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/530 (37%), Positives = 284/530 (54%), Gaps = 4/530 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +++++     P  A  +I  Y+   ++  AR+LFD   Q     WN +I  Y +   
Sbjct  297   LHGLVIRSGFESDPQLANTLITMYSKCGNLFYARKLFDTMLQTDTVTWNGLIAGYVQNGF  356

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A  LFK M+ SG +PD+ TFA  L +  +    +  + VH  +V  G+  D    S 
Sbjct  357   TDEAVTLFKAMIASGVKPDSITFASFLPSILESGSLNNCKEVHSYIVRHGVPFDVYLKSA  416

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             LV  Y K G +E A K F      D+    +MISG+   G   +A+ +F  + + G  P+
Sbjct  417   LVDIYFKGGDVEMARKTFQQNTLVDIAVCTAMISGYVLNGMNIEAINIFRWLVQEGIMPN  476

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
               T   ++      + L+ GK +H   LK G ++   VGS +  MY++C  +  A + F 
Sbjct  477   CLTMASVLPACAALASLKSGKELHCDILKKGLENVCQVGSSITYMYAKCGRLDLAYQFFR  536

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L E D V W+ MI   SQ+G    A++ FR+M M G K D + +++ LSA A L+ +  
Sbjct  537   RLPEKDSVCWNLMIVSFSQNGKPEMAINLFRQMGMSGTKFDSVSLSATLSACANLSALYH  596

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             GRE H F VR  +  +  V+S LIDMYSKCG L L   VF  M  KN +S+NS+I+  G 
Sbjct  597   GRELHCFVVRNSFISDTFVASVLIDMYSKCGKLALARCVFDMMGLKNEVSWNSIIAAYGN  656

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   E   +F ++LE   + PD  TF  ++ AC H GLV +G  Y R M +E+GI  + 
Sbjct  657   HGRPRECLDLFHKMLESGIH-PDHVTFLVIMSACGHAGLVDEGISYLRCMTEEYGISARM  715

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EH+  MV L G AG L EA++ I+S+    D G WG+LL  C +HGN  L  + + HL +
Sbjct  716   EHFACMVDLYGRAGRLHEAFDTIKSMPFTPDAGTWGSLLGACRLHGNVELAKLASTHLLE  775

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWISNI  1803
                E S Y V++SN++AG G WE V K+R  M+  KG  K+PG SWI  I
Sbjct  776   LDPENSGYYVLLSNVHAGAGEWESVVKVRSLMKE-KGVQKIPGYSWIDVI  824


 Score =   204 bits (519),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 210/418 (50%), Gaps = 11/418 (3%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
               +   K++H +          F  + +I+ Y  N  I  AR LFDE P R   LWN ++
Sbjct  188   NNVPLCKMVHDLARSMGFHMDLFIGSSLIKLYTDNGYIHDARYLFDELPLRDCILWNVML  247

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +   F  A + F+DM +S ++P++ TF C+L  C+ +    G   +HG V+ SG E
Sbjct  248   NGYVKNGDFGTAIRTFQDMRNSNSKPNSVTFICLLSICATRGLLGGGIQLHGLVIRSGFE  307

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              D   ++ L++ YSK G L  A K+FD + + D V WN +I+G+   G   +A+ LF  M
Sbjct  308   SDPQLANTLITMYSKCGNLFYARKLFDTMLQTDTVTWNGLIAGYVQNGFTDEAVTLFKAM  367

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIG-----KNVHSLCLKFGFDSNAHVGSLLVSMYS  900
                G KPDS T+   +     PS+L  G     K VHS  ++ G   + ++ S LV +Y 
Sbjct  368   IASGVKPDSITFASFL-----PSILESGSLNNCKEVHSYIVRHGVPFDVYLKSALVDIYF  422

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             +   +  A + F      D+   +AMI G   +G  ++A++ FR +  +G   + L +AS
Sbjct  423   KGGDVEMARKTFQQNTLVDIAVCTAMISGYVLNGMNIEAINIFRWLVQEGIMPNCLTMAS  482

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             VL A A LA ++ G+E H   ++ G      V S++  MY+KCG L+L  Q F+ +P K+
Sbjct  483   VLPACAALASLKSGKELHCDILKKGLENVCQVGSSITYMYAKCGRLDLAYQFFRRLPEKD  542

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
              + +N MI +   +G    A  +F + +       D  + SA L AC +   +  GR 
Sbjct  543   SVCWNLMIVSFSQNGKPEMAINLFRQ-MGMSGTKFDSVSLSATLSACANLSALYHGRE  599


 Score =   182 bits (461),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 115/400 (29%), Positives = 198/400 (50%), Gaps = 1/400 (0%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   + +HA ++ + +S      +RI+  Y L      A  LF          WN +IR 
Sbjct  89    VQRVRQIHAHVVVSGMSDSLTLGSRILGMYILCGRFNDAGNLFFRLQLCYSLPWNWLIRG  148

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             ++    F  A   F  ML     PD +TF  +++AC    +    ++VH      G  +D
Sbjct  149   FSMLGWFDFALMFFFRMLGCNVAPDKYTFPYVIKACGGLNNVPLCKMVHDLARSMGFHMD  208

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
                 S L+  Y+  G + +A  +FD +   D + WN M++G+   GD+  A+  F  M+ 
Sbjct  209   LFIGSSLIKLYTDNGYIHDARYLFDELPLRDCILWNVMLNGYVKNGDFGTAIRTFQDMRN  268

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
                KP+S T++ L+       LL  G  +H L ++ GF+S+  + + L++MYS+C  +  
Sbjct  269   SNSKPNSVTFICLLSICATRGLLGGGIQLHGLVIRSGFESDPQLANTLITMYSKCGNLFY  328

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A ++FD++L+ D VTW+ +I G  Q+G   +A+  F+ M   G K D +  AS L +  +
Sbjct  329   ARKLFDTMLQTDTVTWNGLIAGYVQNGFTDEAVTLFKAMIASGVKPDSITFASFLPSILE  388

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
                +   +E H + VR G   +V + SAL+D+Y K G + +  + F+     +I    +M
Sbjct  389   SGSLNNCKEVHSYIVRHGVPFDVYLKSALVDIYFKGGDVEMARKTFQQNTLVDIAVCTAM  448

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             IS   L+G   EA  IF  +++ E   P+  T +++L AC
Sbjct  449   ISGYVLNGMNIEAINIFRWLVQ-EGIMPNCLTMASVLPAC  487


 Score =   129 bits (325),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 103/421 (24%), Positives = 186/421 (44%), Gaps = 18/421 (4%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  +  S  +++  K +H+ I++  +    +  + ++  Y    D+  AR+ F 
Sbjct  377   ITFASFLPSILESG-SLNNCKEVHSYIVRHGVPFDVYLKSALVDIYFKGGDVEMARKTFQ  435

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             +     I +  ++I  Y        A  +F+ ++  G  P+  T A +L AC+       
Sbjct  436   QNTLVDIAVCTAMISGYVLNGMNIEAINIFRWLVQEGIMPNCLTMASVLPACAALASLKS  495

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +H  ++  GLE      S +   Y+K G L+ A + F  + E D V WN MI     
Sbjct  496   GKELHCDILKKGLENVCQVGSSITYMYAKCGRLDLAYQFFRRLPEKDSVCWNLMIVSFSQ  555

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
              G  + A+ LF +M   G K DS +    +      S L  G+ +H   ++  F S+  V
Sbjct  556   NGKPEMAINLFRQMGMSGTKFDSVSLSATLSACANLSALYHGRELHCFVVRNSFISDTFV  615

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
              S+L+ MYS+C  +  A  +FD +   + V+W+++I      G   + LD F +M   G 
Sbjct  616   ASVLIDMYSKCGKLALARCVFDMMGLKNEVSWNSIIAAYGNHGRPRECLDLFHKMLESGI  675

Query  1054  KVDPLLIASVLSAAAQLAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCG  1212
               D +    ++SA     +V  G        E +G + R  +       + ++D+Y + G
Sbjct  676   HPDHVTFLVIMSACGHAGLVDEGISYLRCMTEEYGISARMEHF------ACMVDLYGRAG  729

Query  1213  FLNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
              L+      K+MP + +  ++ S++    LHGN   A      +LE    +P+ + +  L
Sbjct  730   RLHEAFDTIKSMPFTPDAGTWGSLLGACRLHGNVELAKLASTHLLE---LDPENSGYYVL  786

Query  1390  L  1392
             L
Sbjct  787   L  787


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/267 (23%), Positives = 118/267 (44%), Gaps = 5/267 (2%)
 Frame = +1

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
             S+++  + +H+  +  G   +  +GS ++ MY  C     A  +F  L     + W+ +I
Sbjct  87    SMVQRVRQIHAHVVVSGMSDSLTLGSRILGMYILCGRFNDAGNLFFRLQLCYSLPWNWLI  146

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G S  G    AL FF  M       D      V+ A   L  V   +  H  A   G+H
Sbjct  147   RGFSMLGWFDFALMFFFRMLGCNVAPDKYTFPYVIKACGGLNNVPLCKMVHDLARSMGFH  206

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
             +++ + S+LI +Y+  G+++    +F  +P ++ I +N M++    +G+   A + F++ 
Sbjct  207   MDLFIGSSLIKLYTDNGYIHDARYLFDELPLRDCILWNVMLNGYVKNGDFGTAIRTFQD-  265

Query  1342  LEKEYYNPDEATFSALLCACCHTGLVCDG-RRYFRIMNDEFGIQPKTEHYVYMVKLLGMA  1518
             +      P+  TF  LL  C   GL+  G + +  ++   F   P+  +   ++ +    
Sbjct  266   MRNSNSKPNSVTFICLLSICATRGLLGGGIQLHGLVIRSGFESDPQLAN--TLITMYSKC  323

Query  1519  GELEEAYELIQSIQGPVDFGIWGALLS  1599
             G L  A +L  ++    D   W  L++
Sbjct  324   GNLFYARKLFDTML-QTDTVTWNGLIA  349



>ref|XP_006857329.1| hypothetical protein AMTR_s00067p00084250 [Amborella trichopoda]
 gb|ERN18796.1| hypothetical protein AMTR_s00067p00084250 [Amborella trichopoda]
Length=630

 Score =   326 bits (836),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 182/526 (35%), Positives = 294/526 (56%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  ++K+   H     + ++  Y  +E+ + A ++F+E P+R +  WN+++  Y +  +
Sbjct  57    IHGFLIKSGFEHDIVVMSSLMGVYCKSENFIDACQVFNEMPERDVASWNTMLSCYYQDGQ  116

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A + F+ M  +G +P++ TF     AC+        +  H  ++ S + LD    S 
Sbjct  117   CEKALEFFEKMRSAGVKPNSVTFTIAFSACARLLALDRGKDFHESIMNSEIYLDVFLGSA  176

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             +V  Y+K G L  + KVF+ +   ++V +NS+ISG    GD    + LFI+M+  G KP+
Sbjct  177   IVDMYAKCGCLGMSRKVFEAMPTKNVVSFNSIISGCAMNGDTDSCMELFIRMEMEGLKPN  236

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T  GL+      S L++GK +H   +K G D++  +G  L+ +Y +C  +  A  +F 
Sbjct  237   STTLTGLLAACTRTSFLQLGKFIHGYVIKNGIDNDVFIGCALIDLYFKCGNIKHAELLFL  296

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + + ++V W+ M+ G    G   +AL+ F  M     + D +  +SVLSA +Q+A  Q 
Sbjct  297   KMPKNNVVVWNVMVSGYVTRGHYNEALEIFEGMRKSNIQADAVTFSSVLSACSQIASHQK  356

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E H + +      ++ V  ALIDMY+KCG +     VF+ +P ++++S+ +MI   G 
Sbjct  357   GKEIHHYIIEKELESDLMVGGALIDMYAKCGLVEEAHHVFERLPDRDVVSWTAMIEAYGS  416

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             +G AN+A ++FE  + +    PD  TF ++L AC H GLV +G  YF+ M  E+GI P  
Sbjct  417   NGLANDALKLFER-MSQSNVKPDNVTFLSVLSACSHGGLVHEGCGYFKRMEMEYGISPSL  475

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  M+ LLG AG+L EAYE+ +SI    D G+ GA+LS C+IHGN  LG  +   L +
Sbjct  476   EHYSCMIDLLGRAGKLHEAYEIFKSIPMKTDVGLLGAMLSACNIHGNLELGTEIGDLLLE  535

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                + +S  +++SNMYA  GRWE + KLR +M E    K PG SWI
Sbjct  536   KDPDDASIYIILSNMYAKAGRWEEMGKLRREMRERGVKKNPGCSWI  581


 Score =   183 bits (464),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 194/351 (55%), Gaps = 6/351 (2%)
 Frame = +1

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             +WN ++ +Y++   +S   +LF+ +   S  +PDN+TF  +L++C+          +HG 
Sbjct  1     MWNGLMASYSKNQLYSETLELFQQLQKLSWPKPDNYTFPSVLKSCAGLKMIKFGENIHGF  60

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             ++ SG E D +  S L+  Y K     +A +VF+ + E D+  WN+M+S +   G  +KA
Sbjct  61    LIKSGFEHDIVVMSSLMGVYCKSENFIDACQVFNEMPERDVASWNTMLSCYYQDGQCEKA  120

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLV  888
             L  F KM+  G KP+S T+   I    C  LL +  GK+ H   +      +  +GS +V
Sbjct  121   LEFFEKMRSAGVKPNSVTFT--IAFSACARLLALDRGKDFHESIMNSEIYLDVFLGSAIV  178

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              MY++C C+G + ++F+++   ++V+++++I G + +GD    ++ F  M M+G K +  
Sbjct  179   DMYAKCGCLGMSRKVFEAMPTKNVVSFNSIISGCAMNGDTDSCMELFIRMEMEGLKPNST  238

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
              +  +L+A  + + +Q G+  HG+ ++ G   +V +  ALID+Y KCG +     +F  M
Sbjct  239   TLTGLLAACTRTSFLQLGKFIHGYVIKNGIDNDVFIGCALIDLYFKCGNIKHAELLFLKM  298

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             P  N++ +N M+S     G+ NEA +IFE  + K     D  TFS++L AC
Sbjct  299   PKNNVVVWNVMVSGYVTRGHYNEALEIFEG-MRKSNIQADAVTFSSVLSAC  348


 Score =   152 bits (384),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 147/257 (57%), Gaps = 2/257 (1%)
 Frame = +1

Query  664   WNSMISGHGCLGDWKKALLLFIKMQRMG-EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLC  840
             WN +++ +     + + L LF ++Q++   KPD++T+  ++       +++ G+N+H   
Sbjct  2     WNGLMASYSKNQLYSETLELFQQLQKLSWPKPDNYTFPSVLKSCAGLKMIKFGENIHGFL  61

Query  841   LKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKAL  1020
             +K GF+ +  V S L+ +Y + +    AC++F+ + E D+ +W+ M+    Q G   KAL
Sbjct  62    IKSGFEHDIVVMSSLMGVYCKSENFIDACQVFNEMPERDVASWNTMLSCYYQDGQCEKAL  121

Query  1021  DFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMY  1200
             +FF +M   G K + +      SA A+L  +  G++ H   +    +L+V + SA++DMY
Sbjct  122   EFFEKMRSAGVKPNSVTFTIAFSACARLLALDRGKDFHESIMNSEIYLDVFLGSAIVDMY  181

Query  1201  SKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATF  1380
             +KCG L +  +VF+AMP+KN++S+NS+IS   ++G+ +   ++F   +E E   P+  T 
Sbjct  182   AKCGCLGMSRKVFEAMPTKNVVSFNSIISGCAMNGDTDSCMELFIR-MEMEGLKPNSTTL  240

Query  1381  SALLCACCHTGLVCDGR  1431
             + LL AC  T  +  G+
Sbjct  241   TGLLAACTRTSFLQLGK  257


 Score =   143 bits (360),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 108/404 (27%), Positives = 198/404 (49%), Gaps = 23/404 (6%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K  H  I+ + +    F  + I+  YA    +  +R++F+  P +++  +NSII   A  
Sbjct  156   KDFHESIMNSEIYLDVFLGSAIVDMYAKCGCLGMSRKVFEAMPTKNVVSFNSIISGCAMN  215

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                 +  +LF  M   G +P++ T   +L AC+        + +HG V+ +G++ D    
Sbjct  216   GDTDSCMELFIRMEMEGLKPNSTTLTGLLAACTRTSFLQLGKFIHGYVIKNGIDNDVFIG  275

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
               L+  Y K G ++ A  +F  + + ++V WN M+SG+   G + +AL +F  M++   +
Sbjct  276   CALIDLYFKCGNIKHAELLFLKMPKNNVVVWNVMVSGYVTRGHYNEALEIFEGMRKSNIQ  335

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
              D+ T+  ++      +  + GK +H   ++   +S+  VG  L+ MY++C  +  A  +
Sbjct  336   ADAVTFSSVLSACSQIASHQKGKEIHHYIIEKELESDLMVGGALIDMYAKCGLVEEAHHV  395

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F+ L + D+V+W+AMI     +G    AL  F  M+    K D +   SVLSA +   +V
Sbjct  396   FERLPDRDVVSWTAMIEAYGSNGLANDALKLFERMSQSNVKPDNVTFLSVLSACSHGGLV  455

Query  1114  QPGRETHGFAVRCGY----HLEVSVS------SALIDMYSKCGFLNLGIQVFKAMPSKNI  1263
               G         CGY     +E  +S      S +ID+  + G L+   ++FK++P K  
Sbjct  456   HEG---------CGYFKRMEMEYGISPSLEHYSCMIDLLGRAGKLHEAYEIFKSIPMKTD  506

Query  1264  IS-YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +    +M+S   +HGN     +I + +LEK+   PD+A+   +L
Sbjct  507   VGLLGAMLSACNIHGNLELGTEIGDLLLEKD---PDDASIYIIL  547



>ref|XP_003610363.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES92560.1| PPR containing plant-like protein [Medicago truncatula]
Length=734

 Score =   328 bits (842),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 196/533 (37%), Positives = 302/533 (57%), Gaps = 12/533 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K  H++ +KT  S   +  + ++  Y     +  AR+LFD  P+R+   W ++I  YA +
Sbjct  138   KQAHSVAVKTGCSGDVYVGSSLLNMYCKTGFVFDARKLFDRMPERNTVSWATMISGYASS  197

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRA-CSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                  A ++F+ M       + F    +L A  SD F ++G R VH   + +GL      
Sbjct  198   DIADKAVEVFELMRREEEIQNEFALTSVLSALTSDVFVYTG-RQVHSLAIKNGLLAIVSV  256

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
             ++ LV+ Y+K G L++A++ F+   + + + W++M++G+   GD  KAL LF KM   G 
Sbjct  257   ANALVTMYAKCGSLDDAVRTFEFSGDKNSITWSAMVTGYAQGGDSDKALKLFNKMHSSGV  316

Query  751   KPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
              P  FT VG+I  C D  +++  GK +HS   K GF    +V S +V MY++C  +  A 
Sbjct  317   LPSEFTLVGVINACSDLCAVVE-GKQMHSFAFKLGFGLQLYVLSAVVDMYAKCGSLADAR  375

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLA  1107
             + F+ + +PD+V W+++I G  Q+GD    L+ + +M M+    + L +ASVL A + LA
Sbjct  376   KGFECVQQPDVVLWTSIITGYVQNGDYEGGLNLYGKMQMERVIPNELTMASVLRACSSLA  435

Query  1108  IVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMIS  1287
              +  G++ H   ++ G+ LEV + SAL  MY+KCG L+ G  +F  MPS+++IS+N+MIS
Sbjct  436   ALDQGKQMHARIIKYGFKLEVPIGSALSAMYTKCGSLDDGYLIFWRMPSRDVISWNAMIS  495

Query  1288  NLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGI  1467
              L  +G+ N+A ++FE++L  E   PD  TF  LL AC H GLV  G  YF++M DEF I
Sbjct  496   GLSQNGHGNKALELFEKML-LEGIKPDPVTFVNLLSACSHMGLVDRGWEYFKMMFDEFNI  554

Query  1468  QPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIV  1641
              P  EHY  MV +L  AG+L EA E I+S    VD G  +W  LL  C  H NY LG   
Sbjct  555   APMVEHYACMVDILSRAGKLNEAKEFIES--ATVDHGLCLWRILLGACKNHRNYELGVYA  612

Query  1642  AKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              + L +    +SS  V++S++Y   G  E V+++R  M+A +G  K PG SWI
Sbjct  613   GEKLVELGSPESSAYVLLSSIYTALGDRENVERVRRIMKA-RGVNKEPGCSWI  664


 Score =   192 bits (488),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 141/500 (28%), Positives = 243/500 (49%), Gaps = 15/500 (3%)
 Frame = +1

Query  163   RSLLTQLSR--SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD-  333
             R LL  L     N+ I   + LHA ILKT      +     +  YA    +  A  LFD 
Sbjct  12    RQLLQDLIECTHNKNILKGRTLHARILKTGSISSIYVTNTFLNLYAKTNHLSHALTLFDS  71

Query  334   -ETPQRSIFLWNSIIRAYARAHRFSN---AFQLFKDMLDSGTR-PDNFTFACILRACSDK  498
                  +    WNS+I A+++ H  S+   A  LF+ M+ +    P+  T A +  A S+ 
Sbjct  72    INDNDKDDVSWNSLINAFSQNHSSSSSSFAISLFRRMMRANNVIPNAHTLAGVFSAASNL  131

Query  499   FDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMI  678
              D    +  H   V +G   D    S L++ Y K G + +A K+FD + E + V W +MI
Sbjct  132   SDVVAGKQAHSVAVKTGCSGDVYVGSSLLNMYCKTGFVFDARKLFDRMPERNTVSWATMI  191

Query  679   SGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFD  858
             SG+       KA+ +F  M+R  E  + F    ++  L     +  G+ VHSL +K G  
Sbjct  192   SGYASSDIADKAVEVFELMRREEEIQNEFALTSVLSALTSDVFVYTGRQVHSLAIKNGLL  251

Query  859   SNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREM  1038
             +   V + LV+MY++C  +  A R F+   + + +TWSAM+ G +Q GD  KAL  F +M
Sbjct  252   AIVSVANALVTMYAKCGSLDDAVRTFEFSGDKNSITWSAMVTGYAQGGDSDKALKLFNKM  311

Query  1039  NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFL  1218
             +  G       +  V++A + L  V  G++ H FA + G+ L++ V SA++DMY+KCG L
Sbjct  312   HSSGVLPSEFTLVGVINACSDLCAVVEGKQMHSFAFKLGFGLQLYVLSAVVDMYAKCGSL  371

Query  1219  NLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
                 + F+ +   +++ + S+I+    +G+      ++ + ++ E   P+E T +++L A
Sbjct  372   ADARKGFECVQQPDVVLWTSIITGYVQNGDYEGGLNLYGK-MQMERVIPNELTMASVLRA  430

Query  1399  CCHTGLVCDGRR-YFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDF  1575
             C     +  G++ + RI+  ++G + +      +  +    G L++ Y +   +    D 
Sbjct  431   CSSLAALDQGKQMHARII--KYGFKLEVPIGSALSAMYTKCGSLDDGYLIFWRMPSR-DV  487

Query  1576  GIWGALLS--CCDIHGNYRL  1629
               W A++S    + HGN  L
Sbjct  488   ISWNAMISGLSQNGHGNKAL  507


 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/328 (30%), Positives = 169/328 (52%), Gaps = 1/328 (0%)
 Frame = +1

Query  145   QMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARR  324
             Q   A  S+L+ L+ S+  + T + +H++ +K  L      A  ++  YA    +  A R
Sbjct  217   QNEFALTSVLSALT-SDVFVYTGRQVHSLAIKNGLLAIVSVANALVTMYAKCGSLDDAVR  275

Query  325   LFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFD  504
              F+ +  ++   W++++  YA+      A +LF  M  SG  P  FT   ++ ACSD   
Sbjct  276   TFEFSGDKNSITWSAMVTGYAQGGDSDKALKLFNKMHSSGVLPSEFTLVGVINACSDLCA  335

Query  505   FSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISG  684
                 + +H      G  L     S +V  Y+K G L +A K F+ + +PD+V W S+I+G
Sbjct  336   VVEGKQMHSFAFKLGFGLQLYVLSAVVDMYAKCGSLADARKGFECVQQPDVVLWTSIITG  395

Query  685   HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSN  864
             +   GD++  L L+ KMQ     P+  T   ++      + L  GK +H+  +K+GF   
Sbjct  396   YVQNGDYEGGLNLYGKMQMERVIPNELTMASVLRACSSLAALDQGKQMHARIIKYGFKLE  455

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
               +GS L +MY++C  +     IF  +   D+++W+AMI GLSQ+G   KAL+ F +M +
Sbjct  456   VPIGSALSAMYTKCGSLDDGYLIFWRMPSRDVISWNAMISGLSQNGHGNKALELFEKMLL  515

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRE  1128
             +G K DP+   ++LSA + + +V  G E
Sbjct  516   EGIKPDPVTFVNLLSACSHMGLVDRGWE  543



>ref|XP_006847845.1| hypothetical protein AMTR_s00029p00062590 [Amborella trichopoda]
 gb|ERN09426.1| hypothetical protein AMTR_s00029p00062590 [Amborella trichopoda]
Length=625

 Score =   325 bits (832),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 188/548 (34%), Positives = 309/548 (56%), Gaps = 13/548 (2%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIIL-KTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L Q     +++ T ++LHA++    H  + P   T +I  YA   +++ A+ +FD    +
Sbjct  50    LLQACTKTKSLCTGRVLHALLFFNGHQQNTPL-QTNLINMYATCGNLLDAQLVFDRLQSK  108

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             ++  WN++IR + +   +  A  L   ML SG  PDNFTF  +L+AC+D  D    + +H
Sbjct  109   NVRSWNALIRGFIKHGLYREALILHSQMLGSGIEPDNFTFPFVLKACADLGDLQMGKSIH  168

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               +  S  + D    + LV+  +K G L EA +VF+ + + ++V W +MI+G+   G   
Sbjct  169   HQIERSNYKGDVYVCNALVAMLAKCGDLIEAQRVFNQMTQKNVVSWTAMIAGYAQGGRAM  228

Query  709   KALLLFIKMQRMGEKPDSFTYV-GLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
             +AL L  +M + G  P   T    L  C +  ++   GK +H   +K   D + +V S L
Sbjct  229   EALDLLREMGKAGLSPKPVTLACALPACANLEAIW-FGKEIHGHAIKTKCDDDLYVASAL  287

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK-GGKVD  1062
               MY++   M  A ++FD + +  +V+W+ MI G +Q+G   KALD FR+M +    K +
Sbjct  288   SDMYAKTHDMTYATKVFDKMPKKSVVSWNGMIAGCNQNGFSNKALDLFRKMVVTFPRKPN  347

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
              + + ++L + A+L+ +  G+E HGF+V+   H +  V +ALIDMYSKCG L L  +VF 
Sbjct  348   WVTLVNLLPSCAKLSALLHGKEIHGFSVKNHIHWDTIVCNALIDMYSKCGSLELARRVFD  407

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              MP +++I++ +MI+  G+HGN  +A  +F  ++ +    PD  TF  LL +C H GLV 
Sbjct  408   RMPERDVITWTAMIAGYGMHGNGEKAVHLF-SLMHQSGVRPDYVTFVGLLSSCSHAGLVD  466

Query  1423  DGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALL  1596
              G +   IM  ++GI  + EH   +V LLG AG LEEA++ I+ I  PV+ G  +WGALL
Sbjct  467   QGLKLIEIMEHDYGIHSRLEHQSCIVDLLGRAGRLEEAFDYIKRI--PVEPGPVVWGALL  524

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--  1770
             + C +H N  L   VAK LF+ + + +    ++S++YA  G+W+   ++R+ M+  +G  
Sbjct  525   AACKVHKNVELAERVAKILFELEPKNTGNYSLLSSIYAESGKWKEAAEVRLTMKC-RGLK  583

Query  1771  KMPGKSWI  1794
             K PG SW+
Sbjct  584   KRPGSSWV  591


 Score =   183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/401 (29%), Positives = 209/401 (52%), Gaps = 12/401 (3%)
 Frame = +1

Query  463   TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
             T+A +L+AC+        RV+H  +  +G + ++   + L++ Y+  G L +A  VFD +
Sbjct  46    TYASLLQACTKTKSLCTGRVLHALLFFNGHQQNTPLQTNLINMYATCGNLLDAQLVFDRL  105

Query  643   AEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIG  819
                ++  WN++I G    G +++AL+L  +M   G +PD+FT+  ++  C D   L ++G
Sbjct  106   QSKNVRSWNALIRGFIKHGLYREALILHSQMLGSGIEPDNFTFPFVLKACADLGDL-QMG  164

Query  820   KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQS  999
             K++H    +  +  + +V + LV+M ++C  +  A R+F+ + + ++V+W+AMI G +Q 
Sbjct  165   KSIHHQIERSNYKGDVYVCNALVAMLAKCGDLIEAQRVFNQMTQKNVVSWTAMIAGYAQG  224

Query  1000  GDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS  1179
             G  M+ALD  REM   G    P+ +A  L A A L  +  G+E HG A++     ++ V+
Sbjct  225   GRAMEALDLLREMGKAGLSPKPVTLACALPACANLEAIWFGKEIHGHAIKTKCDDDLYVA  284

Query  1180  SALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY  1359
             SAL DMY+K   +    +VF  MP K+++S+N MI+    +G +N+A  +F +++     
Sbjct  285   SALSDMYAKTHDMTYATKVFDKMPKKSVVSWNGMIAGCNQNGFSNKALDLFRKMVVTFPR  344

Query  1360  NPDEATFSALLCACCHTGLVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEE  1533
              P+  T   LL +C     +  G+    F + N    I   T     ++ +    G LE 
Sbjct  345   KPNWVTLVNLLPSCAKLSALLHGKEIHGFSVKNH---IHWDTIVCNALIDMYSKCGSLEL  401

Query  1534  AYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLF  1656
             A  +   +    D   W A+++   +HGN    G  A HLF
Sbjct  402   ARRVFDRMP-ERDVITWTAMIAGYGMHGN----GEKAVHLF  437


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 76/168 (45%), Gaps = 8/168 (5%)
 Frame = +1

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
             P   AS+L A  +   +  GR  H      G+     + + LI+MY+ CG L     VF 
Sbjct  44    PATYASLLQACTKTKSLCTGRVLHALLFFNGHQQNTPLQTNLINMYATCGNLLDAQLVFD  103

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              + SKN+ S+N++I     HG   EA  +  ++L      PD  TF  +L AC   G + 
Sbjct  104   RLQSKNVRSWNALIRGFIKHGLYREALILHSQMLGSG-IEPDNFTFPFVLKACADLGDLQ  162

Query  1423  DGRR-YFRIMNDEFGIQPKTEHYV--YMVKLLGMAGELEEAYELIQSI  1557
              G+  + +I    +    K + YV   +V +L   G+L EA  +   +
Sbjct  163   MGKSIHHQIERSNY----KGDVYVCNALVAMLAKCGDLIEAQRVFNQM  206



>ref|XP_010320212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Solanum lycopersicum]
Length=606

 Score =   324 bits (830),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 181/544 (33%), Positives = 301/544 (55%), Gaps = 10/544 (2%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSARRLFDETPQR  348
              T L  S  ++   K LH ++L T    +    T+I+     L+  +  AR+LFD+ PQR
Sbjct  36    FTHLLSSCHSLPALKQLHTLVLTTGYHKNLLICTKIVSLACFLSPTMDYARKLFDQMPQR  95

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
              +F WN++IR Y+       +  L+K++   G  PDN+TF  +LR+CS        R +H
Sbjct  96    DVFAWNTLIRGYSNLGPCQESIFLYKELHLQGVLPDNYTFPFVLRSCSVLSALKEGREIH  155

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               ++  G E D    S L+S Y++ G   ++  VFD +   ++V W +MI+G+   G  +
Sbjct  156   CNIIKHGFESDVFVQSSLISLYAQSGETLDSELVFDQMRVRNIVSWTAMIAGYVQNGIHE  215

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMC---LDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             K L +F+KM   G  P++ T V ++     LDC   L +G  +H   +K G +++  + +
Sbjct  216   KGLGVFLKMVDSGTLPNAITLVSVLPACARLDC---LDLGMLIHGYSIKLGVETDVSLVN  272

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV+ Y +C  +  A  +FD + E  +V+W+A+I    Q+ D+   +  F  M  +G + 
Sbjct  273   ALVAFYGKCGLVDVAWSLFDQMKEHSVVSWNAIIAAYEQN-DVSSTIKLFHRMLDQGVEF  331

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D + + +V+SA A+L  +  G+  H      G    V +++ALIDMY+KCG +     VF
Sbjct  332   DYITVVTVISACARLGALGTGKWIHELVKSRGLEWNVPITNALIDMYAKCGSIESARDVF  391

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +P ++++S++S+I     HG+  +A ++F   +++E   P+  TF+A+L AC H+GLV
Sbjct  392   DRLPIRSVVSWSSIIGACASHGHGRDALELFSR-MKEEGVPPNSFTFTAVLTACRHSGLV  450

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +GR++F  M  E+ I P  E    MV LLG +G+L EAYE I+++    D  +WGALL 
Sbjct  451   EEGRKHFESMRMEYSIVPGVEQCACMVDLLGRSGQLLEAYEFIENMPIEPDADVWGALLG  510

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKM  1776
              C IHGN  +   VA  LFD   +   + +++ N+YA  GRW+ V +L+  +E ++  K+
Sbjct  511   ACRIHGNLEMAEYVADRLFDFNPQAVPFYILMKNIYAEAGRWDDVARLKFLLEELEVEKI  570

Query  1777  PGKS  1788
             PGKS
Sbjct  571   PGKS  574



>ref|XP_009775604.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nicotiana sylvestris]
Length=686

 Score =   326 bits (836),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 187/495 (38%), Positives = 281/495 (57%), Gaps = 2/495 (0%)
 Frame = +1

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSD  495
             A+ +F++T + +IFL+N+IIR       F  A + FK M   G  P+NFTF  +L+AC+ 
Sbjct  65    AKIVFNQTQEPNIFLYNTIIRGLVSNDCFFQAIEFFKLMRKDGFLPNNFTFPFLLKACAR  124

Query  496   KFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSM  675
               DF      H  VV  G + D    + LV  Y++ G LE A KVFD I E ++V W ++
Sbjct  125   LMDFELGVKAHTLVVKGGFDCDVFVKTGLVCFYARCGFLEGAHKVFDDIPEKNVVSWTAI  184

Query  676   ISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGF  855
             ++G+   G +K+A+ LF +   MG  PDSFT V ++        +  G+ +H   ++ G 
Sbjct  185   MTGYIDFGKFKEAIELFRRSLEMGLSPDSFTLVRVLSACSRVGDVSSGEWIHRYAVEMGM  244

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
               N  VG+ LV MY++C  M  A  +FD ++E D+V+WSAMI G + +G   +AL+ F +
Sbjct  245   GRNVFVGTALVDMYAKCGNMARARELFDEMVEKDVVSWSAMIQGYAANGLPKEALELFHK  304

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             M  +  + D   +  VLSA A+L  ++ G           +     + +ALIDMY+KCG 
Sbjct  305   MQGENLRPDCYSMVGVLSACAKLGALEVGESATRLMEMDEFFSNAVLGTALIDMYAKCGR  364

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLC  1395
             +  G ++FK +  K+ + +N++IS L +HG+   AF  F +V EK    PD  TF  LLC
Sbjct  365   MLSGWEIFKQVKVKDRVIWNAVISGLAMHGHVKSAFCCFGQV-EKRGIKPDGNTFMGLLC  423

Query  1396  ACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDF  1575
             AC H GLV DGR+YFR M   + ++P  EHY  MV LLG AG L+EA+ LI+ +    + 
Sbjct  424   ACTHAGLVDDGRKYFRSMTHLYSLEPTIEHYGCMVDLLGRAGLLDEAHSLIEIMPMKANA  483

Query  1576  GIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM  1755
              IWGALLS C +H + +L   V K L + +   S   V++SN+YA + +W+  +K+R  M
Sbjct  484   IIWGALLSGCRLHRDTKLAEHVLKQLIELEPWNSGNYVLLSNIYASNNKWDDSEKIRSTM  543

Query  1756  -EAIKGKMPGKSWIS  1797
              E+   K+P  SWI 
Sbjct  544   NESRMQKIPAYSWIE  558



>ref|XP_002510620.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52807.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=708

 Score =   327 bits (837),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/529 (37%), Positives = 297/529 (56%), Gaps = 10/529 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             HA+ +K    +  F  + ++  Y     +  AR +FD  P+R+   W ++I  YA     
Sbjct  134   HAVAIKMACFYDVFVGSSLLNMYCKAGLLFEAREVFDRMPERNEVTWATMISGYAIQRLA  193

Query  403   SNAFQLFKDMLDSGTRPDNFTFACILRACS-DKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
               AF++F+ M       + F F  +L A +  +F  SG + +H   V +GL +     + 
Sbjct  194   GEAFEVFELMRREEEDVNEFAFTSVLSALAVPEFVDSG-KQIHCLAVKTGLLVFLSILNA  252

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             LV+ Y+K G L+++++VF+   + + + W++MI+G+   GD  KAL LF +M   G  P 
Sbjct  253   LVTMYAKCGSLDDSLQVFEMSNDKNSITWSAMITGYAQSGDSHKALKLFSRMHFAGINPS  312

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              FT VG++        +  GK VH+  LK GF+S  ++ + LV MY++      A + F+
Sbjct  313   EFTLVGVLNACSDACAVEEGKQVHNYLLKLGFESQLYIMTALVDMYAKSGVTEDARKGFN  372

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L +PD+V W++MI G  Q+G+   AL  +  M M+G   + L +ASVL A + LA    
Sbjct  373   YLQQPDLVLWTSMIAGYVQNGENEDALSLYCRMQMEGILPNELTMASVLKACSNLAAFDQ  432

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             GR+ H   ++ G  LEV++ SAL  MY+KCG L  G  VF+ MP ++IIS+N+MIS L  
Sbjct  433   GRQIHARTIKYGLGLEVTIGSALSTMYAKCGNLEEGNIVFRRMPERDIISWNAMISGLSQ  492

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             +G   EA ++FEE+ +++   PD+ TF  +L AC H GLV  G  YFR+M DEFG+ PK 
Sbjct  493   NGYGKEALELFEEMRQQD-TKPDDVTFVNVLSACSHMGLVDSGWLYFRMMFDEFGLLPKV  551

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHL  1653
             EHY  MV +L  AG+L EA E I+S    +D G  +W  LL  C  + NY LG    + L
Sbjct  552   EHYACMVDVLSRAGKLYEAKEFIEST--TIDHGLCLWRILLGACRNYRNYELGAYAGEKL  609

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
              +   ++SS  V++S +Y   GR E V+++R  M  ++G  K PG SWI
Sbjct  610   MELGSQESSAYVLLSGIYTALGRPEDVERVR-SMMKVRGVSKEPGCSWI  657


 Score =   183 bits (464),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 213/435 (49%), Gaps = 5/435 (1%)
 Frame = +1

Query  139   LHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFY-ATRIIRFYALNEDIVS  315
             LH   ++  + L Q +   +++   + LHA I+K   S    Y A  +I FYA    +  
Sbjct  3     LHPQNLSSFNSLVQFTH-QKSLQKGRALHAQIIKLASSSSCIYLANSLINFYAKCCHLPK  61

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAF--QLFKDMLDSGTRPDNFTFACILRAC  489
             A+ +FD    + +  WN +I  Y++     ++F  +LF+ M      P+  TF+ I  A 
Sbjct  62    AKLVFDRIHNKDVISWNCLINGYSQQGPTGSSFVMELFQRMRADNILPNAHTFSGIFTAA  121

Query  490   SDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWN  669
             S+       +  H   +      D    S L++ Y K G L EA +VFD + E + V W 
Sbjct  122   SNLSSIFFGQQAHAVAIKMACFYDVFVGSSLLNMYCKAGLLFEAREVFDRMPERNEVTWA  181

Query  670   SMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKF  849
             +MISG+       +A  +F  M+R  E  + F +  ++  L  P  +  GK +H L +K 
Sbjct  182   TMISGYAIQRLAGEAFEVFELMRREEEDVNEFAFTSVLSALAVPEFVDSGKQIHCLAVKT  241

Query  850   GFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFF  1029
             G      + + LV+MY++C  +  + ++F+   + + +TWSAMI G +QSGD  KAL  F
Sbjct  242   GLLVFLSILNALVTMYAKCGSLDDSLQVFEMSNDKNSITWSAMITGYAQSGDSHKALKLF  301

Query  1030  REMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
               M+  G       +  VL+A +    V+ G++ H + ++ G+  ++ + +AL+DMY+K 
Sbjct  302   SRMHFAGINPSEFTLVGVLNACSDACAVEEGKQVHNYLLKLGFESQLYIMTALVDMYAKS  361

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
             G      + F  +   +++ + SMI+    +G   +A  ++   ++ E   P+E T +++
Sbjct  362   GVTEDARKGFNYLQQPDLVLWTSMIAGYVQNGENEDALSLYCR-MQMEGILPNELTMASV  420

Query  1390  LCACCHTGLVCDGRR  1434
             L AC +      GR+
Sbjct  421   LKACSNLAAFDQGRQ  435


 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/322 (30%), Positives = 167/322 (52%), Gaps = 1/322 (0%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
             AF S+L+ L+   + + + K +H + +KT L         ++  YA    +  + ++F+ 
Sbjct  214   AFTSVLSALAVP-EFVDSGKQIHCLAVKTGLLVFLSILNALVTMYAKCGSLDDSLQVFEM  272

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
             +  ++   W+++I  YA++     A +LF  M  +G  P  FT   +L ACSD       
Sbjct  273   SNDKNSITWSAMITGYAQSGDSHKALKLFSRMHFAGINPSEFTLVGVLNACSDACAVEEG  332

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + VH  ++  G E      + LV  Y+K G  E+A K F+ + +PDLV W SMI+G+   
Sbjct  333   KQVHNYLLKLGFESQLYIMTALVDMYAKSGVTEDARKGFNYLQQPDLVLWTSMIAGYVQN  392

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             G+ + AL L+ +MQ  G  P+  T   ++      +    G+ +H+  +K+G      +G
Sbjct  393   GENEDALSLYCRMQMEGILPNELTMASVLKACSNLAAFDQGRQIHARTIKYGLGLEVTIG  452

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             S L +MY++C  +     +F  + E D+++W+AMI GLSQ+G   +AL+ F EM  +  K
Sbjct  453   SALSTMYAKCGNLEEGNIVFRRMPERDIISWNAMISGLSQNGYGKEALELFEEMRQQDTK  512

Query  1057  VDPLLIASVLSAAAQLAIVQPG  1122
              D +   +VLSA + + +V  G
Sbjct  513   PDDVTFVNVLSACSHMGLVDSG  534



>gb|KDO44965.1| hypothetical protein CISIN_1g005487mg [Citrus sinensis]
Length=694

 Score =   326 bits (835),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/534 (34%), Positives = 286/534 (54%), Gaps = 3/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K++H  ++KT        A+     YA       A ++FDE  +R +  WN++I 
Sbjct  121   SVGIGKMIHTHLIKTGFLLDVVIASSTAGMYAKCNSFECAVKMFDEMSERDVASWNTVIS  180

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y +  +   A +LFK M  SG +P++ T   ++ +C+   D    + +H   +  G   
Sbjct  181   CYYQDGQAEKALELFKKMRGSGFQPNSVTLTTVISSCARLMDLDRGKEIHKEFIKDGFVS  240

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             DS  SS LV  Y K G LE A +VF+      +V WN++I+G+   GD K  + LF +M 
Sbjct  241   DSYISSALVDMYGKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVKLFWRMN  300

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G KP   T   ++M       L+ GK +H   ++     +  + S L+ +Y +C  + 
Sbjct  301   EEGIKPTLTTISSVLMSCSRSGQLKHGKVMHGYIIRNKIQGDVFINSSLIDLYFKCGRVS  360

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             SA  +F+ + + D+V W+ MI G    GD  KAL  + +M   G K D +   SVL A +
Sbjct  361   SAENVFEKMSKTDVVYWNVMISGYVTVGDYFKALAIYSDMKEVGAKPDAVTFTSVLPACS  420

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             QLA ++ G+E H   +         V  AL+DMY+KCG ++   +VF  +P ++++S+ S
Sbjct  421   QLAALEKGKEIHNHIIESKLETNEIVMGALLDMYAKCGAVDEAFKVFNELPERDLVSWTS  480

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G HG A EA ++F E +++    PD  TF ALL AC H G V +G  YF +M  E
Sbjct  481   MIAAYGSHGRALEALKLFGE-MQQSNARPDSITFLALLSACSHAGWVDEGGYYFNLMISE  539

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI-QGPVDFGIWGALLSCCDIHGNYRLGG  1635
             + IQP+ EHY  ++ LLG AG L+EAY ++QS  +   D G+   L S C +H +  +G 
Sbjct  540   YNIQPRNEHYSCLIDLLGRAGRLQEAYGILQSTPEIREDAGLLSTLFSACRLHRDIEMGE  599

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
              +AK L +   + SS  +++SNMYA   +W+ V+K+R+ M+ +   K PG SWI
Sbjct  600   KIAKLLIEKDPDDSSTYIVLSNMYASVKKWDEVRKIRLKMKELGLRKNPGCSWI  653


 Score =   200 bits (508),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/484 (28%), Positives = 249/484 (51%), Gaps = 19/484 (4%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR-SIFLWNS  369
             ++++   K++H  ++   L ++      +I  Y   ++   A  +F        + LWN 
Sbjct  16    SKSLKEGKIIHQKVVTLGLQNNIALCKSLINLYFSCQNYDYAMLVFKTIDNPLDLSLWNG  75

Query  370   IIRAYARAHRFSNAFQLFKDML--DSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             ++ +Y + + +  A +LF DML  +   +PD++T+  +L+AC         +++H  ++ 
Sbjct  76    LMASYTKNYMYITALELF-DMLLQNPYLKPDSYTYPSVLKACGGLGSVGIGKMIHTHLIK  134

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +G  LD + +S     Y+K    E A+K+FD ++E D+  WN++IS +   G  +KAL L
Sbjct  135   TGFLLDVVIASSTAGMYAKCNSFECAVKMFDEMSERDVASWNTVISCYYQDGQAEKALEL  194

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMY  897
             F KM+  G +P+S T   +I    C  L+ +  GK +H   +K GF S++++ S LV MY
Sbjct  195   FKKMRGSGFQPNSVTLTTVIS--SCARLMDLDRGKEIHKEFIKDGFVSDSYISSALVDMY  252

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
              +C C+  A  +F+  +   +V W+A+I G S  GD    +  F  MN +G K     I+
Sbjct  253   GKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVKLFWRMNEEGIKPTLTTIS  312

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             SVL + ++   ++ G+  HG+ +R     +V ++S+LID+Y KCG ++    VF+ M   
Sbjct  313   SVLMSCSRSGQLKHGKVMHGYIIRNKIQGDVFINSSLIDLYFKCGRVSSAENVFEKMSKT  372

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +++ +N MIS     G+  +A  I+ ++ E     PD  TF+++L AC     +  G+  
Sbjct  373   DVVYWNVMISGYVTVGDYFKALAIYSDMKEVG-AKPDAVTFTSVLPACSQLAALEKGKEI  431

Query  1438  FRIMNDEFGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
                +     I+ K E + + M  LL M    G ++EA+++   +    D   W ++++  
Sbjct  432   HNHI-----IESKLETNEIVMGALLDMYAKCGAVDEAFKVFNELP-ERDLVSWTSMIAAY  485

Query  1606  DIHG  1617
               HG
Sbjct  486   GSHG  489


 Score =   149 bits (375),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 168/321 (52%), Gaps = 3/321 (1%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEP-  651
             +LR C+        +++H  VV  GL+ +      L++ Y      + A+ VF  I  P 
Sbjct  9     LLRTCTGSKSLKEGKIIHQKVVTLGLQNNIALCKSLINLYFSCQNYDYAMLVFKTIDNPL  68

Query  652   DLVQWNSMISGHGCLGDWKKALLLF-IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNV  828
             DL  WN +++ +     +  AL LF + +Q    KPDS+TY  ++        + IGK +
Sbjct  69    DLSLWNGLMASYTKNYMYITALELFDMLLQNPYLKPDSYTYPSVLKACGGLGSVGIGKMI  128

Query  829   HSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDI  1008
             H+  +K GF  +  + S    MY++C     A ++FD + E D+ +W+ +I    Q G  
Sbjct  129   HTHLIKTGFLLDVVIASSTAGMYAKCNSFECAVKMFDEMSERDVASWNTVISCYYQDGQA  188

Query  1009  MKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSAL  1188
              KAL+ F++M   G + + + + +V+S+ A+L  +  G+E H   ++ G+  +  +SSAL
Sbjct  189   EKALELFKKMRGSGFQPNSVTLTTVISSCARLMDLDRGKEIHKEFIKDGFVSDSYISSAL  248

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             +DMY KCG L +  +VF+    K+++++N++I+     G++    ++F   + +E   P 
Sbjct  249   VDMYGKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVKLFWR-MNEEGIKPT  307

Query  1369  EATFSALLCACCHTGLVCDGR  1431
               T S++L +C  +G +  G+
Sbjct  308   LTTISSVLMSCSRSGQLKHGK  328



>ref|XP_007015317.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY32936.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=704

 Score =   326 bits (835),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 182/534 (34%), Positives = 286/534 (54%), Gaps = 3/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             T+   K++H  ++K    +    A+ ++  YA  +    A  +FDE P R +  WN++I 
Sbjct  121   TVDYGKMIHTHLMKAGFLYDVVVASSLVSMYANCKMFEQATLVFDEMPDRDVACWNTVIS  180

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y +  +   A +LF  M D+G  P++ T   I  AC+   D    R +HG +V  G  L
Sbjct  181   CYYQDGKAEKALELFGKMRDAGFAPNSVTLTVIFSACARLMDLEKGRAIHGELVKHGHVL  240

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             D    S LV  Y K G +E A +VF+ I E  +V WNSMI+G+  + + +  + LF +M 
Sbjct  241   DGFLGSSLVDMYGKCGCIEMAREVFEQIPEKGVVTWNSMIAGYSSVCNSQSCMELFKRMN  300

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G KP   +   ++M     + L+ GK +H   ++   +++  V + L+ +Y +C  + 
Sbjct  301   MEGIKPSLTSLSSILMACSRSAQLQYGKFIHGYMIRNMVEADIFVNNSLIDLYFKCGNVN  360

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             SA  IF  +L+ D+V+W+ MI G    G    AL  +  M   G   D +   SVL+A +
Sbjct  361   SAENIFKMMLKTDLVSWNIMISGYVSIGKFFDALGIYENMMKAGVNPDAVTFTSVLAACS  420

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             QLA ++ G+E H             V  AL+DMY+KCG ++   ++F  +P ++++S+ S
Sbjct  421   QLAALENGKEIHNSITENKLERNEVVMGALLDMYAKCGAVDEAYKIFCELPERDLVSWTS  480

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G HG A +A ++F E +++    PD  TF A+LCAC H GLV +G  YF  + +E
Sbjct  481   MITAYGSHGQALDALELFGE-MQQSNTKPDGVTFLAVLCACSHGGLVDEGCYYFNQLTNE  539

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI-QGPVDFGIWGALLSCCDIHGNYRLGG  1635
               I+P+ EHY  ++ LLG AG L EAYE +QS  +   D G+   L S C +H    LG 
Sbjct  540   HSIEPQLEHYSCLIDLLGRAGRLHEAYEFVQSTPKTREDVGLLSTLFSACHLHKCLELGE  599

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
              +A+ L +   + SS  V++SNMYA   +W  V+K+R+ M  +   K PG SWI
Sbjct  600   KIAELLIEKDPDDSSTYVILSNMYASAKKWNKVRKVRLKMRQLGLRKNPGCSWI  653


 Score =   208 bits (529),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 250/484 (52%), Gaps = 15/484 (3%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETP-QRSIFLWN  366
             S++++   KLLH  I+     ++  +   +I FY       SA R+F        I LWN
Sbjct  15    SSKSLVKGKLLHQKIITFGFQNNIAFCKNLISFYFSCHLHDSAFRVFKTIDYPLDISLWN  74

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSG-TRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
              ++ AY ++  F  A  LF+ + +    +P++FT+  +L+AC         +++H  ++ 
Sbjct  75    GLMAAYTKSFLFVEALDLFERLWEYPYLKPNSFTYPSVLKACGGLGTVDYGKMIHTHLMK  134

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +G   D + +S LVS Y+     E+A  VFD + + D+  WN++IS +   G  +KAL L
Sbjct  135   AGFLYDVVVASSLVSMYANCKMFEQATLVFDEMPDRDVACWNTVISCYYQDGKAEKALEL  194

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMY  897
             F KM+  G  P+S T    ++   C  L+ +  G+ +H   +K G   +  +GS LV MY
Sbjct  195   FGKMRDAGFAPNSVTLT--VIFSACARLMDLEKGRAIHGELVKHGHVLDGFLGSSLVDMY  252

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
              +C C+  A  +F+ + E  +VTW++MI G S   +    ++ F+ MNM+G K     ++
Sbjct  253   GKCGCIEMAREVFEQIPEKGVVTWNSMIAGYSSVCNSQSCMELFKRMNMEGIKPSLTSLS  312

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             S+L A ++ A +Q G+  HG+ +R     ++ V+++LID+Y KCG +N    +FK M   
Sbjct  313   SILMACSRSAQLQYGKFIHGYMIRNMVEADIFVNNSLIDLYFKCGNVNSAENIFKMMLKT  372

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +++S+N MIS     G   +A  I+E ++ K   NPD  TF+++L AC     + +G+  
Sbjct  373   DLVSWNIMISGYVSIGKFFDALGIYENMM-KAGVNPDAVTFTSVLAACSQLAALENGKE-  430

Query  1438  FRIMNDEFGIQPKTEHYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
                +++         + V M  LL M    G ++EAY++   +    D   W ++++   
Sbjct  431   ---IHNSITENKLERNEVVMGALLDMYAKCGAVDEAYKIFCELP-ERDLVSWTSMITAYG  486

Query  1609  IHGN  1620
              HG 
Sbjct  487   SHGQ  490


 Score =   142 bits (359),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/331 (28%), Positives = 165/331 (50%), Gaps = 9/331 (3%)
 Frame = +1

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVF  633
             D      +L+ C         +++H  ++  G + +      L+S Y      + A +VF
Sbjct  2     DTAKLLSLLKTCISSKSLVKGKLLHQKIITFGFQNNIAFCKNLISFYFSCHLHDSAFRVF  61

Query  634   DGIAEP-DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE----KPDSFTYVGLIMCLDC  798
               I  P D+  WN +++ +     + +AL LF   +R+ E    KP+SFTY  ++     
Sbjct  62    KTIDYPLDISLWNGLMAAYTKSFLFVEALDLF---ERLWEYPYLKPNSFTYPSVLKACGG  118

Query  799   PSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAM  978
                +  GK +H+  +K GF  +  V S LVSMY+ CK    A  +FD + + D+  W+ +
Sbjct  119   LGTVDYGKMIHTHLMKAGFLYDVVVASSLVSMYANCKMFEQATLVFDEMPDRDVACWNTV  178

Query  979   ICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGY  1158
             I    Q G   KAL+ F +M   G   + + +  + SA A+L  ++ GR  HG  V+ G+
Sbjct  179   ISCYYQDGKAEKALELFGKMRDAGFAPNSVTLTVIFSACARLMDLEKGRAIHGELVKHGH  238

Query  1159  HLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEE  1338
              L+  + S+L+DMY KCG + +  +VF+ +P K ++++NSMI+      N+    ++F+ 
Sbjct  239   VLDGFLGSSLVDMYGKCGCIEMAREVFEQIPEKGVVTWNSMIAGYSSVCNSQSCMELFKR  298

Query  1339  VLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
              +  E   P   + S++L AC  +  +  G+
Sbjct  299   -MNMEGIKPSLTSLSSILMACSRSAQLQYGK  328



>gb|KHN22086.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=563

 Score =   322 bits (824),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/503 (38%), Positives = 287/503 (57%), Gaps = 12/503 (2%)
 Frame = +1

Query  307   IVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDML--DSGTRPDNFTFACIL  480
             +  AR LFDE P+R+   W ++I  YA       AF+LFK M   + G   + F F  +L
Sbjct  8     VFEARDLFDEMPERNAVSWATMISGYASQELADEAFELFKLMRHEEKGKNENEFVFTSVL  67

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
              A +     +  R VH   + +GL      ++ LV+ Y K G LE+A+K F+     + +
Sbjct  68    SALTCYMLVNTGRQVHSLAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFELSGNKNSI  127

Query  661   QWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSL  837
              W++M++G    GD  KAL LF  M + GE P  FT VG+I  C D  +++  G+ +H  
Sbjct  128   TWSAMVTGFAQFGDSDKALKLFYDMHQSGELPSEFTLVGVINACSDACAIVE-GRQMHGY  186

Query  838   CLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKA  1017
              LK G++   +V S LV MY++C  +  A + F+ + +PD+V W+++I G  Q+GD   A
Sbjct  187   SLKLGYELQLYVLSALVDMYAKCGSIVDARKGFECIQQPDVVLWTSIITGYVQNGDYEGA  246

Query  1018  LDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDM  1197
             L+ + +M + G   + L +ASVL A + LA +  G++ H   ++  + LE+ + SAL  M
Sbjct  247   LNLYGKMQLGGVIPNDLTMASVLKACSNLAALDQGKQMHAGIIKYNFSLEIPIGSALSAM  306

Query  1198  YSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEAT  1377
             Y+KCG L+ G ++F  MP++++IS+N+MIS L  +G  NE  ++FE++   E   PD  T
Sbjct  307   YAKCGSLDDGYRIFWRMPARDVISWNAMISGLSQNGRGNEGLELFEKMC-LEGTKPDNVT  365

Query  1378  FSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI  1557
             F  LL AC H GLV  G  YF++M DEF I P  EHY  MV +L  AG+L EA E I+S 
Sbjct  366   FVNLLSACSHMGLVDRGWVYFKMMFDEFNIAPTVEHYACMVDILSRAGKLHEAKEFIES-  424

Query  1558  QGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWEC  1731
                VD G  +W  LL+    H +Y LG    + L +    +SS  V++S++Y   G+WE 
Sbjct  425   -ATVDHGLCLWRILLAASKNHRDYDLGAYAGEKLMELGSLESSAYVLLSSIYTALGKWED  483

Query  1732  VKKLRVDMEAIKG--KMPGKSWI  1794
             V+++R  M+A +G  K PG SWI
Sbjct  484   VERVRGMMKA-RGVTKEPGCSWI  505


 Score =   164 bits (414),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/321 (31%), Positives = 169/321 (53%), Gaps = 1/321 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F S+L+ L+     ++T + +H++ +K  L      A  ++  Y     +  A + F+ +
Sbjct  63    FTSVLSALT-CYMLVNTGRQVHSLAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFELS  121

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               ++   W++++  +A+      A +LF DM  SG  P  FT   ++ ACSD       R
Sbjct  122   GNKNSITWSAMVTGFAQFGDSDKALKLFYDMHQSGELPSEFTLVGVINACSDACAIVEGR  181

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG  +  G EL     S LV  Y+K G + +A K F+ I +PD+V W S+I+G+   G
Sbjct  182   QMHGYSLKLGYELQLYVLSALVDMYAKCGSIVDARKGFECIQQPDVVLWTSIITGYVQNG  241

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             D++ AL L+ KMQ  G  P+  T   ++      + L  GK +H+  +K+ F     +GS
Sbjct  242   DYEGALNLYGKMQLGGVIPNDLTMASVLKACSNLAALDQGKQMHAGIIKYNFSLEIPIGS  301

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L +MY++C  +    RIF  +   D+++W+AMI GLSQ+G   + L+ F +M ++G K 
Sbjct  302   ALSAMYAKCGSLDDGYRIFWRMPARDVISWNAMISGLSQNGRGNEGLELFEKMCLEGTKP  361

Query  1060  DPLLIASVLSAAAQLAIVQPG  1122
             D +   ++LSA + + +V  G
Sbjct  362   DNVTFVNLLSACSHMGLVDRG  382


 Score =   146 bits (369),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/283 (29%), Positives = 151/283 (53%), Gaps = 3/283 (1%)
 Frame = +1

Query  592   YSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC--LGDWKKALLLFIKMQRMGEKPDSF  765
             Y K G + EA  +FD + E + V W +MISG+    L D    L   ++ +  G+  + F
Sbjct  2     YCKTGLVFEARDLFDEMPERNAVSWATMISGYASQELADEAFELFKLMRHEEKGKNENEF  61

Query  766   TYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSL  945
              +  ++  L C  L+  G+ VHSL +K G      V + LV+MY +C  +  A + F+  
Sbjct  62    VFTSVLSALTCYMLVNTGRQVHSLAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFELS  121

Query  946   LEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGR  1125
                + +TWSAM+ G +Q GD  KAL  F +M+  G       +  V++A +    +  GR
Sbjct  122   GNKNSITWSAMVTGFAQFGDSDKALKLFYDMHQSGELPSEFTLVGVINACSDACAIVEGR  181

Query  1126  ETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHG  1305
             + HG++++ GY L++ V SAL+DMY+KCG +    + F+ +   +++ + S+I+    +G
Sbjct  182   QMHGYSLKLGYELQLYVLSALVDMYAKCGSIVDARKGFECIQQPDVVLWTSIITGYVQNG  241

Query  1306  NANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             +   A  ++ + ++     P++ T +++L AC +   +  G++
Sbjct  242   DYEGALNLYGK-MQLGGVIPNDLTMASVLKACSNLAALDQGKQ  283


 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 132/266 (50%), Gaps = 15/266 (6%)
 Frame = +1

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREM--NMKGGKVDP  1065
             MY +   +  A  +FD + E + V+W+ MI G +      +A + F+ M    KG   + 
Sbjct  1     MYCKTGLVFEARDLFDEMPERNAVSWATMISGYASQELADEAFELFKLMRHEEKGKNENE  60

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
              +  SVLSA     +V  GR+ H  A++ G    VSV++AL+ MY KCG L   ++ F+ 
Sbjct  61    FVFTSVLSALTCYMLVNTGRQVHSLAMKNGLVCIVSVANALVTMYVKCGSLEDALKTFEL  120

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
               +KN I++++M++     G++++A ++F + + +    P E T   ++ AC     + +
Sbjct  121   SGNKNSITWSAMVTGFAQFGDSDKALKLFYD-MHQSGELPSEFTLVGVINACSDACAIVE  179

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS--  1599
             GR+     + + G + +      +V +    G + +A +  + IQ P D  +W ++++  
Sbjct  180   GRQ-MHGYSLKLGYELQLYVLSALVDMYAKCGSIVDARKGFECIQQP-DVVLWTSIITGY  237

Query  1600  --------CCDIHGNYRLGGIVAKHL  1653
                       +++G  +LGG++   L
Sbjct  238   VQNGDYEGALNLYGKMQLGGVIPNDL  263



>ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa]
 gb|EEE86244.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa]
Length=778

 Score =   327 bits (839),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 193/534 (36%), Positives = 294/534 (55%), Gaps = 5/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K +H  +LK  L  +      +I FY     +  AR+LFDE   R +  WNS+I 
Sbjct  119   SVKEGKWVHGFLLKLGLGSYNAVVNSLIAFYLKIRRVDVARKLFDELSNRDVISWNSMIS  178

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y          +LFK ML  G   D  T   IL+AC++  D S  R VHG  V + +  
Sbjct  179   GYVANGFSEKGVELFKKMLYLGVDMDLATMVSILQACANCGDVSLGRAVHGSGVKACVHW  238

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
              +   + L+  Y+K G L+ AI VFD ++   +V W S+I+ +   G   +A+ LF +M 
Sbjct  239   KTTFCNTLLDMYAKCGVLDGAILVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMD  298

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             R G  PD FT   ++    C   L  GK+VH+   +    SN  V + L+ MY++C  M 
Sbjct  299   REGVSPDIFTITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSME  358

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A  +F  +   D+++W+ MI G S++    +AL  F +M ++  K D   +A +L A A
Sbjct  359   DANSVFLEMPVKDIISWNTMIGGYSKNSLPNEALSLFGDMVLE-MKPDGTTLACILPACA  417

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
              LA +  G+E HG  +R G+  +  V++AL+DMY KCG   L   +F  +P+K++I++  
Sbjct  418   SLASLDRGKEVHGHILRNGFFSDQQVANALVDMYVKCGVPVLARLLFDMIPTKDLITWTV  477

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G+HG  N A   F E + +    PDE +F ++L AC H+GL+ +G R+F +M DE
Sbjct  478   MIAGYGMHGFGNNAITTFNE-MRQAGIEPDEVSFISILYACSHSGLLDEGWRFFNVMQDE  536

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
               ++PK EHY  +V LL  +G+L  AY+ I+S+    D  IWGALLS C IH + +L   
Sbjct  537   CNVKPKLEHYACIVDLLARSGKLAMAYKFIKSMPIEPDATIWGALLSGCRIHHDVKLAEK  596

Query  1639  VAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR--VDMEAIKGKMPGKSWI  1794
             VA+H+F+ + E + Y V+++N YA   +WE VKKLR  +    +K K PG SWI
Sbjct  597   VAEHVFELEPENTGYYVLLANTYAEAEKWEEVKKLRQKIGRRGLK-KNPGCSWI  649


 Score =   191 bits (486),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/412 (29%), Positives = 211/412 (51%), Gaps = 6/412 (1%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + QLS   +++   K +H+ I  + +S      ++++  Y    D+   R +FD+     
Sbjct  9     ILQLSAELKSLQDGKKVHSFICSSGISIDSVLGSKLVFMYVTCGDLREGRLIFDKIRNEK  68

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
             +FLWN ++  Y +   F  +  LF+ MLD G   ++ T +C+L+  +        + VHG
Sbjct  69    VFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVEVNSHTVSCVLKCFAALGSVKEGKWVHG  128

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              ++  GL   +   + L++ Y K+  ++ A K+FD ++  D++ WNSMISG+   G  +K
Sbjct  129   FLLKLGLGSYNAVVNSLIAFYLKIRRVDVARKLFDELSNRDVISWNSMISGYVANGFSEK  188

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
              + LF KM  +G   D  T V ++  C +C   + +G+ VH   +K          + L+
Sbjct  189   GVELFKKMLYLGVDMDLATMVSILQACANCGD-VSLGRAVHGSGVKACVHWKTTFCNTLL  247

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              MY++C  +  A  +FD +    +VTW+++I   ++ G   +A+  F EM+ +G   D  
Sbjct  248   DMYAKCGVLDGAILVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMDREGVSPDIF  307

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
              I +VL A A    ++ G++ H +         + V +AL+DMY+KCG +     VF  M
Sbjct  308   TITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSMEDANSVFLEM  367

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEE-VLEKEYYNPDEATFSALLCAC  1401
             P K+IIS+N+MI     +   NEA  +F + VLE +   PD  T + +L AC
Sbjct  368   PVKDIISWNTMIGGYSKNSLPNEALSLFGDMVLEMK---PDGTTLACILPAC  416


 Score =   166 bits (421),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 167/305 (55%), Gaps = 1/305 (0%)
 Frame = +1

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + VH  +  SG+ +DS+  S+LV  Y   G L E   +FD I    +  WN M++G+  +
Sbjct  23    KKVHSFICSSGISIDSVLGSKLVFMYVTCGDLREGRLIFDKIRNEKVFLWNLMMNGYTKI  82

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             GD+K+++ LF +M  +G + +S T   ++ C      ++ GK VH   LK G  S   V 
Sbjct  83    GDFKESVSLFRQMLDLGVEVNSHTVSCVLKCFAALGSVKEGKWVHGFLLKLGLGSYNAVV  142

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + L++ Y + + +  A ++FD L   D+++W++MI G   +G   K ++ F++M   G  
Sbjct  143   NSLIAFYLKIRRVDVARKLFDELSNRDVISWNSMISGYVANGFSEKGVELFKKMLYLGVD  202

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
             +D   + S+L A A    V  GR  HG  V+   H + +  + L+DMY+KCG L+  I V
Sbjct  203   MDLATMVSILQACANCGDVSLGRAVHGSGVKACVHWKTTFCNTLLDMYAKCGVLDGAILV  262

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  M  + ++++ S+I+     G ++EA ++F E +++E  +PD  T + +L AC   G 
Sbjct  263   FDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHE-MDREGVSPDIFTITTVLHACACNGS  321

Query  1417  VCDGR  1431
             + +G+
Sbjct  322   LENGK  326



>ref|XP_010920594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Elaeis guineensis]
Length=977

 Score =   332 bits (850),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 186/532 (35%), Positives = 303/532 (57%), Gaps = 9/532 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             + +H + +K+ L      +  +I  YA    ++ ARRLF     R++  WN++I   AR 
Sbjct  321   RAVHGLSVKSELVPELRVSNALIDMYAKCCCLLEARRLFSRMLGRNVVSWNAMIGGCARN  380

Query  394   HRFSNAFQLFKDM-LDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                   F L ++M ++ G + +  +    L AC    +   ++ +HG V+ + L+ + + 
Sbjct  381   GDVDGTFDLLREMSMEDGVKANEVSVLSALPACLGPAELPNVKELHGYVIRNKLQTNDLV  440

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
             S+ L++AYSK G LE A  VFDG+    +  WN++I G+   GD  KA+ LF++M  +G 
Sbjct  441   SNALIAAYSKCGSLESAGHVFDGMEMKTVSSWNALIGGYAQNGDPSKAVDLFLQMTSLGI  500

Query  751   KPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
             +PD F+   L++ C     LL  G+++H   L+ G + ++ +   L+S+Y +C    ++ 
Sbjct  501   EPDWFSIGSLLLACAHLKDLLN-GRSIHGFVLRNGLEKDSFIKISLLSLYIQCGETSASR  559

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA--SVLSAAAQ  1101
              +FD++ E D V+W+AMI G SQ+G    +L  FR +     + +P +IA  S   A A+
Sbjct  560   ALFDAMEEKDSVSWNAMIAGYSQNGLPDDSLKLFRRLLRD--RYEPSMIAMTSAFMACAE  617

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
             L+ ++ GRE HGFA++  +  +  V S++IDMY+KCG +      F  + +K+ +S+  M
Sbjct  618   LSALRLGREAHGFALKANFCEDAFVGSSIIDMYAKCGSMEQACSFFNNLKNKDGVSWTVM  677

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             I+  G++G   EA  +F+E+L +E  NPD  T+  +L AC H GLV +G RYF  M D+ 
Sbjct  678   ITGYGINGFGREAINLFDEML-REGLNPDAFTYVGILLACSHAGLVEEGLRYFEEMKDKH  736

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIV  1641
             G++PK EHY  +  +LG AG L EA  L++ +    D  IWGALL  C IHGN  LGG V
Sbjct  737   GVEPKLEHYACVTDMLGRAGRLAEAARLVEEMPVEPDGRIWGALLGACRIHGNVSLGGKV  796

Query  1642  AKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             A  L + + +++ + V+ SN+YA  GRW+  +++R  M+     K PG SWI
Sbjct  797   ADKLLELEPDRAEHYVLASNLYASMGRWDDARRMRKRMKEFGLHKDPGCSWI  848


 Score =   224 bits (572),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 146/486 (30%), Positives = 247/486 (51%), Gaps = 13/486 (3%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETP  342
             S L Q   SN  +   + +H +I  +  L  +    TR++  Y++      +R +F+   
Sbjct  98    STLLQACSSNGELDVGQRVHELISSSKELMSNAVVTTRLLTMYSMCGSPSDSRHVFEGLE  157

Query  343   QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS-GTRPDNFTFACILRACSDKFDFSGLR  519
             QR++F WN++I  YAR   +  A  LF  ++ +   +PDNFT  C+L++C    D    R
Sbjct  158   QRNLFQWNAMISGYARNELWDEAIDLFHRLMSTTDIKPDNFTLPCVLKSCGALLDVERGR  217

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VHG  +  GL  D+  S+ L+S Y K G +++A +VF+ +   +LV WN+M+ G    G
Sbjct  218   TVHGITLKLGLGADTFISNSLISMYGKCGFIDDAAQVFETMPARNLVSWNTMLCGLSDNG  277

Query  700   DWKKALLLFIKMQRMGE---KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
               ++   LF +M  +GE   +PD  T V ++        L IG+ VH L +K        
Sbjct  278   LPEEGFDLFREMMSVGEESMRPDEATVVTVLPMSAGKGWLEIGRAVHGLSVKSELVPELR  337

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
             V + L+ MY++C C+  A R+F  +L  ++V+W+AMI G +++GD+    D  REM+M+ 
Sbjct  338   VSNALIDMYAKCCCLLEARRLFSRMLGRNVVSWNAMIGGCARNGDVDGTFDLLREMSMED  397

Query  1051  G-KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G K + + + S L A    A +   +E HG+ +R        VS+ALI  YSKCG L   
Sbjct  398   GVKANEVSVLSALPACLGPAELPNVKELHGYVIRNKLQTNDLVSNALIAAYSKCGSLESA  457

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF  M  K + S+N++I     +G+ ++A  +F + +      PD  +  +LL AC H
Sbjct  458   GHVFDGMEMKTVSSWNALIGGYAQNGDPSKAVDLFLQ-MTSLGIEPDWFSIGSLLLACAH  516

Query  1408  TGLVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI  1581
                + +GR    F + N   G++  +   + ++ L    GE   +  L  +++   D   
Sbjct  517   LKDLLNGRSIHGFVLRN---GLEKDSFIKISLLSLYIQCGETSASRALFDAME-EKDSVS  572

Query  1582  WGALLS  1599
             W A+++
Sbjct  573   WNAMIA  578


 Score =   173 bits (439),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 119/431 (28%), Positives = 198/431 (46%), Gaps = 17/431 (4%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   K LH  +++  L  +   +  +I  Y+    + SA  +FD    +++  WN++I  
Sbjct  419   LPNVKELHGYVIRNKLQTNDLVSNALIAAYSKCGSLESAGHVFDGMEMKTVSSWNALIGG  478

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             YA+    S A  LF  M   G  PD F+   +L AC+   D    R +HG V+ +GLE D
Sbjct  479   YAQNGDPSKAVDLFLQMTSLGIEPDWFSIGSLLLACAHLKDLLNGRSIHGFVLRNGLEKD  538

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
             S     L+S Y + G    +  +FD + E D V WN+MI+G+   G    +L LF ++ R
Sbjct  539   SFIKISLLSLYIQCGETSASRALFDAMEEKDSVSWNAMIAGYSQNGLPDDSLKLFRRLLR  598

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
                +P         M     S LR+G+  H   LK  F  +A VGS ++ MY++C  M  
Sbjct  599   DRYEPSMIAMTSAFMACAELSALRLGREAHGFALKANFCEDAFVGSSIIDMYAKCGSMEQ  658

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             AC  F++L   D V+W+ MI G   +G   +A++ F EM  +G   D      +L A + 
Sbjct  659   ACSFFNNLKNKDGVSWTVMITGYGINGFGREAINLFDEMLREGLNPDAFTYVGILLACSH  718

Query  1102  LAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SK  1257
               +V+ G       ++ HG   +  ++      + + DM  + G L    ++ + MP   
Sbjct  719   AGLVEEGLRYFEEMKDKHGVEPKLEHY------ACVTDMLGRAGRLAEAARLVEEMPVEP  772

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +   + +++    +HGN +   ++ +++LE E   PD A    L      +    D  R 
Sbjct  773   DGRIWGALLGACRIHGNVSLGGKVADKLLELE---PDRAEHYVLASNLYASMGRWDDARR  829

Query  1438  FRIMNDEFGIQ  1470
              R    EFG+ 
Sbjct  830   MRKRMKEFGLH  840



>ref|XP_009779214.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Nicotiana sylvestris]
Length=614

 Score =   323 bits (827),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 182/554 (33%), Positives = 300/554 (54%), Gaps = 7/554 (1%)
 Frame = +1

Query  139   LHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFY-ALNEDIVS  315
             ++Q F+ F  LL     S  +++  K LH + L T    +    T+ +    +L+  +  
Sbjct  29    VNQSFLPFSYLLN----SCHSLAALKRLHVLALTTGYLANLQVCTKFVSLACSLSSTMDY  84

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSD  495
             AR+LFDE PQR +F WN++IR Y+       A  L+KDM   G  PDN+TF  +LR+CS 
Sbjct  85    ARKLFDEMPQRDVFAWNTVIRGYSNLGPCQEAIILYKDMHLQGFVPDNYTFPFVLRSCSV  144

Query  496   KFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSM  675
             +      R VH  ++  G E D    S L++ Y++ G   ++  VFD +   ++V W +M
Sbjct  145   QSALREGREVHCNIIKHGFESDVFVQSCLITLYAQSGETLDSELVFDQMRVRNIVSWTAM  204

Query  676   ISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGF  855
             I+G+   G  +K L  F+KM   G  P++ T V ++        L +G  +H   +K G 
Sbjct  205   IAGYVQNGIPEKGLGHFLKMVNSGTLPNAITLVSVLPACARLESLDMGMLIHGYSIKLGV  264

Query  856   DSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFRE  1035
             + +  + + L++ Y +C  +  A  +FD + E  +V+W+ +I    Q+      ++ F+ 
Sbjct  265   EKDVSLVNALIAFYGKCGLVDVARSLFDQMKEHSLVSWNTIIAAYEQNDAGSATINLFQR  324

Query  1036  MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
             M  +G + D + + +V+SA A+L  +  G+  H           V++++ALIDMY+KCG 
Sbjct  325   MLNEGVEFDYITLVTVISACARLGALGTGKWVHELVKSKCLECNVAITNALIDMYAKCGS  384

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLC  1395
             + L   VF  +P ++++S+ S+I     HG+  +A + F   +++E   P+  TF+A+L 
Sbjct  385   IELARDVFDRLPYRSVVSWTSIIGACASHGHGKDALEFFSR-MKEEGIQPNSFTFTAVLT  443

Query  1396  ACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDF  1575
             AC H+GLV +GR +F  M  E+ I P  E    MV LLG AG+L EAYE ++++    D 
Sbjct  444   ACRHSGLVEEGRNHFESMTTEYSIMPGVEQCACMVDLLGRAGQLLEAYEFVENMPIEPDA  503

Query  1576  GIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM  1755
              +WGALL  C IHGN  L   VA  L D   +   + +++ N+YA  GRWE V +L+  +
Sbjct  504   DVWGALLGACKIHGNLELAESVADRLLDLNPQTVPFYILMKNIYAEAGRWEEVARLKFLL  563

Query  1756  EAIKG-KMPGKSWI  1794
             E ++  K+PGKS +
Sbjct  564   EEVEAEKIPGKSSV  577



>ref|XP_010657333.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Vitis vinifera]
Length=723

 Score =   326 bits (835),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 194/546 (36%), Positives = 301/546 (55%), Gaps = 8/546 (1%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHA-IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L Q   + ++    + LHA +I  + L ++ +  T++  FYA    +  A  +FD    +
Sbjct  52    LLQSFTNTKSFKQGQQLHAHMISFSILENNTYLNTKLAAFYAGCGLMSQAEVIFDGIVLK  111

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             + FLWN +IR YA       +  L+++ML  G R DNFT+  +L+AC D       R VH
Sbjct  112   NSFLWNFMIRGYASNGLPMKSLVLYREMLCFGQRADNFTYPFVLKACGDLLLVEIGRRVH  171

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               VVV GLE D    + L++ Y+K G +  A  VFD +AE DL  WN+MISG+    D  
Sbjct  172   SEVVVCGLESDIYVGNSLLAMYAKFGDMGTARMVFDRMAERDLTSWNTMISGYAKNADSG  231

Query  709   KALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGF-DSNAHVGSL  882
              A L+F  M + G   D  T +GL+  C D  ++ + GK +H   ++    + N    + 
Sbjct  232   TAFLVFDLMGKAGLFADCTTLLGLLSACADLKAV-KEGKVIHGYAVRNSIGNYNKFFTNS  290

Query  883   LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVD  1062
             L+ MY  C CM  A R+F+ +   D V+W++MI G +++GD  ++L  FR M + G   D
Sbjct  291   LIEMYCNCNCMVDARRLFERVRWKDTVSWNSMILGYARNGDAFESLRLFRRMALDGSGPD  350

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
              +   +VL A  Q+A ++ G   H + V+ G+     V +AL+DMYSKCG L    +VF 
Sbjct  351   QVTFIAVLGACDQIAALRYGMSIHSYLVKKGFDANTIVGTALVDMYSKCGSLACSRRVFD  410

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              MP K+++S+++M++  GLHG   EA  I +  ++     PD   F+++L AC H GLV 
Sbjct  411   EMPDKSLVSWSAMVAGYGLHGRGREAISILDG-MKANSVIPDNGVFTSILSACSHAGLVV  469

Query  1423  DGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSC  1602
             +G+  F  M  E+ ++P   HY  MV LLG AG L+EAY +I++++      IW ALL+ 
Sbjct  470   EGKEIFYKMEKEYNVKPALSHYSCMVDLLGRAGHLDEAYVIIRTMEIKPTSDIWAALLTA  529

Query  1603  CDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KM  1776
               +H N +L  I A+ +FD   +  S  + +SN+YA + RW+ V+++R  M   KG  K 
Sbjct  530   SRLHKNIKLAEISAQKVFDMNPKVVSSYICLSNIYAAEKRWDDVERVRA-MVRRKGLKKS  588

Query  1777  PGKSWI  1794
             PG S+I
Sbjct  589   PGCSFI  594



>ref|XP_006369200.1| hypothetical protein POPTR_0001s18710g [Populus trichocarpa]
 gb|ERP65769.1| hypothetical protein POPTR_0001s18710g [Populus trichocarpa]
Length=572

 Score =   322 bits (824),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 192/556 (35%), Positives = 306/556 (55%), Gaps = 18/556 (3%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTIS--TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             FR+LL    R N   S    K LHA ILK   S  P + +R+I  Y+    +  +  LF+
Sbjct  7     FRTLL---DRPNIISSKYQAKQLHAQILKLEPSS-PIHLSRLISIYSNFNLLHESLLLFN  62

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
                   +  + SIIR Y        +  LF  M  SG +PD+  F  +L++C+   D   
Sbjct  63    ALHSPPVLAYKSIIRCYVANGLLVQSVALFLQMRASGKKPDHHVFPSLLKSCALLSDLKL  122

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKL------GPLEEAIK-VFDGIAEPDLVQWNS  672
                +HG ++  G++ D    + L++ Y K       G + +++K VF+ + + D+V WN+
Sbjct  123   GESIHGCIIRLGMDFDLYTCNALMNMYGKFQKVDRRGSIMDSVKKVFEKMLKRDVVSWNT  182

Query  673   MISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFG  852
             +I+G+   G +++AL+L  +M+    KPDSFT   ++        L  GK +H   ++ G
Sbjct  183   VIAGNAENGKYEEALMLVREMRNDNLKPDSFTLSSVLPIFAEYVDLHKGKEIHGYAMRHG  242

Query  853   FDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFR  1032
             FD++  +GS LV MY++C  +  A ++F+ L + D ++W+++I G  Q+G   + L FF 
Sbjct  243   FDNDVFIGSSLVGMYAKCARVEDALQVFNILPQRDSISWNSIIAGCVQNGLFDEGLRFFH  302

Query  1033  EMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCG  1212
             +M     K  P+  +S++ A A L  +  G++ HGF +R GY   + VSS+L+DMY+KCG
Sbjct  303   QMLKAKVKPVPVSFSSIMPACANLIALHLGKQLHGFIIRVGYDDNMFVSSSLVDMYAKCG  362

Query  1213  FLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             ++ +   +F  M   +++S+ ++I    LHG A  A  +FE+ +E E   P+   F A+L
Sbjct  363   YIKVARWIFDRMDVHDMVSWTAIIMGYALHGQACHAVSLFEQ-MEMEGVRPNYVAFVAVL  421

Query  1393  CACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVD  1572
              AC H G++ +  RYF  M   +GI P  EHY  M  LLG AG+L+EA+ELI S+  PV+
Sbjct  422   TACSHAGMMNEAWRYFNSMTQNYGIVPGLEHYACMADLLGRAGKLDEAFELISSMHRPVE  481

Query  1573  FGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVD  1752
              GIW +LLS C +H N  L   VA+ +F+   E +   +++SN YA   RW+ V KL+  
Sbjct  482   -GIWLSLLSACRVHKNVDLAEKVAEKIFEVDPENTGAYILLSNTYAAGQRWKDVAKLQYL  540

Query  1753  M--EAIKGKMPGKSWI  1794
             M  + IK K P  SWI
Sbjct  541   MRNKGIK-KSPAFSWI  555



>ref|XP_003629790.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET04266.1| PPR containing plant protein [Medicago truncatula]
Length=908

 Score =   330 bits (846),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 194/532 (36%), Positives = 294/532 (55%), Gaps = 3/532 (1%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   K +H  +LK     +      +I  Y     + SA  LFDE  +  +  WNS+I  
Sbjct  211   VKECKRVHGYVLKLGFGSNTAVVNSLIAAYFKFGGVESAHNLFDELSEPDVVSWNSMING  270

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
                     N  ++F  ML  G   D  T   +L AC++  + S  R +HG  V +    +
Sbjct  271   CVVNGFSGNGLEIFIQMLILGVEVDLTTLVSVLVACANIGNLSLGRALHGFGVKACFSEE  330

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
              + S+ L+  YSK G L  A +VF  + +  +V W S+I+ +   G +  A+ LF +MQ 
Sbjct  331   VVFSNTLLDMYSKCGNLNGATEVFVKMGDTTIVSWTSIIAAYVREGLYSDAIGLFDEMQS  390

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              G +PD +T   ++    C S L  G++VHS  +K G  SN  V + L++MY++C  +  
Sbjct  391   KGVRPDIYTVTSIVHACACSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYAKCGSVEE  450

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F  +   D+V+W+ MI G SQ+    +AL+ F +M  K  K D + +A VL A A 
Sbjct  451   ARLVFSKIPVKDIVSWNTMIGGYSQNLLPNEALELFLDMQ-KQFKPDDITMACVLPACAG  509

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
             LA +  GRE HG  +R GY  ++ V+ AL+DMY+KCG L L   +F  +P K++IS+  M
Sbjct  510   LAALDKGREIHGHILRRGYFSDLHVACALVDMYAKCGLLVLAQLLFDMIPKKDLISWTVM  569

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             I+  G+HG  NEA   F E +      PDE++FSA+L AC H+GL+ +G ++F  M +E 
Sbjct  570   IAGYGMHGFGNEAISTFNE-MRIAGIEPDESSFSAILNACSHSGLLNEGWKFFNSMRNEC  628

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIV  1641
             G++PK EHY  +V LL   G L +AY+ I+S+    D  IWG LLS C IH + +L   V
Sbjct  629   GVEPKLEHYACVVDLLARMGNLSKAYKFIESMPIKPDTTIWGVLLSGCRIHHDVKLAEKV  688

Query  1642  AKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKM-PGKSWI  1794
             A+H+F+ + + + Y V+++N+YA   +WE VKKLR  M+    K  PG SWI
Sbjct  689   AEHIFELEPDNTRYYVVLANVYAEAEKWEEVKKLRKRMQKRGFKQNPGCSWI  740


 Score =   213 bits (542),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/419 (29%), Positives = 217/419 (52%), Gaps = 2/419 (0%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIF  357
             QL    +++   K +H++I+   +S       +++  Y    D+V  R++FD+     +F
Sbjct  102   QLCAEKKSLEDGKRVHSVIISNGISVDEALGAKLVFMYVNCGDLVQGRKIFDKIMNDKVF  161

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGV  537
             LWN ++  YA+   F  +  LFK M   G   + +TF C+L+  +        + VHG V
Sbjct  162   LWNLLMSEYAKIGNFRESVSLFKKMQKLGVVGNCYTFTCVLKCFAALGKVKECKRVHGYV  221

Query  538   VVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL  717
             +  G   ++   + L++AY K G +E A  +FD ++EPD+V WNSMI+G    G     L
Sbjct  222   LKLGFGSNTAVVNSLIAAYFKFGGVESAHNLFDELSEPDVVSWNSMINGCVVNGFSGNGL  281

Query  718   LLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
              +FI+M  +G + D  T V +++       L +G+ +H   +K  F       + L+ MY
Sbjct  282   EIFIQMLILGVEVDLTTLVSVLVACANIGNLSLGRALHGFGVKACFSEEVVFSNTLLDMY  341

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
             S+C  +  A  +F  + +  +V+W+++I    + G    A+  F EM  KG + D   + 
Sbjct  342   SKCGNLNGATEVFVKMGDTTIVSWTSIIAAYVREGLYSDAIGLFDEMQSKGVRPDIYTVT  401

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             S++ A A  + +  GR+ H + ++ G    + V++ALI+MY+KCG +     VF  +P K
Sbjct  402   SIVHACACSSSLDKGRDVHSYVIKNGMGSNLPVTNALINMYAKCGSVEEARLVFSKIPVK  461

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             +I+S+N+MI     +   NEA ++F ++  ++ + PD+ T + +L AC     +  GR 
Sbjct  462   DIVSWNTMIGGYSQNLLPNEALELFLDM--QKQFKPDDITMACVLPACAGLAALDKGRE  518


 Score =   180 bits (456),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 129/457 (28%), Positives = 221/457 (48%), Gaps = 21/457 (5%)
 Frame = +1

Query  250   SHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKD  429
             SH+ F   +  R   L    V     F  T        N+ I  +       NA +L   
Sbjct  27    SHNRFIFFKQPRRTCLLHSTVCVSPSFTNTTHSVTQNQNAKINKFCEMGDLRNAIELL--  84

Query  430   MLDSGTRPDNF-----TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAY  594
                  T+  ++     ++  +L+ C++K      + VH  ++ +G+ +D    ++LV  Y
Sbjct  85    -----TKSKSYELGLNSYCSVLQLCAEKKSLEDGKRVHSVIISNGISVDEALGAKLVFMY  139

Query  595   SKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYV  774
                G L +  K+FD I    +  WN ++S +  +G++++++ LF KMQ++G   + +T+ 
Sbjct  140   VNCGDLVQGRKIFDKIMNDKVFLWNLLMSEYAKIGNFRESVSLFKKMQKLGVVGNCYTFT  199

Query  775   GLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEP  954
              ++ C      ++  K VH   LK GF SN  V + L++ Y +   + SA  +FD L EP
Sbjct  200   CVLKCFAALGKVKECKRVHGYVLKLGFGSNTAVVNSLIAAYFKFGGVESAHNLFDELSEP  259

Query  955   DMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETH  1134
             D+V+W++MI G   +G     L+ F +M + G +VD   + SVL A A +  +  GR  H
Sbjct  260   DVVSWNSMINGCVVNGFSGNGLEIFIQMLILGVEVDLTTLVSVLVACANIGNLSLGRALH  319

Query  1135  GFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNAN  1314
             GF V+  +  EV  S+ L+DMYSKCG LN   +VF  M    I+S+ S+I+     G  +
Sbjct  320   GFGVKACFSEEVVFSNTLLDMYSKCGNLNGATEVFVKMGDTTIVSWTSIIAAYVREGLYS  379

Query  1315  EAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR--RYFRIMNDEFGIQPKTEHY  1488
             +A  +F+E ++ +   PD  T ++++ AC  +  +  GR    + I N      P T   
Sbjct  380   DAIGLFDE-MQSKGVRPDIYTVTSIVHACACSSSLDKGRDVHSYVIKNGMGSNLPVTN--  436

Query  1489  VYMVKLLGMAGELEEAYELIQSIQGPV-DFGIWGALL  1596
               ++ +    G +EEA  +   I  PV D   W  ++
Sbjct  437   -ALINMYAKCGSVEEARLVFSKI--PVKDIVSWNTMI  470



>ref|XP_002268853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Vitis vinifera]
 ref|XP_010655782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Vitis vinifera]
Length=853

 Score =   329 bits (843),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 188/526 (36%), Positives = 286/526 (54%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +++ + L      A  ++  YA    +  ARRLFD  P+  +  WN +I  Y +   
Sbjct  270   LHGLVVSSGLEMDSPVANTLLAMYAKCGHLFDARRLFDMMPKTDLVTWNGMISGYVQNGF  329

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A  LF +M+ +  +PD+ TF+  L   S+       + +H  ++ +G+ LD    S 
Sbjct  330   MDEASCLFHEMISARMKPDSITFSSFLPLLSEGATLRQGKEIHCYIIRNGVSLDVFLKSA  389

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A K+FD     D+V   +MISG+   G    AL +F  + +   + +
Sbjct  390   LIDIYFKCRDVEMARKIFDQRTPVDIVVCTAMISGYVLNGMNNNALEIFRWLLQERMRAN  449

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             S T   ++      + L +GK +H   LK G   + +VGS ++ MY++C  +  A + F 
Sbjct  450   SVTLASVLPACAGLAALTLGKELHGHILKNGHGGSCYVGSAIMDMYAKCGRLDLAHQTFI  509

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + + D V W++MI   SQ+G   +A+D FR+M M G K D + I++ LSA A L  +  
Sbjct  510   GISDKDAVCWNSMITSCSQNGKPEEAIDLFRQMGMAGTKYDCVSISAALSACANLPALHY  569

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E H F +R  +  ++   SALIDMYSKCG L+L  +VF  M  KN +S+NS+I+  G 
Sbjct  570   GKEIHAFMMRGAFRSDLFAESALIDMYSKCGNLDLACRVFDTMEEKNEVSWNSIIAAYGN  629

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   ++  +F  +L  +   PD  TF A++ AC H G V +G  YFR M +E GI  + 
Sbjct  630   HGRLKDSLNLFHGML-GDGIQPDHVTFLAIISACGHAGQVDEGIHYFRCMTEELGIMARM  688

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV L G AG L EA+ +I S+    D G+WG LL  C +HGN  L  + +++LFD
Sbjct  689   EHYACMVDLFGRAGRLNEAFGMINSMPFSPDAGVWGTLLGACRLHGNVELAEVASRNLFD  748

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                + S Y V++SN++A  G+WE V K+R  M E    K+PG SWI
Sbjct  749   LDPQNSGYYVLLSNVHANAGQWESVLKIRSLMKERGVQKVPGCSWI  794


 Score =   222 bits (566),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/405 (33%), Positives = 220/405 (54%), Gaps = 3/405 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
              +++  +++H  I         F  + +I+FY+ N  I  AR LFD  P +   LWN ++
Sbjct  161   NSVALGRVVHDKIQFMGFELDVFVGSSLIKFYSENGCIHDARYLFDRMPSKDGVLWNVML  220

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               Y +   + NA  +F +M  + T P++ TFAC+L  C+ +   +    +HG VV SGLE
Sbjct  221   NGYVKNGDWDNATGVFMEMRRTETNPNSVTFACVLSVCASEIMINFGSQLHGLVVSSGLE  280

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             +DS  ++ L++ Y+K G L +A ++FD + + DLV WN MISG+   G   +A  LF +M
Sbjct  281   MDSPVANTLLAMYAKCGHLFDARRLFDMMPKTDLVTWNGMISGYVQNGFMDEASCLFHEM  340

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                  KPDS T+   +  L   + LR GK +H   ++ G   +  + S L+ +Y +C+ +
Sbjct  341   ISARMKPDSITFSSFLPLLSEGATLRQGKEIHCYIIRNGVSLDVFLKSALIDIYFKCRDV  400

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A +IFD     D+V  +AMI G   +G    AL+ FR +  +  + + + +ASVL A 
Sbjct  401   EMARKIFDQRTPVDIVVCTAMISGYVLNGMNNNALEIFRWLLQERMRANSVTLASVLPAC  460

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A LA +  G+E HG  ++ G+     V SA++DMY+KCG L+L  Q F  +  K+ + +N
Sbjct  461   AGLAALTLGKELHGHILKNGHGGSCYVGSAIMDMYAKCGRLDLAHQTFIGISDKDAVCWN  520

Query  1276  SMISNLGLHGNANEAFQIFEEV-LEKEYYNPDEATFSALLCACCH  1407
             SMI++   +G   EA  +F ++ +    Y  D  + SA L AC +
Sbjct  521   SMITSCSQNGKPEEAIDLFRQMGMAGTKY--DCVSISAALSACAN  563


 Score =   204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 139/493 (28%), Positives = 243/493 (49%), Gaps = 15/493 (3%)
 Frame = +1

Query  166   SLLTQLSRSNQT------ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRL  327
             SL  QL    QT      +S  +  HA +L   + ++    T+++  Y L    + A+ +
Sbjct  44    SLAPQLVSILQTCTDPSGLSQGRQAHAQMLVNGIGYNGILGTKLLGMYVLCGAFLDAKNI  103

Query  328   FDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF  507
             F +        WN +IR +    +F  A   +  ML  GT PD +TF  +++AC      
Sbjct  104   FYQLRLWCSEPWNWMIRGFTMMGQFDFALLFYFKMLGCGTLPDKYTFPYVIKACGGLNSV  163

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
             +  RVVH  +   G ELD    S L+  YS+ G + +A  +FD +   D V WN M++G+
Sbjct  164   ALGRVVHDKIQFMGFELDVFVGSSLIKFYSENGCIHDARYLFDRMPSKDGVLWNVMLNGY  223

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                GDW  A  +F++M+R    P+S T+  ++       ++  G  +H L +  G + ++
Sbjct  224   VKNGDWDNATGVFMEMRRTETNPNSVTFACVLSVCASEIMINFGSQLHGLVVSSGLEMDS  283

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
              V + L++MY++C  +  A R+FD + + D+VTW+ MI G  Q+G + +A   F EM   
Sbjct  284   PVANTLLAMYAKCGHLFDARRLFDMMPKTDLVTWNGMISGYVQNGFMDEASCLFHEMISA  343

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               K D +  +S L   ++ A ++ G+E H + +R G  L+V + SALID+Y KC  + + 
Sbjct  344   RMKPDSITFSSFLPLLSEGATLRQGKEIHCYIIRNGVSLDVFLKSALIDIYFKCRDVEMA  403

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
              ++F      +I+   +MIS   L+G  N A +IF  +L+ E    +  T +++L AC  
Sbjct  404   RKIFDQRTPVDIVVCTAMISGYVLNGMNNNALEIFRWLLQ-ERMRANSVTLASVLPACAG  462

Query  1408  TGLVCDGRR-YFRIMNDEFGIQPKTEHYV--YMVKLLGMAGELEEAYELIQSIQGPVDFG  1578
                +  G+  +  I+ +  G       YV   ++ +    G L+ A++    I    D  
Sbjct  463   LAALTLGKELHGHILKNGHG----GSCYVGSAIMDMYAKCGRLDLAHQTFIGISDK-DAV  517

Query  1579  IWGALLSCCDIHG  1617
              W ++++ C  +G
Sbjct  518   CWNSMITSCSQNG  530


 Score =   155 bits (392),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 115/422 (27%), Positives = 202/422 (48%), Gaps = 20/422 (5%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F S L  LS    T+   K +H  I++  +S   F  + +I  Y    D+  AR++FD
Sbjct  350   ITFSSFLPLLSEG-ATLRQGKEIHCYIIRNGVSLDVFLKSALIDIYFKCRDVEMARKIFD  408

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             +     I +  ++I  Y      +NA ++F+ +L    R ++ T A +L AC+     + 
Sbjct  409   QRTPVDIVVCTAMISGYVLNGMNNNALEIFRWLLQERMRANSVTLASVLPACAGLAALTL  468

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
              + +HG ++ +G        S ++  Y+K G L+ A + F GI++ D V WNSMI+    
Sbjct  469   GKELHGHILKNGHGGSCYVGSAIMDMYAKCGRLDLAHQTFIGISDKDAVCWNSMITSCSQ  528

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              G  ++A+ LF +M   G K D  +    L  C + P+ L  GK +H+  ++  F S+  
Sbjct  529   NGKPEEAIDLFRQMGMAGTKYDCVSISAALSACANLPA-LHYGKEIHAFMMRGAFRSDLF  587

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
               S L+ MYS+C  +  ACR+FD++ E + V+W+++I      G +  +L+ F  M   G
Sbjct  588   AESALIDMYSKCGNLDLACRVFDTMEEKNEVSWNSIIAAYGNHGRLKDSLNLFHGMLGDG  647

Query  1051  GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRC-----GYHLEVSVSSALIDMYSKCGF  1215
              + D +   +++SA      V  G   H F  RC     G    +   + ++D++ + G 
Sbjct  648   IQPDHVTFLAIISACGHAGQVDEG--IHYF--RCMTEELGIMARMEHYACMVDLFGRAGR  703

Query  1216  LNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY--NPDEATFSA  1386
             LN    +  +MP S +   + +++    LHGN   A     EV  +  +  +P  + +  
Sbjct  704   LNEAFGMINSMPFSPDAGVWGTLLGACRLHGNVELA-----EVASRNLFDLDPQNSGYYV  758

Query  1387  LL  1392
             LL
Sbjct  759   LL  760



>ref|XP_008225340.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Prunus mume]
Length=878

 Score =   329 bits (844),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 190/527 (36%), Positives = 288/527 (55%), Gaps = 5/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  + K            ++ FY  N  I SAR++FDE   R +  WNS+I AY     
Sbjct  226   VHGYLYKLGFGSDNTVGNSLMAFYFKNRRIESARKVFDELSDRDVISWNSMISAYVSNGL  285

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                   +F+ ML  G   D  T   +L ACSD  + S  R +H   + + L++D I  + 
Sbjct  286   ADKGVDIFRQMLSLGIDVDLATIINVLMACSDGGNLSLGRALHSYAIKTCLDMDIIFYNN  345

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  YSK G L  A +VF  + +  +V W SMI+G+   G   +A+ LF +M+R G  PD
Sbjct  346   VLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNGVSPD  405

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              +T   ++    C   L+ G+++H    + G DS   V + L+ MY++C  M  A  +F 
Sbjct  406   VYTITSILHACACNGSLKKGRDIHKYIREHGMDSGLFVCNTLMDMYAKCGSMEDAHSVFS  465

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
             ++   D+V+W+ MI G S++    +AL  F EM  K  K D + IASVL A A LA +  
Sbjct  466   NMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQQK-SKPDGMTIASVLPACASLAALNR  524

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  +R GY  +  V++AL+DMY KCG L L   +F  +P K++IS+  +++  G+
Sbjct  525   GQEIHGHILRNGYFSDRYVANALVDMYVKCGVLVLARLLFDIIPMKDLISWTVIVAGYGM  584

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   EA   F E + K    PD  +F ++L AC H+GL+ +  R+F  M +++ I PK 
Sbjct  585   HGLGREAITAFNE-MRKSGIKPDSISFISILYACSHSGLLDEAWRFFDSMRNDYSIVPKL  643

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LL   G L +AY+ I  +    D  IWG+LL  C IH + +L   VA+ +F+
Sbjct  644   EHYACMVDLLARTGNLTKAYKFINKMPIEPDATIWGSLLCGCRIHHDVKLAEKVAERVFE  703

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKL--RVDMEAIKGKMPGKSWI  1794
              + E + Y V+++N+YA   +WE VKKL  R+  + +K K PG SWI
Sbjct  704   LEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRQGLK-KNPGCSWI  749


 Score =   196 bits (497),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/402 (30%), Positives = 205/402 (51%), Gaps = 2/402 (0%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K +H++I             +++  +    D+  AR +FD+     IFLWN +I
Sbjct  117   KSLQDGKRVHSVICSNGAEVDGPLGAKLVFMFVKCGDLREARLIFDKLSNGKIFLWNLMI  176

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               YA+   F     LF+ M +   + +++TF+CIL+  S          VHG +   G  
Sbjct  177   NEYAKVRNFREGIHLFRKMQELDIQANSYTFSCILKCFSSLGYVREGEWVHGYLYKLGFG  236

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              D+   + L++ Y K   +E A KVFD +++ D++ WNSMIS +   G   K + +F +M
Sbjct  237   SDNTVGNSLMAFYFKNRRIESARKVFDELSDRDVISWNSMISAYVSNGLADKGVDIFRQM  296

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
               +G   D  T + ++M       L +G+ +HS  +K   D +    + ++ MYS+C  +
Sbjct  297   LSLGIDVDLATIINVLMACSDGGNLSLGRALHSYAIKTCLDMDIIFYNNVLDMYSKCGDL  356

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
              SA ++F  + +  +V+W++MI G  + G   +A++ F EM   G   D   I S+L A 
Sbjct  357   SSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNGVSPDVYTITSILHAC  416

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A    ++ GR+ H +    G    + V + L+DMY+KCG +     VF  MP K+I+S+N
Sbjct  417   ACNGSLKKGRDIHKYIREHGMDSGLFVCNTLMDMYAKCGSMEDAHSVFSNMPVKDIVSWN  476

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             +MI     +   NEA ++F E+ +K    PD  T +++L AC
Sbjct  477   TMIGGYSKNCLPNEALKLFSEMQQKS--KPDGMTIASVLPAC  516


 Score =   172 bits (437),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 115/418 (28%), Positives = 211/418 (50%), Gaps = 19/418 (5%)
 Frame = +1

Query  364   NSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFT---FACILRACSDKFDFSGLRVVHGG  534
             N+ I  Y       NA +L       G++        +  +L  C+        + VH  
Sbjct  74    NAKISKYCEMGNLKNAVELV-----CGSKKSELDLEGYCSVLELCAGLKSLQDGKRVHSV  128

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             +  +G E+D    ++LV  + K G L EA  +FD ++   +  WN MI+ +  + ++++ 
Sbjct  129   ICSNGAEVDGPLGAKLVFMFVKCGDLREARLIFDKLSNGKIFLWNLMINEYAKVRNFREG  188

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSM  894
             + LF KMQ +  + +S+T+  ++ C      +R G+ VH    K GF S+  VG+ L++ 
Sbjct  189   IHLFRKMQELDIQANSYTFSCILKCFSSLGYVREGEWVHGYLYKLGFGSDNTVGNSLMAF  248

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y + + + SA ++FD L + D+++W++MI     +G   K +D FR+M   G  VD   I
Sbjct  249   YFKNRRIESARKVFDELSDRDVISWNSMISAYVSNGLADKGVDIFRQMLSLGIDVDLATI  308

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS  1254
              +VL A +    +  GR  H +A++    +++   + ++DMYSKCG L+   QVF  M  
Sbjct  309   INVLMACSDGGNLSLGRALHSYAIKTCLDMDIIFYNNVLDMYSKCGDLSSATQVFGKMGQ  368

Query  1255  KNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR-  1431
             ++++S+ SMI+     G ++EA ++F E +E+   +PD  T +++L AC   G +  GR 
Sbjct  369   RSVVSWTSMIAGYVREGLSDEAIELFSE-MERNGVSPDVYTITSILHACACNGSLKKGRD  427

Query  1432  --RYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPV-DFGIWGALL  1596
               +Y R    E G+         ++ +    G +E+A+ +  ++  PV D   W  ++
Sbjct  428   IHKYIR----EHGMDSGLFVCNTLMDMYAKCGSMEDAHSVFSNM--PVKDIVSWNTMI  479


 Score =   154 bits (389),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 109/405 (27%), Positives = 194/405 (48%), Gaps = 16/405 (4%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
              +S  + LH+  +KT L     +   ++  Y+   D+ SA ++F +  QRS+  W S+I 
Sbjct  320   NLSLGRALHSYAIKTCLDMDIIFYNNVLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIA  379

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y R      A +LF +M  +G  PD +T   IL AC+        R +H  +   G++ 
Sbjct  380   GYVREGLSDEAIELFSEMERNGVSPDVYTITSILHACACNGSLKKGRDIHKYIREHGMDS  439

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH--GCLGDWKKALLLFIK  732
                  + L+  Y+K G +E+A  VF  +   D+V WN+MI G+   CL +  +AL LF +
Sbjct  440   GLFVCNTLMDMYAKCGSMEDAHSVFSNMPVKDIVSWNTMIGGYSKNCLPN--EALKLFSE  497

Query  733   MQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             MQ+   KPD  T   ++      + L  G+ +H   L+ G+ S+ +V + LV MY +C  
Sbjct  498   MQQKS-KPDGMTIASVLPACASLAALNRGQEIHGHILRNGYFSDRYVANALVDMYVKCGV  556

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
             +  A  +FD +   D+++W+ ++ G    G   +A+  F EM   G K D +   S+L A
Sbjct  557   LVLARLLFDIIPMKDLISWTVIVAGYGMHGLGREAITAFNEMRKSGIKPDSISFISILYA  616

Query  1093  AAQLAIVQPGRETHGF--AVRCGYHL--EVSVSSALIDMYSKCGFLNLGIQVFKAMP-SK  1257
              +   ++    E   F  ++R  Y +  ++   + ++D+ ++ G L    +    MP   
Sbjct  617   CSHSGLLD---EAWRFFDSMRNDYSIVPKLEHYACMVDLLARTGNLTKAYKFINKMPIEP  673

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + S++    +H +   A ++ E V E E   P+   +  LL
Sbjct  674   DATIWGSLLCGCRIHHDVKLAEKVAERVFELE---PENTGYYVLL  715



>ref|XP_010668450.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   320 bits (819),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 295/523 (56%), Gaps = 6/523 (1%)
 Frame = +1

Query  235   LKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAF  414
             +K     + F  + ++  Y+  +++ SAR +FD+     + +WN++I  YA+      A 
Sbjct  1     MKIGFDSNEFVGSSLVGMYSKYDELGSARAMFDQLGSMDVVVWNTMITGYAQNGCEEEAM  60

Query  415   QLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAY  594
             +LF +M   G  P+  TF+ ++ A S   D +  R +H  ++ SG   D    + +V  Y
Sbjct  61    ELFLEMEIRGFSPNYTTFSVVIDASSVMPDETLGRKLHAKILKSGFLCDVYLGTAIVDLY  120

Query  595   SKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL--LLFIKMQRMGEKPDSFT  768
             SK   + +A + F  +++ +++ +N++I+G+G  GD +KAL     +++QRM  KPD+ T
Sbjct  121   SKFLIMTDAERAFSEMSKKNVISYNALITGYGLSGDHEKALKSYTLLRLQRM--KPDACT  178

Query  769   YVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLL  948
             ++GL+          +G+ VHS  +K G D +  V + +V+ YS+C  + SA + F++  
Sbjct  179   FIGLLTSTATSCAFVVGEKVHSDSIKLGLDQDVLVRNSIVNFYSKCGRIDSAIKAFETAQ  238

Query  949   EPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRE  1128
               D+V+W+A+I GL Q+ +  KAL+ F EM+    K D    +SV+ A A LA V  GR 
Sbjct  239   GSDIVSWTAIISGLVQNNEHTKALELFCEMHKLSEKADEFSSSSVIKAVASLAAVAQGRN  298

Query  1129  THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGN  1308
              HG+ ++ G    + V SALIDMYSK G +   +++F  MP KN++S+NSMI+    +G 
Sbjct  299   LHGYVLKVGLSDHIFVGSALIDMYSKFGVVEDALKLFSEMPDKNVVSWNSMITGYAQNGF  358

Query  1309  ANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHY  1488
             ++EA  +F++++      P   TF  +L ACC+ GLV +GRRY+ +M   +GI P  EHY
Sbjct  359   SDEALDLFDKMVRNGIL-PTSVTFVGVLLACCNAGLVQEGRRYYHLMGSHYGISPSVEHY  417

Query  1489  VYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKV  1668
               MV LLG +G + EA E + S     +  IW +LL+CC+ H ++ +   VA++    K 
Sbjct  418   SCMVNLLGHSGYVGEAEEFLLSSPFKEEHEIWKSLLNCCEAHRDFDVAARVAEYCSLLKP  477

Query  1669  EKSSYGVMVSNMYAGDGRWECVKKLRVDME-AIKGKMPGKSWI  1794
               SS   ++SN+YA    W  V++ R  M+ A   K PG SW+
Sbjct  478   NDSSTYTILSNIYATKQLWSEVERTRDSMKMADIVKEPGCSWV  520


 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/347 (28%), Positives = 166/347 (48%), Gaps = 1/347 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LHA ILK+      +  T I+  Y+    +  A R F E  ++++  +N++I  Y  +  
Sbjct  97    LHAKILKSGFLCDVYLGTAIVDLYSKFLIMTDAERAFSEMSKKNVISYNALITGYGLSGD  156

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A + +  +     +PD  TF  +L + +    F     VH   +  GL+ D +  + 
Sbjct  157   HEKALKSYTLLRLQRMKPDACTFIGLLTSTATSCAFVVGEKVHSDSIKLGLDQDVLVRNS  216

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             +V+ YSK G ++ AIK F+     D+V W ++ISG     +  KAL LF +M ++ EK D
Sbjct  217   IVNFYSKCGRIDSAIKAFETAQGSDIVSWTAIISGLVQNNEHTKALELFCEMHKLSEKAD  276

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              F+   +I  +   + +  G+N+H   LK G   +  VGS L+ MYS+   +  A ++F 
Sbjct  277   EFSSSSVIKAVASLAAVAQGRNLHGYVLKVGLSDHIFVGSALIDMYSKFGVVEDALKLFS  336

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + + ++V+W++MI G +Q+G   +ALD F +M   G     +    VL A     +VQ 
Sbjct  337   EMPDKNVVSWNSMITGYAQNGFSDEALDLFDKMVRNGILPTSVTFVGVLLACCNAGLVQE  396

Query  1120  GRE-THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             GR   H      G    V   S ++++    G++    +   + P K
Sbjct  397   GRRYYHLMGSHYGISPSVEHYSCMVNLLGHSGYVGEAEEFLLSSPFK  443



>ref|XP_011100907.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Sesamum indicum]
Length=713

 Score =   325 bits (833),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 190/530 (36%), Positives = 301/530 (57%), Gaps = 11/530 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
             H +++K   S   F  + ++  Y     +   R++FDE P R+   W+++I  YA     
Sbjct  140   HCVVVKFVDSCDVFVYSSMLNVYCKLGFLGDGRKVFDEMPDRNSITWSTMISGYASQRLG  199

Query  403   SNAFQLFKDMLDSGTRPDN-FTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
             + AF +F+ M+       N F    +L A +        + VH   + +GL       + 
Sbjct  200   NEAFWVFRGMMSGEEEEVNEFCVTSVLSAFTSPEFVDKGKQVHSLAIKNGLSEIVSVGNA  259

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             +V+ Y+K G L +A++VF+   + + + W++MI+GH   GD +KAL+LF +M   G +P 
Sbjct  260   VVTMYAKCGSLNDAVRVFELSTDKNSITWSAMITGHAQSGDGEKALVLFKEMHFRGMRPS  319

Query  760   SFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
              +T VG++  C D   ++ +GK VH+  +K GF+   ++ + L+ MY++C  +  A + F
Sbjct  320   KYTIVGVLNACSDTEEII-MGKQVHAYLVKLGFEFQMYIMTALIDMYAKCGFIVEAQKGF  378

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             D L + D+V W++MI G  Q+GD   A+  +  M M+G   + L +ASVL A + L+ ++
Sbjct  379   DHLHDSDLVLWTSMIGGYVQNGDNESAISLYCRMQMEGIAPNELTMASVLKACSSLSALE  438

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              G++ H   V+ G+ LEV + SAL  MY+KCG L+ G  VFK MP+++++S+N+MIS L 
Sbjct  439   QGKQIHAHVVKNGFTLEVPIGSALSTMYAKCGSLDDGNGVFKRMPARDVVSWNAMISGLS  498

Query  1297  LHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPK  1476
              +G   EA  +FEE ++ E   PD  TF  +L AC H GLV  G  YF  M  +FGI PK
Sbjct  499   QNGRGIEALDLFEE-MQLEGVKPDSVTFVNILSACSHMGLVDKGWEYFHSMPTKFGIVPK  557

Query  1477  TEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKH  1650
              EHY  MV +LG AG+L +A E I+S    +D G  +W  LLS C  H NY LG    + 
Sbjct  558   IEHYACMVDILGRAGKLHQAKEFIES--ATIDHGLCLWRILLSACRNHRNYELGAYAGEK  615

Query  1651  LFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             L +   ++SS  V++S++Y+  GR   V+++R  M +I+G  K PG SWI
Sbjct  616   LMELGSQESSAYVLLSSIYSALGRLNDVERVRRIM-SIRGISKEPGCSWI  664


 Score =   204 bits (520),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 134/432 (31%), Positives = 223/432 (52%), Gaps = 9/432 (2%)
 Frame = +1

Query  163   RSLLTQLSR--SNQTISTTKLLHAIILKTHL-SHHPFYATRIIRFYALNEDIVSARRLFD  333
             R L ++L     +Q +   K LHA +LKT L       ++ ++ FYA       AR LF 
Sbjct  12    RHLFSKLRHFTDHQGLPDGKSLHAHLLKTGLFPSCALLSSTLLNFYAKCHLFSEARLLFA  71

Query  334   ETPQRSIFL-WNSIIRAYAR---AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKF  501
             E P +   + WN +I +Y++   AH   +A QLFK+ML   + P++ TFA I  A +   
Sbjct  72    EMPHKEDSVSWNILINSYSQLGLAHYSFSALQLFKEMLQHRSLPNSHTFAGIFSAAAILE  131

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
             D    R  H  VV      D    S +++ Y KLG L +  KVFD + + + + W++MIS
Sbjct  132   DEVMARQAHCVVVKFVDSCDVFVYSSMLNVYCKLGFLGDGRKVFDEMPDRNSITWSTMIS  191

Query  682   GHGCLGDWKKALLLFIKMQRMGEKP-DSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFD  858
             G+       +A  +F  M    E+  + F    ++     P  +  GK VHSL +K G  
Sbjct  192   GYASQRLGNEAFWVFRGMMSGEEEEVNEFCVTSVLSAFTSPEFVDKGKQVHSLAIKNGLS  251

Query  859   SNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREM  1038
                 VG+ +V+MY++C  +  A R+F+   + + +TWSAMI G +QSGD  KAL  F+EM
Sbjct  252   EIVSVGNAVVTMYAKCGSLNDAVRVFELSTDKNSITWSAMITGHAQSGDGEKALVLFKEM  311

Query  1039  NMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFL  1218
             + +G +     I  VL+A +    +  G++ H + V+ G+  ++ + +ALIDMY+KCGF+
Sbjct  312   HFRGMRPSKYTIVGVLNACSDTEEIIMGKQVHAYLVKLGFEFQMYIMTALIDMYAKCGFI  371

Query  1219  NLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
                 + F  +   +++ + SMI     +G+   A  ++   ++ E   P+E T +++L A
Sbjct  372   VEAQKGFDHLHDSDLVLWTSMIGGYVQNGDNESAISLYCR-MQMEGIAPNELTMASVLKA  430

Query  1399  CCHTGLVCDGRR  1434
             C     +  G++
Sbjct  431   CSSLSALEQGKQ  442


 Score =   180 bits (457),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 178/345 (52%), Gaps = 1/345 (0%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S + +   K +H++ +K  LS        ++  YA    +  A R+F+ +  ++   W++
Sbjct  231   SPEFVDKGKQVHSLAIKNGLSEIVSVGNAVVTMYAKCGSLNDAVRVFELSTDKNSITWSA  290

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +I  +A++     A  LFK+M   G RP  +T   +L ACSD  +    + VH  +V  G
Sbjct  291   MITGHAQSGDGEKALVLFKEMHFRGMRPSKYTIVGVLNACSDTEEIIMGKQVHAYLVKLG  350

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
              E      + L+  Y+K G + EA K FD + + DLV W SMI G+   GD + A+ L+ 
Sbjct  351   FEFQMYIMTALIDMYAKCGFIVEAQKGFDHLHDSDLVLWTSMIGGYVQNGDNESAISLYC  410

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
             +MQ  G  P+  T   ++      S L  GK +H+  +K GF     +GS L +MY++C 
Sbjct  411   RMQMEGIAPNELTMASVLKACSSLSALEQGKQIHAHVVKNGFTLEVPIGSALSTMYAKCG  470

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +     +F  +   D+V+W+AMI GLSQ+G  ++ALD F EM ++G K D +   ++LS
Sbjct  471   SLDDGNGVFKRMPARDVVSWNAMISGLSQNGRGIEALDLFEEMQLEGVKPDSVTFVNILS  530

Query  1090  AAAQLAIVQPGRET-HGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
             A + + +V  G E  H    + G   ++   + ++D+  + G L+
Sbjct  531   ACSHMGLVDKGWEYFHSMPTKFGIVPKIEHYACMVDILGRAGKLH  575



>ref|XP_004161068.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g33680-like [Cucumis sativus]
Length=710

 Score =   325 bits (833),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 196/550 (36%), Positives = 301/550 (55%), Gaps = 9/550 (2%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
              F  + T  S S +T    +  HA+ +KT   +  F  + +I  Y     ++ AR++FD 
Sbjct  115   TFSGVFTAASSSPETFGGLQA-HALAIKTSNFYDVFVGSSLINMYCKIGCMLDARKVFDT  173

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
              P+R+   W +II  YA       A++LF  M       D F +  +L A +        
Sbjct  174   IPERNTVSWATIISGYAMERMAFEAWELFXLMRREEGAHDKFIYTSVLSALTVPDLVHYG  233

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + +H   + +GL   +   + LV+ Y K G L++A+K F+   + D + W++MI+G+   
Sbjct  234   KQIHCLALKNGLLSIASVGNALVTMYGKCGCLDDALKTFELSGDKDDITWSAMITGYAQA  293

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             GD  +AL LF  M   G KP  FT+VG+I        L  GK +H   LK G++   +  
Sbjct  294   GDSHEALNLFYNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYECQIYFM  353

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + LV MY++C  +  A + FD L EPD+V W++MI G +Q+G+   AL  +  M M+   
Sbjct  354   TALVDMYAKCGSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCRMQMERIM  413

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                L +ASVL A + LA ++ G++ H   ++ G+ LEV + SAL  MY+KCG L  G  V
Sbjct  414   PHELTMASVLRACSSLAALEQGKQIHAQTIKYGFSLEVPIGSALSTMYAKCGSLEDGNLV  473

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F+ MPS++I+++N+MIS L  +G   +A ++FEE L      PD  TF  +L AC H GL
Sbjct  474   FRRMPSRDIMTWNAMISGLSQNGEGLKALELFEE-LRHGTTKPDYVTFVNVLSACSHMGL  532

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGA  1590
             V  G+ YFR+M DEFGI P+ EHY  MV +L  AG+L E  E I+S    +D G  +W  
Sbjct  533   VERGKVYFRMMLDEFGIVPRVEHYACMVDILSRAGKLHETKEFIES--ATIDHGMCLWRI  590

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG  1770
             LL  C  + NY LG    + L +   ++SS  +++S++Y   GR + V+++R  M+ ++G
Sbjct  591   LLGACRNYRNYELGAYAGEKLMELGSQESSAYILLSSIYTALGRSDDVERVRRLMK-LRG  649

Query  1771  --KMPGKSWI  1794
               K PG SWI
Sbjct  650   VNKEPGCSWI  659


 Score =   220 bits (560),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 246/510 (48%), Gaps = 10/510 (2%)
 Frame = +1

Query  136   LLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVS  315
             LL     +F  LL + +R  + +   K +HA +L+T      +    ++  YA    IV 
Sbjct  5     LLPPQHRSFVDLLLRCTR-QKDLQKGKAIHAQLLRTGSFSSVYLTNSLVNLYAKCGSIVK  63

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAF--QLFKDMLDSGTRPDNFTFACILRAC  489
             A+ +F+    + +  WN +I  Y++      +F  +LF+ M    T P+  TF+ +  A 
Sbjct  64    AKLVFESITNKDVVSWNCLINGYSQKGTVGYSFVMELFQRMRAENTLPNGHTFSGVFTAA  123

Query  490   SDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWN  669
             S   +  G    H   + +    D    S L++ Y K+G + +A KVFD I E + V W 
Sbjct  124   SSSPETFGGLQAHALAIKTSNFYDVFVGSSLINMYCKIGCMLDARKVFDTIPERNTVSWA  183

Query  670   SMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKF  849
             ++ISG+       +A  LF  M+R     D F Y  ++  L  P L+  GK +H L LK 
Sbjct  184   TIISGYAMERMAFEAWELFXLMRREEGAHDKFIYTSVLSALTVPDLVHYGKQIHCLALKN  243

Query  850   GFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFF  1029
             G  S A VG+ LV+MY +C C+  A + F+   + D +TWSAMI G +Q+GD  +AL+ F
Sbjct  244   GLLSIASVGNALVTMYGKCGCLDDALKTFELSGDKDDITWSAMITGYAQAGDSHEALNLF  303

Query  1030  REMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
               M++ G K        V++A + +  ++ G++ HG++++ GY  ++   +AL+DMY+KC
Sbjct  304   YNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYECQIYFMTALVDMYAKC  363

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
             G L    + F  +   +I+ + SMIS    +G    A  ++   ++ E   P E T +++
Sbjct  364   GSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCR-MQMERIMPHELTMASV  422

Query  1390  LCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPV  1569
             L AC     +  G++       ++G   +      +  +    G LE+   L+       
Sbjct  423   LRACSSLAALEQGKQ-IHAQTIKYGFSLEVPIGSALSTMYAKCGSLEDG-NLVFRRMPSR  480

Query  1570  DFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             D   W A++S    +G     G+ A  LF+
Sbjct  481   DIMTWNAMISGLSQNGE----GLKALELFE  506



>ref|XP_007214267.1| hypothetical protein PRUPE_ppa025121mg [Prunus persica]
 gb|EMJ15466.1| hypothetical protein PRUPE_ppa025121mg [Prunus persica]
Length=796

 Score =   327 bits (838),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 189/527 (36%), Positives = 290/527 (55%), Gaps = 5/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  + K            ++ FY  N  I SAR++FDE   R +  WNS+I AY     
Sbjct  144   VHGYLYKLGFGSDNTVGNSLMAFYFKNRIIESARKVFDELSDRDVISWNSMISAYVANGL  203

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                  ++F+ ML  G   D  T   +L ACSD  + S  R +H   + + L++D +  + 
Sbjct  204   AEKGVEIFRQMLSLGVDVDLATVINVLMACSDGGNLSLGRALHSYAIKTCLDMDIMFYNN  263

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  YSK G L  A +VF  + +  +V W SMI+G+   G   +A+ LF +M+R    PD
Sbjct  264   VLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNDVSPD  323

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
              +T   ++    C   L+ G+++H    + G DS+  V + L+ MY++C  M  A  +F 
Sbjct  324   VYTITSILHACACNGSLKKGRDIHKYIREHGMDSSLFVCNTLMDMYAKCGSMEDAHSVFS  383

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
             S+   D+V+W+ MI G S++    +AL  F EM  K  K D + IASVL A A LA +  
Sbjct  384   SMPVKDIVSWNTMIGGYSKNCLPNEALKLFSEMQQK-SKPDGMTIASVLPACASLAALNR  442

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  +R GY  +  V++AL+DMY KCG L L   +F  +P K++IS+  +++  G+
Sbjct  443   GQEIHGHILRNGYFSDRYVANALVDMYVKCGVLVLARLLFDIIPIKDLISWTVIVAGYGM  502

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG  +EA   F E + K    PD  +F ++L AC H+GL+ +  R+F  M +++ I PK 
Sbjct  503   HGFGSEAITAFNE-MRKSGIKPDSISFISILYACSHSGLLDEAWRFFDSMRNDYSIVPKL  561

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LL   G L +AY+ I  +    D  IWG+LL  C IH + +L   VA+ +F+
Sbjct  562   EHYACMVDLLARTGNLTKAYKFINKMPIEPDATIWGSLLCGCRIHHDVKLAEKVAERVFE  621

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKL--RVDMEAIKGKMPGKSWI  1794
              + E + Y V+++N+YA   +WE VKKL  R+  + +K K PG SWI
Sbjct  622   LEPENTGYYVLLANIYAEAEKWEEVKKLRERIGRQGLK-KNPGCSWI  667


 Score =   202 bits (515),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/402 (30%), Positives = 208/402 (52%), Gaps = 2/402 (0%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             +++   K +H++I             +++  +    D+  ARR+FD+     +FLWN +I
Sbjct  35    KSLQDGKRVHSVICNNGAEVDGPLGAKLVFMFVKCGDLREARRVFDKLSNGKVFLWNLMI  94

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
               YA+   F     LF+ M + G + +++TF+CIL+  S          VHG +   G  
Sbjct  95    NEYAKVRNFREGIHLFRKMQELGIQANSYTFSCILKCFSSLGYVREGEWVHGYLYKLGFG  154

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              D+   + L++ Y K   +E A KVFD +++ D++ WNSMIS +   G  +K + +F +M
Sbjct  155   SDNTVGNSLMAFYFKNRIIESARKVFDELSDRDVISWNSMISAYVANGLAEKGVEIFRQM  214

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
               +G   D  T + ++M       L +G+ +HS  +K   D +    + ++ MYS+C  +
Sbjct  215   LSLGVDVDLATVINVLMACSDGGNLSLGRALHSYAIKTCLDMDIMFYNNVLDMYSKCGDL  274

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
              SA ++F  + +  +V+W++MI G  + G   +A++ F EM       D   I S+L A 
Sbjct  275   SSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSEMERNDVSPDVYTITSILHAC  334

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A    ++ GR+ H +    G    + V + L+DMY+KCG +     VF +MP K+I+S+N
Sbjct  335   ACNGSLKKGRDIHKYIREHGMDSSLFVCNTLMDMYAKCGSMEDAHSVFSSMPVKDIVSWN  394

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             +MI     +   NEA ++F E+ +K    PD  T +++L AC
Sbjct  395   TMIGGYSKNCLPNEALKLFSEMQQKS--KPDGMTIASVLPAC  434


 Score =   177 bits (449),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/381 (29%), Positives = 202/381 (53%), Gaps = 11/381 (3%)
 Frame = +1

Query  466   FACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             +  +L  C+        + VH  +  +G E+D    ++LV  + K G L EA +VFD ++
Sbjct  24    YCSVLELCAGLKSLQDGKRVHSVICNNGAEVDGPLGAKLVFMFVKCGDLREARRVFDKLS  83

Query  646   EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKN  825
                +  WN MI+ +  + ++++ + LF KMQ +G + +S+T+  ++ C      +R G+ 
Sbjct  84    NGKVFLWNLMINEYAKVRNFREGIHLFRKMQELGIQANSYTFSCILKCFSSLGYVREGEW  143

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             VH    K GF S+  VG+ L++ Y + + + SA ++FD L + D+++W++MI     +G 
Sbjct  144   VHGYLYKLGFGSDNTVGNSLMAFYFKNRIIESARKVFDELSDRDVISWNSMISAYVANGL  203

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
               K ++ FR+M   G  VD   + +VL A +    +  GR  H +A++    +++   + 
Sbjct  204   AEKGVEIFRQMLSLGVDVDLATVINVLMACSDGGNLSLGRALHSYAIKTCLDMDIMFYNN  263

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             ++DMYSKCG L+   QVF  M  ++++S+ SMI+     G ++EA ++F E +E+   +P
Sbjct  264   VLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIAGYVREGLSDEAIELFSE-MERNDVSP  322

Query  1366  DEATFSALLCACCHTGLVCDGR---RYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEA  1536
             D  T +++L AC   G +  GR   +Y R    E G+         ++ +    G +E+A
Sbjct  323   DVYTITSILHACACNGSLKKGRDIHKYIR----EHGMDSSLFVCNTLMDMYAKCGSMEDA  378

Query  1537  YELIQSIQGPV-DFGIWGALL  1596
             + +  S+  PV D   W  ++
Sbjct  379   HSVFSSM--PVKDIVSWNTMI  397


 Score =   152 bits (384),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/405 (27%), Positives = 193/405 (48%), Gaps = 16/405 (4%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
              +S  + LH+  +KT L     +   ++  Y+   D+ SA ++F +  QRS+  W S+I 
Sbjct  238   NLSLGRALHSYAIKTCLDMDIMFYNNVLDMYSKCGDLSSATQVFGKMGQRSVVSWTSMIA  297

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y R      A +LF +M  +   PD +T   IL AC+        R +H  +   G++ 
Sbjct  298   GYVREGLSDEAIELFSEMERNDVSPDVYTITSILHACACNGSLKKGRDIHKYIREHGMDS  357

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH--GCLGDWKKALLLFIK  732
                  + L+  Y+K G +E+A  VF  +   D+V WN+MI G+   CL +  +AL LF +
Sbjct  358   SLFVCNTLMDMYAKCGSMEDAHSVFSSMPVKDIVSWNTMIGGYSKNCLPN--EALKLFSE  415

Query  733   MQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             MQ+   KPD  T   ++      + L  G+ +H   L+ G+ S+ +V + LV MY +C  
Sbjct  416   MQQK-SKPDGMTIASVLPACASLAALNRGQEIHGHILRNGYFSDRYVANALVDMYVKCGV  474

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
             +  A  +FD +   D+++W+ ++ G    G   +A+  F EM   G K D +   S+L A
Sbjct  475   LVLARLLFDIIPIKDLISWTVIVAGYGMHGFGSEAITAFNEMRKSGIKPDSISFISILYA  534

Query  1093  AAQLAIVQPGRETHGF--AVRCGYHL--EVSVSSALIDMYSKCGFLNLGIQVFKAMP-SK  1257
              +   ++    E   F  ++R  Y +  ++   + ++D+ ++ G L    +    MP   
Sbjct  535   CSHSGLLD---EAWRFFDSMRNDYSIVPKLEHYACMVDLLARTGNLTKAYKFINKMPIEP  591

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALL  1392
             +   + S++    +H +   A ++ E V E E   P+   +  LL
Sbjct  592   DATIWGSLLCGCRIHHDVKLAEKVAERVFELE---PENTGYYVLL  633



>ref|XP_011019049.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Populus euphratica]
Length=682

 Score =   324 bits (830),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 188/541 (35%), Positives = 300/541 (55%), Gaps = 4/541 (1%)
 Frame = +1

Query  178   QLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIF  357
             +L +   ++   K +HA +L+  L    +   +++RF     +   + R+F +T + +IF
Sbjct  15    RLFQGFNSLKHLKHVHAALLRLGLDEDSYLLNKVLRFSFNFGNTNYSHRIFHQTKEPNIF  74

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGV  537
             L+N++I        F  + +++  M   G  PD+FTF  +L+AC+   D      +HG V
Sbjct  75    LFNTMIHGLVLNDSFQESIEIYHSMRKEGLSPDSFTFPFLLKACARLLDSKLGIKLHGLV  134

Query  538   VVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL  717
             V +G E D+  ++ LVS Y K G ++ A KVFD I E ++  W ++ISG+  +G  ++A+
Sbjct  135   VKAGCESDAFVNTSLVSLYGKCGFIDNAFKVFDDIPEKNVAAWTAIISGYVGVGKCREAI  194

Query  718   LLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
              +F ++  MG +PDSF+ V ++        L  G+ ++    K G   N  V + LV  Y
Sbjct  195   DMFRRLLDMGLRPDSFSLVRVLAACTRIGDLTSGEWINDYITKIGMVRNVFVATSLVDFY  254

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
              +C  M  A  +FD +LE D+V+WS+MI G + +G   +ALD F +M  +G + D   + 
Sbjct  255   VKCGNMERAFSVFDGMLEKDIVSWSSMIQGYASNGLPKEALDLFFKMLNEGFRPDCYAMV  314

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
              VL A A+L  ++ G        R  +     + +ALIDMY+KCG ++   +VF+ M  K
Sbjct  315   GVLCACARLGALELGNWASNLMDRNEFLGNPVLGTALIDMYAKCGRMDSAWEVFRGMRKK  374

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +I+ +N+ IS L + G+   AF +F + +EK    PD  TF  LLCAC H GLV +GR+Y
Sbjct  375   DIVVWNAAISGLAMSGHFKAAFALFGQ-MEKSGIEPDGNTFVGLLCACTHAGLVDEGRQY  433

Query  1438  FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             F  M   F + P+ EHY  MV LLG AG L+EA++L++S+    +  +WGALL  C +H 
Sbjct  434   FNSMERVFTLTPEIEHYGCMVDLLGRAGFLDEAHQLVKSMPMGANAIVWGALLGACRLHR  493

Query  1618  NYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--EAIKGKMPGKSW  1791
             + +L  +V K L   +   S   V++SN+Y+   +WE   K+R  M    IK K+PG SW
Sbjct  494   DTQLVEVVLKQLIALEPSNSGNYVLLSNIYSASHKWEDAAKIRSIMSERGIK-KVPGYSW  552

Query  1792  I  1794
             I
Sbjct  553   I  553



>gb|EYU40350.1| hypothetical protein MIMGU_mgv1a021272mg [Erythranthe guttata]
Length=791

 Score =   327 bits (837),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 184/533 (35%), Positives = 301/533 (56%), Gaps = 9/533 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +HA ++    S + +  T ++  YA   +I  A ++FD  P++ +  WN++I  +A  
Sbjct  134   KQIHAQLILNGFSDNLYSMTSVMNLYAKCREIHEAYKMFDRMPEKDLVCWNTVIAGFAHN  193

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                  + +L   M + G  PD  T   IL A ++  +    + +H   V  GLE     S
Sbjct  194   GMPKKSLELVSAMQEEGHIPDLVTVVTILPASANIGNLRVGKSIHAYAVRHGLESYVNVS  253

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + L+  Y+K G +  A  +FD ++   +V WNSMI G+   GD+ +AL LF KM   G +
Sbjct  254   TALLDMYAKCGLIRTARHIFDSMSSKTVVSWNSMIDGYSQSGDYSEALDLFQKMLDEGLR  313

Query  754   PDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
             P + T +G +    C +L  I  G+ VH L +  G DS+  V + L+SMY +CK +  A 
Sbjct  314   PSNVTVMGALHA--CANLCDISRGQFVHKLVIDSGLDSDVSVMNSLISMYCKCKRVDLAA  371

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLA  1107
             ++F  L    +V+W+AMI G +Q+G  ++A+  F +M  K  K+D   + SV++A A+L+
Sbjct  372   QLFHKLRMKSLVSWNAMILGYAQNGFTIEAISLFCKMQEKNMKLDSFSLVSVITAVAELS  431

Query  1108  IVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM-PSKNIISYNSMI  1284
             +++  +  HG AVR      V   +AL+DMY+KCG ++   ++F +M  ++++ ++N+MI
Sbjct  432   VLRQAKWAHGLAVRTCLDKNVFAMTALVDMYAKCGAVHTARKLFDSMGDNRHVTTWNAMI  491

Query  1285  SNLGLHGNANEAFQIFEEVLEK-EYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
                G HG   EA ++FE +  K    NP++ TF  ++ AC H+GLV  GR+YF +M +++
Sbjct  492   DGYGTHGFGEEAVELFEHMCSKGSVINPNDVTFLCIISACSHSGLVKQGRKYFTMMKEKY  551

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIV  1641
             G++PK +HY  +V LLG AG+L+EA+E I  +    +  ++GA+L  C IH N  LG   
Sbjct  552   GLEPKMDHYGAVVDLLGRAGQLKEAWEFILQMPVEPEINVFGAMLGACKIHKNVDLGEKA  611

Query  1642  AKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             A  LFD + +   Y V+++N+YA    W+ V K+R  ME  KG  K PG S +
Sbjct  612   ADKLFDLEPDDGGYHVLLANIYAIASMWDKVAKVRTLMEK-KGIQKTPGCSSV  663


 Score =   199 bits (507),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 188/331 (57%), Gaps = 0/331 (0%)
 Frame = +1

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGV  537
             L++++++ YA+     +A + F  M   G  P  + +A +++AC+DKFD    + +H  +
Sbjct  81    LYHTLLKGYAQQSNLDSAMKFFSRMKHDGVSPIVYNYAYLMKACADKFDVRRGKQIHAQL  140

Query  538   VVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL  717
             +++G   +    + +++ Y+K   + EA K+FD + E DLV WN++I+G    G  KK+L
Sbjct  141   ILNGFSDNLYSMTSVMNLYAKCREIHEAYKMFDRMPEKDLVCWNTVIAGFAHNGMPKKSL  200

Query  718   LLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMY  897
              L   MQ  G  PD  T V ++        LR+GK++H+  ++ G +S  +V + L+ MY
Sbjct  201   ELVSAMQEEGHIPDLVTVVTILPASANIGNLRVGKSIHAYAVRHGLESYVNVSTALLDMY  260

Query  898   SRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIA  1077
             ++C  + +A  IFDS+    +V+W++MI G SQSGD  +ALD F++M  +G +   + + 
Sbjct  261   AKCGLIRTARHIFDSMSSKTVVSWNSMIDGYSQSGDYSEALDLFQKMLDEGLRPSNVTVM  320

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
               L A A L  +  G+  H   +  G   +VSV ++LI MY KC  ++L  Q+F  +  K
Sbjct  321   GALHACANLCDISRGQFVHKLVIDSGLDSDVSVMNSLISMYCKCKRVDLAAQLFHKLRMK  380

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEK  1350
             +++S+N+MI     +G   EA  +F ++ EK
Sbjct  381   SLVSWNAMILGYAQNGFTIEAISLFCKMQEK  411


 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/323 (24%), Positives = 146/323 (45%), Gaps = 10/323 (3%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             IS  + +H +++ + L         +I  Y   + +  A +LF +   +S+  WN++I  
Sbjct  332   ISRGQFVHKLVIDSGLDSDVSVMNSLISMYCKCKRVDLAAQLFHKLRMKSLVSWNAMILG  391

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             YA+      A  LF  M +   + D+F+   ++ A ++       +  HG  V + L+ +
Sbjct  392   YAQNGFTIEAISLFCKMQEKNMKLDSFSLVSVITAVAELSVLRQAKWAHGLAVRTCLDKN  451

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEP-DLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
                 + LV  Y+K G +  A K+FD + +   +  WN+MI G+G  G  ++A+ LF  M 
Sbjct  452   VFAMTALVDMYAKCGAVHTARKLFDSMGDNRHVTTWNAMIDGYGTHGFGEEAVELFEHMC  511

Query  739   RMGE--KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCL-KFGFDSNAHVGSLLVSMYSRCK  909
               G    P+  T++ +I       L++ G+   ++   K+G +        +V +  R  
Sbjct  512   SKGSVINPNDVTFLCIISACSHSGLVKQGRKYFTMMKEKYGLEPKMDHYGAVVDLLGRAG  571

Query  910   CMGSACR-IFDSLLEPDMVTWSAMI--CGLSQSGDI-MKALDFFREMNMKGGKVDPLL--  1071
              +  A   I    +EP++  + AM+  C + ++ D+  KA D   ++    G    LL  
Sbjct  572   QLKEAWEFILQMPVEPEINVFGAMLGACKIHKNVDLGEKAADKLFDLEPDDGGYHVLLAN  631

Query  1072  IASVLSAAAQLAIVQPGRETHGF  1140
             I ++ S   ++A V+   E  G 
Sbjct  632   IYAIASMWDKVAKVRTLMEKKGI  654



>ref|XP_008793555.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Phoenix dactylifera]
Length=870

 Score =   328 bits (842),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 285/526 (54%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH + ++  L      A  ++  Y+        ++LFD  PQ  +  WN +I  Y +   
Sbjct  288   LHGLTIRCGLDLEASVANTLLAMYSKCRCFTDMKKLFDLMPQADLVAWNGMISGYVQNGL  347

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
              + A  LF  M  +G +PD+ T A  L A SD       + +H  ++ + + +D+   S 
Sbjct  348   RNEALDLFYQMQAAGIKPDSITLASFLPAFSDLTSLKQGKDIHAYIIRNSVCMDAFLKSA  407

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +  A KVFD     D+V  ++MISG+   G  + AL +F  +     KP+
Sbjct  408   LIDIYFKCKDVRMAQKVFDATGAMDVVICSAMISGYVLNGMNRDALGMFRWLLEAQLKPN  467

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             + T   ++    C   L++GK +H   LK  F+   +VGS L+ MY++C  +    +IF 
Sbjct  468   AITVSSVLPACSCLFALKLGKELHGYILKNAFEGKCYVGSALMDMYAKCGRLDLGHQIFT  527

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L E D + W++MI   +Q+G   +A+  FR+M  +  + D + I+S LSA A L  +  
Sbjct  528   KLSERDTIAWNSMITSFNQNGQPKEAISLFRQMGSEELRYDCVTISSALSACASLPALHY  587

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HGF  R     ++   SALIDMYSKCG L++   VF +M  KN +S+NS+I+  G 
Sbjct  588   GKEIHGFMARGSLRADLYAVSALIDMYSKCGNLDIARCVFDSMQEKNEVSWNSIIAAYGT  647

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   +A  +F++ ++   + PD  TF AL+ AC H G + +G R+F  M +E+GI  + 
Sbjct  648   HGLVKDAVSLFQQ-MQNAGFQPDHITFLALISACGHAGQIEEGFRFFHCMTEEYGIAARM  706

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV L G AG+L++A   I S+    D GIWGALL  C +HGN  L  + +K LF+
Sbjct  707   EHYACMVDLYGRAGKLDKALNFITSMPFKPDAGIWGALLGACRVHGNIALADLASKQLFE  766

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
                  S Y V++SN++A  GRW+ V K+R  M+  K  K+PG SWI
Sbjct  767   LDPCNSGYYVLMSNIHAVAGRWDGVSKVRSLMKERKVQKVPGCSWI  812


 Score =   216 bits (551),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 141/473 (30%), Positives = 239/473 (51%), Gaps = 3/473 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
              +   +L+H  I    L    F  + +I+ YA    I  AR +FD  P+R   LWN +I 
Sbjct  180   AVGLGRLIHKTICLMGLEADLFVGSSLIKMYAEGNFIDEAREVFDRMPERDCVLWNVMID  239

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y R     NA +LF  M  +  +P++  FA +L  C+ +        +HG  +  GL+L
Sbjct  240   GYVRNGDRGNAVELFNSMRRTEIKPNSVAFAGVLSICAAEAMLKYGIQLHGLTIRCGLDL  299

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             ++  ++ L++ YSK     +  K+FD + + DLV WN MISG+   G   +AL LF +MQ
Sbjct  300   EASVANTLLAMYSKCRCFTDMKKLFDLMPQADLVAWNGMISGYVQNGLRNEALDLFYQMQ  359

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G KPDS T    +      + L+ GK++H+  ++     +A + S L+ +Y +CK + 
Sbjct  360   AAGIKPDSITLASFLPAFSDLTSLKQGKDIHAYIIRNSVCMDAFLKSALIDIYFKCKDVR  419

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A ++FD+    D+V  SAMI G   +G    AL  FR +     K + + ++SVL A +
Sbjct  420   MAQKVFDATGAMDVVICSAMISGYVLNGMNRDALGMFRWLLEAQLKPNAITVSSVLPACS  479

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
              L  ++ G+E HG+ ++  +  +  V SAL+DMY+KCG L+LG Q+F  +  ++ I++NS
Sbjct  480   CLFALKLGKELHGYILKNAFEGKCYVGSALMDMYAKCGRLDLGHQIFTKLSERDTIAWNS  539

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI++   +G   EA  +F ++  +E    D  T S+ L AC     +  G+     M   
Sbjct  540   MITSFNQNGQPKEAISLFRQMGSEE-LRYDCVTISSALSACASLPALHYGKEIHGFMA-R  597

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
               ++        ++ +    G L+ A  +  S+Q   +   W ++++    HG
Sbjct  598   GSLRADLYAVSALIDMYSKCGNLDIARCVFDSMQEKNEVS-WNSIIAAYGTHG  649


 Score =   212 bits (539),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 121/396 (31%), Positives = 209/396 (53%), Gaps = 1/396 (0%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             + +HA ++   +       TR++  Y L      A+ +F    + S   WN +IR +   
Sbjct  84    RQVHAQLVLNGVDDDDSLGTRLLGMYVLCRSFSDAKDVFFRLKKVSPLPWNWMIRGFTMV  143

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
               F+ A   +  M   G  PD +TF  ++++C +       R++H  + + GLE D    
Sbjct  144   GWFNLALLFYIKMWFVGALPDKYTFPYVIKSCCNLSAVGLGRLIHKTICLMGLEADLFVG  203

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S L+  Y++   ++EA +VFD + E D V WN MI G+   GD   A+ LF  M+R   K
Sbjct  204   SSLIKMYAEGNFIDEAREVFDRMPERDCVLWNVMIDGYVRNGDRGNAVELFNSMRRTEIK  263

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P+S  + G++      ++L+ G  +H L ++ G D  A V + L++MYS+C+C     ++
Sbjct  264   PNSVAFAGVLSICAAEAMLKYGIQLHGLTIRCGLDLEASVANTLLAMYSKCRCFTDMKKL  323

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD + + D+V W+ MI G  Q+G   +ALD F +M   G K D + +AS L A + L  +
Sbjct  324   FDLMPQADLVAWNGMISGYVQNGLRNEALDLFYQMQAAGIKPDSITLASFLPAFSDLTSL  383

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G++ H + +R    ++  + SALID+Y KC  + +  +VF A  + +++  ++MIS  
Sbjct  384   KQGKDIHAYIIRNSVCMDAFLKSALIDIYFKCKDVRMAQKVFDATGAMDVVICSAMISGY  443

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
              L+G   +A  +F  +LE +   P+  T S++L AC
Sbjct  444   VLNGMNRDALGMFRWLLEAQ-LKPNAITVSSVLPAC  478


 Score =   165 bits (418),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 161/311 (52%), Gaps = 1/311 (0%)
 Frame = +1

Query  466   FACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             F  +LRAC D  D    R VH  +V++G++ D    ++L+  Y       +A  VF  + 
Sbjct  67    FLSMLRACHDPLDLQKGRQVHAQLVLNGVDDDDSLGTRLLGMYVLCRSFSDAKDVFFRLK  126

Query  646   EPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKN  825
             +   + WN MI G   +G +  ALL +IKM  +G  PD +T+  +I      S + +G+ 
Sbjct  127   KVSPLPWNWMIRGFTMVGWFNLALLFYIKMWFVGALPDKYTFPYVIKSCCNLSAVGLGRL  186

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             +H      G +++  VGS L+ MY+    +  A  +FD + E D V W+ MI G  ++GD
Sbjct  187   IHKTICLMGLEADLFVGSSLIKMYAEGNFIDEAREVFDRMPERDCVLWNVMIDGYVRNGD  246

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
                A++ F  M     K + +  A VLS  A  A+++ G + HG  +RCG  LE SV++ 
Sbjct  247   RGNAVELFNSMRRTEIKPNSVAFAGVLSICAAEAMLKYGIQLHGLTIRCGLDLEASVANT  306

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             L+ MYSKC       ++F  MP  +++++N MIS    +G  NEA  +F + ++     P
Sbjct  307   LLAMYSKCRCFTDMKKLFDLMPQADLVAWNGMISGYVQNGLRNEALDLFYQ-MQAAGIKP  365

Query  1366  DEATFSALLCA  1398
             D  T ++ L A
Sbjct  366   DSITLASFLPA  376


 Score =   139 bits (349),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 93/379 (25%), Positives = 183/379 (48%), Gaps = 16/379 (4%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K +HA I++  +    F  + +I  Y   +D+  A+++FD T    + + +++I 
Sbjct  382   SLKQGKDIHAYIIRNSVCMDAFLKSALIDIYFKCKDVRMAQKVFDATGAMDVVICSAMIS  441

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y       +A  +F+ +L++  +P+  T + +L ACS  F     + +HG ++ +  E 
Sbjct  442   GYVLNGMNRDALGMFRWLLEAQLKPNAITVSSVLPACSCLFALKLGKELHGYILKNAFEG  501

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
                  S L+  Y+K G L+   ++F  ++E D + WNSMI+     G  K+A+ LF +M 
Sbjct  502   KCYVGSALMDMYAKCGRLDLGHQIFTKLSERDTIAWNSMITSFNQNGQPKEAISLFRQMG  561

Query  739   RMGEKPDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                 + D  T    L  C   P+ L  GK +H    +    ++ +  S L+ MYS+C  +
Sbjct  562   SEELRYDCVTISSALSACASLPA-LHYGKEIHGFMARGSLRADLYAVSALIDMYSKCGNL  620

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A  +FDS+ E + V+W+++I      G +  A+  F++M   G + D +   +++SA 
Sbjct  621   DIARCVFDSMQEKNEVSWNSIIAAYGTHGLVKDAVSLFQQMQNAGFQPDHITFLALISAC  680

Query  1096  AQLAIVQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS  1254
                  ++ G        E +G A R  ++      + ++D+Y + G L+  +    +MP 
Sbjct  681   GHAGQIEEGFRFFHCMTEEYGIAARMEHY------ACMVDLYGRAGKLDKALNFITSMPF  734

Query  1255  K-NIISYNSMISNLGLHGN  1308
             K +   + +++    +HGN
Sbjct  735   KPDAGIWGALLGACRVHGN  753



>ref|XP_010228112.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Brachypodium distachyon]
Length=735

 Score =   325 bits (833),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 192/551 (35%), Positives = 299/551 (54%), Gaps = 12/551 (2%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F SLL +L  +   ++T + +HA +    LS     AT +   YA       ARR+FD  
Sbjct  63    FTSLL-KLCAARADLATGRAVHAQLAARGLSPEALAATALANMYAKCRRPGDARRVFDRM  121

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS-GTRPDNFTFACILRACSDKFDFSGL  516
             P R    WN+++  YAR      A  +   M +  G RPD  T   +L AC+D       
Sbjct  122   PARDRVAWNALVAGYARNGLAEAAVGMVVRMQEEDGERPDAVTLVSVLPACADAQALGAC  181

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             R VH   V  G +     S+ ++  Y K G ++ A KVFDG+ + + V WN+MI G+   
Sbjct  182   REVHAFAVRGGFDEQVNVSTAILDVYCKCGAVDSARKVFDGMQDRNSVSWNAMIKGYAEN  241

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLD-CPSL--LRIGKNVHSLCLKFGFDSNA  867
             GD  +AL LF +M  +GE  D  T V ++  L  C  L  L  G+ VH L ++ G +SN 
Sbjct  242   GDATEALALFKRM--VGEGVD-VTDVSVLAALHACGELGFLDEGRRVHELLVRIGLESNV  298

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             +V + L++MY +CK    A ++FD L     V+W+AMI G +Q+G    A+  F  M ++
Sbjct  299   NVMNALITMYCKCKRTDLAAQVFDELGYKTRVSWNAMILGCTQNGSSEDAVRLFSRMQLE  358

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
               K D   + S++ A A ++     R  HG+++R     +V V +ALIDMY+KCG +++ 
Sbjct  359   NVKPDSFTLVSIIPALADISDPLQARWIHGYSIRLHLDQDVYVLTALIDMYAKCGRVSIA  418

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               +F +   +++I++N+MI   G HG+   A ++FEE ++     P+E TF ++L AC H
Sbjct  419   RSLFNSARDRHVITWNAMIHGYGSHGSGKVAVELFEE-MKSSGKVPNETTFLSVLSACSH  477

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              GLV +G+ YF  M +++G++P  EHY  MV LLG AG+L EA+  IQ +       ++G
Sbjct  478   AGLVDEGQEYFSSMKEDYGLEPGMEHYGTMVDLLGRAGKLHEAWSFIQKMPMEPGISVYG  537

Query  1588  ALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK  1767
             A+L  C +H N  L    A+ +F+ + E+  Y V+++N+YA    W+ V ++R  ME  K
Sbjct  538   AMLGACKLHKNVELAEESAQRIFELEPEEGVYHVLLANIYANASLWKDVARVRTAMEK-K  596

Query  1768  G--KMPGKSWI  1794
             G  K PG S +
Sbjct  597   GLQKTPGWSIV  607


 Score =   179 bits (454),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 185/345 (54%), Gaps = 5/345 (1%)
 Frame = +1

Query  373   IRAYARAHRFSNAFQLFKDMLD-SGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +RA A       A   F  M   SG+ P   TF  +L+ C+ + D +  R VH  +   G
Sbjct  31    LRAAASRSDLRGALAAFAAMSPASGSGPVLRTFTSLLKLCAARADLATGRAVHAQLAARG  90

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             L  +++ ++ L + Y+K     +A +VFD +   D V WN++++G+   G  + A+ + +
Sbjct  91    LSPEALAATALANMYAKCRRPGDARRVFDRMPARDRVAWNALVAGYARNGLAEAAVGMVV  150

Query  730   KMQRM-GEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             +MQ   GE+PD+ T V ++  C D  +L    + VH+  ++ GFD   +V + ++ +Y +
Sbjct  151   RMQEEDGERPDAVTLVSVLPACADAQALGAC-REVHAFAVRGGFDEQVNVSTAILDVYCK  209

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASV  1083
             C  + SA ++FD + + + V+W+AMI G +++GD  +AL  F+ M  +G  V  + + + 
Sbjct  210   CGAVDSARKVFDGMQDRNSVSWNAMIKGYAENGDATEALALFKRMVGEGVDVTDVSVLAA  269

Query  1084  LSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNI  1263
             L A  +L  +  GR  H   VR G    V+V +ALI MY KC   +L  QVF  +  K  
Sbjct  270   LHACGELGFLDEGRRVHELLVRIGLESNVNVMNALITMYCKCKRTDLAAQVFDELGYKTR  329

Query  1264  ISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             +S+N+MI     +G++ +A ++F   ++ E   PD  T  +++ A
Sbjct  330   VSWNAMILGCTQNGSSEDAVRLFSR-MQLENVKPDSFTLVSIIPA  373



>gb|EMT00934.1| hypothetical protein F775_15202 [Aegilops tauschii]
Length=731

 Score =   325 bits (833),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 288/526 (55%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH + +K  L      A  ++  YA  + +  A RLFD  P+  +  WN +I    +   
Sbjct  149   LHTLAVKYGLEPEVAVANTLVSMYAKCQCLDDAWRLFDLMPRDDLVTWNGMISGCVQNGL  208

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
               +A +LF DM  SG +PD+ T A +L A +D   F   + +HG +V + + LD    S 
Sbjct  209   VDDALRLFCDMQKSGLQPDSVTLASLLPALTDLNGFKQGKEIHGYIVRNCVHLDVFLVSA  268

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             LV  Y K   +  A  VFD     D+V  ++MISG+   G  + A+ +F  +  +G KP+
Sbjct  269   LVDIYFKCRDVRMAQNVFDATKTIDVVIGSTMISGYVLNGMSEAAVKMFRYLLEVGIKPN  328

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             +      +    C + +++G+ +H   LK  ++   +V S L+ MY++C  +  +  IF 
Sbjct  329   AVMVASTLPACACMAAMKLGQELHGYVLKNAYEGRCYVESALMDMYAKCGRLDLSHYIFS  388

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              +   D VTW++MI   +Q+G+  +AL+ FR+M+M+G K   + I+S+LSA A L  +  
Sbjct  389   KMSAKDEVTWNSMISSFAQNGEPEEALELFRQMSMEGVKYSNVTISSILSACAGLPAIYY  448

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  ++     +V   SALIDMY KCG L L  +VF+ MP KN +++NS+IS  G 
Sbjct  449   GKEIHGIIIKGPIRADVFAESALIDMYGKCGNLELAFRVFEFMPEKNEVTWNSIISAYGA  508

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   E+  +    +++E +N D  TF AL+ AC H G V +G R F+ M +E+ I P+ 
Sbjct  509   HGLVEESVSLLCR-MQEEGFNADHVTFLALISACAHAGQVQEGLRLFKCMTEEYQIAPRV  567

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EH   MV L   AG+L++A + I  +    D GIWGALL  C +H +  L  I ++ LF 
Sbjct  568   EHLACMVDLYSRAGKLDKAMQFIADMPFKPDAGIWGALLHACRVHRDVELAEIASQELFK  627

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
                  S Y V++SN+ A  GRW+ V K+R  M+  K  K+PG SW+
Sbjct  628   LDPHNSGYYVLMSNINAVAGRWDGVSKMRRLMKDKKVQKIPGYSWV  673


 Score =   206 bits (524),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 143/474 (30%), Positives = 237/474 (50%), Gaps = 5/474 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
              ++  +L+H       L    +  + +I+ YA    +  AR +FD   +R   LWN ++ 
Sbjct  41    ALALGRLVHRTARALGLDRDMYVGSALIKMYADAGLLGGAREVFDGMAERDCVLWNVMMD  100

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDF-SGLRVVHGGVVVSGLE  555
              Y +    ++A  LF  M  S   P+  T AC L  C+ + D  SGL++ H   V  GLE
Sbjct  101   GYVKGGDVASAVGLFGAMRASRCDPNFATLACFLSVCATEADLLSGLQL-HTLAVKYGLE  159

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              +   ++ LVS Y+K   L++A ++FD +   DLV WN MISG    G    AL LF  M
Sbjct  160   PEVAVANTLVSMYAKCQCLDDAWRLFDLMPRDDLVTWNGMISGCVQNGLVDDALRLFCDM  219

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
             Q+ G +PDS T   L+  L   +  + GK +H   ++     +  + S LV +Y +C+ +
Sbjct  220   QKSGLQPDSVTLASLLPALTDLNGFKQGKEIHGYIVRNCVHLDVFLVSALVDIYFKCRDV  279

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
               A  +FD+    D+V  S MI G   +G    A+  FR +   G K + +++AS L A 
Sbjct  280   RMAQNVFDATKTIDVVIGSTMISGYVLNGMSEAAVKMFRYLLEVGIKPNAVMVASTLPAC  339

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A +A ++ G+E HG+ ++  Y     V SAL+DMY+KCG L+L   +F  M +K+ +++N
Sbjct  340   ACMAAMKLGQELHGYVLKNAYEGRCYVESALMDMYAKCGRLDLSHYIFSKMSAKDEVTWN  399

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMND  1455
             SMIS+   +G   EA ++F + +  E       T S++L AC     +  G+    I+  
Sbjct  400   SMISSFAQNGEPEEALELFRQ-MSMEGVKYSNVTISSILSACAGLPAIYYGKEIHGIII-  457

Query  1456  EFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             +  I+        ++ + G  G LE A+ + + +    +   W +++S    HG
Sbjct  458   KGPIRADVFAESALIDMYGKCGNLELAFRVFEFMPEKNEV-TWNSIISAYGAHG  510


 Score =   181 bits (460),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 177/336 (53%), Gaps = 1/336 (0%)
 Frame = +1

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
             HRF+  F +      S  RPD  T   ++++C+     +  R+VH      GL+ D    
Sbjct  5     HRFAVLFYVKMWAHPSAPRPDGHTLPYVVKSCAALGALALGRLVHRTARALGLDRDMYVG  64

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S L+  Y+  G L  A +VFDG+AE D V WN M+ G+   GD   A+ LF  M+     
Sbjct  65    SALIKMYADAGLLGGAREVFDGMAERDCVLWNVMMDGYVKGGDVASAVGLFGAMRASRCD  124

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P+  T    +      + L  G  +H+L +K+G +    V + LVSMY++C+C+  A R+
Sbjct  125   PNFATLACFLSVCATEADLLSGLQLHTLAVKYGLEPEVAVANTLVSMYAKCQCLDDAWRL  184

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD +   D+VTW+ MI G  Q+G +  AL  F +M   G + D + +AS+L A   L   
Sbjct  185   FDLMPRDDLVTWNGMISGCVQNGLVDDALRLFCDMQKSGLQPDSVTLASLLPALTDLNGF  244

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E HG+ VR   HL+V + SAL+D+Y KC  + +   VF A  + +++  ++MIS  
Sbjct  245   KQGKEIHGYIVRNCVHLDVFLVSALVDIYFKCRDVRMAQNVFDATKTIDVVIGSTMISGY  304

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
              L+G +  A ++F  +LE     P+    ++ L AC
Sbjct  305   VLNGMSEAAVKMFRYLLEVG-IKPNAVMVASTLPAC  339


 Score =   120 bits (300),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 123/238 (52%), Gaps = 7/238 (3%)
 Frame = +1

Query  697   GDWKKALLLFIKM--QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
             G  + A+L ++KM       +PD  T   ++        L +G+ VH      G D + +
Sbjct  3     GHHRFAVLFYVKMWAHPSAPRPDGHTLPYVVKSCAALGALALGRLVHRTARALGLDRDMY  62

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
             VGS L+ MY+    +G A  +FD + E D V W+ M+ G  + GD+  A+  F  M  + 
Sbjct  63    VGSALIKMYADAGLLGGAREVFDGMAERDCVLWNVMMDGYVKGGDVASAVGLFGAM--RA  120

Query  1051  GKVDP--LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
              + DP    +A  LS  A  A +  G + H  AV+ G   EV+V++ L+ MY+KC  L+ 
Sbjct  121   SRCDPNFATLACFLSVCATEADLLSGLQLHTLAVKYGLEPEVAVANTLVSMYAKCQCLDD  180

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
               ++F  MP  +++++N MIS    +G  ++A ++F + ++K    PD  T ++LL A
Sbjct  181   AWRLFDLMPRDDLVTWNGMISGCVQNGLVDDALRLFCD-MQKSGLQPDSVTLASLLPA  237


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (44%), Gaps = 26/173 (15%)
 Frame = +1

Query  214  KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
            K +H II+K  +    F  + +I  Y    ++  A R+F+  P+++   WNSII AY   
Sbjct  450  KEIHGIIIKGPIRADVFAESALIDMYGKCGNLELAFRVFEFMPEKNEVTWNSIISAYGAH  509

Query  394  HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                 +  L   M + G   D+ TF  ++ AC+           H G V  GL L    +
Sbjct  510  GLVEESVSLLCRMQEEGFNADHVTFLALISACA-----------HAGQVQEGLRLFKCMT  558

Query  574  SQ------------LVSAYSKLGPLEEAIK-VFDGIAEPDLVQWNSMISGHGC  693
             +            +V  YS+ G L++A++ + D   +PD   W +++  H C
Sbjct  559  EEYQIAPRVEHLACMVDLYSRAGKLDKAMQFIADMPFKPDAGIWGALL--HAC  609



>emb|CDP19953.1| unnamed protein product [Coffea canephora]
Length=713

 Score =   324 bits (831),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 201/565 (36%), Positives = 311/565 (55%), Gaps = 17/565 (3%)
 Frame = +1

Query  133   QLLHQMFI----AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALN  300
             Q+ H+ F+     F  + T LS     I   K +H +++K   +   F  + ++  Y   
Sbjct  106   QMRHRNFLPDPHTFSGIFTALSILENPI-VGKQVHVLVVKAADNSDVFVNSSLLNMYCKL  164

Query  301   EDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPD--NFTFAC  474
               +  AR+LFDE P R+   W ++I  YA       A ++FK +   G   D   F F  
Sbjct  165   GIVEEARKLFDEMPNRNSVSWATMISGYATQRLAKEACEVFKLLFSGGQTEDLNEFAFTS  224

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICS--SQLVSAYSKLGPLEEAIKVFDGIAE  648
             +L A +        + +HG  V   L+L SI S  + +V+ Y+K G L++A+  F   ++
Sbjct  225   VLSAFTLPEFIDIGKQIHGLSV--KLDLFSIVSVDNAIVTMYAKCGSLDDAVLAFKFSSD  282

Query  649   PDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKN  825
              + + W++MI+G+   G+  KAL LF  M   G KP  +T VG++  C D  +    GK 
Sbjct  283   KNSITWSAMITGYAQTGNGDKALKLFSDMHFYGMKPSEYTLVGVLNACSDVEAACH-GKQ  341

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             VH   LK G++S+ ++ + LV MY++C  +  A + F+ L EPD+V W++MI G  Q+GD
Sbjct  342   VHGYLLKLGYESHMYIMTALVDMYAKCGNIEDAQKGFEYLQEPDIVLWTSMIGGYVQNGD  401

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
                A++ + +M MK    + L +AS+L A + LA ++ G++ H  +V+ G+ LEV + SA
Sbjct  402   NESAINLYCQMQMKNIVPNELTMASILKACSGLAALEQGKQMHAQSVKYGFSLEVPIGSA  461

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             L  MY+KCG L  G  VF  MP+++++S+N+MIS    +G   EA ++FEE +  E   P
Sbjct  462   LATMYAKCGNLEDGNIVFWRMPARDVVSWNAMISGHSQNGRGAEALELFEE-MRMEGTEP  520

Query  1366  DEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYEL  1545
             D  TF  +L AC H GLV +G  YFR+M DEFG+ P  +HY  MV +LG AG L EA E 
Sbjct  521   DYVTFVNVLSACSHMGLVDEGWGYFRMMFDEFGLMPGVDHYACMVDILGRAGRLNEAKEF  580

Query  1546  IQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRW  1725
             I+S        +W  LLS C  + NY LG    + L +   ++SS  V++S++Y+  GR 
Sbjct  581   IESANIDHGLALWRILLSACRNYRNYELGAYAGEKLMELGSQESSTYVLLSSIYSALGRL  640

Query  1726  ECVKKLRVDMEAIKG--KMPGKSWI  1794
               V+++R  M   +G  K PG SWI
Sbjct  641   NEVERVR-RMMNFRGVSKEPGCSWI  664


 Score =   182 bits (461),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 126/439 (29%), Positives = 215/439 (49%), Gaps = 9/439 (2%)
 Frame = +1

Query  136   LLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHH-PFYATRIIRFYALNEDIV  312
             L H   + F  LL    + N  I   + LHA ++K  +S    F A  ++ FY+    + 
Sbjct  7     LTHNSRVFFSKLLDCTLQRNLRIG--QYLHAHLIKAGISSSCTFLANNLVNFYSKCHRLQ  64

Query  313   SARRLFDETPQRSIFLWNSIIRAYAR-AHRFS--NAFQLFKDMLDSGTRPDNFTFACILR  483
              A  +F E   + +  WN +I  Y++   R S  +  +LF  M      PD  TF+ I  
Sbjct  65    EAYLVFQEIQNKDVVSWNCLINGYSQLGSRDSSLSVLKLFIQMRHRNFLPDPHTFSGIFT  124

Query  484   ACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQ  663
             A S   +    + VH  VV +    D   +S L++ Y KLG +EEA K+FD +   + V 
Sbjct  125   ALSILENPIVGKQVHVLVVKAADNSDVFVNSSLLNMYCKLGIVEEARKLFDEMPNRNSVS  184

Query  664   WNSMISGHGCLGDWKKALLLFIKMQRMGEKPD--SFTYVGLIMCLDCPSLLRIGKNVHSL  837
             W +MISG+      K+A  +F  +   G+  D   F +  ++     P  + IGK +H L
Sbjct  185   WATMISGYATQRLAKEACEVFKLLFSGGQTEDLNEFAFTSVLSAFTLPEFIDIGKQIHGL  244

Query  838   CLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKA  1017
              +K    S   V + +V+MY++C  +  A   F    + + +TWSAMI G +Q+G+  KA
Sbjct  245   SVKLDLFSIVSVDNAIVTMYAKCGSLDDAVLAFKFSSDKNSITWSAMITGYAQTGNGDKA  304

Query  1018  LDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDM  1197
             L  F +M+  G K     +  VL+A + +     G++ HG+ ++ GY   + + +AL+DM
Sbjct  305   LKLFSDMHFYGMKPSEYTLVGVLNACSDVEAACHGKQVHGYLLKLGYESHMYIMTALVDM  364

Query  1198  YSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEAT  1377
             Y+KCG +    + F+ +   +I+ + SMI     +G+   A  ++ ++  K    P+E T
Sbjct  365   YAKCGNIEDAQKGFEYLQEPDIVLWTSMIGGYVQNGDNESAINLYCQMQMKNIV-PNELT  423

Query  1378  FSALLCACCHTGLVCDGRR  1434
              +++L AC     +  G++
Sbjct  424   MASILKACSGLAALEQGKQ  442


 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 104/369 (28%), Positives = 185/369 (50%), Gaps = 15/369 (4%)
 Frame = +1

Query  517   RVVHGGVVVSGLELD-SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
             + +H  ++ +G+    +  ++ LV+ YSK   L+EA  VF  I   D+V WN +I+G+  
Sbjct  31    QYLHAHLIKAGISSSCTFLANNLVNFYSKCHRLQEAYLVFQEIQNKDVVSWNCLINGYSQ  90

Query  694   LGDWKKAL---LLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSN  864
             LG    +L    LFI+M+     PD  T+ G+   L       +GK VH L +K   +S+
Sbjct  91    LGSRDSSLSVLKLFIQMRHRNFLPDPHTFSGIFTALSILENPIVGKQVHVLVVKAADNSD  150

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
               V S L++MY +   +  A ++FD +   + V+W+ MI G +      +A + F+ +  
Sbjct  151   VFVNSSLLNMYCKLGIVEEARKLFDEMPNRNSVSWATMISGYATQRLAKEACEVFKLL-F  209

Query  1045  KGGKVDPL---LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGF  1215
              GG+ + L      SVLSA      +  G++ HG +V+      VSV +A++ MY+KCG 
Sbjct  210   SGGQTEDLNEFAFTSVLSAFTLPEFIDIGKQIHGLSVKLDLFSIVSVDNAIVTMYAKCGS  269

Query  1216  LNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY--NPDEATFSAL  1389
             L+  +  FK    KN I++++MI+     GN ++A ++F ++    +Y   P E T   +
Sbjct  270   LDDAVLAFKFSSDKNSITWSAMITGYAQTGNGDKALKLFSDM---HFYGMKPSEYTLVGV  326

Query  1390  LCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPV  1569
             L AC      C G++    +  + G +        +V +    G +E+A +  + +Q P 
Sbjct  327   LNACSDVEAACHGKQVHGYL-LKLGYESHMYIMTALVDMYAKCGNIEDAQKGFEYLQEP-  384

Query  1570  DFGIWGALL  1596
             D  +W +++
Sbjct  385   DIVLWTSMI  393



>ref|XP_003540859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Glycine max]
Length=701

 Score =   324 bits (830),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 192/552 (35%), Positives = 300/552 (54%), Gaps = 5/552 (1%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             +LL  L+ S       +L   +     L  + + AT++   YA+   +  A+ +FD+   
Sbjct  27    TLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKLAACYAVCGHMPYAQHIFDQIVL  86

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             ++ FLWNS+IR YA  +  S A  L+  ML  G +PDNFT+  +L+AC D       R V
Sbjct  87    KNSFLWNSMIRGYACNNSPSRALFLYLKMLHFGQKPDNFTYPFVLKACGDLLLREMGRKV  146

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             H  VVV GLE D    + ++S Y K G +E A  VFD +   DL  WN+M+SG    G+ 
Sbjct  147   HALVVVGGLEEDVYVGNSILSMYFKFGDVEAARVVFDRMLVRDLTSWNTMMSGFVKNGEA  206

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
             + A  +F  M+R G   D  T + L+        L++GK +H   ++ G       G L+
Sbjct  207   RGAFEVFGDMRRDGFVGDRTTLLALLSACGDVMDLKVGKEIHGYVVRNGESGRVCNGFLM  266

Query  886   ---VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
                + MY  C+ +  A ++F+ L   D+V+W+++I G  + GD  +AL+ F  M + G  
Sbjct  267   NSIIDMYCNCESVSCARKLFEGLRVKDVVSWNSLISGYEKCGDAFQALELFGRMVVVGAV  326

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D + + SVL+A  Q++ ++ G     + V+ GY + V V +ALI MY+ CG L    +V
Sbjct  327   PDEVTVISVLAACNQISALRLGATVQSYVVKRGYVVNVVVGTALIGMYANCGSLVCACRV  386

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  MP KN+ +   M++  G+HG   EA  IF E+L K    PDE  F+A+L AC H+GL
Sbjct  387   FDEMPEKNLPACTVMVTGFGIHGRGREAISIFYEMLGKG-VTPDEGIFTAVLSACSHSGL  445

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             V +G+  F  M  ++ ++P+  HY  +V LLG AG L+EAY +I++++   +  +W ALL
Sbjct  446   VDEGKEIFYKMTRDYSVEPRPTHYSCLVDLLGRAGYLDEAYAVIENMKLKPNEDVWTALL  505

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GK  1773
             S C +H N +L  I A+ LF+   +  S  V +SN+YA + RWE V+ +R  +   +  K
Sbjct  506   SACRLHRNVKLAVISAQKLFELNPDGVSGYVCLSNIYAAERRWEDVENVRALVAKRRLRK  565

Query  1774  MPGKSWISNIKM  1809
              P  S++   KM
Sbjct  566   PPSYSFVELNKM  577


 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 172/320 (54%), Gaps = 5/320 (2%)
 Frame = +1

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSG-LELDSICSSQLVSAYSKLGPLEEAIKV  630
             D+     +L++ ++    +    +H  V   G L  ++  +++L + Y+  G +  A  +
Sbjct  21    DSLQCGTLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKLAACYAVCGHMPYAQHI  80

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL  810
             FD I   +   WNSMI G+ C     +AL L++KM   G+KPD+FTY  ++       L 
Sbjct  81    FDQIVLKNSFLWNSMIRGYACNNSPSRALFLYLKMLHFGQKPDNFTYPFVLKACGDLLLR  140

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
              +G+ VH+L +  G + + +VG+ ++SMY +   + +A  +FD +L  D+ +W+ M+ G 
Sbjct  141   EMGRKVHALVVVGGLEEDVYVGNSILSMYFKFGDVEAARVVFDRMLVRDLTSWNTMMSGF  200

Query  991   SQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEV  1170
              ++G+   A + F +M   G   D   + ++LSA   +  ++ G+E HG+ VR G    V
Sbjct  201   VKNGEARGAFEVFGDMRRDGFVGDRTTLLALLSACGDVMDLKVGKEIHGYVVRNGESGRV  260

Query  1171  S---VSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 + +++IDMY  C  ++   ++F+ +  K+++S+NS+IS     G+A +A ++F  +
Sbjct  261   CNGFLMNSIIDMYCNCESVSCARKLFEGLRVKDVVSWNSLISGYEKCGDAFQALELFGRM  320

Query  1342  LEKEYYNPDEATFSALLCAC  1401
             +      PDE T  ++L AC
Sbjct  321   VVVGAV-PDEVTVISVLAAC  339



>ref|XP_003588887.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES59138.1| PPR containing plant-like protein [Medicago truncatula]
Length=697

 Score =   324 bits (830),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 188/529 (36%), Positives = 283/529 (53%), Gaps = 3/529 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             +++H  ++K  L       + ++  YA   +   A +LFDE P + +  WN++I  Y ++
Sbjct  126   QMIHTCLVKEGLMVDIVVGSSLVGMYAKCNEFECAVKLFDEMPDKDVACWNTVISCYYQS  185

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              +F  A + F  M   G  PD+ T    + +C+   D    R +H  +V SG  +DS  S
Sbjct  186   GKFEEALRYFGMMRRFGFEPDSVTITTAISSCARLLDLDRGREIHKELVNSGFRMDSFVS  245

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + LV  Y K G LE AI+VF+ +    +V WNSMI+G+G  GD    + LF +M   G K
Sbjct  246   AALVDMYGKCGQLEMAIEVFEQMPNKTVVAWNSMINGYGFKGDGISCIQLFKRMYSEGVK  305

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P   T    +M     + L  GK VH   ++     +  + S L+ +Y +C  + SA  I
Sbjct  306   PTLTTLTSTLMACSQSAQLLEGKFVHGYIIRNRIQPDIFLNSSLMDLYFKCGKVESAETI  365

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F  + +   V+W+ MI G    G +  AL  F EM+    + D +   SVL+A +QLA +
Sbjct  366   FKLMPKTTTVSWNVMISGYVTEGKLFDALRLFGEMSKSFVEPDAITFTSVLAACSQLAAL  425

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + GRE H   V         V  AL+DMY+KCG +     VFK +P ++++S+ SMI+  
Sbjct  426   EKGREIHNLIVERNLGNNEVVMGALLDMYAKCGAVEEAFGVFKCLPERDLVSWTSMITAY  485

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG   EA ++F E+L+     PD  TF A+L AC H GLV DG  +F  M + +GI P
Sbjct  486   GSHGRVYEALELFAEMLQSN-VKPDRVTFLAILSACSHAGLVDDGLYHFNQMINVYGIIP  544

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQS-IQGPVDFGIWGALLSCCDIHGNYRLGGIVAKH  1650
             + EHY  ++ LLG AG L EAYE++QS  +   DF +   L S C +H N  LG  +A++
Sbjct  545   RIEHYSCLITLLGRAGRLHEAYEILQSNPEISDDFQLLSTLFSACRLHKNLDLGVEIAEN  604

Query  1651  LFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             L D   + SS  +++SNMYA  G+W+ V+ +R  M+ +   K PG SWI
Sbjct  605   LIDKDPDDSSTYIILSNMYASFGKWDEVRMVRSKMKDLGLKKNPGCSWI  653


 Score =   194 bits (493),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 139/490 (28%), Positives = 241/490 (49%), Gaps = 17/490 (3%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD--ETPQ  345
             L + S +++++   K+LH  ++   L +  +    +I  Y        A+ +FD  E P 
Sbjct  9     LLRASVNSKSLKQGKVLHQKVVTLGLQNDVYVCKNLISLYVSCNLFDYAKNVFDVIENP-  67

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLF-KDMLDSGTRPDNFTFACILRACSDKFDFSGLRV  522
               I L N ++  Y R   +  A  LF K M     +PD++T+  +L+AC         ++
Sbjct  68    FEISLCNGLMAGYTRNCMYDEALGLFDKLMCYPCLKPDSYTYPSVLKACGGLRRVVLGQM  127

Query  523   VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGD  702
             +H  +V  GL +D +  S LV  Y+K    E A+K+FD + + D+  WN++IS +   G 
Sbjct  128   IHTCLVKEGLMVDIVVGSSLVGMYAKCNEFECAVKLFDEMPDKDVACWNTVISCYYQSGK  187

Query  703   WKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVG  876
             +++AL  F  M+R G +PDS T    I    C  LL +  G+ +H   +  GF  ++ V 
Sbjct  188   FEEALRYFGMMRRFGFEPDSVTITTAIS--SCARLLDLDRGREIHKELVNSGFRMDSFVS  245

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + LV MY +C  +  A  +F+ +    +V W++MI G    GD +  +  F+ M  +G K
Sbjct  246   AALVDMYGKCGQLEMAIEVFEQMPNKTVVAWNSMINGYGFKGDGISCIQLFKRMYSEGVK  305

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                  + S L A +Q A +  G+  HG+ +R     ++ ++S+L+D+Y KCG +     +
Sbjct  306   PTLTTLTSTLMACSQSAQLLEGKFVHGYIIRNRIQPDIFLNSSLMDLYFKCGKVESAETI  365

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             FK MP    +S+N MIS     G   +A ++F E + K +  PD  TF+++L AC     
Sbjct  366   FKLMPKTTTVSWNVMISGYVTEGKLFDALRLFGE-MSKSFVEPDAITFTSVLAACSQLAA  424

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWG  1587
             +  GR    ++ +    +    + V M  LL M    G +EEA+ + + +    D   W 
Sbjct  425   LEKGREIHNLIVE----RNLGNNEVVMGALLDMYAKCGAVEEAFGVFKCLP-ERDLVSWT  479

Query  1588  ALLSCCDIHG  1617
             ++++    HG
Sbjct  480   SMITAYGSHG  489



>ref|XP_008445307.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Cucumis melo]
 ref|XP_008445308.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Cucumis melo]
Length=710

 Score =   324 bits (830),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 193/550 (35%), Positives = 303/550 (55%), Gaps = 9/550 (2%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
              F  + T  S S +T    +  HA+ +KT   +  F  + +I  Y     ++ AR++FD 
Sbjct  115   TFSGVFTAASSSPETFGGLQA-HALAIKTSNFYDVFVGSSLINMYCKIGCLLDARKVFDT  173

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
              P+R+I  W ++I  YA       A++LF  M       D F +  +L A +        
Sbjct  174   IPERNIVSWATMISGYAMERMALEAWELFLLMRREEGAHDKFIYTGVLSALTVPDLVRYG  233

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + +H   + +GL   +   + LV+ Y K G L++A+K F+   + D + W++MI+G+   
Sbjct  234   KQIHCLALKNGLLSIASVGNALVTMYGKCGCLDDALKTFELSGDKDDITWSAMITGYAQA  293

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             GD  +AL LF  M   G KP  FT+VG+I        L  GK +H   LK G++   +  
Sbjct  294   GDSDEALKLFYNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYERQIYFM  353

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + LV MY++C  +  A + FD L EPD+V W++MI G +Q+G+   AL  +  M M+G  
Sbjct  354   TALVDMYAKCGSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCRMQMEGIL  413

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                L +ASVL A + LA ++ G++ H   ++ G+ LEV + SAL  MY+KCG +  G  V
Sbjct  414   PHELTMASVLRACSSLAALEQGKQIHAQTIKYGFSLEVPIGSALSTMYAKCGSVEDGNLV  473

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F+ MP+++I+++N+MIS L  +G   +A ++FEE +      PD  TF  +L AC H GL
Sbjct  474   FRRMPTRDIMTWNAMISGLSQNGEGLKALELFEE-MRHGTTKPDYVTFVNVLSACSHMGL  532

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGA  1590
             V  G+ YFR+M D+FGI P+ EHY  MV +L  AG+L E  E I+S    +D G  +W  
Sbjct  533   VERGKVYFRMMLDDFGIVPRVEHYACMVDILSRAGKLHETKEFIES--ATIDHGMCLWRI  590

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG  1770
             LL  C  + NY LG    + L +   ++SS  +++S++Y   GR + V+++R  M+ ++G
Sbjct  591   LLGACRNYRNYELGAYAGEKLMELGSQESSAYILLSSIYTALGRSDDVERVRRLMK-LRG  649

Query  1771  --KMPGKSWI  1794
               K PG SWI
Sbjct  650   VNKEPGCSWI  659


 Score =   224 bits (571),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 146/514 (28%), Positives = 251/514 (49%), Gaps = 10/514 (2%)
 Frame = +1

Query  127   SYQLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNED  306
             S  LL     +F  LL + +R  + +   K +HA +L+T      +    ++  YA    
Sbjct  2     SLYLLPPQHRSFFDLLLRYTR-QKDLQKGKAIHAQLLRTGSCCSVYLTNSLVNLYAKCGS  60

Query  307   IVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAF--QLFKDMLDSGTRPDNFTFACIL  480
             ++ A+ +F+    + +  WN +I  Y++     ++F  +LF+ M    T P+  TF+ + 
Sbjct  61    LLKAKLVFESISNKDVVSWNCLINGYSQKGTVGSSFVMELFQRMRAENTLPNAHTFSGVF  120

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
              A S   +  G    H   + +    D    S L++ Y K+G L +A KVFD I E ++V
Sbjct  121   TAASSSPETFGGLQAHALAIKTSNFYDVFVGSSLINMYCKIGCLLDARKVFDTIPERNIV  180

Query  661   QWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLC  840
              W +MISG+       +A  LF+ M+R     D F Y G++  L  P L+R GK +H L 
Sbjct  181   SWATMISGYAMERMALEAWELFLLMRREEGAHDKFIYTGVLSALTVPDLVRYGKQIHCLA  240

Query  841   LKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKAL  1020
             LK G  S A VG+ LV+MY +C C+  A + F+   + D +TWSAMI G +Q+GD  +AL
Sbjct  241   LKNGLLSIASVGNALVTMYGKCGCLDDALKTFELSGDKDDITWSAMITGYAQAGDSDEAL  300

Query  1021  DFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMY  1200
               F  M++ G K        V++A + +  ++ G++ HG++++ GY  ++   +AL+DMY
Sbjct  301   KLFYNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYERQIYFMTALVDMY  360

Query  1201  SKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATF  1380
             +KCG L    + F  +   +I+ + SMIS    +G    A  ++   ++ E   P E T 
Sbjct  361   AKCGSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCR-MQMEGILPHELTM  419

Query  1381  SALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQ  1560
             +++L AC     +  G++       ++G   +      +  +    G +E+   L+    
Sbjct  420   ASVLRACSSLAALEQGKQ-IHAQTIKYGFSLEVPIGSALSTMYAKCGSVEDG-NLVFRRM  477

Query  1561  GPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDN  1662
                D   W A++S    +G     G+ A  LF+ 
Sbjct  478   PTRDIMTWNAMISGLSQNGE----GLKALELFEE  507



>ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Vitis vinifera]
Length=686

 Score =   323 bits (828),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/518 (36%), Positives = 284/518 (55%), Gaps = 2/518 (0%)
 Frame = +1

Query  247   LSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFK  426
             L H  +    I+R      D    R LF +  Q +IFLWN++IR       F +A + + 
Sbjct  42    LCHDNYLLNMILRCSFDFSDTNYTRFLFHQIKQPNIFLWNTMIRGLVSNDCFDDAIEFYG  101

Query  427   DMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLG  606
              M   G  P+NFTF  +L+AC+   D      +H  VV  G + D    + LV  Y+K G
Sbjct  102   LMRSEGFLPNNFTFPFVLKACARLLDLQLGVKIHTLVVKGGFDCDVFVKTSLVCLYAKCG  161

Query  607   PLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIM  786
              LE+A KVFD I + ++V W ++ISG+  +G +++A+ +F ++  M   PDSFT V ++ 
Sbjct  162   YLEDAHKVFDDIPDKNVVSWTAIISGYIGVGKFREAIDMFRRLLEMNLAPDSFTIVRVLS  221

Query  787   CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVT  966
                    L  G+ +H   ++ G   N  VG+ LV MY++C  M  A  +FD + E D+V+
Sbjct  222   ACTQLGDLNSGEWIHKCIMEMGMVRNVFVGTSLVDMYAKCGNMEKARSVFDGMPEKDIVS  281

Query  967   WSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAV  1146
             W AMI G + +G   +A+D F +M  +  K D   +  VLSA A+L  ++ G    G   
Sbjct  282   WGAMIQGYALNGLPKEAIDLFLQMQRENVKPDCYTVVGVLSACARLGALELGEWVSGLVD  341

Query  1147  RCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQ  1326
             R  +     + +ALID+Y+KCG ++   +VFK M  K+ + +N++IS L ++G    +F 
Sbjct  342   RNEFLYNPVLGTALIDLYAKCGSMSRAWEVFKGMKEKDRVVWNAIISGLAMNGYVKISFG  401

Query  1327  IFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKL  1506
             +F +V EK    PD  TF  LLC C H GLV +GRRYF  M   F + P  EHY  MV L
Sbjct  402   LFGQV-EKLGIKPDGNTFIGLLCGCTHAGLVDEGRRYFNSMYRFFSLTPSIEHYGCMVDL  460

Query  1507  LGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYG  1686
             LG AG L+EA++LI+++    +  +WGALL  C IH + +L  +  K L + +   S   
Sbjct  461   LGRAGLLDEAHQLIRNMPMEANAIVWGALLGACRIHRDTQLAELALKQLIELEPWNSGNY  520

Query  1687  VMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWIS  1797
             V++SN+Y+ + +W+   K+R+ M E    K PG SWI 
Sbjct  521   VLLSNIYSANLKWDEAAKVRLSMNEKRIQKPPGCSWIE  558


 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 126/262 (48%), Gaps = 2/262 (1%)
 Frame = +1

Query  202  ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
            +++ + +H  I++  +  + F  T ++  YA   ++  AR +FD  P++ I  W ++I+ 
Sbjct  229  LNSGEWIHKCIMEMGMVRNVFVGTSLVDMYAKCGNMEKARSVFDGMPEKDIVSWGAMIQG  288

Query  382  YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
            YA       A  LF  M     +PD +T   +L AC+          V G V  +    +
Sbjct  289  YALNGLPKEAIDLFLQMQRENVKPDCYTVVGVLSACARLGALELGEWVSGLVDRNEFLYN  348

Query  562  SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
             +  + L+  Y+K G +  A +VF G+ E D V WN++ISG    G  K +  LF ++++
Sbjct  349  PVLGTALIDLYAKCGSMSRAWEVFKGMKEKDRVVWNAIISGLAMNGYVKISFGLFGQVEK  408

Query  742  MGEKPDSFTYVGLIMCLDCPSLLRIGKN-VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
            +G KPD  T++GL+       L+  G+   +S+   F    +      +V +  R   + 
Sbjct  409  LGIKPDGNTFIGLLCGCTHAGLVDEGRRYFNSMYRFFSLTPSIEHYGCMVDLLGRAGLLD  468

Query  919  SACRIFDSL-LEPDMVTWSAMI  981
             A ++  ++ +E + + W A++
Sbjct  469  EAHQLIRNMPMEANAIVWGALL  490



>ref|XP_006479094.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Citrus sinensis]
 ref|XP_006479095.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X2 [Citrus sinensis]
 ref|XP_006479096.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X3 [Citrus sinensis]
Length=1077

 Score =   332 bits (850),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/531 (34%), Positives = 288/531 (54%), Gaps = 4/531 (1%)
 Frame = +1

Query  208   TTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYA  387
             T + LH+  +K  +S        ++  Y    D+ +A + F  T   ++ LWN ++ AY 
Sbjct  420   TGEQLHSYAIKVGISKDIIVEGSMLDLYVKCSDVETAYKFFLTTETENVVLWNVMLVAYG  479

Query  388   RAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSI  567
             + +  S +FQ+FK M   G  P+ +T+  ILR C+     S    +H  V+ +G + +  
Sbjct  480   QLNDLSESFQIFKQMQTEGLTPNQYTYPTILRTCTSLGALSLGEQIHTQVIKTGFQFNVY  539

Query  568   CSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMG  747
               S L+  Y+KLG L  A ++   + E D+V W +MI G    G + +AL LF +M+  G
Sbjct  540   VCSVLIDMYAKLGNLNTAQEILRRLPEDDVVSWTAMIVGFVQHGMFGEALELFEEMENQG  599

Query  748   EKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
              + D+  +   I        L  G+ +H+     GF  +  +G+ L+S+Y+RC  +  A 
Sbjct  600   IQSDNIGFSSAISACAGIQALNQGRQIHAQSYISGFSDDLSIGNALISLYARCGRIQEAY  659

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLA  1107
              +F+ +   D ++W+ +I G +QSG    AL  F +M   G + +     SV+SAAA LA
Sbjct  660   LVFNKIDAKDNISWNGLISGFAQSGYCEGALQVFSQMIRVGVQANLYTFGSVVSAAANLA  719

Query  1108  IVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMIS  1287
              ++ G++ H   ++ GY  E   S++LI +Y+KCG ++   + F  MP KN +S+N+MI+
Sbjct  720   NIKQGKQVHAMIIKTGYDSETEASNSLITLYAKCGSIDDAKRGFLEMPEKNEVSWNAMIT  779

Query  1288  NLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGI  1467
                 HG A EA  +FE+ ++K    P+  TF  +L AC H GLV +G RYF  M+ E+G+
Sbjct  780   GFSQHGYALEAINLFEK-MKKHDVMPNHVTFVGVLSACSHVGLVNEGLRYFESMSTEYGL  838

Query  1468  QPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAK  1647
              PK EHY  +V LLG AG L  A E  + +    D  +W  LLS C +H N  +G   A 
Sbjct  839   VPKPEHYACVVDLLGRAGSLSRAREFTEQMPIEPDAMVWRTLLSACRVHKNMEIGEYAAN  898

Query  1648  HLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDME--AIKGKMPGKSWI  1794
             HL + + E S+  V++SN+YA  G+W+C  ++R  M+   +K K PG+SWI
Sbjct  899   HLLELEPEDSATYVLLSNIYAAAGKWDCRDQIRQIMKDRGVK-KEPGQSWI  948


 Score =   211 bits (538),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 133/474 (28%), Positives = 233/474 (49%), Gaps = 7/474 (1%)
 Frame = +1

Query  211   TKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYAR  390
              K +H  ILK           +I   Y  + D+ SA  +FD+  +R++F WN +I  +  
Sbjct  116   AKKIHGKILKLGFDGEQVLCDKIFNIYLASGDLDSAMNIFDDMSKRTVFSWNKLISGFVS  175

Query  391   AHRFSNAFQLFKDMLDSGTRPDNFTFACILRAC--SDKFDFSGLRVVHGGVVVSGLELDS  564
                      LF  M+D    P+  TF  +LRAC  S       +  +HG ++  G     
Sbjct  176   KKLSGRVLGLFLQMIDDDVIPNEATFVGVLRACIGSGNVAVQCVNQIHGLIISHGFGGSP  235

Query  565   ICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRM  744
             + S+ L+  Y+K G ++ A KVF+ +   D V W +MISG    G  ++A+LLF +M  +
Sbjct  236   LISNPLIDLYAKNGFIDSAKKVFNNLCFKDSVSWVAMISGFSQNGYEREAILLFCQMHIL  295

Query  745   GEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSA  924
             G  P  +     +       L  IG+  H L  K+GF S   V + LV++YSR   + SA
Sbjct  296   GTVPTPYAISSALSACTKIELFEIGEQFHGLIFKWGFSSETFVCNALVTLYSRSGNLTSA  355

Query  925   CRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQL  1104
              +IF  + + D VT++++I GL+Q G   KAL+ F +M +   K D + +AS++SA A +
Sbjct  356   EQIFSKMQQRDGVTYNSLISGLAQCGYSDKALELFEKMQLDCLKPDCVTVASLVSACASV  415

Query  1105  AIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMI  1284
                + G + H +A++ G   ++ V  +++D+Y KC  +    + F    ++N++ +N M+
Sbjct  416   GAFRTGEQLHSYAIKVGISKDIIVEGSMLDLYVKCSDVETAYKFFLTTETENVVLWNVML  475

Query  1285  SNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFG  1464
                G   + +E+FQIF++ ++ E   P++ T+  +L  C   G +  G +       + G
Sbjct  476   VAYGQLNDLSESFQIFKQ-MQTEGLTPNQYTYPTILRTCTSLGALSLGEQ-IHTQVIKTG  533

Query  1465  IQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGI-WGALLSCCDIHGNY  1623
              Q        ++ +    G L  A E+++ +  P D  + W A++     HG +
Sbjct  534   FQFNVYVCSVLIDMYAKLGNLNTAQEILRRL--PEDDVVSWTAMIVGFVQHGMF  585


 Score =   202 bits (514),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 139/530 (26%), Positives = 253/530 (48%), Gaps = 17/530 (3%)
 Frame = +1

Query  73    AI*TGFGRIAFSRDIVWRSYQLLHQMFIAFRSLLTQLSRSNQTISTTKL--------LHA  228
             A+ +GF +  + R+ +     L  QM I   ++ T  + S+   + TK+         H 
Sbjct  271   AMISGFSQNGYEREAIL----LFCQMHI-LGTVPTPYAISSALSACTKIELFEIGEQFHG  325

Query  229   IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSN  408
             +I K   S   F    ++  Y+ + ++ SA ++F +  QR    +NS+I   A+      
Sbjct  326   LIFKWGFSSETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVTYNSLISGLAQCGYSDK  385

Query  409   AFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVS  588
             A +LF+ M     +PD  T A ++ AC+    F     +H   +  G+  D I    ++ 
Sbjct  386   ALELFEKMQLDCLKPDCVTVASLVSACASVGAFRTGEQLHSYAIKVGISKDIIVEGSMLD  445

Query  589   AYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFT  768
              Y K   +E A K F      ++V WN M+  +G L D  ++  +F +MQ  G  P+ +T
Sbjct  446   LYVKCSDVETAYKFFLTTETENVVLWNVMLVAYGQLNDLSESFQIFKQMQTEGLTPNQYT  505

Query  769   YVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLL  948
             Y  ++        L +G+ +H+  +K GF  N +V S+L+ MY++   + +A  I   L 
Sbjct  506   YPTILRTCTSLGALSLGEQIHTQVIKTGFQFNVYVCSVLIDMYAKLGNLNTAQEILRRLP  565

Query  949   EPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRE  1128
             E D+V+W+AMI G  Q G   +AL+ F EM  +G + D +  +S +SA A +  +  GR+
Sbjct  566   EDDVVSWTAMIVGFVQHGMFGEALELFEEMENQGIQSDNIGFSSAISACAGIQALNQGRQ  625

Query  1129  THGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGN  1308
              H  +   G+  ++S+ +ALI +Y++CG +     VF  + +K+ IS+N +IS     G 
Sbjct  626   IHAQSYISGFSDDLSIGNALISLYARCGRIQEAYLVFNKIDAKDNISWNGLISGFAQSGY  685

Query  1309  ANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHY  1488
                A Q+F +++ +     +  TF +++ A  +   +  G++    M  + G   +TE  
Sbjct  686   CEGALQVFSQMI-RVGVQANLYTFGSVVSAAANLANIKQGKQ-VHAMIIKTGYDSETEAS  743

Query  1489  VYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
               ++ L    G +++A      +    +   W A+++    HG Y L  I
Sbjct  744   NSLITLYAKCGSIDDAKRGFLEMPEKNEVS-WNAMITGFSQHG-YALEAI  791


 Score =   161 bits (408),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/428 (24%), Positives = 207/428 (48%), Gaps = 5/428 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
              +S  + +H  ++KT    + +  + +I  YA   ++ +A+ +    P+  +  W ++I 
Sbjct  518   ALSLGEQIHTQVIKTGFQFNVYVCSVLIDMYAKLGNLNTAQEILRRLPEDDVVSWTAMIV  577

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              + +   F  A +LF++M + G + DN  F+  + AC+     +  R +H    +SG   
Sbjct  578   GFVQHGMFGEALELFEEMENQGIQSDNIGFSSAISACAGIQALNQGRQIHAQSYISGFSD  637

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             D    + L+S Y++ G ++EA  VF+ I   D + WN +ISG    G  + AL +F +M 
Sbjct  638   DLSIGNALISLYARCGRIQEAYLVFNKIDAKDNISWNGLISGFAQSGYCEGALQVFSQMI  697

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             R+G + + +T+  ++      + ++ GK VH++ +K G+DS     + L+++Y++C  + 
Sbjct  698   RVGVQANLYTFGSVVSAAANLANIKQGKQVHAMIIKTGYDSETEASNSLITLYAKCGSID  757

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A R F  + E + V+W+AMI G SQ G  ++A++ F +M       + +    VLSA +
Sbjct  758   DAKRGFLEMPEKNEVSWNAMITGFSQHGYALEAINLFEKMKKHDVMPNHVTFVGVLSACS  817

Query  1099  QLAIVQPG-RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIISY  1272
              + +V  G R     +   G   +    + ++D+  + G L+   +  + MP   + + +
Sbjct  818   HVGLVNEGLRYFESMSTEYGLVPKPEHYACVVDLLGRAGSLSRAREFTEQMPIEPDAMVW  877

Query  1273  NSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMN  1452
              +++S   +H N          +LE E   P+++    LL          D R   R + 
Sbjct  878   RTLLSACRVHKNMEIGEYAANHLLELE---PEDSATYVLLSNIYAAAGKWDCRDQIRQIM  934

Query  1453  DEFGIQPK  1476
              + G++ +
Sbjct  935   KDRGVKKE  942


 Score =   158 bits (399),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/346 (27%), Positives = 183/346 (53%), Gaps = 3/346 (1%)
 Frame = +1

Query  403   SNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQL  582
             S   +L + M + G + ++ TF  +L  C         + +HG ++  G + + +   ++
Sbjct  79    SKGIELLRVMEERGIQANSQTFVWLLEGCLSYGSLLEAKKIHGKILKLGFDGEQVLCDKI  138

Query  583   VSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDS  762
              + Y   G L+ A+ +FD +++  +  WN +ISG        + L LF++M      P+ 
Sbjct  139   FNIYLASGDLDSAMNIFDDMSKRTVFSWNKLISGFVSKKLSGRVLGLFLQMIDDDVIPNE  198

Query  763   FTYVGLI-MCLDCPSL-LRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
              T+VG++  C+   ++ ++    +H L +  GF  +  + + L+ +Y++   + SA ++F
Sbjct  199   ATFVGVLRACIGSGNVAVQCVNQIHGLIISHGFGGSPLISNPLIDLYAKNGFIDSAKKVF  258

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             ++L   D V+W AMI G SQ+G   +A+  F +M++ G    P  I+S LSA  ++ + +
Sbjct  259   NNLCFKDSVSWVAMISGFSQNGYEREAILLFCQMHILGTVPTPYAISSALSACTKIELFE  318

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              G + HG   + G+  E  V +AL+ +YS+ G L    Q+F  M  ++ ++YNS+IS L 
Sbjct  319   IGEQFHGLIFKWGFSSETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVTYNSLISGLA  378

Query  1297  LHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
               G +++A ++FE+ ++ +   PD  T ++L+ AC   G    G +
Sbjct  379   QCGYSDKALELFEK-MQLDCLKPDCVTVASLVSACASVGAFRTGEQ  423


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/264 (23%), Positives = 126/264 (48%), Gaps = 2/264 (1%)
 Frame = +1

Query  196  QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
            Q ++  + +HA    +  S        +I  YA    I  A  +F++   +    WN +I
Sbjct  618  QALNQGRQIHAQSYISGFSDDLSIGNALISLYARCGRIQEAYLVFNKIDAKDNISWNGLI  677

Query  376  RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
              +A++     A Q+F  M+  G + + +TF  ++ A ++  +    + VH  ++ +G +
Sbjct  678  SGFAQSGYCEGALQVFSQMIRVGVQANLYTFGSVVSAAANLANIKQGKQVHAMIIKTGYD  737

Query  556  LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
             ++  S+ L++ Y+K G +++A + F  + E + V WN+MI+G    G   +A+ LF KM
Sbjct  738  SETEASNSLITLYAKCGSIDDAKRGFLEMPEKNEVSWNAMITGFSQHGYALEAINLFEKM  797

Query  736  QRMGEKPDSFTYVGLIMCLDCPSLLRIG-KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
            ++    P+  T+VG++       L+  G +   S+  ++G        + +V +  R   
Sbjct  798  KKHDVMPNHVTFVGVLSACSHVGLVNEGLRYFESMSTEYGLVPKPEHYACVVDLLGRAGS  857

Query  913  MGSACRIFDSL-LEPDMVTWSAMI  981
            +  A    + + +EPD + W  ++
Sbjct  858  LSRAREFTEQMPIEPDAMVWRTLL  881



>ref|XP_008366040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Malus domestica]
Length=877

 Score =   328 bits (840),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 188/527 (36%), Positives = 288/527 (55%), Gaps = 5/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  + K            ++ FY  N  I  AR++FDE   R +  WNS+I AY     
Sbjct  225   IHGYLYKLGFGSDNTVGNSLMAFYFKNRRIEXARKVFDELCDRDVISWNSMISAYVSNGL  284

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                  ++F+ M+  G   D  T   +L AC    + S  R +H   + +  + D +  + 
Sbjct  285   AEKGVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNN  344

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  YSK G L  AI+VF  + E  +V W SMI+GH   G   +A+ LF +M+R G  PD
Sbjct  345   VLDMYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPD  404

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             ++T   ++        L+ G+++H+   + G DS+ +V + L+ MY++C  M  A  +F 
Sbjct  405   AYTITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYAKCGSMEDAHSVFS  464

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              +   D+V+W+ MI G S++    +AL  F EM M+  K D + IASVL A A LA +  
Sbjct  465   RMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEM-MQKSKPDSMTIASVLPACASLAALNR  523

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  +R GY  E  V++AL+DMY KCG L L   +F  +P K++IS+  + +  G+
Sbjct  524   GQEIHGHILRNGYFSERHVANALVDMYVKCGVLVLARLLFDXIPVKDLISWTVIXAGYGM  583

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   EA   F E + K    PD  +F ++L AC H+GL  +  R+F  M +++GI PK 
Sbjct  584   HGFGREAIAAFNE-MRKAGIEPDSVSFISILYACSHSGLXDEAWRFFDTMRNDYGIVPKL  642

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LL   G L +AY+ I+++    D  IWG+LL  C IH + +L   VA+H+F+
Sbjct  643   EHYACMVDLLSRTGNLTKAYKFIKTMPIEPDATIWGSLLCGCRIHHDVKLAEKVAEHVFE  702

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKL--RVDMEAIKGKMPGKSWI  1794
              + E + Y V+++N+YA   +WE VK L  R+    +K K PG SWI
Sbjct  703   LEPENTGYYVLLANIYAEAEKWEEVKMLRERITRRGLK-KNPGCSWI  748


 Score =   209 bits (531),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 211/410 (51%), Gaps = 2/410 (0%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + +L     ++   K +H++I    +        +++  Y    D+  ARR+FD+     
Sbjct  108   VVELCAGMMSLQDGKXVHSVICDNGVEADGQLGAKLVFMYVKCGDLREARRVFDKLSNGK  167

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
             +F+WN +I  YA+   F     LF  M + G + +++TF+C+L+  S          +HG
Sbjct  168   VFVWNLMINEYAKVRNFREGVYLFGKMQELGIQANSYTFSCVLKCFSALGCVREGEWIHG  227

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              +   G   D+   + L++ Y K   +E A KVFD + + D++ WNSMIS +   G  +K
Sbjct  228   YLYKLGFGSDNTVGNSLMAFYFKNRRIEXARKVFDELCDRDVISWNSMISAYVSNGLAEK  287

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
              + +F +M  +G   D  T + ++M       L +G+ +H+  +K  FD +    + ++ 
Sbjct  288   GVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNNVLD  347

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             MYS+C  + SA ++F  + E  +V+W++MI G  + G   +A+  F EM   G   D   
Sbjct  348   MYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPDAYT  407

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
             I S+L A A    ++ GR+ H +    G    + V + L+DMY+KCG +     VF  MP
Sbjct  408   ITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYAKCGSMEDAHSVFSRMP  467

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             +K+I+S+N+MI     +   NEA ++F E+++K    PD  T +++L AC
Sbjct  468   AKDIVSWNTMIGGYSKNCLPNEALKLFSEMMQKS--KPDSMTIASVLPAC  515


 Score =   182 bits (463),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/411 (27%), Positives = 208/411 (51%), Gaps = 5/411 (1%)
 Frame = +1

Query  364   NSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVV  543
             N+ I  Y       +A ++      S    D   +  ++  C+        + VH  +  
Sbjct  73    NAKINKYCEMGNLKSAMEMVSGAQKS--ELDLEAYCSVVELCAGMMSLQDGKXVHSVICD  130

Query  544   SGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             +G+E D    ++LV  Y K G L EA +VFD ++   +  WN MI+ +  + ++++ + L
Sbjct  131   NGVEADGQLGAKLVFMYVKCGDLREARRVFDKLSNGKVFVWNLMINEYAKVRNFREGVYL  190

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             F KMQ +G + +S+T+  ++ C      +R G+ +H    K GF S+  VG+ L++ Y +
Sbjct  191   FGKMQELGIQANSYTFSCVLKCFSALGCVREGEWIHGYLYKLGFGSDNTVGNSLMAFYFK  250

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASV  1083
              + +  A ++FD L + D+++W++MI     +G   K ++ FR+M   G  VD   I +V
Sbjct  251   NRRIEXARKVFDELCDRDVISWNSMISAYVSNGLAEKGVEIFRQMVSLGIDVDLATIINV  310

Query  1084  LSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNI  1263
             L A      +  GR  H +A++  +  +V   + ++DMYSKCG L+  IQVFK M  +++
Sbjct  311   LMACVAGGNLSLGRALHAYAIKASFDEDVMFCNNVLDMYSKCGDLSSAIQVFKKMGERSV  370

Query  1264  ISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFR  1443
             +S+ SMI+     G ++EA  +F E +E++  NPD  T +++L AC  +G +  GR    
Sbjct  371   VSWTSMIAGHIREGLSDEAIGLFSE-MERDGVNPDAYTITSILHACASSGSLKKGRDIHN  429

Query  1444  IMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
              +  E G+         ++ +    G +E+A+ +   +    D   W  ++
Sbjct  430   YIK-EHGMDSSLYVCNTLMDMYAKCGSMEDAHSVFSRMPAK-DIVSWNTMI  478



>gb|KDP40584.1| hypothetical protein JCGZ_24583 [Jatropha curcas]
Length=815

 Score =   326 bits (836),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 192/546 (35%), Positives = 298/546 (55%), Gaps = 6/546 (1%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             + L +L   N  +   K +H  ++ + LS + F  T ++  YA       A ++FD   +
Sbjct  145   TYLLKLCGDNSDLRRGKEIHGQLITSGLSWNQFAMTGVVNLYAKCRKTDDAYKMFDRMSE  204

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             R +  WN+II  YA+      A QL   + + G RPD+ T   IL A ++       + +
Sbjct  205   RDLVCWNTIISGYAQNGLPEVALQLVPRIFEEGHRPDSITIVSILPAVANIKSLRIGKAI  264

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             HG V+ +G E     S+ LV  YSK   +  A  +FDG+    +V WNSMI G    GD 
Sbjct  265   HGYVIRAGFESLVNTSTALVDMYSKCESVGTARVIFDGMNRRTVVTWNSMIDGCVQSGDP  324

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSL  882
             ++A+ LF KM   G +P   T + ++  C D   L + GK VH L  +   DSN  V + 
Sbjct  325   QEAMALFQKMLDEGFQPSDVTLMEVLHACADLGDLEQ-GKFVHKLVDELKLDSNVSVMNS  383

Query  883   LVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVD  1062
             L+SMYSRCK +  A  IF +L    +V+W+AMI G +Q+G + +AL+ F EM  +  K D
Sbjct  384   LISMYSRCKRVDIAANIFKNLQNKTLVSWNAMILGYAQNGLVDEALNSFCEMQSRNIKPD  443

Query  1063  PLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFK  1242
                + SV+ A A+L+I +  +  HG  +R      V V +AL+DMYSKCG ++   ++F 
Sbjct  444   SFTMVSVIPALAELSIPRQAKWIHGVIIRRFLDKNVFVMTALVDMYSKCGAIHTARKLFD  503

Query  1243  AMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVC  1422
              M  +++I++N+M+   G HG    A ++F E +E+    P++ TF  +L AC H+GLV 
Sbjct  504   MMSERHVITWNAMVDAYGTHGLGKAAVELFRE-MERGSIKPNDITFLCVLSACSHSGLVE  562

Query  1423  DGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSC  1602
             +G +YF  M +++G++P  +HY  MV LLG AG L EA++ IQ +    +  ++GA+L  
Sbjct  563   EGLQYFASMKNDYGLEPSMDHYGAMVDLLGRAGRLNEAWDFIQKMPVEPEITVYGAMLGA  622

Query  1603  CDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KM  1776
             C IH N  LG   A  LF+   ++  Y V+++N+YA    WE + ++R  M   KG  K 
Sbjct  623   CKIHKNVELGEKAANKLFELNPDEGGYHVLLANIYATASMWEKLAEVRTMMRK-KGLQKT  681

Query  1777  PGKSWI  1794
             PG S +
Sbjct  682   PGCSLV  687


 Score =   203 bits (516),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/401 (29%), Positives = 210/401 (52%), Gaps = 4/401 (1%)
 Frame = +1

Query  205   STTKLLHAI---ILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
             ++ K LH I   I+K    +   + T+++  +     +  A  +F+    +   L+++++
Sbjct  54    TSIKELHQILPLIIKNGFYNEELFQTKLVSLFCKYGSLTEAACVFEHVDDKLEALYHTML  113

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
             + YA+      A   F  M      P  + F  +L+ C D  D    + +HG ++ SGL 
Sbjct  114   KGYAKNSSLDAALSFFCRMKHDNVEPVVYNFTYLLKLCGDNSDLRRGKEIHGQLITSGLS  173

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              +    + +V+ Y+K    ++A K+FD ++E DLV WN++ISG+   G  + AL L  ++
Sbjct  174   WNQFAMTGVVNLYAKCRKTDDAYKMFDRMSERDLVCWNTIISGYAQNGLPEVALQLVPRI  233

Query  736   QRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCM  915
                G +PDS T V ++  +     LRIGK +H   ++ GF+S  +  + LV MYS+C+ +
Sbjct  234   FEEGHRPDSITIVSILPAVANIKSLRIGKAIHGYVIRAGFESLVNTSTALVDMYSKCESV  293

Query  916   GSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAA  1095
             G+A  IFD +    +VTW++MI G  QSGD  +A+  F++M  +G +   + +  VL A 
Sbjct  294   GTARVIFDGMNRRTVVTWNSMIDGCVQSGDPQEAMALFQKMLDEGFQPSDVTLMEVLHAC  353

Query  1096  AQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYN  1275
             A L  ++ G+  H           VSV ++LI MYS+C  +++   +FK + +K ++S+N
Sbjct  354   ADLGDLEQGKFVHKLVDELKLDSNVSVMNSLISMYSRCKRVDIAANIFKNLQNKTLVSWN  413

Query  1276  SMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCA  1398
             +MI     +G  +EA   F E ++     PD  T  +++ A
Sbjct  414   AMILGYAQNGLVDEALNSFCE-MQSRNIKPDSFTMVSVIPA  453



>gb|EYU18632.1| hypothetical protein MIMGU_mgv1a022910mg, partial [Erythranthe 
guttata]
Length=582

 Score =   320 bits (820),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/540 (34%), Positives = 295/540 (55%), Gaps = 11/540 (2%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE-TPQRSIFLWNS  369
             NQ +S  + LH+ ++ T     P  AT +I  Y+    +  A  +F+  T   ++F++NS
Sbjct  1     NQELSPGRKLHSFMIVTGYLSSPVSATSLINMYSKCNSVADAVSVFNSSTDVHNVFVYNS  60

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             II         + AF+ +  M   G  PD FT  C+++ACS+  D   L+ +HG +    
Sbjct  61    IIAGLTANDLPAQAFEFYCRMRSFGVAPDKFTLPCVIKACSNVAD---LKSIHGLLFKLE  117

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAE-PDLVQWNSMISGHGCLGDWKKALLLF  726
             L LD    S L+ +Y K   + +A++VF+ +    D+V WN+MI+G+  +GD+ KALL++
Sbjct  118   LGLDLFIGSALIHSYLKFELMNDALQVFEKLPIIDDIVLWNAMINGYVQIGDFDKALLIY  177

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
             I+M   G  P+ FT  G++  L     L  GK+VH+  +K GF+S   V + L+ MY +C
Sbjct  178   IRMAETGLVPNRFTITGVLSALALAGELCNGKSVHAFTVKTGFESGLAVLNALIDMYGKC  237

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
             + +  A  +F++++E DM +W+++I    Q GD    L   ++M + G + D + + + L
Sbjct  238   RQLSDASMVFENMIEKDMYSWNSIISVHEQCGDHDGTLRLLKQMFISGFQPDIVTVTAAL  297

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHL--EVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
              A + LA +  GRE HG+ +  G          +A++DMY+KCG +     VF  M +K+
Sbjct  298   PACSHLAALMHGREVHGYMITSGLDKVGNTYTVNAIMDMYAKCGSMREARLVFDRMRNKD  357

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYF  1440
               S+N M+   GLHG+ NEA ++F  + +     PDE +F   L AC H G V  G+   
Sbjct  358   AASWNIMVMGYGLHGHGNEALELFSRMCQSG-LKPDEISFVGALVACSHAGFVIKGKELL  416

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
               M  ++G+ P  EHY  ++ +LG AG+L EA+ELI ++    +  +W A LS C IHGN
Sbjct  417   EEMEPKYGVAPAIEHYACVIDMLGRAGQLVEAFELISNMSIEPNQVVWRAFLSSCRIHGN  476

Query  1621  YRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--EAIKGKMPGKSWI  1794
               L  + A+ + +   +     V++SN+Y   GR+E V +LR  M  + +K K PG SWI
Sbjct  477   ADLAEVAARRVLEVGSDHCGNYVLMSNIYGAAGRYEEVAELRHTMRQQDVK-KSPGCSWI  535



>ref|XP_009352737.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Pyrus x bretschneideri]
Length=879

 Score =   327 bits (839),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 188/527 (36%), Positives = 289/527 (55%), Gaps = 5/527 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H  + K            ++ FY  N  I SA ++FDE   R +  WNS+I AY     
Sbjct  227   IHGYLYKLGFGSDNTVGNSLMAFYFKNRRIESACKVFDELCDRDVISWNSMISAYVSNGL  286

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                  ++F+ M+  G   D  T   +L AC    + S  R +H   + +  + D +  + 
Sbjct  287   AEKGVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNN  346

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  YSK G L  AI+VF  + E  +V W SMI+GH   G   +A+ LF +M+R G  PD
Sbjct  347   VLDMYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPD  406

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             ++T   ++        L+ G+++H+   + G DS+ +V + L+ MY++C  M  A  +F 
Sbjct  407   AYTITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYAKCGSMEDAHSVFS  466

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              +   D+V+W+ MI G S++    +AL  F EM M+  K D + IAS+L A A LA +  
Sbjct  467   RMPAKDIVSWNTMIGGYSKNCLPNEALKLFSEM-MQKSKPDSMTIASILPACASLAALNR  525

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HG  +R GY  E  V++AL+DMY KCG L L   +F   P K++IS+  +++  G+
Sbjct  526   GQEIHGHILRNGYFSERHVANALVDMYVKCGVLVLARLLFDMFPVKDLISWTVIVAGYGM  585

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   EA   F E + K    PD  +F ++L AC H+GL  +  R+F  M +++GI PK 
Sbjct  586   HGFGREAIAAFNE-MRKAGTEPDGVSFVSILYACSHSGLRDEAWRFFDTMRNDYGIVPKL  644

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV LL   G L +AY+ I+++    D  IWG+LL  C IH + +L   VA+H+F+
Sbjct  645   EHYACMVDLLSRTGNLTKAYKFIKTMPIEPDATIWGSLLCGCRIHHDVKLAEKVAEHVFE  704

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKL--RVDMEAIKGKMPGKSWI  1794
              + E + Y V+++N+YA   +WE VKKL  R+    +K K PG SWI
Sbjct  705   LEPENTGYYVLLANIYAEAEKWEEVKKLRERITRRGLK-KNPGCSWI  750


 Score =   209 bits (532),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 211/410 (51%), Gaps = 2/410 (0%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + +L     ++   K +H++I    +        +++  Y    D+  ARR+FD+     
Sbjct  110   VVELCAGMMSLQDGKKVHSVICDNGVEADGQLGAKLVFMYVKCGDLREARRVFDKLSNGK  169

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
             +F+WN +I  YA+   F     LF  M + G + +++TF+C+L+  S          +HG
Sbjct  170   VFVWNLMINEYAKVRNFREGVYLFGKMQELGIQANSYTFSCVLKCFSALGCVREGEWIHG  229

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              +   G   D+   + L++ Y K   +E A KVFD + + D++ WNSMIS +   G  +K
Sbjct  230   YLYKLGFGSDNTVGNSLMAFYFKNRRIESACKVFDELCDRDVISWNSMISAYVSNGLAEK  289

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
              + +F +M  +G   D  T + ++M       L +G+ +H+  +K  FD +    + ++ 
Sbjct  290   GVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCNNVLD  349

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             MYS+C  + SA ++F  + E  +V+W++MI G  + G   +A+  F EM   G   D   
Sbjct  350   MYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSEMERDGVNPDAYT  409

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
             I S+L A A    ++ GR+ H +    G    + V + L+DMY+KCG +     VF  MP
Sbjct  410   ITSILHACASSGSLKKGRDIHNYIKEHGMDSSLYVCNTLMDMYAKCGSMEDAHSVFSRMP  469

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             +K+I+S+N+MI     +   NEA ++F E+++K    PD  T +++L AC
Sbjct  470   AKDIVSWNTMIGGYSKNCLPNEALKLFSEMMQKS--KPDSMTIASILPAC  517


 Score =   188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/378 (29%), Positives = 200/378 (53%), Gaps = 3/378 (1%)
 Frame = +1

Query  463   TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
              +  ++  C+        + VH  +  +G+E D    ++LV  Y K G L EA +VFD +
Sbjct  106   AYCSVVELCAGMMSLQDGKKVHSVICDNGVEADGQLGAKLVFMYVKCGDLREARRVFDKL  165

Query  643   AEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGK  822
             +   +  WN MI+ +  + ++++ + LF KMQ +G + +S+T+  ++ C      +R G+
Sbjct  166   SNGKVFVWNLMINEYAKVRNFREGVYLFGKMQELGIQANSYTFSCVLKCFSALGCVREGE  225

Query  823   NVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSG  1002
              +H    K GF S+  VG+ L++ Y + + + SAC++FD L + D+++W++MI     +G
Sbjct  226   WIHGYLYKLGFGSDNTVGNSLMAFYFKNRRIESACKVFDELCDRDVISWNSMISAYVSNG  285

Query  1003  DIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSS  1182
                K ++ FR+M   G  VD   I +VL A      +  GR  H +A++  +  +V   +
Sbjct  286   LAEKGVEIFRQMVSLGIDVDLATIINVLMACVAGGNLSLGRALHAYAIKASFDEDVMFCN  345

Query  1183  ALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
              ++DMYSKCG L+  IQVFK M  ++++S+ SMI+     G ++EA  +F E +E++  N
Sbjct  346   NVLDMYSKCGDLSSAIQVFKKMGERSVVSWTSMIAGHIREGLSDEAIGLFSE-MERDGVN  404

Query  1363  PDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYE  1542
             PD  T +++L AC  +G +  GR     +  E G+         ++ +    G +E+A+ 
Sbjct  405   PDAYTITSILHACASSGSLKKGRDIHNYIK-EHGMDSSLYVCNTLMDMYAKCGSMEDAHS  463

Query  1543  LIQSIQGPVDFGIWGALL  1596
             +   +    D   W  ++
Sbjct  464   VFSRMPAK-DIVSWNTMI  480



>ref|XP_007022988.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY25610.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=805

 Score =   326 bits (835),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 279/526 (53%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +++   L      A  ++  Y+    +  A +LF   PQ  +  WN +I  Y +   
Sbjct  228   LHGLVVCCGLEFDSVVANALLSMYSKCGWLSDAHKLFGMMPQADLVSWNGMISGYVQNGF  287

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
               +A  LF +M+ SG +PD  TF+  L A +    F   + +HG ++  G+ LD    S 
Sbjct  288   MQDASCLFNEMISSGLKPDAITFSSFLPAVTGLGCFRKGKEIHGYILRHGVSLDVFLKSA  347

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A KV++   E D+V   +MISG+   G    AL +F  + +   +P+
Sbjct  348   LIDVYFKCRDVEMARKVYNQRTEVDVVMCTAMISGYVLNGMNNDALEIFRWLLKEKIRPN  407

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             + T   ++      + L++GK +H   +K G D   HVGS ++ MY++C  +     IF 
Sbjct  408   AVTLASVLPACADLAALKVGKELHGYIIKNGLDCGCHVGSAVIDMYAKCGRLDVTHDIFR  467

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L E D V W++MI   SQ+G   KA+D F  M   G K D + I++ LSA A L  +  
Sbjct  468   RLSERDSVCWNSMITSCSQNGKPEKAIDLFCWMGSTGMKYDCVSISAALSACANLPALHY  527

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HGF ++  +  +    SALIDMY+KCG L     VF  M  KN +S+NS+I+  G 
Sbjct  528   GKEIHGFMIKGSFCSDPFAKSALIDMYAKCGNLGSSQHVFDMMEEKNEVSWNSIIAAYGN  587

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   +   +F E+L+ E   PD  TF A++ AC H G V DG  YF+ M +E+GI  + 
Sbjct  588   HGRLEDCLALFHEMLKNE-IQPDHVTFLAIISACGHAGKVDDGIHYFQSMTEEYGITARM  646

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  +V L G AG L EA+E I+S+    D G+WG LL  C  HGN  L    ++HLFD
Sbjct  647   EHYACVVDLFGRAGRLNEAFETIKSMPFSPDAGVWGTLLGACRNHGNVELAEFASRHLFD  706

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                + S Y V++SN+ A  G W  V K+R  M E    K+PG SWI
Sbjct  707   LDPQNSGYYVLLSNLLADAGHWGSVLKIRSLMKERGVQKVPGYSWI  752


 Score =   220 bits (560),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 201/372 (54%), Gaps = 0/372 (0%)
 Frame = +1

Query  217   LLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAH  396
             L+H  I+      + F  + +I FY  N  +  AR LFD+ P R   LWN ++  Y +  
Sbjct  126   LIHEAIMSMGFEVNVFVGSSLINFYVENGHVDRARPLFDKIPVRDCVLWNVMLNGYVKCE  185

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
                 A ++F++M    T+PD  TFA I   C+ +        +HG VV  GLE DS+ ++
Sbjct  186   ELDKAMEIFEEMRKGETKPDEVTFAAIFSLCASEGMVDFGTQLHGLVVCCGLEFDSVVAN  245

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKP  756
              L+S YSK G L +A K+F  + + DLV WN MISG+   G  + A  LF +M   G KP
Sbjct  246   ALLSMYSKCGWLSDAHKLFGMMPQADLVSWNGMISGYVQNGFMQDASCLFNEMISSGLKP  305

Query  757   DSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIF  936
             D+ T+   +  +      R GK +H   L+ G   +  + S L+ +Y +C+ +  A +++
Sbjct  306   DAITFSSFLPAVTGLGCFRKGKEIHGYILRHGVSLDVFLKSALIDVYFKCRDVEMARKVY  365

Query  937   DSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQ  1116
             +   E D+V  +AMI G   +G    AL+ FR +  +  + + + +ASVL A A LA ++
Sbjct  366   NQRTEVDVVMCTAMISGYVLNGMNNDALEIFRWLLKEKIRPNAVTLASVLPACADLAALK  425

Query  1117  PGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLG  1296
              G+E HG+ ++ G      V SA+IDMY+KCG L++   +F+ +  ++ + +NSMI++  
Sbjct  426   VGKELHGYIIKNGLDCGCHVGSAVIDMYAKCGRLDVTHDIFRRLSERDSVCWNSMITSCS  485

Query  1297  LHGNANEAFQIF  1332
              +G   +A  +F
Sbjct  486   QNGKPEKAIDLF  497


 Score =   163 bits (413),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 115/441 (26%), Positives = 213/441 (48%), Gaps = 14/441 (3%)
 Frame = +1

Query  310   VSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFT---FACIL  480
             V AR + +E       L    +  Y R   F++A  +F  +     +  N        ++
Sbjct  57    VHARLILNEITTTDPLL----LAMYLRCGSFNDAKNMFYRIDLGCVKRWNLMIRGLVKMV  112

Query  481   RACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLV  660
             +ACS   +     ++H  ++  G E++    S L++ Y + G ++ A  +FD I   D V
Sbjct  113   KACSGLNNVRFGTLIHEAIMSMGFEVNVFVGSSLINFYVENGHVDRARPLFDKIPVRDCV  172

Query  661   QWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLC  840
              WN M++G+    +  KA+ +F +M++   KPD  T+  +        ++  G  +H L 
Sbjct  173   LWNVMLNGYVKCEELDKAMEIFEEMRKGETKPDEVTFAAIFSLCASEGMVDFGTQLHGLV  232

Query  841   LKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKAL  1020
             +  G + ++ V + L+SMYS+C  +  A ++F  + + D+V+W+ MI G  Q+G +  A 
Sbjct  233   VCCGLEFDSVVANALLSMYSKCGWLSDAHKLFGMMPQADLVSWNGMISGYVQNGFMQDAS  292

Query  1021  DFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMY  1200
               F EM   G K D +  +S L A   L   + G+E HG+ +R G  L+V + SALID+Y
Sbjct  293   CLFNEMISSGLKPDAITFSSFLPAVTGLGCFRKGKEIHGYILRHGVSLDVFLKSALIDVY  352

Query  1201  SKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATF  1380
              KC  + +  +V+      +++   +MIS   L+G  N+A +IF  +L KE   P+  T 
Sbjct  353   FKCRDVEMARKVYNQRTEVDVVMCTAMISGYVLNGMNNDALEIFRWLL-KEKIRPNAVTL  411

Query  1381  SALLCACCHTGLVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQS  1554
             +++L AC     +  G+    + I N   G+         ++ +    G L+  +++ + 
Sbjct  412   ASVLPACADLAALKVGKELHGYIIKN---GLDCGCHVGSAVIDMYAKCGRLDVTHDIFRR  468

Query  1555  IQGPVDFGIWGALLSCCDIHG  1617
             +    D   W ++++ C  +G
Sbjct  469   LS-ERDSVCWNSMITSCSQNG  488


 Score =   145 bits (367),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 180/378 (48%), Gaps = 16/378 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  IL+  +S   F  + +I  Y    D+  AR+++++  +  + +  ++I  Y   
Sbjct  327   KEIHGYILRHGVSLDVFLKSALIDVYFKCRDVEMARKVYNQRTEVDVVMCTAMISGYVLN  386

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                ++A ++F+ +L    RP+  T A +L AC+D       + +HG ++ +GL+      
Sbjct  387   GMNNDALEIFRWLLKEKIRPNAVTLASVLPACADLAALKVGKELHGYIIKNGLDCGCHVG  446

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S ++  Y+K G L+    +F  ++E D V WNSMI+     G  +KA+ LF  M   G K
Sbjct  447   SAVIDMYAKCGRLDVTHDIFRRLSERDSVCWNSMITSCSQNGKPEKAIDLFCWMGSTGMK  506

Query  754   PDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
              D  +    L  C + P+ L  GK +H   +K  F S+    S L+ MY++C  +GS+  
Sbjct  507   YDCVSISAALSACANLPA-LHYGKEIHGFMIKGSFCSDPFAKSALIDMYAKCGNLGSSQH  565

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             +FD + E + V+W+++I      G +   L  F EM     + D +   +++SA      
Sbjct  566   VFDMMEEKNEVSWNSIIAAYGNHGRLEDCLALFHEMLKNEIQPDHVTFLAIISACGHAGK  625

Query  1111  VQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNII  1266
             V  G        E +G   R  ++      + ++D++ + G LN   +  K+MP S +  
Sbjct  626   VDDGIHYFQSMTEEYGITARMEHY------ACVVDLFGRAGRLNEAFETIKSMPFSPDAG  679

Query  1267  SYNSMISNLGLHGNANEA  1320
              + +++     HGN   A
Sbjct  680   VWGTLLGACRNHGNVELA  697



>gb|KHN22863.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=701

 Score =   323 bits (828),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 192/552 (35%), Positives = 300/552 (54%), Gaps = 5/552 (1%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             +LL  L+ S       +L   +     L  + + AT++   YA+   +  A+ +FD+   
Sbjct  27    TLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKLAACYAVCGHMPYAQHIFDQIVL  86

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             ++ FLWNS+IR YA  +  S A  L+  ML  G +PDNFT+  +L+AC D       R V
Sbjct  87    KNSFLWNSMIRGYACNNSPSRALFLYLKMLHFGQKPDNFTYPFVLKACGDLLLREMGRKV  146

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             H  VVV GLE D    + ++S Y K G +E A  VFD +   DL  WN+M+SG    G+ 
Sbjct  147   HALVVVGGLEEDVYVGNSILSMYFKFGDVEAARVVFDRMLVRDLTSWNTMMSGFVKNGEA  206

Query  706   KKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
             + A  +F  M+R G   D  T + L+        L++GK +H   ++ G       G L+
Sbjct  207   RGAFEVFGDMRRDGFVGDRTTLLALLSACGDVMDLKVGKEIHGYVVRNGESGRVCNGFLM  266

Query  886   ---VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
                + MY  C+ +  A ++F+ L   D+V+W+++I G  + GD  +AL+ F  M + G  
Sbjct  267   NSIIDMYCNCESVSCARKLFEGLRVKDVVSWNSLISGYEKCGDAFQALELFGRMVVVGAV  326

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
              D + + SVL+A  Q++ ++ G     + V+ GY + V V +ALI MY+ CG L   + V
Sbjct  327   PDEVTVISVLAACNQISALRLGATVQSYVVKRGYVVNVVVGTALIGMYANCGSLVCELLV  386

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F  MP KN+ +   M++  G+HG   EA  IF E+L K    PDE  F+A+L AC H+GL
Sbjct  387   FDEMPEKNLPACTVMVTGFGIHGRGREAISIFYEMLGKG-VTPDEGIFTAVLSACSHSGL  445

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
             V +G+  F  M  ++ ++P+  HY  +V LLG AG L+EAY +I++++   +  +W ALL
Sbjct  446   VDEGKEIFYKMTRDYSVEPRPTHYSCLVDLLGRAGYLDEAYAVIENMKLKPNEDVWTALL  505

Query  1597  SCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GK  1773
             S C +H N +L  I A+ LF+   +  S  V +SN+YA + RWE V+ +R  +   +  K
Sbjct  506   SACRLHRNVKLAVISAQKLFELNPDGVSGYVCLSNIYAAERRWEDVENVRALVAKRRLRK  565

Query  1774  MPGKSWISNIKM  1809
              P  S++   KM
Sbjct  566   PPSYSFVELNKM  577


 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 172/320 (54%), Gaps = 5/320 (2%)
 Frame = +1

Query  454   DNFTFACILRACSDKFDFSGLRVVHGGVVVSG-LELDSICSSQLVSAYSKLGPLEEAIKV  630
             D+     +L++ ++    +    +H  V   G L  ++  +++L + Y+  G +  A  +
Sbjct  21    DSLQCGTLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKLAACYAVCGHMPYAQHI  80

Query  631   FDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL  810
             FD I   +   WNSMI G+ C     +AL L++KM   G+KPD+FTY  ++       L 
Sbjct  81    FDQIVLKNSFLWNSMIRGYACNNSPSRALFLYLKMLHFGQKPDNFTYPFVLKACGDLLLR  140

Query  811   RIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGL  990
              +G+ VH+L +  G + + +VG+ ++SMY +   + +A  +FD +L  D+ +W+ M+ G 
Sbjct  141   EMGRKVHALVVVGGLEEDVYVGNSILSMYFKFGDVEAARVVFDRMLVRDLTSWNTMMSGF  200

Query  991   SQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEV  1170
              ++G+   A + F +M   G   D   + ++LSA   +  ++ G+E HG+ VR G    V
Sbjct  201   VKNGEARGAFEVFGDMRRDGFVGDRTTLLALLSACGDVMDLKVGKEIHGYVVRNGESGRV  260

Query  1171  S---VSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 + +++IDMY  C  ++   ++F+ +  K+++S+NS+IS     G+A +A ++F  +
Sbjct  261   CNGFLMNSIIDMYCNCESVSCARKLFEGLRVKDVVSWNSLISGYEKCGDAFQALELFGRM  320

Query  1342  LEKEYYNPDEATFSALLCAC  1401
             +      PDE T  ++L AC
Sbjct  321   VVVGAV-PDEVTVISVLAAC  339



>ref|XP_010662541.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 
[Vitis vinifera]
 ref|XP_002268072.2| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 
[Vitis vinifera]
 ref|XP_010662542.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 
[Vitis vinifera]
 ref|XP_010662543.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 
[Vitis vinifera]
Length=593

 Score =   320 bits (819),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 190/560 (34%), Positives = 311/560 (56%), Gaps = 15/560 (3%)
 Frame = +1

Query  139   LHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSA  318
             ++ M+     LL  + R  +TI + K +HA ++ + L H  F  +++  F+  +   V  
Sbjct  1     MNTMYFLKLRLLNSIHRC-KTIRSLKQIHAHLIASGLLHDEFVLSKVSEFFGKHIGFVDY  59

Query  319   RRLFDETPQRSIFL----WNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRA  486
                FD   Q  + +    +N++I AYA +     AF ++  ++ +G  PD +TF  +L+A
Sbjct  60    A--FDFLNQTDLHVGTLPYNTLIAAYASSCTPKAAFLVYGRIVGNGFVPDMYTFPVVLKA  117

Query  487   CSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQW  666
             C+          VHG  V  G   D    + L+  YS  G    A +VFD +   D+V W
Sbjct  118   CTKFLGVQEGEQVHGVAVKMGFLCDLYVQNSLLHFYSVCGKWGGAGRVFDEMLVRDVVSW  177

Query  667   NSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLK  846
               +ISG+   G + +A+ LF+KM  +   P+  T+V +++       L +GK VH L  K
Sbjct  178   TGLISGYVRTGLFDEAINLFLKMDVV---PNVATFVSVLVACGRMGYLSMGKGVHGLVYK  234

Query  847   FGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDF  1026
               F     VG+ LV MY +C+C+  A ++FD L + D+V+W+++I GL Q      +L+ 
Sbjct  235   RAFGIGLVVGNALVDMYVKCECLCEARKLFDELPDRDIVSWTSIISGLVQCKQPKDSLEL  294

Query  1027  FREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSK  1206
             F +M + G + D +++ SVLSA A L  +  GR    +  R G   ++ + +AL+DMY+K
Sbjct  295   FYDMQISGVEPDRIILTSVLSACASLGALDYGRWVQEYIERQGIEWDIHIGTALVDMYAK  354

Query  1207  CGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSA  1386
             CG + + + +F  +P++NI ++N+++  L +HG+ +EA + FE ++      P+E TF A
Sbjct  355   CGCIEMALHIFNGIPNRNIFTWNALLGGLAMHGHGHEALKHFELMIGAG-IRPNEVTFLA  413

Query  1387  LLCACCHTGLVCDGRRYF-RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQG  1563
             +L ACCH+GLV +GR YF ++++  F   P+ EHY  M+ LL  AG L+EAY+ I+++  
Sbjct  414   ILTACCHSGLVAEGRSYFYQMISQPFNFSPRLEHYGCMIDLLCRAGLLDEAYKFIRNMPL  473

Query  1564  PVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKL  1743
             P D  IWGALLS C  +GN  L   +  HL + K + S   V++SN+YA + RW+ V ++
Sbjct  474   PPDVLIWGALLSACKANGNVELSQEILSHLLELKSQDSGVYVLLSNIYATNERWDDVTRV  533

Query  1744  RVDMEAIKG--KMPGKSWIS  1797
             R  M+  KG  K PG S I 
Sbjct  534   RRLMKD-KGIRKFPGSSVIE  552



>ref|XP_008811840.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Phoenix dactylifera]
Length=773

 Score =   325 bits (832),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 175/523 (33%), Positives = 298/523 (57%), Gaps = 5/523 (1%)
 Frame = +1

Query  187   RSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWN  366
             ++ Q +   K +H+++ K     + F +  +I  Y+    + +A + F E P R +  WN
Sbjct  107   KACQDLDVAKNMHSLVFKMGFVWNVFVSASLIHVYSRFGSLGNAEKAFGEMPYRDLGSWN  166

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             +++  +    +   A ++F++M+      D  T + IL  C+   +      +H  V+  
Sbjct  167   AMVSGFCLNGKAVEALRVFEEMIREEVGMDKVTISSILPVCAQLENLLMGMSIHVHVIKR  226

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             GL  D   ++ L+  Y+KL  L+EA +VFDG+ E DL+ WNS+I+G+   G+   AL LF
Sbjct  227   GLNSDIFVANALIDMYAKLDCLDEARRVFDGMEEKDLITWNSIIAGYEQAGNPSMALKLF  286

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFD-SNAHVGSLLVSMYSR  903
               M+  G +PD  T V L   +      R G++VH   ++ G+D  +  VG+ +V MY++
Sbjct  287   DMMKECGIEPDILTLVSLASAVAQLGDNRRGRSVHCYVMRRGWDGDDIVVGNAMVDMYAK  346

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL--LIA  1077
                +  A  +F+ +   D+++W+ +I G SQ+G   +A++ +  M    G V P    + 
Sbjct  347   LTNIKPAQEVFNRMPAKDVISWNTLIAGYSQNGLANEAIETYEYMEKYEG-VAPSQGTLV  405

Query  1078  SVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSK  1257
             SVL A + +  +Q G   HG ++  G  ++V V++ L+DMY+KCG L   + +F+ +P +
Sbjct  406   SVLPACSHVGALQQGMRIHGRSIHIGLEVDVFVATCLVDMYAKCGRLQDAMLLFERVPKR  465

Query  1258  NIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRY  1437
             +   +N++I+  G+HG+ ++A  +F + +++E   PD+ TF +LL AC H GLV  GR+ 
Sbjct  466   STGPWNAIIAGHGVHGHGDKALGLFSD-MQQEGVKPDQVTFVSLLSACSHAGLVDQGRQC  524

Query  1438  FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
             F+IM   +GI+P T+HY  MV LLG AG+L+ AYE I+S+    D G+WGA L  C IHG
Sbjct  525   FQIMQTTYGIKPATKHYACMVDLLGRAGQLDAAYEFIKSMSLRPDSGVWGAFLGACRIHG  584

Query  1618  NYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR  1746
             N  +G +V+ +LF+   E   Y V++SNMYA  G+W+ V ++R
Sbjct  585   NVEMGALVSNYLFEVDPENVGYYVLLSNMYAKVGKWDGVDEVR  627


 Score =   229 bits (583),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 252/479 (53%), Gaps = 13/479 (3%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   + LH++ +    +     +T+++  Y+   D+ S+  +F+ +P +++  WNS+I 
Sbjct  12    SLRLARPLHSLFIVAGRTGDSLLSTKLLNLYSRLGDLPSSILVFEHSPAKNVVSWNSMIS  71

Query  379   AYARAHRFSNAFQLFKDMLDS-GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLE  555
              Y R   FS A   F+ +L + G RPD FTF   L+AC D  D +  + +H  V   G  
Sbjct  72    CYVRHGLFSQAVGCFRRLLATPGIRPDAFTFPVTLKACQD-LDVA--KNMHSLVFKMGFV  128

Query  556   LDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKM  735
              +   S+ L+  YS+ G L  A K F  +   DL  WN+M+SG    G   +AL +F +M
Sbjct  129   WNVFVSASLIHVYSRFGSLGNAEKAFGEMPYRDLGSWNAMVSGFCLNGKAVEALRVFEEM  188

Query  736   QRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
              R     D  T   ++ +C    +LL +G ++H   +K G +S+  V + L+ MY++  C
Sbjct  189   IREEVGMDKVTISSILPVCAQLENLL-MGMSIHVHVIKRGLNSDIFVANALIDMYAKLDC  247

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
             +  A R+FD + E D++TW+++I G  Q+G+   AL  F  M   G + D L + S+ SA
Sbjct  248   LDEARRVFDGMEEKDLITWNSIIAGYEQAGNPSMALKLFDMMKECGIEPDILTLVSLASA  307

Query  1093  AAQLAIVQPGRETHGFAVRCGYH-LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
              AQL   + GR  H + +R G+   ++ V +A++DMY+K   +    +VF  MP+K++IS
Sbjct  308   VAQLGDNRRGRSVHCYVMRRGWDGDDIVVGNAMVDMYAKLTNIKPAQEVFNRMPAKDVIS  367

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +N++I+    +G ANEA + +E + + E   P + T  ++L AC H G +  G    RI 
Sbjct  368   WNTLIAGYSQNGLANEAIETYEYMEKYEGVAPSQGTLVSVLPACSHVGALQQG---MRIH  424

Query  1450  NDEFGIQPKTEHYVY--MVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGN  1620
                  I  + + +V   +V +    G L++A  L + +      G W A+++   +HG+
Sbjct  425   GRSIHIGLEVDVFVATCLVDMYAKCGRLQDAMLLFERVP-KRSTGPWNAIIAGHGVHGH  482


 Score = 95.1 bits (235),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 110/207 (53%), Gaps = 6/207 (3%)
 Frame = +1

Query  790   LDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTW  969
             L CPSL R+ + +HSL +  G   ++ + + L+++YSR   + S+  +F+     ++V+W
Sbjct  8     LTCPSL-RLARPLHSLFIVAGRTGDSLLSTKLLNLYSRLGDLPSSILVFEHSPAKNVVSW  66

Query  970   SAMICGLSQSGDIMKALDFFRE-MNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAV  1146
             ++MI    + G   +A+  FR  +   G + D       L A   L +    +  H    
Sbjct  67    NSMISCYVRHGLFSQAVGCFRRLLATPGIRPDAFTFPVTLKACQDLDV---AKNMHSLVF  123

Query  1147  RCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQ  1326
             + G+   V VS++LI +YS+ G L    + F  MP +++ S+N+M+S   L+G A EA +
Sbjct  124   KMGFVWNVFVSASLIHVYSRFGSLGNAEKAFGEMPYRDLGSWNAMVSGFCLNGKAVEALR  183

Query  1327  IFEEVLEKEYYNPDEATFSALLCACCH  1407
             +FEE++ +E    D+ T S++L  C  
Sbjct  184   VFEEMIREE-VGMDKVTISSILPVCAQ  209



>ref|XP_002272819.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 
[Vitis vinifera]
Length=633

 Score =   321 bits (822),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 187/530 (35%), Positives = 284/530 (54%), Gaps = 8/530 (2%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFY-ALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAH  396
             +HA ++K+ L    F    ++  Y  L  D    R++FD    + +  W S+I  Y R  
Sbjct  81    IHAHVIKSGLEFDRFVGNSLLTLYFKLGTDFPETRKVFDGLFVKDVISWTSMISGYVRVG  140

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
             +  N+ +LF  ML  G  P+ FT + +++ACS+  D    R+ HG V+  G + + + +S
Sbjct  141   KPMNSLELFWKMLAYGVEPNAFTLSAVIKACSELGDLKLGRIFHGVVLGRGFDSNYVIAS  200

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR-MGEK  753
              L+  + +   L++A ++FD + EPD + W S+IS       + +AL  F  MQR  G  
Sbjct  201   ALIDMHGRNCALDDARQLFDELLEPDAICWTSIISALTRNDFFDEALRFFYSMQRDHGMC  260

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PD FT+  ++        L+ GK VH+  +  GF  N  V S LV MY +C  +G + RI
Sbjct  261   PDGFTFGTVLTACGNLGRLKQGKEVHAKVITTGFCGNVVVESSLVDMYGKCGSVGESQRI  320

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD +   + V+WSA++ G  Q+GD    +  FR+M     KVD     ++L   A LA V
Sbjct  321   FDRMPIKNSVSWSALLGGYCQNGDFKSVIQIFRKME----KVDLYCFGTILRTCAGLAAV  376

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E H   +R G   +V V SAL+D+Y+KCG +     +F  MP +N+I++NSMI   
Sbjct  377   RQGKEVHCQYIRKGGWRDVIVESALVDLYAKCGCIEYAQTIFDQMPVRNLITWNSMIGGF  436

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G   EA +IF +++ KE   PD  +F  +L AC H GLV +GR YF  M  ++GI+ 
Sbjct  437   AQNGRGEEALRIFNQMV-KEGIKPDYISFIGILFACSHRGLVDEGREYFISMTKDYGIKV  495

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
               EHY  MV LLG AG LEEA  LI++     D  +W ALL  C    NY +   +AK +
Sbjct  496   GIEHYSCMVDLLGRAGLLEEAEILIETSDFRDDSSLWAALLGACTTCTNYEIAERIAKRV  555

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWISN  1800
              + + +     V+++N+Y   GRW    ++R  M+     KMPGKSWI  
Sbjct  556   MELEPDYHLSYVLLANVYKAVGRWNDALRIRRLMKDRGVNKMPGKSWIET  605


 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 179/358 (50%), Gaps = 7/358 (2%)
 Frame = +1

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             S I    ++   S A QL K +           +A +L+ C+    F+    +H  V+ S
Sbjct  29    SKILQLCKSGELSGALQLLKSIDPGEISAKPVLYASLLQTCTKVLAFNHGLQIHAHVIKS  88

Query  547   GLELDSICSSQLVSAYSKLGP-LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             GLE D    + L++ Y KLG    E  KVFDG+   D++ W SMISG+  +G    +L L
Sbjct  89    GLEFDRFVGNSLLTLYFKLGTDFPETRKVFDGLFVKDVISWTSMISGYVRVGKPMNSLEL  148

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             F KM   G +P++FT   +I        L++G+  H + L  GFDSN  + S L+ M+ R
Sbjct  149   FWKMLAYGVEPNAFTLSAVIKACSELGDLKLGRIFHGVVLGRGFDSNYVIASALIDMHGR  208

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV-DPLLIAS  1080
                +  A ++FD LLEPD + W+++I  L+++    +AL FF  M    G   D     +
Sbjct  209   NCALDDARQLFDELLEPDAICWTSIISALTRNDFFDEALRFFYSMQRDHGMCPDGFTFGT  268

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             VL+A   L  ++ G+E H   +  G+   V V S+L+DMY KCG +    ++F  MP KN
Sbjct  269   VLTACGNLGRLKQGKEVHAKVITTGFCGNVVVESSLVDMYGKCGSVGESQRIFDRMPIKN  328

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
              +S+++++     +G+     QIF ++ + + Y      F  +L  C     V  G+ 
Sbjct  329   SVSWSALLGGYCQNGDFKSVIQIFRKMEKVDLY-----CFGTILRTCAGLAAVRQGKE  381


 Score =   155 bits (393),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 170/338 (50%), Gaps = 8/338 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             ++ H ++L      +   A+ +I  +  N  +  AR+LFDE  +     W SII A  R 
Sbjct  181   RIFHGVVLGRGFDSNYVIASALIDMHGRNCALDDARQLFDELLEPDAICWTSIISALTRN  240

Query  394   HRFSNAFQLFKDM-LDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
               F  A + F  M  D G  PD FTF  +L AC +       + VH  V+ +G   + + 
Sbjct  241   DFFDEALRFFYSMQRDHGMCPDGFTFGTVLTACGNLGRLKQGKEVHAKVITTGFCGNVVV  300

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
              S LV  Y K G + E+ ++FD +   + V W++++ G+   GD+K  + +F KM    E
Sbjct  301   ESSLVDMYGKCGSVGESQRIFDRMPIKNSVSWSALLGGYCQNGDFKSVIQIFRKM----E  356

Query  751   KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
             K D + +  ++      + +R GK VH   ++ G   +  V S LV +Y++C C+  A  
Sbjct  357   KVDLYCFGTILRTCAGLAAVRQGKEVHCQYIRKGGWRDVIVESALVDLYAKCGCIEYAQT  416

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             IFD +   +++TW++MI G +Q+G   +AL  F +M  +G K D +    +L A +   +
Sbjct  417   IFDQMPVRNLITWNSMIGGFAQNGRGEEALRIFNQMVKEGIKPDYISFIGILFACSHRGL  476

Query  1111  VQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFL  1218
             V  GRE +  ++   Y ++V +   S ++D+  + G L
Sbjct  477   VDEGRE-YFISMTKDYGIKVGIEHYSCMVDLLGRAGLL  513



>ref|XP_006344830.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
[Solanum tuberosum]
Length=721

 Score =   323 bits (828),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 198/553 (36%), Positives = 308/553 (56%), Gaps = 11/553 (2%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFY-ALNEDIVSARRLFD  333
              F  + T +S    +  T K  H +  K       F  + ++  Y      +  AR++FD
Sbjct  120   TFAGIFTSVSTLGDSF-TGKQAHCLAFKLGYLSDVFVGSSLLNVYCKAGHYLGDARKMFD  178

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDML-DSGTRPDNFTFACILRACS-DKFDF  507
             E P+R+   W ++I  YA       A  +F  ML + G   + F F  +L A +  +F +
Sbjct  179   EMPERNSVSWTTMISGYALQRMVKEAVGVFSVMLWERGEDVNEFVFTSVLSAIALPEFVY  238

Query  508   SGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGH  687
              G + +H   + +G       ++  V+ Y+K G L++A   F+  +E + + W+++I+G+
Sbjct  239   VG-KQIHCLSLKNGFLWAVSVANATVTMYAKCGSLDDACWAFELSSEKNSITWSALITGY  297

Query  688   GCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA  867
                GD +KAL LF +M   G  P  +T VG++        LR GK VH   LK GF+   
Sbjct  298   AQNGDCEKALKLFSEMHYCGMNPSEYTLVGVLNACSDFDALREGKQVHGYLLKLGFEPQM  357

Query  868   HVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMK  1047
             ++ + LV MY++C  +  A R FD L EPD+V W++MI G  ++GD   A+  +  M M+
Sbjct  358   YILTALVDMYAKCGNISDARRGFDYLKEPDIVLWTSMIAGYVKNGDNESAMGMYCRMLME  417

Query  1048  GGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G   + L +ASVL A + LA ++ G++ H   V+ G++LEV + SAL  MY+K G L+ G
Sbjct  418   GVIPNELTMASVLKACSSLAALEQGKQIHAHIVKHGFNLEVPIGSALSTMYAKSGSLHDG  477

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF+ MP+++++S+NSM+S L  +G   EA ++FEE+L  E   PD  TF  +L AC H
Sbjct  478   NLVFRRMPARDLVSWNSMMSGLSQNGCGTEALELFEEMLH-EGTRPDYVTFVNILSACSH  536

Query  1408  TGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--I  1581
              GLV  G   F++M+DEFGI+P+ EH+  MV + G AGEL EA E I+S    VD G  +
Sbjct  537   MGLVKRGWSIFKMMSDEFGIEPRLEHFACMVDMFGRAGELYEAKEFIESAASHVDHGLCL  596

Query  1582  WGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEA  1761
             W  LLS C  + NY LG    + L +   ++SS  V++S++Y+  GR E V+++R  M  
Sbjct  597   WRILLSACRNYRNYELGAYAGEKLMELGSQESSAYVLLSSIYSALGRLEDVERVRRLMN-  655

Query  1762  IKG--KMPGKSWI  1794
             ++G  K PG SWI
Sbjct  656   LRGVSKEPGCSWI  668


 Score =   186 bits (471),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/421 (29%), Positives = 212/421 (50%), Gaps = 9/421 (2%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFY-ATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             ++ I   + LHA +LKT  S    Y +  I+  YA    +  A   F E   + +  WN 
Sbjct  26    SKNIPKGQSLHAHLLKTGSSSSCIYLSNSIVNLYAKCHRLSDAHLAFQEIQSKDVVSWNC  85

Query  370   IIRAYARAHRFSNAF---QLFKDMLDSGTRPDNFTFACILRACSDKFD-FSGLRVVHGGV  537
             +I  Y++  R  ++     LFK M      P+  TFA I  + S   D F+G +  H   
Sbjct  86    LINGYSQLGRRDSSLSVLNLFKLMRQENALPNPHTFAGIFTSVSTLGDSFTG-KQAHCLA  144

Query  538   VVSGLELDSICSSQLVSAYSKLGP-LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
                G   D    S L++ Y K G  L +A K+FD + E + V W +MISG+      K+A
Sbjct  145   FKLGYLSDVFVGSSLLNVYCKAGHYLGDARKMFDEMPERNSVSWTTMISGYALQRMVKEA  204

Query  715   LLLF-IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVS  891
             + +F + +   GE  + F +  ++  +  P  + +GK +H L LK GF     V +  V+
Sbjct  205   VGVFSVMLWERGEDVNEFVFTSVLSAIALPEFVYVGKQIHCLSLKNGFLWAVSVANATVT  264

Query  892   MYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLL  1071
             MY++C  +  AC  F+   E + +TWSA+I G +Q+GD  KAL  F EM+  G       
Sbjct  265   MYAKCGSLDDACWAFELSSEKNSITWSALITGYAQNGDCEKALKLFSEMHYCGMNPSEYT  324

Query  1072  IASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP  1251
             +  VL+A +    ++ G++ HG+ ++ G+  ++ + +AL+DMY+KCG ++   + F  + 
Sbjct  325   LVGVLNACSDFDALREGKQVHGYLLKLGFEPQMYILTALVDMYAKCGNISDARRGFDYLK  384

Query  1252  SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
               +I+ + SMI+    +G+   A  ++  +L  E   P+E T +++L AC     +  G+
Sbjct  385   EPDIVLWTSMIAGYVKNGDNESAMGMYCRML-MEGVIPNELTMASVLKACSSLAALEQGK  443

Query  1432  R  1434
             +
Sbjct  444   Q  444


 Score =   139 bits (349),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 98/353 (28%), Positives = 179/353 (51%), Gaps = 18/353 (5%)
 Frame = +1

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL---LFIKMQR  741
             S+ +V+ Y+K   L +A   F  I   D+V WN +I+G+  LG    +L    LF  M++
Sbjct  52    SNSIVNLYAKCHRLSDAHLAFQEIQSKDVVSWNCLINGYSQLGRRDSSLSVLNLFKLMRQ  111

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC---  912
                 P+  T+ G+   +        GK  H L  K G+ S+  VGS L+++Y  CK    
Sbjct  112   ENALPNPHTFAGIFTSVSTLGDSFTGKQAHCLAFKLGYLSDVFVGSSLLNVY--CKAGHY  169

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK-VDPLLIASVLS  1089
             +G A ++FD + E + V+W+ MI G +    + +A+  F  M  + G+ V+  +  SVLS
Sbjct  170   LGDARKMFDEMPERNSVSWTTMISGYALQRMVKEAVGVFSVMLWERGEDVNEFVFTSVLS  229

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A    V  G++ H  +++ G+   VSV++A + MY+KCG L+     F+    KN I+
Sbjct  230   AIALPEFVYVGKQIHCLSLKNGFLWAVSVANATVTMYAKCGSLDDACWAFELSSEKNSIT  289

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYY---NPDEATFSALLCACCHTGLVCDGRRYF  1440
             ++++I+    +G+  +A ++F E+    +Y   NP E T   +L AC     + +G++  
Sbjct  290   WSALITGYAQNGDCEKALKLFSEM----HYCGMNPSEYTLVGVLNACSDFDALREGKQVH  345

Query  1441  RIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
               +  + G +P+      +V +    G + +A      ++ P D  +W ++++
Sbjct  346   GYLL-KLGFEPQMYILTALVDMYAKCGNISDARRGFDYLKEP-DIVLWTSMIA  396



>ref|XP_011040529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040532.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040533.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040534.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040535.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040536.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040537.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040538.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040539.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040541.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
 ref|XP_011040542.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Populus euphratica]
Length=841

 Score =   326 bits (835),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 178/548 (32%), Positives = 303/548 (55%), Gaps = 3/548 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F  +L+ +S S   +   + LH +++++ L   P     ++  Y+    +  AR+LFD
Sbjct  247   VTFACVLS-ISCSEAVVEYGRQLHGLVVRSGLDFDPLVGNTLVTVYSKGGQLGDARKLFD  305

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
               PQ  + +WN +I  Y +     +A  LF +M+ +G +PD+ TF   L + ++      
Sbjct  306   MMPQIDLVVWNRMIGGYVQNGFMDDASMLFNEMISAGIKPDSITFTSFLPSLAESSSLRQ  365

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
             ++ +HG +V  G+ LD   +S L+  Y K G    A K+F+   + D+V + +MISG+  
Sbjct  366   IKEIHGYIVRHGVILDVYLNSALIDLYFKCGAAVVACKMFNLSTKFDIVIYTAMISGYVF  425

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
              G  K AL +F  + +    P++ T+  ++      + +++G+ +H   +K   D    V
Sbjct  426   NGMNKDALEIFRWLLQKKMIPNALTFSSILPACAGLAAIKLGRELHGYIIKNELDEKCPV  485

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
             GS +++MY++C  +  A  IF  +   D + W+++I   SQ G   +A+  FR+M M+G 
Sbjct  486   GSAIMNMYAKCGRLDLAHLIFGRISIKDAICWNSIITSFSQDGKPEEAIYLFRQMGMEGV  545

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
             K D + +++ LSA A +  +  G+E HGF ++  +  ++   SALI+MY+KCG LN+   
Sbjct  546   KYDCVTVSAALSACANIPALHYGKEIHGFMIKGAFEPDLFDMSALINMYAKCGKLNIARL  605

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTG  1413
             VF  M  KN +++NS+I+  G HG   ++  +F  +LE E   PD  TF  +L +C H G
Sbjct  606   VFNLMQEKNEVAWNSIIAAYGYHGYLADSLALFHNMLE-EGIQPDHITFLTILSSCGHAG  664

Query  1414  LVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGAL  1593
              V DG  YFR M +E+GI  + EHY  M  L G AG L+EA+E+I+S+  P    +WG L
Sbjct  665   QVEDGVHYFRCMTEEYGIPAQMEHYACMADLFGRAGHLDEAFEVIKSMPFPPAASVWGTL  724

Query  1594  LSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKG  1770
             L  C +HGN  L  + +++L D + + S Y ++++++ A  G+W  V K++  M E    
Sbjct  725   LGACRVHGNVELAEVASRYLLDLEPKNSGYYLLLTHVLADAGKWRSVHKIQHLMKERGVQ  784

Query  1771  KMPGKSWI  1794
             K+PG SWI
Sbjct  785   KVPGCSWI  792


 Score =   201 bits (511),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 133/430 (31%), Positives = 221/430 (51%), Gaps = 7/430 (2%)
 Frame = +1

Query  163   RSLLTQLSRSNQTIST----TKLLHA--IILKTHLSHHPFYATRIIRFYALNEDIVSARR  324
              SL TQL    Q  ST     K LHA  ++   +++++     +++  Y L    V A++
Sbjct  41    HSLATQLESFLQKPSTKLEQAKQLHAQFVVSGINITNNGLLGGKMLGLYVLCNSFVHAKK  100

Query  325   LFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFD  504
             LF +        WN +IR   +   F  A   +  ML  G  PD +TF  +++ CS   +
Sbjct  101   LFYQLEFYYAMPWNWMIRGLVKMGCFDFALLFYFKMLGCGVFPDKYTFPPVIKCCSGLNN  160

Query  505   FSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISG  684
                 +V+   ++  G +LD   +S L+  Y+  G LE+A   FD + + D V WN MI+G
Sbjct  161   VRLGKVIQDMILEMGFDLDMFVASSLIKLYANNGCLEDARLFFDKMIDKDCVLWNVMING  220

Query  685   HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSN  864
             +    +   A+ LF  M     KPDS T+  ++      +++  G+ +H L ++ G D +
Sbjct  221   YVQCRESDSAIKLFKDMMSSEAKPDSVTFACVLSISCSEAVVEYGRQLHGLVVRSGLDFD  280

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
               VG+ LV++YS+   +G A ++FD + + D+V W+ MI G  Q+G +  A   F EM  
Sbjct  281   PLVGNTLVTVYSKGGQLGDARKLFDMMPQIDLVVWNRMIGGYVQNGFMDDASMLFNEMIS  340

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
              G K D +   S L + A+ + ++  +E HG+ VR G  L+V ++SALID+Y KCG   +
Sbjct  341   AGIKPDSITFTSFLPSLAESSSLRQIKEIHGYIVRHGVILDVYLNSALIDLYFKCGAAVV  400

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
               ++F      +I+ Y +MIS    +G   +A +IF  +L+K+   P+  TFS++L AC 
Sbjct  401   ACKMFNLSTKFDIVIYTAMISGYVFNGMNKDALEIFRWLLQKKMI-PNALTFSSILPACA  459

Query  1405  HTGLVCDGRR  1434
                 +  GR 
Sbjct  460   GLAAIKLGRE  469


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/235 (24%), Positives = 105/235 (45%), Gaps = 5/235 (2%)
 Frame = +1

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y  C     A ++F  L     + W+ MI GL + G    AL F+ +M   G   D    
Sbjct  89    YVLCNSFVHAKKLFYQLEFYYAMPWNWMIRGLVKMGCFDFALLFYFKMLGCGVFPDKYTF  148

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS  1254
               V+   + L  V+ G+      +  G+ L++ V+S+LI +Y+  G L      F  M  
Sbjct  149   PPVIKCCSGLNNVRLGKVIQDMILEMGFDLDMFVASSLIKLYANNGCLEDARLFFDKMID  208

Query  1255  KNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
             K+ + +N MI+       ++ A ++F++++  E   PD  TF+ +L   C   +V  GR+
Sbjct  209   KDCVLWNVMINGYVQCRESDSAIKLFKDMMSSEA-KPDSVTFACVLSISCSEAVVEYGRQ  267

Query  1435  -YFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALL  1596
              +  ++       P   +   +V +    G+L +A +L   +   +D  +W  ++
Sbjct  268   LHGLVVRSGLDFDPLVGN--TLVTVYSKGGQLGDARKLFD-MMPQIDLVVWNRMI  319



>ref|XP_006843170.1| hypothetical protein AMTR_s00146p00058250 [Amborella trichopoda]
 gb|ERN04845.1| hypothetical protein AMTR_s00146p00058250 [Amborella trichopoda]
Length=380

 Score =   313 bits (801),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 240/381 (63%), Gaps = 8/381 (2%)
 Frame = +1

Query  664   WNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCL  843
             WN+MI+G+   G ++  + LFI M   G +PD F+ V +  C    S L+ G+ +H   L
Sbjct  2     WNAMINGYFQCGLYETGITLFITMVNWGIRPDGFSLVAVSSCFIDESSLKQGQGIHGFAL  61

Query  844   KFGFDS---NAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMK  1014
             K   +    N HV S LV+MY+RC C+    ++F+ +L PD++TWSA++CGL Q GD   
Sbjct  62    KTVLNEEKQNQHVISGLVAMYTRCNCLDYGIKMFNQVLHPDLITWSALLCGLFQVGDCEN  121

Query  1015  ALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALID  1194
              +  FR +   G   DP+LI+++LS+ A+ A+++ G+ETHG+  RC +     +SSALI+
Sbjct  122   GVKLFRNLIFSGITPDPILISAILSSCAKCAMLRWGKETHGYIFRCNFKDSGEISSALIN  181

Query  1195  MYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEA  1374
             MYS+CG +    Q+F+ +   N++ YNSMI+ L  HG   EA Q+F+E++ +    PD A
Sbjct  182   MYSRCGSIKSAHQIFETVSGGNLVVYNSMIAGLAAHGLGLEAIQLFDELVGRG-LRPDGA  240

Query  1375  TFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQS  1554
             TF+ LL AC H+GLV +G+  F  M   FGI P  EHYVYMV+LLG+AG+LEEAY L++ 
Sbjct  241   TFAGLLSACRHSGLVDEGQEIFEKMRGIFGILPGVEHYVYMVELLGLAGKLEEAYFLVE-  299

Query  1555  IQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECV  1734
              + P   G+WGA LS C  H +  L  + A+ L + +  K +Y V++SN+YA +GRWE V
Sbjct  300   -ERPAS-GVWGAFLSLCRDHSDVALARVAAERLLELEPRKVAYRVIMSNIYASEGRWEEV  357

Query  1735  KKLRVDM-EAIKGKMPGKSWI  1794
             +K+R +M E    K PG SWI
Sbjct  358   RKVREEMAEREMRKTPGCSWI  378


 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/352 (26%), Positives = 159/352 (45%), Gaps = 42/352 (12%)
 Frame = +1

Query  358   LWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG--  531
             +WN++I  Y +   +     LF  M++ G RPD F+   +     D+      + +HG  
Sbjct  1     MWNAMINGYFQCGLYETGITLFITMVNWGIRPDGFSLVAVSSCFIDESSLKQGQGIHGFA  60

Query  532   -GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
                V++  + +    S LV+ Y++   L+  IK+F+ +  PDL+ W++++ G   +GD +
Sbjct  61    LKTVLNEEKQNQHVISGLVAMYTRCNCLDYGIKMFNQVLHPDLITWSALLCGLFQVGDCE  120

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
               + LF  +   G  PD      ++  C  C ++LR GK  H    +  F  +  + S L
Sbjct  121   NGVKLFRNLIFSGITPDPILISAILSSCAKC-AMLRWGKETHGYIFRCNFKDSGEISSAL  179

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             ++MYSRC  + SA +IF+++   ++V +++MI GL+  G  ++A+  F E+  +G + D 
Sbjct  180   INMYSRCGSIKSAHQIFETVSGGNLVVYNSMIAGLAAHGLGLEAIQLFDELVGRGLRPDG  239

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
                A +LSA     +V  G+E   F    G                          +F  
Sbjct  240   ATFAGLLSACRHSGLVDEGQEI--FEKMRG--------------------------IFGI  271

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             +P   +  Y  M+  LGL G   EA+ + EE        P    + A L  C
Sbjct  272   LP--GVEHYVYMVELLGLAGKLEEAYFLVEE-------RPASGVWGAFLSLC  314


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 98/206 (48%), Gaps = 3/206 (1%)
 Frame = +1

Query  220  LHAIILKTHLS---HHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYAR  390
            +H   LKT L+    +    + ++  Y     +    ++F++     +  W++++    +
Sbjct  56   IHGFALKTVLNEEKQNQHVISGLVAMYTRCNCLDYGIKMFNQVLHPDLITWSALLCGLFQ  115

Query  391  AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                 N  +LF++++ SG  PD    + IL +C+        +  HG +     +     
Sbjct  116  VGDCENGVKLFRNLIFSGITPDPILISAILSSCAKCAMLRWGKETHGYIFRCNFKDSGEI  175

Query  571  SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
            SS L++ YS+ G ++ A ++F+ ++  +LV +NSMI+G    G   +A+ LF ++   G 
Sbjct  176  SSALINMYSRCGSIKSAHQIFETVSGGNLVVYNSMIAGLAAHGLGLEAIQLFDELVGRGL  235

Query  751  KPDSFTYVGLIMCLDCPSLLRIGKNV  828
            +PD  T+ GL+       L+  G+ +
Sbjct  236  RPDGATFAGLLSACRHSGLVDEGQEI  261



>ref|XP_008352297.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g21300-like [Malus domestica]
Length=672

 Score =   322 bits (824),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 189/536 (35%), Positives = 288/536 (54%), Gaps = 2/536 (0%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S   IS    LH +++   L      A  ++  Y+  +    A +LFD  P+  +  WN 
Sbjct  85    SKAMISFGTQLHGLVVACGLESDSPAANTLLAMYSKCQYFSDACKLFDMMPRTDLVTWNG  144

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +I  Y ++     A +LF+DM+ +  +PD+ TFA  L + +++ +    + +HG +V   
Sbjct  145   MISGYTQSGLMLEASRLFQDMISTSVKPDSITFASFLPSVAEQGNMKQGKEIHGYIVRHC  204

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
             + LD    S L+  Y K   +E A K+F+     D+V   +MISG    G    A  +F 
Sbjct  205   VPLDMFLQSALIDVYFKCRNVEMAFKIFNQSTRTDVVMCTTMISGFVLNGMNSDASEIFR  264

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCK  909
              + +   +P+S T   ++      + L+ GK VH   LK GFD   +VGS L+ MY++  
Sbjct  265   WLLKQKMRPNSLTVASVLPACAGLATLKFGKEVHGNILKHGFDGMCYVGSALIDMYAKSG  324

Query  910   CMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLS  1089
              +  A R+   L E D+V W++MI   SQ+G   +ALD FR+M M+  K D + I++  S
Sbjct  325   RLDLAHRVLQRLTERDVVCWNSMITSYSQNGKPEEALDLFRQMGMEDVKYDRVSISAGQS  384

Query  1090  AAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIIS  1269
             A A L     G+E H F +R  +  ++   SALIDM +KCG L+L  +VF  M  KN +S
Sbjct  385   ACANLPAFHYGKEIHSFMIRNTFSSDLFAESALIDMMTKCGNLDLARRVFDMMEEKNEVS  444

Query  1270  YNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM  1449
             +NS+IS  G HG   E+  +F ++L      PD  TF  +L AC H G V DG  YFR M
Sbjct  445   WNSIISAYGNHGRLKESLVLFHKMLGNGIL-PDHVTFLGILFACGHAGAVDDGILYFRSM  503

Query  1450  NDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRL  1629
              +E+ I  + EHY  MV LLG AG L EA E I+++    D G+WG +L  C +HGN +L
Sbjct  504   IEEYRILARLEHYACMVDLLGRAGHLHEALETIKNMPFSPDTGVWGTMLGACRLHGNVKL  563

Query  1630  GGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
                V+++LF+   + S Y +++SN+ A  G+W  V K+R  M+  +  K+P  SWI
Sbjct  564   VEEVSRYLFELAPQSSGYYILLSNILADAGKWGSVLKVRTLMKNREVQKVPRYSWI  619


 Score =   197 bits (500),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 135/471 (29%), Positives = 231/471 (49%), Gaps = 7/471 (1%)
 Frame = +1

Query  262   FYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDS  441
             F  + +I+ Y  N  I  A  LF + P +   LWN ++  Y +    +N+ ++F +M  S
Sbjct  8     FVGSSLIQLYVDNGGIQDAWHLFVKMPAKDCVLWNVMLHGYVKIGESNNSVRMFLEMRSS  67

Query  442   GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEA  621
               +P+  TFA IL  C+ K   S    +HG VV  GLE DS  ++ L++ YSK     +A
Sbjct  68    EVKPNAVTFAYILSICASKAMISFGTQLHGLVVACGLESDSPAANTLLAMYSKCQYFSDA  127

Query  622   IKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCP  801
              K+FD +   DLV WN MISG+   G   +A  LF  M     KPDS T+   +  +   
Sbjct  128   CKLFDMMPRTDLVTWNGMISGYTQSGLMLEASRLFQDMISTSVKPDSITFASFLPSVAEQ  187

Query  802   SLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMI  981
               ++ GK +H   ++     +  + S L+ +Y +C+ +  A +IF+     D+V  + MI
Sbjct  188   GNMKQGKEIHGYIVRHCVPLDMFLQSALIDVYFKCRNVEMAFKIFNQSTRTDVVMCTTMI  247

Query  982   CGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYH  1161
              G   +G    A + FR +  +  + + L +ASVL A A LA ++ G+E HG  ++ G+ 
Sbjct  248   SGFVLNGMNSDASEIFRWLLKQKMRPNSLTVASVLPACAGLATLKFGKEVHGNILKHGFD  307

Query  1162  LEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV  1341
                 V SALIDMY+K G L+L  +V + +  ++++ +NSMI++   +G   EA  +F ++
Sbjct  308   GMCYVGSALIDMYAKSGRLDLAHRVLQRLTERDVVCWNSMITSYSQNGKPEEALDLFRQM  367

Query  1342  -LEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIM-NDEFGIQPKTEHYVYMVKLLGM  1515
              +E   Y  D  + SA   AC +      G+     M  + F      E    ++ ++  
Sbjct  368   GMEDVKY--DRVSISAGQSACANLPAFHYGKEIHSFMIRNTFSSDLFAES--ALIDMMTK  423

Query  1516  AGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKV  1668
              G L+ A  +   ++   +   W +++S    HG  +   ++   +  N +
Sbjct  424   CGNLDLARRVFDMMEEKNEVS-WNSIISAYGNHGRLKESLVLFHKMLGNGI  473


 Score =   159 bits (403),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 159/285 (56%), Gaps = 1/285 (0%)
 Frame = +1

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G  +D    S L+  Y   G +++A  +F  +   D V WN M+ G+  +G+   ++ +F
Sbjct  2     GFGIDIFVGSSLIQLYVDNGGIQDAWHLFVKMPAKDCVLWNVMLHGYVKIGESNNSVRMF  61

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
             ++M+    KP++ T+  ++      +++  G  +H L +  G +S++   + L++MYS+C
Sbjct  62    LEMRSSEVKPNAVTFAYILSICASKAMISFGTQLHGLVVACGLESDSPAANTLLAMYSKC  121

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
             +    AC++FD +   D+VTW+ MI G +QSG +++A   F++M     K D +  AS L
Sbjct  122   QYFSDACKLFDMMPRTDLVTWNGMISGYTQSGLMLEASRLFQDMISTSVKPDSITFASFL  181

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
              + A+   ++ G+E HG+ VR    L++ + SALID+Y KC  + +  ++F      +++
Sbjct  182   PSVAEQGNMKQGKEIHGYIVRHCVPLDMFLQSALIDVYFKCRNVEMAFKIFNQSTRTDVV  241

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                +MIS   L+G  ++A +IF  +L K+   P+  T +++L AC
Sbjct  242   MCTTMISGFVLNGMNSDASEIFRWLL-KQKMRPNSLTVASVLPAC  285



>ref|XP_009380253.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Musa acuminata subsp. malaccensis]
Length=774

 Score =   324 bits (831),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/514 (36%), Positives = 288/514 (56%), Gaps = 5/514 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H++  +     + F +  ++  Y+    I  AR+ F+E P +    WN+++    + 
Sbjct  117   KRIHSLAFRFGFVWNVFVSASVVHMYSRLGSIDDARKAFEEMPYKDQGSWNAMLSGLCQN  176

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
              + + A ++F++M+  G   +  T + IL  C+          +H   +  GL+ D   S
Sbjct  177   GKAAEAAEVFEEMMIRGLPMNKVTVSSILPVCAPLDSLLLGAAIHVYCIKHGLDSDLFVS  236

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             +  +  Y+K G LEEA KVFDG+ + DLV WNS+ISG+   G++  AL LF  M+  G +
Sbjct  237   NAFIDMYAKTGRLEEAQKVFDGMTDMDLVTWNSIISGYEQAGEFSTALKLFDGMKESGVR  296

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNA-HVGSLLVSMYSRCKCMGSACR  930
             PD  T V L   +      R G+ VH   L+ G+DS    VG+ +V MY +     +A +
Sbjct  297   PDRLTLVTLASAVAQCGDDRTGRTVHGYILRRGWDSRGIVVGNAIVDMYGKLSKAEAARK  356

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL--LIASVLSAAAQL  1104
             +FD +L  D+++W+ +I   SQ+G   +A++ +  M  + G + P+   +ASVL A A +
Sbjct  357   VFDRMLVRDVISWNTLITSYSQNGLANEAIEIYESMQSREG-IAPIQGTLASVLPACAHV  415

Query  1105  AIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMI  1284
               +Q G + HG AVR G   +V V++ LIDMY+KCG L     +F+ +P ++   +N++I
Sbjct  416   GALQQGMKIHGRAVRTGLQSDVFVATCLIDMYAKCGRLEEATHLFEQVPRRHTGPWNAII  475

Query  1285  SNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFG  1464
             + LG+HG+   A  +F E +++E   PD+ TF +LL AC H GLV  GRR F  M    G
Sbjct  476   AGLGVHGHGQRAVSLFSE-MQEEGVKPDQVTFVSLLSACSHAGLVDLGRRCFEQMQTVHG  534

Query  1465  IQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVA  1644
             + P  +HY  MV +LG AG L+ AYELI ++    D G+WGALL  C IHGN  LG + +
Sbjct  535   LSPCLKHYACMVDMLGRAGRLDAAYELIATMPVKPDSGVWGALLGACRIHGNVELGKLAS  594

Query  1645  KHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR  1746
              HLF+   E   Y V++SNMYA  G W+ V ++R
Sbjct  595   SHLFEIDAENVGYYVLLSNMYAKAGEWDGVDEVR  628


 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 140/481 (29%), Positives = 244/481 (51%), Gaps = 11/481 (2%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNS  369
             S  T+   + LHA++L +      F +T+++  Y+   D+ SA   F   P +S+  WNS
Sbjct  10    SCATLRLARPLHALLLVSGRFDDVFLSTKLLNLYSRLGDLPSAALTFRHAPTKSVITWNS  69

Query  370   IIRAYARAHRFSNAFQLF-KDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             +I  Y       +A   F + +L S   PD FTF   ++AC   +D    + +H      
Sbjct  70    MIACYVHHGLLPDALACFHRLLLTSSACPDGFTFPVTIKAC---WDLEWGKRIHSLAFRF  126

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G   +   S+ +V  YS+LG +++A K F+ +   D   WN+M+SG    G   +A  +F
Sbjct  127   GFVWNVFVSASVVHMYSRLGSIDDARKAFEEMPYKDQGSWNAMLSGLCQNGKAAEAAEVF  186

Query  727   IKMQRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
              +M   G   +  T   ++ +C    SLL +G  +H  C+K G DS+  V +  + MY++
Sbjct  187   EEMMIRGLPMNKVTVSSILPVCAPLDSLL-LGAAIHVYCIKHGLDSDLFVSNAFIDMYAK  245

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASV  1083
                +  A ++FD + + D+VTW+++I G  Q+G+   AL  F  M   G + D L + ++
Sbjct  246   TGRLEEAQKVFDGMTDMDLVTWNSIISGYEQAGEFSTALKLFDGMKESGVRPDRLTLVTL  305

Query  1084  LSAAAQLAIVQPGRETHGFAVRCGYHLE-VSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
              SA AQ    + GR  HG+ +R G+    + V +A++DMY K        +VF  M  ++
Sbjct  306   ASAVAQCGDDRTGRTVHGYILRRGWDSRGIVVGNAIVDMYGKLSKAEAARKVFDRMLVRD  365

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR-Y  1437
             +IS+N++I++   +G ANEA +I+E +  +E   P + T +++L AC H G +  G + +
Sbjct  366   VISWNTLITSYSQNGLANEAIEIYESMQSREGIAPIQGTLASVLPACAHVGALQQGMKIH  425

Query  1438  FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHG  1617
              R +    G+Q        ++ +    G LEEA  L + +      G W A+++   +HG
Sbjct  426   GRAVRT--GLQSDVFVATCLIDMYAKCGRLEEATHLFEQVP-RRHTGPWNAIIAGLGVHG  482

Query  1618  N  1620
             +
Sbjct  483   H  483


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 135/295 (46%), Gaps = 12/295 (4%)
 Frame = +1

Query  790   LDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTW  969
             L C +L R+ + +H+L L  G   +  + + L+++YSR   + SA   F       ++TW
Sbjct  9     LSCATL-RLARPLHALLLVSGRFDDVFLSTKLLNLYSRLGDLPSAALTFRHAPTKSVITW  67

Query  970   SAMICGLSQSGDIMKALDFFREMNMKGGKV-DPLLIASVLSAAAQLAIVQPGRETHGFAV  1146
             ++MI      G +  AL  F  + +      D       + A   L   + G+  H  A 
Sbjct  68    NSMIACYVHHGLLPDALACFHRLLLTSSACPDGFTFPVTIKACWDL---EWGKRIHSLAF  124

Query  1147  RCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQ  1326
             R G+   V VS++++ MYS+ G ++   + F+ MP K+  S+N+M+S L  +G A EA +
Sbjct  125   RFGFVWNVFVSASVVHMYSRLGSIDDARKAFEEMPYKDQGSWNAMLSGLCQNGKAAEAAE  184

Query  1327  IFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKL  1506
             +FEE++ +     ++ T S++L  C     +  G     +   + G+          + +
Sbjct  185   VFEEMMIRG-LPMNKVTVSSILPVCAPLDSLLLGAA-IHVYCIKHGLDSDLFVSNAFIDM  242

Query  1507  LGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVE  1671
                 G LEEA ++   +   +D   W +++S  +  G +      A  LFD   E
Sbjct  243   YAKTGRLEEAQKVFDGMT-DMDLVTWNSIISGYEQAGEFS----TALKLFDGMKE  292



>ref|XP_010931478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial-like [Elaeis guineensis]
Length=721

 Score =   323 bits (827),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 186/544 (34%), Positives = 298/544 (55%), Gaps = 5/544 (1%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHA-IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L Q+  + +++   + LHA ++    L  + + +T++   YA+   +  AR LFD    +
Sbjct  51    LLQIITNFKSLEKGRRLHAHMVASGVLLDNTYLSTKLCAMYAICGSMADARALFDGIALK  110

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
             + FLWN ++R YA +     A  L++DML SG + DNFT+  +L AC D       + +H
Sbjct  111   NPFLWNVMVRGYACSGFPLKALDLYRDMLRSGRKADNFTYPFVLMACGDLLLIEVGKKIH  170

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
               ++V G E D   S+ L+S YSK G ++ A  +FD +   DL  WN+MISG+    D  
Sbjct  171   SQIIVCGYESDVYVSNSLLSMYSKFGEMKLAQDLFDKMLAKDLTSWNTMISGYAKNNDSV  230

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
             +AL +F  +   G   D  T + ++      + L+ GK +H+  L+   + +  + + L+
Sbjct  231   RALTVFAVLAMGGGGMDRATLLSILPACANTAALKQGKEIHAYMLRNSLEFDEFLINALI  290

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              +Y     +  A  +F+ +   D V+W+++I G ++ GD +++L  F +MN +G   D +
Sbjct  291   DVYVNSDFIAGARCLFEKISRKDTVSWNSLIAGYARHGDAVESLKLFCQMNSEGMFPDEI  350

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
              + SVL A  ++A +Q G   H +  R G+   V V +ALIDMY+KCG L+   Q F  M
Sbjct  351   TLVSVLGACDRIAALQFGWSLHAYLTRKGFDNMVIVGTALIDMYAKCGSLDCSRQAFDEM  410

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
             P KN++S+ +MIS  GLHG   EA   F E ++++   PD+ TF++++ AC H GLV + 
Sbjct  411   PMKNLVSWTAMISGYGLHGRGREAVACFNE-MKRKNMGPDKITFTSVISACSHAGLVDEA  469

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +  F  M+ E+ I P  EHY  MV LLG AG L+E Y+LI  +    +  +W A LS C 
Sbjct  470   KEIFNQMSKEYSISPSVEHYSCMVDLLGRAGHLDEVYKLILDMNVEPNVDVWVAFLSACR  529

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVD--MEAIKGKMPG  1782
             IH N  L  I A++ F    +     V +SN+YA + RW  V+++R    M  +K K PG
Sbjct  530   IHHNVELAEIAAQNAFRFNPKGIGAYVSLSNLYAVEKRWSDVERVRATARMNGLK-KPPG  588

Query  1783  KSWI  1794
              S+I
Sbjct  589   CSFI  592



>ref|XP_007022987.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007022989.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007022990.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007022991.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007022992.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY25609.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY25611.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY25612.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY25613.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY25614.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=833

 Score =   325 bits (834),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 279/526 (53%), Gaps = 2/526 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH +++   L      A  ++  Y+    +  A +LF   PQ  +  WN +I  Y +   
Sbjct  256   LHGLVVCCGLEFDSVVANALLSMYSKCGWLSDAHKLFGMMPQADLVSWNGMISGYVQNGF  315

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
               +A  LF +M+ SG +PD  TF+  L A +    F   + +HG ++  G+ LD    S 
Sbjct  316   MQDASCLFNEMISSGLKPDAITFSSFLPAVTGLGCFRKGKEIHGYILRHGVSLDVFLKSA  375

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             L+  Y K   +E A KV++   E D+V   +MISG+   G    AL +F  + +   +P+
Sbjct  376   LIDVYFKCRDVEMARKVYNQRTEVDVVMCTAMISGYVLNGMNNDALEIFRWLLKEKIRPN  435

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
             + T   ++      + L++GK +H   +K G D   HVGS ++ MY++C  +     IF 
Sbjct  436   AVTLASVLPACADLAALKVGKELHGYIIKNGLDCGCHVGSAVIDMYAKCGRLDVTHDIFR  495

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              L E D V W++MI   SQ+G   KA+D F  M   G K D + I++ LSA A L  +  
Sbjct  496   RLSERDSVCWNSMITSCSQNGKPEKAIDLFCWMGSTGMKYDCVSISAALSACANLPALHY  555

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HGF ++  +  +    SALIDMY+KCG L     VF  M  KN +S+NS+I+  G 
Sbjct  556   GKEIHGFMIKGSFCSDPFAKSALIDMYAKCGNLGSSQHVFDMMEEKNEVSWNSIIAAYGN  615

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   +   +F E+L+ E   PD  TF A++ AC H G V DG  YF+ M +E+GI  + 
Sbjct  616   HGRLEDCLALFHEMLKNE-IQPDHVTFLAIISACGHAGKVDDGIHYFQSMTEEYGITARM  674

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  +V L G AG L EA+E I+S+    D G+WG LL  C  HGN  L    ++HLFD
Sbjct  675   EHYACVVDLFGRAGRLNEAFETIKSMPFSPDAGVWGTLLGACRNHGNVELAEFASRHLFD  734

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSWI  1794
                + S Y V++SN+ A  G W  V K+R  M E    K+PG SWI
Sbjct  735   LDPQNSGYYVLLSNLLADAGHWGSVLKIRSLMKERGVQKVPGYSWI  780


 Score =   193 bits (491),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 133/490 (27%), Positives = 237/490 (48%), Gaps = 18/490 (4%)
 Frame = +1

Query  175   TQLSRSNQTIS------TTKLLHA-IILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             TQL+   Q+ S        K +HA +IL    +  P      +R  + N+    A+ +F 
Sbjct  36    TQLASFLQSTSFPSNLQQGKQVHARLILNEITTTDPLLLAMYLRCGSFND----AKNMFY  91

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
                   +  WN +IR   +   F      +  ML  G  PDNFTF  +++ACS   +   
Sbjct  92    RIDLGCVKRWNLMIRGLVKMGWFHLGLLFYFKMLGCGVSPDNFTFPSVVKACSGLNNVRF  151

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
               ++H  ++  G E++    S L++ Y + G ++ A  +FD I   D V WN M++G+  
Sbjct  152   GTLIHEAIMSMGFEVNVFVGSSLINFYVENGHVDRARPLFDKIPVRDCVLWNVMLNGYVK  211

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
               +  KA+ +F +M++   KPD  T+  +        ++  G  +H L +  G + ++ V
Sbjct  212   CEELDKAMEIFEEMRKGETKPDEVTFAAIFSLCASEGMVDFGTQLHGLVVCCGLEFDSVV  271

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
              + L+SMYS+C  +  A ++F  + + D+V+W+ MI G  Q+G +  A   F EM   G 
Sbjct  272   ANALLSMYSKCGWLSDAHKLFGMMPQADLVSWNGMISGYVQNGFMQDASCLFNEMISSGL  331

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
             K D +  +S L A   L   + G+E HG+ +R G  L+V + SALID+Y KC  + +  +
Sbjct  332   KPDAITFSSFLPAVTGLGCFRKGKEIHGYILRHGVSLDVFLKSALIDVYFKCRDVEMARK  391

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTG  1413
             V+      +++   +MIS   L+G  N+A +IF  +L KE   P+  T +++L AC    
Sbjct  392   VYNQRTEVDVVMCTAMISGYVLNGMNNDALEIFRWLL-KEKIRPNAVTLASVLPACADLA  450

Query  1414  LVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWG  1587
              +  G+    + I N   G+         ++ +    G L+  +++ + +    D   W 
Sbjct  451   ALKVGKELHGYIIKN---GLDCGCHVGSAVIDMYAKCGRLDVTHDIFRRLS-ERDSVCWN  506

Query  1588  ALLSCCDIHG  1617
             ++++ C  +G
Sbjct  507   SMITSCSQNG  516


 Score =   145 bits (367),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 180/378 (48%), Gaps = 16/378 (4%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H  IL+  +S   F  + +I  Y    D+  AR+++++  +  + +  ++I  Y   
Sbjct  355   KEIHGYILRHGVSLDVFLKSALIDVYFKCRDVEMARKVYNQRTEVDVVMCTAMISGYVLN  414

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                ++A ++F+ +L    RP+  T A +L AC+D       + +HG ++ +GL+      
Sbjct  415   GMNNDALEIFRWLLKEKIRPNAVTLASVLPACADLAALKVGKELHGYIIKNGLDCGCHVG  474

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S ++  Y+K G L+    +F  ++E D V WNSMI+     G  +KA+ LF  M   G K
Sbjct  475   SAVIDMYAKCGRLDVTHDIFRRLSERDSVCWNSMITSCSQNGKPEKAIDLFCWMGSTGMK  534

Query  754   PDSFTY-VGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
              D  +    L  C + P+ L  GK +H   +K  F S+    S L+ MY++C  +GS+  
Sbjct  535   YDCVSISAALSACANLPA-LHYGKEIHGFMIKGSFCSDPFAKSALIDMYAKCGNLGSSQH  593

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             +FD + E + V+W+++I      G +   L  F EM     + D +   +++SA      
Sbjct  594   VFDMMEEKNEVSWNSIIAAYGNHGRLEDCLALFHEMLKNEIQPDHVTFLAIISACGHAGK  653

Query  1111  VQPG-------RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNII  1266
             V  G        E +G   R  ++      + ++D++ + G LN   +  K+MP S +  
Sbjct  654   VDDGIHYFQSMTEEYGITARMEHY------ACVVDLFGRAGRLNEAFETIKSMPFSPDAG  707

Query  1267  SYNSMISNLGLHGNANEA  1320
              + +++     HGN   A
Sbjct  708   VWGTLLGACRNHGNVELA  725



>ref|XP_010091782.1| hypothetical protein L484_003842 [Morus notabilis]
 gb|EXB45758.1| hypothetical protein L484_003842 [Morus notabilis]
Length=633

 Score =   320 bits (821),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 185/553 (33%), Positives = 302/553 (55%), Gaps = 14/553 (3%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETP--  342
             L Q   +N+ +   + +H+ ++    L + P   T +I  Y+    +  A  +F+  P  
Sbjct  43    LLQACANNKDLIKGRQIHSFVITCGFLLNSPPLITSLINMYSKCGQMDDAIWVFN-CPCD  101

Query  343   -QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               R++F +N++I  +    R +     +  M + G   D FTF C++RACSD  +   +R
Sbjct  102   DDRNVFAYNAMIAGFIVNGRAAEGLVFYNRMREMGVVADKFTFPCVIRACSDLTEVLEVR  161

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              +HG +   GLELD    S LV+ Y K   +E+A ++F+ + E D+V WN+M++G+  +G
Sbjct  162   KIHGVLFKLGLELDVFAGSALVNTYLKFSLIEDAQEMFEELPERDVVLWNAMVNGYAQIG  221

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
              + KAL +F  M   G  P++FT  G++           G+ VH   +K G+DS   V +
Sbjct  222   SFDKALEVFRSMSEEGVIPNNFTVTGVLSIFAVMEDFNNGRVVHGFVIKTGYDSGTAVLN  281

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L+ +Y +CKC G A +IF+ + + D+ +W+++I    Q GD  + L  F +M   G   
Sbjct  282   ALIDVYGKCKCPGYALKIFEMMDDKDIFSWNSIISVHEQCGDHEETLRLFDKMLGAGVMP  341

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRC-----GYHLEVSVSSALIDMYSKCGFLNL  1224
             D + I + L A + L  +  G+E HGF +R      G+   V V++AL+DMY+KCG +  
Sbjct  342   DLITITAALPACSNLVAMMHGKEIHGFMIRSFLGKDGHCEYVLVNNALMDMYAKCGSMRN  401

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
                +F  M +K++ S+N MI   G+HG   EA  +F  + E +   PDE TF  +L AC 
Sbjct  402   ACMIFDKMRNKDVASWNIMIMGYGIHGYGKEALDMFARMCETQ-LKPDEVTFVGVLSACN  460

Query  1405  HTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIW  1584
             H GL+  GR +F  M   +GI P  EHY  ++ +LG AG+L+EAYEL++++    +  +W
Sbjct  461   HAGLLRQGRDFFTQMKTNYGITPTIEHYTCVIDMLGRAGKLKEAYELVRTMPIEANPIVW  520

Query  1585  GALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM--E  1758
              ALL+ C +HG+  L  I A+ +F+ +       V++SN+Y   GR+E V ++R  M  +
Sbjct  521   RALLAACRLHGDADLAEIAAQQVFELEPGACGGYVLMSNIYGVAGRYEEVSEVRDSMRQQ  580

Query  1759  AIKGKMPGKSWIS  1797
              +K K PG SWI 
Sbjct  581   NVK-KTPGCSWIE  592



>ref|XP_006446259.1| hypothetical protein CICLE_v10014446mg [Citrus clementina]
 gb|ESR59499.1| hypothetical protein CICLE_v10014446mg [Citrus clementina]
Length=705

 Score =   322 bits (826),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 179/534 (34%), Positives = 285/534 (53%), Gaps = 3/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K++H  ++KT        A+     YA       A ++FDE  +R +  WN++I 
Sbjct  107   SVGIGKMIHTHLIKTGFLLDVVIASSTAGMYAKCNSFECAVKMFDEMSERDVASWNTVIS  166

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y +  +   A +LFK M DSG +P++ T   ++ +C+   D    + +H   +  G   
Sbjct  167   CYYQDGQAEKALELFKKMRDSGFQPNSVTLTTVVSSCARLMDLERGKEIHKEFIKDGFVS  226

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
             DS  SS LV  Y K G LE A +VF+      +V WN++I+G+   GD K  + LF +M 
Sbjct  227   DSYISSALVDMYGKCGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVELFWRMN  286

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
               G KP   T   ++M       L+ GK +H   ++     +  + S L+ +Y +C  + 
Sbjct  287   EEGIKPTLTTISSVLMSCSRSGQLKHGKVMHGYIIRNKIQGDVFINSSLIDLYFKCGRVS  346

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
             SA  +F+ + + D+V W+ MI G    GD  KAL  + +M   G K D +   SVL A +
Sbjct  347   SAENVFEKMSKTDVVYWNVMISGYVTVGDYFKALAIYSDMKEVGAKPDAVTFTSVLPACS  406

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
             QLA ++ G+E H   +         V  AL+DMY+KCG ++   +VF  +P ++++S+ S
Sbjct  407   QLAALEKGKEIHNHIIESKLETNEIVMGALLDMYAKCGAVDEAFKVFYELPERDLVSWTS  466

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G HG A EA ++F E +++    PD  TF A+L AC H G V +G  YF  M  E
Sbjct  467   MITAYGSHGRALEALKLFGE-MQQSNARPDSITFLAVLSACSHAGWVDEGGYYFNQMISE  525

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSI-QGPVDFGIWGALLSCCDIHGNYRLGG  1635
             + I+P+ EHY  ++ LLG AG L+EAY ++QS  +   D G+   L S C +H +  +G 
Sbjct  526   YNIKPRNEHYSCLIDLLGRAGRLQEAYGILQSTPEIREDAGLLSTLFSACRLHRDIEMGE  585

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
              + K L +   + SS  +++SNMYA   +W+ V+K+R+ M+ +   K PG SWI
Sbjct  586   KIGKLLIEKDPDDSSTYIVLSNMYASVKKWDEVRKIRLKMKELGLRKNPGCSWI  639


 Score =   202 bits (514),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/482 (28%), Positives = 249/482 (52%), Gaps = 19/482 (4%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR-SIFLWNSII  375
             ++   K++H  ++   L ++      +I  Y   ++   A  +F        + LWN ++
Sbjct  4     SLKEGKIIHQKVVTLGLQNNIALCKSLINLYFSCQNYDCAMLVFKTIDNPLDLSLWNGLM  63

Query  376   RAYARAHRFSNAFQLFKDML--DSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
              +Y + + + NA +LF DML  +   +PD++T+  +L+AC         +++H  ++ +G
Sbjct  64    ASYTKNYMYINALELF-DMLLQNPYLKPDSYTYPSVLKACGGLGSVGIGKMIHTHLIKTG  122

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
               LD + +S     Y+K    E A+K+FD ++E D+  WN++IS +   G  +KAL LF 
Sbjct  123   FLLDVVIASSTAGMYAKCNSFECAVKMFDEMSERDVASWNTVISCYYQDGQAEKALELFK  182

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             KM+  G +P+S T   ++    C  L+ +  GK +H   +K GF S++++ S LV MY +
Sbjct  183   KMRDSGFQPNSVTLTTVVS--SCARLMDLERGKEIHKEFIKDGFVSDSYISSALVDMYGK  240

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASV  1083
             C C+  A  +F+  +   +V W+A+I G S  GD    ++ F  MN +G K     I+SV
Sbjct  241   CGCLEMAREVFEQTVLKSVVAWNALIAGYSSRGDSKSCVELFWRMNEEGIKPTLTTISSV  300

Query  1084  LSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNI  1263
             L + ++   ++ G+  HG+ +R     +V ++S+LID+Y KCG ++    VF+ M   ++
Sbjct  301   LMSCSRSGQLKHGKVMHGYIIRNKIQGDVFINSSLIDLYFKCGRVSSAENVFEKMSKTDV  360

Query  1264  ISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFR  1443
             + +N MIS     G+  +A  I+ ++ E     PD  TF+++L AC     +  G+    
Sbjct  361   VYWNVMISGYVTVGDYFKALAIYSDMKEVG-AKPDAVTFTSVLPACSQLAALEKGKEIHN  419

Query  1444  IMNDEFGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSCCDI  1611
              +     I+ K E + + M  LL M    G ++EA+++   +    D   W ++++    
Sbjct  420   HI-----IESKLETNEIVMGALLDMYAKCGAVDEAFKVFYELP-ERDLVSWTSMITAYGS  473

Query  1612  HG  1617
             HG
Sbjct  474   HG  475



>gb|KDP36856.1| hypothetical protein JCGZ_08147 [Jatropha curcas]
Length=707

 Score =   322 bits (826),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 188/528 (36%), Positives = 292/528 (55%), Gaps = 8/528 (2%)
 Frame = +1

Query  223   HAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRF  402
              A+ ++T   +  F  + ++  Y     ++ AR++FDE P+R+   W ++I  YA     
Sbjct  133   QALAIRTVSFYDVFVGSSLLNMYCKAGLLLEARKVFDEMPERNSVTWATMISGYAIQRLA  192

Query  403   SNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQL  582
               A  +F+ M       + F F   L A +        + +H   V +GL       + L
Sbjct  193   GEALGIFELMRREDEGLNEFVFTSALSALAIPDFIDSGKQIHCLAVKNGLLAFVSVLNAL  252

Query  583   VSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDS  762
             V+ Y+K G L+++++VF+  ++ D + W++MI+G+   GD  KAL LF +M   G  P  
Sbjct  253   VTMYAKCGGLDDSLQVFEMSSDKDSITWSAMITGYAQSGDSHKALKLFSRMHFAGINPSE  312

Query  763   FTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDS  942
             FT VG++        +  GK VH+  +K GF+   ++ + LV MY++C C   A + F+ 
Sbjct  313   FTLVGVLNACSDIGAVEEGKQVHNYLVKLGFEFQMYIMTALVDMYAKCGCTADAWKGFNY  372

Query  943   LLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPG  1122
             L EPD++ W++MI G  Q+G+   AL  + +M M+G   + L +ASVL A + LA +  G
Sbjct  373   LQEPDIILWTSMIAGYVQNGENEDALSLYCKMQMQGVLPNELTMASVLKACSSLAALDQG  432

Query  1123  RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLH  1302
             R+ H   ++ G  L V + SAL  MY+KCG L  G  VF+ MP ++++S+N+MIS +  +
Sbjct  433   RQIHARTIKYGLSLAVPIGSALSTMYAKCGSLEEGTLVFRRMPERDVVSWNAMISGVSQN  492

Query  1303  GNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTE  1482
             G   EA ++FEE + +E   PD+ TF  +L AC H GLV  G  YF++M DEFGI P  E
Sbjct  493   GYGREALELFEE-MRREGTKPDDVTFVNVLSACSHMGLVERGWVYFKMMLDEFGIVPGVE  551

Query  1483  HYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGGIVAKHLF  1656
             HY  MV +L  AG L EA E I+S +  VD G  +W  LL  C  + NY LG    + L 
Sbjct  552   HYACMVDVLSRAGNLSEAKEFIESAK--VDHGLCLWRILLGACRNYHNYELGAYAGEKLM  609

Query  1657  DNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
             +   ++SS  V++S++Y    R E V+++R  M  I+G  K PG SWI
Sbjct  610   ELGSQESSAYVLLSSIYTALNRPEDVERIR-SMMRIRGVSKEPGCSWI  656


 Score =   197 bits (501),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 134/486 (28%), Positives = 235/486 (48%), Gaps = 17/486 (3%)
 Frame = +1

Query  193   NQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSI  372
              +++   + LH  I+K+  S   + A  ++ FYA   ++  A+ +F+    + +  WN +
Sbjct  20    QKSLQRGRALHGQIIKSASSSCIYLANSLVNFYAKCGNLPKAKLVFERIRDKDVISWNCL  79

Query  373   IRAYAR--AHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             I +Y++     +S   +LFK M    T P+  TFA +  A S+      L  V  G    
Sbjct  80    INSYSQQGPAGYSLVMELFKSMRAENTFPNAHTFAGVFTAASN------LSSVFCGQQAQ  133

Query  547   GLEL------DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
              L +      D    S L++ Y K G L EA KVFD + E + V W +MISG+       
Sbjct  134   ALAIRTVSFYDVFVGSSLLNMYCKAGLLLEARKVFDEMPERNSVTWATMISGYAIQRLAG  193

Query  709   KALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
             +AL +F  M+R  E  + F +   +  L  P  +  GK +H L +K G  +   V + LV
Sbjct  194   EALGIFELMRREDEGLNEFVFTSALSALAIPDFIDSGKQIHCLAVKNGLLAFVSVLNALV  253

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
             +MY++C  +  + ++F+   + D +TWSAMI G +QSGD  KAL  F  M+  G      
Sbjct  254   TMYAKCGGLDDSLQVFEMSSDKDSITWSAMITGYAQSGDSHKALKLFSRMHFAGINPSEF  313

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
              +  VL+A + +  V+ G++ H + V+ G+  ++ + +AL+DMY+KCG      + F  +
Sbjct  314   TLVGVLNACSDIGAVEEGKQVHNYLVKLGFEFQMYIMTALVDMYAKCGCTADAWKGFNYL  373

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
                +II + SMI+    +G   +A  ++ + ++ +   P+E T +++L AC     +  G
Sbjct  374   QEPDIILWTSMIAGYVQNGENEDALSLYCK-MQMQGVLPNELTMASVLKACSSLAALDQG  432

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             R+       ++G+         +  +    G LEE   + + +    D   W A++S   
Sbjct  433   RQ-IHARTIKYGLSLAVPIGSALSTMYAKCGSLEEGTLVFRRMP-ERDVVSWNAMISGVS  490

Query  1609  IHGNYR  1626
              +G  R
Sbjct  491   QNGYGR  496


 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 165/321 (51%), Gaps = 1/321 (0%)
 Frame = +1

Query  160   FRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDET  339
             F S L+ L+  +  I + K +H + +K  L         ++  YA    +  + ++F+ +
Sbjct  214   FTSALSALAIPD-FIDSGKQIHCLAVKNGLLAFVSVLNALVTMYAKCGGLDDSLQVFEMS  272

Query  340   PQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLR  519
               +    W+++I  YA++     A +LF  M  +G  P  FT   +L ACSD       +
Sbjct  273   SDKDSITWSAMITGYAQSGDSHKALKLFSRMHFAGINPSEFTLVGVLNACSDIGAVEEGK  332

Query  520   VVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLG  699
              VH  +V  G E      + LV  Y+K G   +A K F+ + EPD++ W SMI+G+   G
Sbjct  333   QVHNYLVKLGFEFQMYIMTALVDMYAKCGCTADAWKGFNYLQEPDIILWTSMIAGYVQNG  392

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             + + AL L+ KMQ  G  P+  T   ++      + L  G+ +H+  +K+G      +GS
Sbjct  393   ENEDALSLYCKMQMQGVLPNELTMASVLKACSSLAALDQGRQIHARTIKYGLSLAVPIGS  452

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L +MY++C  +     +F  + E D+V+W+AMI G+SQ+G   +AL+ F EM  +G K 
Sbjct  453   ALSTMYAKCGSLEEGTLVFRRMPERDVVSWNAMISGVSQNGYGREALELFEEMRREGTKP  512

Query  1060  DPLLIASVLSAAAQLAIVQPG  1122
             D +   +VLSA + + +V+ G
Sbjct  513   DDVTFVNVLSACSHMGLVERG  533


 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 102/380 (27%), Positives = 189/380 (50%), Gaps = 6/380 (2%)
 Frame = +1

Query  466   FACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIA  645
             F  IL  C+ +      R +HG ++ S        ++ LV+ Y+K G L +A  VF+ I 
Sbjct  11    FNSILE-CTHQKSLQRGRALHGQIIKSASSSCIYLANSLVNFYAKCGNLPKAKLVFERIR  69

Query  646   EPDLVQWNSMISGHGCLGDWKKALL--LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIG  819
             + D++ WN +I+ +   G    +L+  LF  M+     P++ T+ G+       S +  G
Sbjct  70    DKDVISWNCLINSYSQQGPAGYSLVMELFKSMRAENTFPNAHTFAGVFTAASNLSSVFCG  129

Query  820   KNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQS  999
             +   +L ++     +  VGS L++MY +   +  A ++FD + E + VTW+ MI G +  
Sbjct  130   QQAQALAIRTVSFYDVFVGSSLLNMYCKAGLLLEARKVFDEMPERNSVTWATMISGYAIQ  189

Query  1000  GDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVS  1179
                 +AL  F  M  +   ++  +  S LSA A    +  G++ H  AV+ G    VSV 
Sbjct  190   RLAGEALGIFELMRREDEGLNEFVFTSALSALAIPDFIDSGKQIHCLAVKNGLLAFVSVL  249

Query  1180  SALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYY  1359
             +AL+ MY+KCG L+  +QVF+    K+ I++++MI+     G++++A ++F   +     
Sbjct  250   NALVTMYAKCGGLDDSLQVFEMSSDKDSITWSAMITGYAQSGDSHKALKLFSR-MHFAGI  308

Query  1360  NPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAY  1539
             NP E T   +L AC   G V +G++    +  + G + +      +V +    G   +A+
Sbjct  309   NPSEFTLVGVLNACSDIGAVEEGKQVHNYLV-KLGFEFQMYIMTALVDMYAKCGCTADAW  367

Query  1540  ELIQSIQGPVDFGIWGALLS  1599
             +    +Q P D  +W ++++
Sbjct  368   KGFNYLQEP-DIILWTSMIA  386



>ref|XP_002317690.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE98302.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=757

 Score =   323 bits (829),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 177/549 (32%), Positives = 302/549 (55%), Gaps = 3/549 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             + F  +L+ +S S   +   + LH +++++ L   P     ++  Y+    +  AR+LFD
Sbjct  163   VTFACVLS-ISCSEAMVEYGRQLHGLVVRSGLDFVPLVGNTLVTVYSKGRQLGDARKLFD  221

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
               PQ  + +WN +I  Y +     +A  LF +M+ +G +PD+ TF   L + ++      
Sbjct  222   MMPQIDLVVWNRMIGGYVQNGFMDDASMLFNEMISAGIKPDSITFTSFLPSLAESSSLKQ  281

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGC  693
             ++ +HG +V  G+ LD   +S L+  Y K      A K+F+   + D+V + +MISG+  
Sbjct  282   IKEIHGYIVRHGVILDVYLNSALIDLYFKCRDAVMACKMFNLSTKFDIVIYTAMISGYVL  341

Query  694   LGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHV  873
              G  K AL +F  + +    P++ T+  ++      + +++G+ +H   +K   +    V
Sbjct  342   NGMNKDALEIFRWLLQKKMIPNALTFSSILPACAGLAAIKLGRELHGYIIKNELEEKCPV  401

Query  874   GSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG  1053
             GS +++MY++C  +  A  IF  +   D + W+++I   SQ G   +A+  FR+M M+G 
Sbjct  402   GSAIMNMYAKCGRLDLAHLIFGRISIKDAICWNSIITSFSQDGKPEEAIYLFRQMGMEGV  461

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
             K D + +++ LSA A +  +  G+E HGF ++  +  ++   SALI+MY+KCG LN+   
Sbjct  462   KYDCVTVSAALSACANIPALHYGKEIHGFMIKGAFESDLFDMSALINMYAKCGKLNIARL  521

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTG  1413
             VF  M  KN +++NS+I+  G HG   ++  +F  +LE E   PD  TF  +L +C H G
Sbjct  522   VFNLMQEKNEVAWNSIIAAYGYHGYLADSLALFHNMLE-EGIQPDHITFLTILSSCGHAG  580

Query  1414  LVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGAL  1593
              V DG RYFR M +E+GI  + EHY  M  L G AG L+EA+E+I S+  P    +WG L
Sbjct  581   QVEDGVRYFRCMTEEYGIPAQMEHYACMADLFGRAGHLDEAFEVITSMPFPPAASVWGTL  640

Query  1594  LSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKG  1770
             L  C +HGN  L  + +++L D + + S Y ++++++ A  G+W  V K++  M E    
Sbjct  641   LGACRVHGNVELAEVASRYLLDLEPKNSGYYLLLTHVLADAGKWRSVHKIQHLMKERGVQ  700

Query  1771  KMPGKSWIS  1797
             K+PG SWI 
Sbjct  701   KVPGCSWIE  709


 Score =   223 bits (567),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 219/405 (54%), Gaps = 3/405 (1%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSII  375
               +   K++  +IL+       F A+ +I+ YA N  I  ARR FD+   +   LWN +I
Sbjct  75    NNVRLGKVIQDMILEMGFDLDMFVASSLIKLYADNGCIEDARRFFDKMIDKDCVLWNVMI  134

Query  376   RAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILR-ACSDKFDFSGLRVVHGGVVVSGL  552
               Y +     +A +LFKDM+ S  +PD+ TFAC+L  +CS+     G R +HG VV SGL
Sbjct  135   NGYVQCGESDSAIKLFKDMMSSEAKPDSVTFACVLSISCSEAMVEYG-RQLHGLVVRSGL  193

Query  553   ELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIK  732
             +   +  + LV+ YSK   L +A K+FD + + DLV WN MI G+   G    A +LF +
Sbjct  194   DFVPLVGNTLVTVYSKGRQLGDARKLFDMMPQIDLVVWNRMIGGYVQNGFMDDASMLFNE  253

Query  733   MQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKC  912
             M   G KPDS T+   +  L   S L+  K +H   ++ G   + ++ S L+ +Y +C+ 
Sbjct  254   MISAGIKPDSITFTSFLPSLAESSSLKQIKEIHGYIVRHGVILDVYLNSALIDLYFKCRD  313

Query  913   MGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSA  1092
                AC++F+   + D+V ++AMI G   +G    AL+ FR +  K    + L  +S+L A
Sbjct  314   AVMACKMFNLSTKFDIVIYTAMISGYVLNGMNKDALEIFRWLLQKKMIPNALTFSSILPA  373

Query  1093  AAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISY  1272
              A LA ++ GRE HG+ ++     +  V SA+++MY+KCG L+L   +F  +  K+ I +
Sbjct  374   CAGLAAIKLGRELHGYIIKNELEEKCPVGSAIMNMYAKCGRLDLAHLIFGRISIKDAICW  433

Query  1273  NSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
             NS+I++    G   EA  +F + +  E    D  T SA L AC +
Sbjct  434   NSIITSFSQDGKPEEAIYLFRQ-MGMEGVKYDCVTVSAALSACAN  477


 Score =   198 bits (504),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 203/386 (53%), Gaps = 1/386 (0%)
 Frame = +1

Query  277   IIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPD  456
             ++  Y L    V A++LF +        WN +IR   +   F  A   +  ML  G  PD
Sbjct  1     MLGMYVLCNSFVDAKKLFYQLEFYYAMPWNWMIRGLVKLGCFDFALLFYFKMLGCGVFPD  60

Query  457   NFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFD  636
              +TF  +++ C+   +    +V+   ++  G +LD   +S L+  Y+  G +E+A + FD
Sbjct  61    KYTFPPVIKCCTGLNNVRLGKVIQDMILEMGFDLDMFVASSLIKLYADNGCIEDARRFFD  120

Query  637   GIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI  816
              + + D V WN MI+G+   G+   A+ LF  M     KPDS T+  ++      +++  
Sbjct  121   KMIDKDCVLWNVMINGYVQCGESDSAIKLFKDMMSSEAKPDSVTFACVLSISCSEAMVEY  180

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             G+ +H L ++ G D    VG+ LV++YS+ + +G A ++FD + + D+V W+ MI G  Q
Sbjct  181   GRQLHGLVVRSGLDFVPLVGNTLVTVYSKGRQLGDARKLFDMMPQIDLVVWNRMIGGYVQ  240

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSV  1176
             +G +  A   F EM   G K D +   S L + A+ + ++  +E HG+ VR G  L+V +
Sbjct  241   NGFMDDASMLFNEMISAGIKPDSITFTSFLPSLAESSSLKQIKEIHGYIVRHGVILDVYL  300

Query  1177  SSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY  1356
             +SALID+Y KC    +  ++F      +I+ Y +MIS   L+G   +A +IF  +L+K+ 
Sbjct  301   NSALIDLYFKCRDAVMACKMFNLSTKFDIVIYTAMISGYVLNGMNKDALEIFRWLLQKKM  360

Query  1357  YNPDEATFSALLCACCHTGLVCDGRR  1434
               P+  TFS++L AC     +  GR 
Sbjct  361   I-PNALTFSSILPACAGLAAIKLGRE  385



>ref|XP_010465057.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Camelina sativa]
Length=695

 Score =   322 bits (824),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 189/580 (33%), Positives = 309/580 (53%), Gaps = 11/580 (2%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQ  345
             S    L  S+   S  + +HA +L   L    F  T++I+  +   D+  AR++FD  P 
Sbjct  23    SFYASLIDSSTRKSHLRQIHARLLVLGLQFSGFLITKLIQASSSFGDVTFARQVFDGLPH  82

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
               I+ WN+IIR Y+R + F +A  ++  M  +   PD+FTF  +L+AC         RVV
Sbjct  83    PQIYPWNAIIRGYSRNNYFQDALLMYSKMHLARVSPDSFTFPHLLKACGGLSHLPMGRVV  142

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI--AEPDLVQWNSMISGHGCLG  699
             H  V   G E D    + L++ Y+K   L  A  VF+G+   E  +V W +++SG+   G
Sbjct  143   HAQVFRLGFEDDVFVQNGLIALYAKCKRLGFARTVFEGVPLTERTIVSWTAIVSGYAQNG  202

Query  700   DWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGS  879
             +  +AL +F +M++MG KPD    V ++    C   L  G++VH+  +K G ++   +  
Sbjct  203   EPVEALEIFSQMRKMGVKPDWVALVSVLNAFTCLQGLEQGRSVHASVVKMGLETEPDLLI  262

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              L +MY++C  + +A  +FD +  P+++ W+AMI G +++G    A+D F EM  K  + 
Sbjct  263   SLNTMYAKCGQVATAKVLFDKMTSPNLILWNAMISGYAKNGYAKDAIDMFHEMIDKDVRP  322

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D + I S +SA AQ+  ++  R    +  R  Y  +V +SSALIDM++KCG +     VF
Sbjct  323   DTISITSAVSACAQVGSLEQARWMDEYVGRTEYRDDVFISSALIDMFAKCGSVECARSVF  382

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
                  ++++ +++MI   GLHG A EA  ++  ++E++   P++ TF  LL AC H+GLV
Sbjct  383   DRTLDRDVVVWSAMIVGYGLHGRAKEAISLY-RIMERDGVYPNDITFLGLLMACNHSGLV  441

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              +G  +F  M D   I P+ +HY  ++ LLG AG +++AYE+I+ +       +WGALLS
Sbjct  442   REGWWFFNRMTDH-KINPQQQHYACVIDLLGRAGHMDQAYEVIKCMPVQPGVTVWGALLS  500

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKMP  1779
              C  H +  LG   A+ LF      + + V +SN+YA    WE V ++RV       KM 
Sbjct  501   ACKKHRHVELGEYAAQQLFAIDPSNTGHYVQLSNLYAAARLWERVAEVRV-------KMK  553

Query  1780  GKSWISNIKM*WITCIN*LASCTLASKCIGRWKPLLSKVE  1899
              K    ++   W+     L +  +  K   R+K +  +VE
Sbjct  554   EKGLSKDVGCSWVEVRGRLEAFRVGDKSHPRYKEIERQVE  593



>ref|XP_008246495.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g05240 [Prunus mume]
Length=565

 Score =   318 bits (814),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 292/526 (56%), Gaps = 9/526 (2%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNE--DIVSARRLFDETPQRSIFLWNS  369
             +++S  K LH +++ T +  +    +R++ F A +E  D++ A+ +F +  Q S+++WNS
Sbjct  16    KSMSELKQLHGLMITTSVFKNVIPLSRLVDFCANSEARDLIYAKSVFHQINQPSVYIWNS  75

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +IR Y+ +   + +  ++++ML  G  PDNFTF  +L+ACS    +   R VH  +V +G
Sbjct  76    MIRGYSNSENPAESLIMYREMLQRGYVPDNFTFPFVLKACSLITVYHYGRCVHNCIVKTG  135

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
              ELD   S+ L+S Y+    +   +KVFD I + ++V W S+ISG        +A+ +F 
Sbjct  136   FELDMYASTCLLSMYASFADMNSGLKVFDNIPKWNVVAWTSLISGFVGNNQATEAIKVFK  195

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS-------NAHVGSLLV  888
              M+    +P+ FT V +++       +  GK VHS   + GFD        N  + + ++
Sbjct  196   DMELQNIQPNEFTMVHVVVACARSRDIDTGKLVHSRIRQLGFDPFGSSFNFNIVLATAIL  255

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              MY++C  + +A  +F+ + + ++VTW++MI   +Q G   +A+  F +M   G   D  
Sbjct  256   DMYAKCGSLRTARDLFNKMPQRNLVTWNSMISAYNQYGRAEEAIGLFSDMQNVGFAPDEA  315

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
                 V+ A AQL  +  G+  H +  +     + ++ +AL+DMY+K G      ++F  +
Sbjct  316   TFLGVIGACAQLGALALGQSLHSYVSKTSMGKDTAIGTALVDMYAKTGDARSAQRIFDNL  375

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
               K+++++ SMI+ L +HG+  EA Q F ++ E     PD+ ++  +LCAC H GLV +G
Sbjct  376   QKKDVMAWTSMITGLAMHGHGMEALQTFRKMQEDARVVPDQISYIGVLCACSHVGLVEEG  435

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +R+F  M + +GI+P  EHY  MV LL  AG  EEA  L++ +    +  +WGALL+ C+
Sbjct  436   QRHFASMVNVYGIEPTEEHYCCMVDLLSRAGRFEEAVRLLEEMPLQPNVAVWGALLNGCE  495

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR  1746
             IH N  L   V + + + +   S   V++SN+YA  GRW+ VK  R
Sbjct  496   IHENVDLADQVRRRITEMEPYGSGVYVLLSNIYARAGRWQEVKLAR  541



>ref|XP_009614402.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=613

 Score =   319 bits (818),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 183/556 (33%), Positives = 302/556 (54%), Gaps = 8/556 (1%)
 Frame = +1

Query  127   SYQLLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKT-HLSHHPFYATRIIRFYALNE  303
             +Y + +  F+ F  LL     S  +++  K LHA+ L T +L++ P     +     L+ 
Sbjct  25    TYAIANHPFLPFSYLLN----SCHSLAALKRLHALALTTGYLTNLPVCTKLVSLACFLSP  80

Query  304   DIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILR  483
              +  AR+LFD+ PQR +F WN++IR Y+       A  L+KDM   G  PDN+TF  +LR
Sbjct  81    TMDYARKLFDQMPQRDVFAWNTVIRGYSNLGPCQEAIILYKDMHLQGFLPDNYTFPFVLR  140

Query  484   ACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQ  663
             +CS        R VH  ++  G E D    S L++ Y++ G   ++  VFD +   ++V 
Sbjct  141   SCSVLSALREGREVHCNIIKHGFESDVFVQSCLITLYAQSGETLDSELVFDQMRVRNIVS  200

Query  664   WNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCL  843
             W + I+G+   G  +K L  F+KM   G  P++ T V ++        L +G  +H   +
Sbjct  201   WTATIAGYVQNGIPEKGLGHFLKMVNSGTLPNAITLVSVLPACARLESLDMGMLIHGYSI  260

Query  844   KFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALD  1023
             K G +++  + + L++ Y +C  +  A  +F+ + E ++V+W+ +I    Q+      + 
Sbjct  261   KLGVETDVALVNALIAFYGKCGLVDVAWSLFE-MKEHNLVSWNTIIAVYEQNDAGSATIK  319

Query  1024  FFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYS  1203
              F+ M  +G K D + + +V+SA A+L  +  G+  H      G    + +++ALIDMY+
Sbjct  320   LFQRMLDEGVKFDYITLVTVISACARLGALGTGKWIHELVKSKGLECNIPITNALIDMYA  379

Query  1204  KCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFS  1383
             KCG + L   VF  +P ++++S+ S+I     HG+  +A + F   ++KE   P+  TF+
Sbjct  380   KCGSIELARDVFDRLPCRSVVSWTSIIGACASHGHGKDALEFFSR-MKKEGIQPNSLTFT  438

Query  1384  ALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQG  1563
             A+L AC H+GLV +GR++F  M  E+ I P  E    MV LLG AG+L EAYE ++++  
Sbjct  439   AVLTACRHSGLVEEGRKHFESMTTEYSIVPGVEQCACMVDLLGRAGQLFEAYEFVENMPI  498

Query  1564  PVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKL  1743
               D  +WGALL  C IHGN  L   VA  L D   +   + +++ N+YA  GRWE V +L
Sbjct  499   EPDADVWGALLGACKIHGNLELAESVADRLLDLNPQTVPFYILMKNIYAEAGRWEEVARL  558

Query  1744  RVDMEAIKG-KMPGKS  1788
             +  +E ++  K+PGKS
Sbjct  559   KFLLEEMEAEKIPGKS  574



>ref|XP_010256994.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nelumbo nucifera]
 ref|XP_010256995.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nelumbo nucifera]
 ref|XP_010256996.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nelumbo nucifera]
 ref|XP_010256997.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nelumbo nucifera]
 ref|XP_010256998.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Nelumbo nucifera]
Length=688

 Score =   321 bits (823),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/530 (35%), Positives = 293/530 (55%), Gaps = 4/530 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +HA +L+  L    +    I++    + +   AR +F +T + +IFLWN++IR +   
Sbjct  33    KHVHARLLRFGLDQDNYLVNMILKSCLESGETQHARLVFSQTREPNIFLWNTMIRGFVSN  92

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                 +A + +  M   G  P+NFTF  +L+AC+   D      +H  V+ +G + D    
Sbjct  93    DCLYDAIKFYGLMRREGLFPNNFTFPFVLKACARLSDLELGIKIHTHVLKAGFDYDVYVK  152

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + LV  Y+K G +  A KVFD + + ++V W ++ISG+   G++ +A+++F K+  MG K
Sbjct  153   TSLVCLYAKCGCVGNAHKVFDEMPDKNVVSWTAIISGYIDFGNFGEAVVMFQKLLEMGLK  212

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PDSFT V ++        ++ G+ +H    + G D N  V + LV MY++C  M  A  +
Sbjct  213   PDSFTLVRVLSACSQLGDVKNGEWIHRYIREMGMDRNVFVATSLVDMYTKCGSMEKARSV  272

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD + E D V+WSAMI G + +G   +A++ F +M  +  K D   +  +LSA AQL   
Sbjct  273   FDGMHEKDTVSWSAMIAGYAMNGVPKEAVELFFQMQRENVKPDCFTMVGILSACAQLGAF  332

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G    G   +  Y     + +ALIDMY+KCG ++    +F+ M  ++++ +N++IS L
Sbjct  333   ELGDWVSGLIGKNEYLNNFVLGTALIDMYAKCGRMSRAWWIFEEMKERDVVVWNAIISGL  392

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
              ++G+   AF +F + +EK    PD  TF  LLC C H GLV DGR+YF  M+  + + P
Sbjct  393   SMNGHVKAAFGLFGQ-MEKLGIQPDGNTFIGLLCGCTHAGLVEDGRQYFVSMSRIYSLTP  451

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
             + EHY  +V LLG AG L+EA++LI+ +    +  +WGALL  C IH + +L   V K L
Sbjct  452   RIEHYGCIVDLLGRAGFLDEAHQLIKDMPIQANAVVWGALLGGCRIHRDTQLAEHVLKRL  511

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWIS  1797
              + +   S   V++SN+Y+  GRW     LR  M   KG  K PG SWI 
Sbjct  512   IELEPCNSGNYVLLSNIYSTSGRWNDAANLRFLMNE-KGIQKTPGCSWIE  560


 Score =   171 bits (433),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 112/393 (28%), Positives = 209/393 (53%), Gaps = 24/393 (6%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPD  654
             +L+ C++   F  L+ VH  ++  GL+ D+   + ++ +  + G  + A  VF    EP+
Sbjct  22    LLQGCNN---FKELKHVHARLLRFGLDQDNYLVNMILKSCLESGETQHARLVFSQTREPN  78

Query  655   LVQWNSMISG---HGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKN  825
             +  WN+MI G   + CL D   A+  +  M+R G  P++FT+  ++      S L +G  
Sbjct  79    IFLWNTMIRGFVSNDCLYD---AIKFYGLMRREGLFPNNFTFPFVLKACARLSDLELGIK  135

Query  826   VHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGD  1005
             +H+  LK GFD + +V + LV +Y++C C+G+A ++FD + + ++V+W+A+I G    G+
Sbjct  136   IHTHVLKAGFDYDVYVKTSLVCLYAKCGCVGNAHKVFDEMPDKNVVSWTAIISGYIDFGN  195

Query  1006  IMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSA  1185
               +A+  F+++   G K D   +  VLSA +QL  V+ G   H +    G    V V+++
Sbjct  196   FGEAVVMFQKLLEMGLKPDSFTLVRVLSACSQLGDVKNGEWIHRYIREMGMDRNVFVATS  255

Query  1186  LIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNP  1365
             L+DMY+KCG +     VF  M  K+ +S+++MI+   ++G   EA ++F + +++E   P
Sbjct  256   LVDMYTKCGSMEKARSVFDGMHEKDTVSWSAMIAGYAMNGVPKEAVELFFQ-MQRENVKP  314

Query  1366  DEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEH---YVYMVKLLGM---AGEL  1527
             D  T   +L AC   G        F + +   G+  K E+   +V    L+ M    G +
Sbjct  315   DCFTMVGILSACAQLGA-------FELGDWVSGLIGKNEYLNNFVLGTALIDMYAKCGRM  367

Query  1528  EEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
               A+ + + ++   D  +W A++S   ++G+ +
Sbjct  368   SRAWWIFEEMK-ERDVVVWNAIISGLSMNGHVK  399



>ref|XP_008230158.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Prunus mume]
Length=643

 Score =   320 bits (819),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/498 (36%), Positives = 288/498 (58%), Gaps = 13/498 (3%)
 Frame = +1

Query  196   QTISTTK------LLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSI  354
             Q+++ TK       LHA+++ + +L ++ + +T++  FYA    +  A+ +FD    ++ 
Sbjct  41    QSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKLAAFYANCGRMAQAQVIFDGILLKNS  100

Query  355   FLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGG  534
             FLWN +IR YA       A  L+++ML  G + DNFT+  +L+AC D       R VH  
Sbjct  101   FLWNFMIRGYACNECSLKALVLYREMLSFGQKADNFTYPFVLKACGDLLLVETGRRVHSE  160

Query  535   VVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKA  714
             VVVSGLE D   ++ L++ YSK G +  A  +FD + E DL+ WN+MIS +    + +KA
Sbjct  161   VVVSGLESDIYVANALLAMYSKFGDMGLARMLFDRMLERDLISWNTMISCYVKNNNLRKA  220

Query  715   LLLFIKMQRMGEKPDSFTYVGLIMCLDCPSL--LRIGKNVHSLCL-KFGFDSNAHVGSLL  885
             L +F +M + G K D  T +G++    C  L  L++GK +H+  + K G   N  + + L
Sbjct  221   LEVFEEMGKAGLKADGTTLLGILSA--CAELLALKLGKEIHAYVVRKSGEIRNEFLTNSL  278

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             + MY   K +  + R+FD +   D V+W++MI G  Q+GD  ++L  F +M M+G +VD 
Sbjct  279   IEMYCNSKSLAYSRRLFDGVKLKDTVSWNSMIRGYEQNGDAFESLRLFCQMVMEGAEVDE  338

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
             + I ++L A  Q++ +Q G   H   V+ G+   + V +ALIDMYSKCG L+   +VF  
Sbjct  339   VTIITILGACDQISALQFGMSVHSCLVKKGFGANIIVGTALIDMYSKCGSLSCSCRVFDE  398

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
             +P KN++++++MIS  G HG   EA   + E++    + PDE   +++L AC H GLV +
Sbjct  399   IPRKNLVAWSAMISGYGAHGRGEEAISCYHELVANN-FTPDEGVLTSVLSACSHAGLVNE  457

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
             G+  F  M  E+ ++P   HY  +V LLG AG ++EAYELI++++      IW ALLS C
Sbjct  458   GKHIFNRMTIEYNVKPGLAHYSCLVDLLGRAGHVDEAYELIKTMEVKPSSDIWAALLSAC  517

Query  1606  DIHGNYRLGGIVAKHLFD  1659
              +H N +L  + A+   D
Sbjct  518   RLHKNVKLAEVSAQKTHD  535


 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 173/311 (56%), Gaps = 3/311 (1%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSI-CSSQLVSAYSKLGPLEEAIKVFDGIAEP  651
             IL++ ++   F   + +H  +V SG  L++   S++L + Y+  G + +A  +FDGI   
Sbjct  39    ILQSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKLAAFYANCGRMAQAQVIFDGILLK  98

Query  652   DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVH  831
             +   WN MI G+ C     KAL+L+ +M   G+K D+FTY  ++       L+  G+ VH
Sbjct  99    NSFLWNFMIRGYACNECSLKALVLYREMLSFGQKADNFTYPFVLKACGDLLLVETGRRVH  158

Query  832   SLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIM  1011
             S  +  G +S+ +V + L++MYS+   MG A  +FD +LE D+++W+ MI    ++ ++ 
Sbjct  159   SEVVVSGLESDIYVANALLAMYSKFGDMGLARMLFDRMLERDLISWNTMISCYVKNNNLR  218

Query  1012  KALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVS-VSSAL  1188
             KAL+ F EM   G K D   +  +LSA A+L  ++ G+E H + VR    +    ++++L
Sbjct  219   KALEVFEEMGKAGLKADGTTLLGILSACAELLALKLGKEIHAYVVRKSGEIRNEFLTNSL  278

Query  1189  IDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPD  1368
             I+MY     L    ++F  +  K+ +S+NSMI     +G+A E+ ++F +++  E    D
Sbjct  279   IEMYCNSKSLAYSRRLFDGVKLKDTVSWNSMIRGYEQNGDAFESLRLFCQMV-MEGAEVD  337

Query  1369  EATFSALLCAC  1401
             E T   +L AC
Sbjct  338   EVTIITILGAC  348



>ref|XP_009605798.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 
[Nicotiana tomentosiformis]
Length=852

 Score =   325 bits (832),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 181/525 (34%), Positives = 286/525 (54%), Gaps = 2/525 (0%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             LH ++++  L      A  +I  Y+    +  AR+LFD  PQ     WN +I  Y +   
Sbjct  274   LHGLVVRCGLEMDSPVANTLITMYSKFCSLFHARKLFDLVPQADRVTWNGMIGGYVQNGY  333

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A +LF +M+ +  +PD+ TFA +L + S   +    + +HG ++   + +D    + 
Sbjct  334   MDEALELFHEMVATSVKPDSITFASLLPSVSISENLYQGKAIHGYIMRHDVSVDVFLKNA  393

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPD  759
             ++  Y K G +E A  +F+     D+V   +MISG    G    AL +F  +     +P+
Sbjct  394   IIDMYFKCGNVEAARNIFNFSPAVDVVICTAMISGFVLNGMSFDALDVFRWLLIKKMRPN  453

Query  760   SFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFD  939
               T    +      + LR+GK +H +  K GF    +VGS ++ MY++C  +  A ++F 
Sbjct  454   PVTLASTLPACANLAALRLGKELHGVIAKRGFQGILYVGSAVMDMYAKCGRLDLAQQVFR  513

Query  940   SLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQP  1119
              + E D+V W++MI    Q+ +   A+DFF +M   G K D + I+S LSA A L  +  
Sbjct  514   RMSERDVVCWNSMITSCCQNAEPELAIDFFHQMGADGAKYDCVSISSALSACANLPALHY  573

Query  1120  GRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGL  1299
             G+E HGF ++  +  +V V SALIDMY+KCG L +  +VF  M +KN +S+NS+I+  G 
Sbjct  574   GKEIHGFIMKSAFSSDVFVESALIDMYAKCGNLEVAWRVFDLMANKNEVSWNSIIAAYGN  633

Query  1300  HGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKT  1479
             HG   +   +F   + K+ + PD  TF A++ AC H+G V +G+ YF  M  E+GI P+ 
Sbjct  634   HGRLKDCLDLFHG-MRKDGFQPDHVTFLAIISACGHSGRVEEGKYYFNCMTQEYGITPRM  692

Query  1480  EHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             EHY  MV L G AG +EEA+ +I+S+    D GIWG LL  C +HGN  L  + ++HL  
Sbjct  693   EHYACMVDLFGRAGLVEEAFGVIKSMPIAPDAGIWGTLLGACRLHGNTELAEMASEHLLG  752

Query  1660  NKVEKSSYGVMVSNMYAGDGRWECVKKLRVDM-EAIKGKMPGKSW  1791
                + S Y ++ +N++A  G+W+ V K+R  M E    K+PG SW
Sbjct  753   LDPQNSGYYILQANLHANAGKWDMVSKIRHMMKERGVQKLPGYSW  797


 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 131/480 (27%), Positives = 236/480 (49%), Gaps = 6/480 (1%)
 Frame = +1

Query  175   TQLSRSN--QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             T L+ +N    I   K +HA +    + +     TRI+  Y L      A+ LF +    
Sbjct  54    TSLTENNIGSVIQKGKQIHAQVTVNGIDNLGILGTRILGMYVLCNRFTDAKNLFFQLQLC  113

Query  349   SIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVH  528
                 WN +IR Y     F+ A  LF  ML  GT PD +TF  +++AC+        + +H
Sbjct  114   YASPWNWMIRGYTIMGCFNLAILLFFKMLVFGTNPDKYTFPYVVKACAGINSVKLGKWLH  173

Query  529   GGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWK  708
             G V   G E D    S  +  Y++ G L +A  +FD ++  D V WN MI+G+       
Sbjct  174   GMVQSLGFEDDVFVGSAFIKFYAENGCLADARLLFDKMSRRDSVLWNVMINGYAKDEQSV  233

Query  709   KALL-LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLL  885
               ++ LF +M++   KP+S TY  ++      ++++ G  +H L ++ G + ++ V + L
Sbjct  234   NDVVGLFREMRKSETKPNSVTYACVLSVCASETMVKFGCQLHGLVVRCGLEMDSPVANTL  293

Query  886   VSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDP  1065
             ++MYS+   +  A ++FD + + D VTW+ MI G  Q+G + +AL+ F EM     K D 
Sbjct  294   ITMYSKFCSLFHARKLFDLVPQADRVTWNGMIGGYVQNGYMDEALELFHEMVATSVKPDS  353

Query  1066  LLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKA  1245
             +  AS+L + +    +  G+  HG+ +R    ++V + +A+IDMY KCG +     +F  
Sbjct  354   ITFASLLPSVSISENLYQGKAIHGYIMRHDVSVDVFLKNAIIDMYFKCGNVEAARNIFNF  413

Query  1246  MPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCD  1425
              P+ +++   +MIS   L+G + +A  +F  +L K+   P+  T ++ L AC +   +  
Sbjct  414   SPAVDVVICTAMISGFVLNGMSFDALDVFRWLLIKK-MRPNPVTLASTLPACANLAALRL  472

Query  1426  GRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCC  1605
             G+    ++    G Q        ++ +    G L+ A ++ + +    D   W ++++ C
Sbjct  473   GKELHGVIAKR-GFQGILYVGSAVMDMYAKCGRLDLAQQVFRRMS-ERDVVCWNSMITSC  530


 Score =   141 bits (355),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/424 (25%), Positives = 196/424 (46%), Gaps = 25/424 (6%)
 Frame = +1

Query  124   RSYQLLHQMF--------IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRI  279
              + +L H+M         I F SLL  +S S + +   K +H  I++  +S   F    I
Sbjct  336   EALELFHEMVATSVKPDSITFASLLPSVSIS-ENLYQGKAIHGYIMRHDVSVDVFLKNAI  394

Query  280   IRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDN  459
             I  Y    ++ +AR +F+ +P   + +  ++I  +       +A  +F+ +L    RP+ 
Sbjct  395   IDMYFKCGNVEAARNIFNFSPAVDVVICTAMISGFVLNGMSFDALDVFRWLLIKKMRPNP  454

Query  460   FTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDG  639
              T A  L AC++       + +HG +   G +      S ++  Y+K G L+ A +VF  
Sbjct  455   VTLASTLPACANLAALRLGKELHGVIAKRGFQGILYVGSAVMDMYAKCGRLDLAQQVFRR  514

Query  640   IAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTY-VGLIMCLDCPSLLRI  816
             ++E D+V WNSMI+      + + A+  F +M   G K D  +    L  C + P+ L  
Sbjct  515   MSERDVVCWNSMITSCCQNAEPELAIDFFHQMGADGAKYDCVSISSALSACANLPA-LHY  573

Query  817   GKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQ  996
             GK +H   +K  F S+  V S L+ MY++C  +  A R+FD +   + V+W+++I     
Sbjct  574   GKEIHGFIMKSAFSSDVFVESALIDMYAKCGNLEVAWRVFDLMANKNEVSWNSIIAAYGN  633

Query  997   SGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGR-------ETHGFAVRCG  1155
              G +   LD F  M   G + D +   +++SA      V+ G+       + +G   R  
Sbjct  634   HGRLKDCLDLFHGMRKDGFQPDHVTFLAIISACGHSGRVEEGKYYFNCMTQEYGITPRME  693

Query  1156  YHLEVSVSSALIDMYSKCGFLNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIF  1332
             ++      + ++D++ + G +     V K+MP + +   + +++    LHGN   A    
Sbjct  694   HY------ACMVDLFGRAGLVEEAFGVIKSMPIAPDAGIWGTLLGACRLHGNTELAEMAS  747

Query  1333  EEVL  1344
             E +L
Sbjct  748   EHLL  751



>ref|XP_007208504.1| hypothetical protein PRUPE_ppa026555mg [Prunus persica]
 gb|EMJ09703.1| hypothetical protein PRUPE_ppa026555mg [Prunus persica]
Length=565

 Score =   317 bits (813),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 291/526 (55%), Gaps = 9/526 (2%)
 Frame = +1

Query  196   QTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNE--DIVSARRLFDETPQRSIFLWNS  369
             +++S  K LH +++ T + ++    +R++ F A +E  D+V A+ +F +  Q  +++WNS
Sbjct  16    KSMSELKQLHGLMITTSVFNNVIPLSRLVDFCANSEARDLVYAKSVFHQINQPRVYIWNS  75

Query  370   IIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSG  549
             +IR Y+ +   + +  ++++ML  G  PDNFTF  +L+ACS    +   R VH  +V +G
Sbjct  76    MIRGYSNSENPAESLIMYREMLQRGYVPDNFTFPFVLKACSLITVYHYGRCVHNCIVKTG  135

Query  550   LELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFI  729
              ELD   S+ L+S Y+    +   +KVFD I + ++V W S+ISG        +A+ +F 
Sbjct  136   FELDMYASTCLLSMYASCADMNSGLKVFDNIPKWNVVAWTSLISGFVGNNQATEAIKVFK  195

Query  730   KMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS-------NAHVGSLLV  888
              M+    +P+ FT V +++       +  GK VHS   + GFD        N  + + ++
Sbjct  196   DMELQNVQPNEFTMVHVVVACARSRDIDTGKLVHSRIRQLGFDPFGSSFNFNIVLATAIL  255

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              MY++C  + +A  +F+ + + ++VTW++MI   +Q G   +A+  F +M   G   D  
Sbjct  256   DMYAKCGSLRTARDLFNKMPQRNLVTWNSMISAYNQYGRAEEAIGLFSDMQNAGFAPDEA  315

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
                 V+ A AQL  +  G+  H +  +     + ++ +AL+DMY+K G      ++F  +
Sbjct  316   TFLGVIGACAQLGALALGQSLHSYVSKTSMGKDTAIGTALVDMYAKTGDAGSAQRIFDNL  375

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDG  1428
               K+++++ SMI+ L +HG+  EA   F ++ E     PD+ T+  +LCAC H GLV +G
Sbjct  376   QKKDVMAWTSMITGLAMHGHGKEALHAFRKMQEDARVVPDQITYIGVLCACSHVGLVEEG  435

Query  1429  RRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCD  1608
             +R+F  M + +GI+P  EHY  MV LL  AG  EEA  L++ +    +  +WGALL+ C+
Sbjct  436   QRHFASMVNIYGIEPTEEHYCCMVDLLSRAGRFEEAVRLLEEMPLQPNVAVWGALLNGCE  495

Query  1609  IHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR  1746
             IH N  L   V + + + +   S   V++SN+YA  GRW+ VK  R
Sbjct  496   IHENVDLADQVRRRITEMEPHGSGVYVLLSNIYARAGRWQEVKLAR  541



>ref|XP_008243706.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Prunus mume]
Length=577

 Score =   317 bits (813),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 177/537 (33%), Positives = 295/537 (55%), Gaps = 3/537 (1%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYA-LNEDIVSARRLFDETPQRSIFLWN  366
             S  + S  K +HA+I +   + +   +T+++   + +   +  AR+LFD  P+R  FLWN
Sbjct  39    SCSSFSDLKCIHALIFQHGSNQNLLLSTKLVTLASSMAPTMDYARKLFDTMPERDAFLWN  98

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             ++IR YA       A  L+++M  SG  PDN+TF  ++R+C+ +      + VH  ++  
Sbjct  99    TLIRGYADRGPSHEAIVLYRNMHHSGLSPDNYTFPFVVRSCTVQLALREGKEVHCNIIKY  158

Query  547   GLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLF  726
             G   D    S LVS Y++      +  VF  +   ++V W +MI+G+   G +K+ L + 
Sbjct  159   GFHSDVFVQSSLVSMYAQSSETLNSEIVFSDMIVKNIVSWTAMIAGYVQNGFYKEGLSVL  218

Query  727   IKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRC  906
               M   G +P+  T V ++        L +GK +H   +K G DS+  + + L++ Y +C
Sbjct  219   RDMVASGTQPNVVTLVSILPACASLKFLDLGKLIHGCGIKVGVDSDMALMNALIAFYGKC  278

Query  907   KCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVL  1086
               + +A  +F  ++  ++V+W+AMI    Q+     A+  FR M  +  + D + I SV+
Sbjct  279   GNLDTARSLFKGMVVRNLVSWNAMIAAYEQNNAGTDAIKLFRRMQTENVEYDYITIVSVI  338

Query  1087  SAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNII  1266
             SA A L  +  G   H  A   G+    S+ +ALI+MY+KCG ++L   VF+ +P K+++
Sbjct  339   SACASLGALNTGIWLHELARMKGFGTNASIPNALINMYAKCGNIDLAKDVFEGLPHKSVV  398

Query  1267  SYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRI  1446
             S+ S+I     HG+ ++A  +F  +++++   P+  TF+A+L AC H GLV +GR++F  
Sbjct  399   SWTSIIGACASHGHGDDALMLF-SMMKEQGTKPNSFTFTAVLTACRHAGLVEEGRKHFES  457

Query  1447  MNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYR  1626
             M  ++ I P  EHY  MV LLG AG L EAY+ I+++    D G+WGALLS C IHGN  
Sbjct  458   MIKDYSISPGVEHYACMVDLLGRAGCLHEAYKFIETMPVEPDAGVWGALLSACRIHGNVE  517

Query  1627  LGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDME-AIKGKMPGKSWI  1794
             L  +V   L     +  +  V++SN+YA   RWE   +LR  M   +  K+PG+S++
Sbjct  518   LAELVVARLSRLDTQTVTSYVLMSNIYAEASRWEDEARLRNLMRKKLLKKLPGQSFV  574



>ref|XP_003530713.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
isoform X1 [Glycine max]
 ref|XP_006586046.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
isoform X2 [Glycine max]
 ref|XP_006586047.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
isoform X3 [Glycine max]
 ref|XP_006586048.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like 
isoform X4 [Glycine max]
Length=705

 Score =   321 bits (823),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 188/531 (35%), Positives = 282/531 (53%), Gaps = 7/531 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K++H  ++KT L       + ++  YA       A  LF+E P++ +  WN++I  Y ++
Sbjct  126   KMIHTCLVKTGLMMDIVVGSSLVGMYAKCNAFEKAIWLFNEMPEKDVACWNTVISCYYQS  185

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
               F  A + F  M   G  P++ T    + +C+   D +    +H  ++ SG  LDS  S
Sbjct  186   GNFKEALEYFGLMRRFGFEPNSVTITTAISSCARLLDLNRGMEIHEELINSGFLLDSFIS  245

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             S LV  Y K G LE AI+VF+ + +  +V WNSMISG+G  GD    + LF +M   G K
Sbjct  246   SALVDMYGKCGHLEMAIEVFEQMPKKTVVAWNSMISGYGLKGDSISCIQLFKRMYNEGVK  305

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             P   T   LIM     + L  GK VH   ++    S+  + S L+ +Y +C  +  A  I
Sbjct  306   PTLTTLSSLIMVCSRSARLLEGKFVHGYTIRNRIQSDVFINSSLMDLYFKCGKVELAENI  365

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F  + +  +V+W+ MI G    G + +AL  F EM     + D +   SVL+A +QLA +
Sbjct  366   FKLIPKSKVVSWNVMISGYVAEGKLFEALGLFSEMRKSYVEPDAITFTSVLTACSQLAAL  425

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G E H   +         V  AL+DMY+KCG ++    VFK +P ++++S+ SMI+  
Sbjct  426   EKGEEIHNLIIEKKLDNNEVVMGALLDMYAKCGAVDEAFSVFKCLPKRDLVSWTSMITAY  485

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
             G HG A  A ++F E+L+     PD  TF A+L AC H GLV +G  YF  M + +GI P
Sbjct  486   GSHGQAYVALELFAEMLQSN-MKPDRVTFLAILSACGHAGLVDEGCYYFNQMVNVYGIIP  544

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPV---DFGIWGALLSCCDIHGNYRLGGIVA  1644
             + EHY  ++ LLG AG L EAYE++Q  Q P    D  +   L S C +H N  LG  +A
Sbjct  545   RVEHYSCLIDLLGRAGRLHEAYEILQ--QNPEIRDDVELLSTLFSACRLHRNIDLGAEIA  602

Query  1645  KHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
             + L D   + SS  +++SNMYA   +W+ V+ +R  M+ +   K PG SWI
Sbjct  603   RTLIDKDPDDSSTYILLSNMYASAHKWDEVRVVRSKMKELGLKKNPGCSWI  653


 Score =   211 bits (537),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 253/498 (51%), Gaps = 23/498 (5%)
 Frame = +1

Query  190   SNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD--ETPQRSIFLW  363
             +++++   KL+H  ++   L +  F    +I  Y        A+ +FD  E P   I LW
Sbjct  15    NSKSLKQGKLIHQKVVTLGLQNDIFLCKNLINLYLSCHLYDHAKCVFDNMENPCE-ISLW  73

Query  364   NSIIRAYARAHRFSNAFQLFKDMLDSG-TRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             N ++  Y + + +  A +LF+ +L     +PD++T+  +L+AC   + +   +++H  +V
Sbjct  74    NGLMAGYTKNYMYVEALELFEKLLHYPYLKPDSYTYPSVLKACGGLYKYVLGKMIHTCLV  133

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
              +GL +D +  S LV  Y+K    E+AI +F+ + E D+  WN++IS +   G++K+AL 
Sbjct  134   KTGLMMDIVVGSSLVGMYAKCNAFEKAIWLFNEMPEKDVACWNTVISCYYQSGNFKEALE  193

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRI--GKNVHSLCLKFGFDSNAHVGSLLVSM  894
              F  M+R G +P+S T    I    C  LL +  G  +H   +  GF  ++ + S LV M
Sbjct  194   YFGLMRRFGFEPNSVTITTAIS--SCARLLDLNRGMEIHEELINSGFLLDSFISSALVDM  251

Query  895   YSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLI  1074
             Y +C  +  A  +F+ + +  +V W++MI G    GD +  +  F+ M  +G K     +
Sbjct  252   YGKCGHLEMAIEVFEQMPKKTVVAWNSMISGYGLKGDSISCIQLFKRMYNEGVKPTLTTL  311

Query  1075  ASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPS  1254
             +S++   ++ A +  G+  HG+ +R     +V ++S+L+D+Y KCG + L   +FK +P 
Sbjct  312   SSLIMVCSRSARLLEGKFVHGYTIRNRIQSDVFINSSLMDLYFKCGKVELAENIFKLIPK  371

Query  1255  KNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRR  1434
               ++S+N MIS     G   EA  +F E + K Y  PD  TF+++L AC     +  G  
Sbjct  372   SKVVSWNVMISGYVAEGKLFEALGLFSE-MRKSYVEPDAITFTSVLTACSQLAALEKGEE  430

Query  1435  YFRIMNDEFGIQPKTE-HYVYMVKLLGM---AGELEEAYELIQSIQGPVDFGIWGALLSC  1602
                ++     I+ K + + V M  LL M    G ++EA+ + + +    D   W ++++ 
Sbjct  431   IHNLI-----IEKKLDNNEVVMGALLDMYAKCGAVDEAFSVFKCLPKR-DLVSWTSMITA  484

Query  1603  CDIHGNYRLGGIVAKHLF  1656
                HG       VA  LF
Sbjct  485   YGSHGQ----AYVALELF  498


 Score =   170 bits (430),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/323 (32%), Positives = 174/323 (54%), Gaps = 7/323 (2%)
 Frame = +1

Query  475   ILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEP-  651
             +LRAC +       +++H  VV  GL+ D      L++ Y      + A  VFD +  P 
Sbjct  9     LLRACMNSKSLKQGKLIHQKVVTLGLQNDIFLCKNLINLYLSCHLYDHAKCVFDNMENPC  68

Query  652   DLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE-KPDSFTYVGLIMCLDCPSLLR--IGK  822
             ++  WN +++G+     + +AL LF K+      KPDS+TY  ++    C  L +  +GK
Sbjct  69    EISLWNGLMAGYTKNYMYVEALELFEKLLHYPYLKPDSYTYPSVLKA--CGGLYKYVLGK  126

Query  823   NVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSG  1002
              +H+  +K G   +  VGS LV MY++C     A  +F+ + E D+  W+ +I    QSG
Sbjct  127   MIHTCLVKTGLMMDIVVGSSLVGMYAKCNAFEKAIWLFNEMPEKDVACWNTVISCYYQSG  186

Query  1003  DIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSS  1182
             +  +AL++F  M   G + + + I + +S+ A+L  +  G E H   +  G+ L+  +SS
Sbjct  187   NFKEALEYFGLMRRFGFEPNSVTITTAISSCARLLDLNRGMEIHEELINSGFLLDSFISS  246

Query  1183  ALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYN  1362
             AL+DMY KCG L + I+VF+ MP K ++++NSMIS  GL G++    Q+F+  +  E   
Sbjct  247   ALVDMYGKCGHLEMAIEVFEQMPKKTVVAWNSMISGYGLKGDSISCIQLFKR-MYNEGVK  305

Query  1363  PDEATFSALLCACCHTGLVCDGR  1431
             P   T S+L+  C  +  + +G+
Sbjct  306   PTLTTLSSLIMVCSRSARLLEGK  328



>ref|XP_007047622.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX91779.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=718

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 213/584 (36%), Positives = 314/584 (54%), Gaps = 45/584 (8%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKT--------------------HLS--HHPFYA  270
              FR+LL +   +++ + T K LHA+ +K+                    HL+  H+ F+ 
Sbjct  10    TFRNLL-KTCITHRDLLTGKSLHALYIKSLIPSSTYLSNHFILLYSKCGHLTAAHNAFHQ  68

Query  271   TR---------IIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLF  423
             T+         II  YA       A +LFD+ PQ  +  +N++I AYA   +   A  LF
Sbjct  69    TQDPNTFSFNAIIAAYAKESFPFVAHQLFDQIPQPDLVSYNTLISAYADCGKTEPALGLF  128

Query  424   KDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKL  603
             K M + G   D FT + ++ AC +  D   LR +H  +V  G    +  ++ L+S YSK 
Sbjct  129   KKMRELGFEMDGFTLSGVITACLN--DLFLLRQLHCFLVFCGFHSYASVNNALLSCYSKE  186

Query  604   GPLEEAIKVFDGIAE-PDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGL  780
             G LEEA +VF G+ E  D V WNSMI  +G   +  KAL LF +M R+G   D FT   +
Sbjct  187   GLLEEAKRVFYGMGEGKDEVSWNSMIVAYGQHKEGAKALALFQEMVRIGLVVDMFTLASV  246

Query  781   IMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR-IFDSLLEPD  957
             +        L  G   H++ +K GF  NAHVGS L+ +YS+C    S CR +FD +  PD
Sbjct  247   LTAFTSLEDLLGGLQFHAMLIKTGFHQNAHVGSGLIDLYSKCGGGMSDCRKVFDEVSGPD  306

Query  958   MVTWSAMICGLSQSGDIMKALDF-FREMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETH  1134
             +V W+ +I G S + ++ +     F+EM   G   D     +V+SA + L+    GR+ H
Sbjct  307   LVLWNTVISGYSLNEELAEEALECFQEMRCVGYHPDDCSFVNVISACSNLSSPSQGRQIH  366

Query  1135  GFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNAN  1314
               A++   H  + V++AL+ MYSKCG L+    +F  MP  N +S NSMI+    HG   
Sbjct  367   ALAIKSETHNRIQVNNALVAMYSKCGNLHDARWLFDRMPEHNTVSLNSMIAGYAEHGIGM  426

Query  1315  EAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVY  1494
             E+  +FE++LE+   +P   TF ++L AC HTG + +G++YF IM ++FGI+P+ EHY  
Sbjct  427   ESLLLFEQMLERN-ISPTSVTFISVLSACAHTGKLEEGQKYFNIMKEKFGIEPEVEHYSC  485

Query  1495  MVKLLGMAGELEEAYELIQSIQ-GPVDFGIWGALLSCCDIHGNYRLGGIVAKHLFDNKVE  1671
             M+ LLG AG+L EA  LI+++   P   G W ALLS C +HGN  L    A  L + +  
Sbjct  486   MIDLLGRAGKLSEAERLIETMPFSPGSIG-WAALLSACKMHGNIELASRAANQLLELEPS  544

Query  1672  KSSYGVMVSNMYAGDGRWE---CVKKLRVDMEAIKGKMPGKSWI  1794
              +   VM++NMYA  G+WE    V+KL  D   ++ K PG SWI
Sbjct  545   NAVPYVMLANMYASSGKWEEAATVRKLMRD-RGVR-KKPGCSWI  586



>ref|XP_010681694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Beta vulgaris subsp. vulgaris]
Length=559

 Score =   317 bits (811),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 186/546 (34%), Positives = 300/546 (55%), Gaps = 6/546 (1%)
 Frame = +1

Query  166   SLLTQLSRSNQTISTTKLLHAIILKTH-LSHHPFYATRIIRFYALNEDIVSARRLFDETP  342
             +LL  L+ S + ++  ++LHA I+ +  L  + F A+++  FYA    + +A  +F++  
Sbjct  16    ALLQSLTNS-RLLNKGQILHAHIISSGVLLKNTFLASKLAAFYANCGLMENAEIIFEQIM  74

Query  343   QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRV  522
              ++ FLWN +IR Y  +     A  L+  ML  G +PDNFT+  +++AC D       R+
Sbjct  75    VKNSFLWNYMIRGYTTSGFTVKALLLYSKMLSLGFQPDNFTYPFVVKACGDSLFVEFGRI  134

Query  523   VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGD  702
             +H  V+++G E D   ++ L++ YS  G +  A  VFD + + DL  WN+MI+GH   G 
Sbjct  135   IHAQVMINGFESDVYVANCLLAMYSNFGEMGTARLVFDRMTQRDLTSWNTMITGHVKNGF  194

Query  703   WKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFG-FDSNAHVGS  879
              ++AL  F+ +QR    PDS T +G++       ++  GK VH   L+   F SN  + +
Sbjct  195   SEEALCFFLLLQRSQLAPDSATLLGVLSACSDLHMITKGKEVHGYVLRNSMFTSNRFLTN  254

Query  880   LLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV  1059
              LV  Y +CK M  A R+F  +   D VTW+ MI G  Q+G   + L  F +M   G + 
Sbjct  255   SLVEFYCKCKTMLHAIRLF-MVSSKDSVTWNTMISGYVQTGKGFEGLRLFCQMVAYGEQP  313

Query  1060  DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVF  1239
             D   I ++L A  Q+     G   H +  + G+   + V++ALI MY+ CG L+   +VF
Sbjct  314   DLATIVTLLRACEQVIAFDFGMSIHSYLTQKGFGCSIMVATALIGMYAGCGKLSCSQRVF  373

Query  1240  KAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLV  1419
               +  KN++S+ +M+S  G HG   EA   F +++      PDE  F+++L AC H GLV
Sbjct  374   GEITEKNLVSWTAMLSAYGHHGKGREALSTFNQMVANGIV-PDEGAFTSILTACSHAGLV  432

Query  1420  CDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLS  1599
              DGR  FR +   + ++P   HY  +V LL  +G LEEAYE+I +++      IW +LL 
Sbjct  433   EDGREIFRQIKQNYNMKPALAHYACLVDLLSRSGHLEEAYEIIDNMEVEPTVDIWVSLLF  492

Query  1600  CCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKMP  1779
              C +HGN  L  + A+++F+   ++ S  + +SN YA + RW  V+KLR   ++ + +MP
Sbjct  493   GCRLHGNLHLAEVSAQNIFEGNPDRISGYISLSNTYAYEKRWNDVEKLRHVAQSKRLEMP  552

Query  1780  -GKSWI  1794
              G S+I
Sbjct  553   RGYSFI  558



>ref|XP_008784571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Phoenix dactylifera]
Length=903

 Score =   325 bits (834),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/530 (34%), Positives = 297/530 (56%), Gaps = 5/530 (1%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             + +H +  K  L H    +  +I  YA    +  ARRLF  T  R++  WN++I   AR 
Sbjct  247   RAVHGLSAKLGLVHELRVSNALIDMYAKCCCLFEARRLFGRTLGRNVVSWNAMIGGCARN  306

Query  394   HRFSNAFQLFKDM-LDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
                   F L ++M ++ G   +  T    L AC    +   ++ +HG  + + L+ D + 
Sbjct  307   GDADGTFHLLREMSVEDGVMANEVTVLNALPACLGPSELPNVKELHGYAIRNELQTDDLV  366

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
             S+ L++AY+K G LE A  VF+G+    +  WN++I G+   GD +KA+ LF++M  +GE
Sbjct  367   SNALIAAYAKCGSLESAGHVFNGMEMKTVGSWNALIGGYAQNGDPRKAIDLFLQMASLGE  426

Query  751   KPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSAC  927
             +PD F+   L++ C     LL  GK++H   L+ G + ++ +   L+S+Y +C    ++ 
Sbjct  427   EPDWFSIGSLLLACARSKDLLN-GKSIHGFVLRNGLERDSFIKISLLSLYIQCGETSASR  485

Query  928   RIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLA  1107
              +FD++ E D V+W+AMI G SQ+G    +L  FR +   G +   + +     A A+L+
Sbjct  486   VLFDAVEEKDPVSWNAMIAGYSQNGLPEDSLKLFRRLLRDGYEPSMIAMTGAFMACAELS  545

Query  1108  IVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMIS  1287
              ++ GRE HGFA++     +  V  ++IDMY+KCG +      F  + +++ +S+  MI+
Sbjct  546   ALRLGREAHGFALKANVSEDAFVGCSIIDMYAKCGSIEQACSFFSNLKNRDAVSWTVMIT  605

Query  1288  NLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGI  1467
               G++G   EA  +F+E + +E   PD  T+  +L AC H G+V +G RYF  M ++ G+
Sbjct  606   GYGINGFGAEAINLFDE-MRREGLKPDAFTYVGILLACSHAGMVEEGLRYFEEMKNKDGV  664

Query  1468  QPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAK  1647
             +PK EHY  +  +LG AG L EA  L++ +    D  IWGALL  C IHG+  LGG VA+
Sbjct  665   EPKLEHYACVADMLGRAGRLAEAARLVEEMPVEPDCRIWGALLGACRIHGDVSLGGKVAE  724

Query  1648  HLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWI  1794
              L + + +++ + V+ SN+YA  GRW+  +++R  M+ I   K PG SWI
Sbjct  725   KLLELEPDRAEHHVLASNLYASAGRWDDARRVRKRMKEIGLRKDPGCSWI  774


 Score =   213 bits (541),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 142/488 (29%), Positives = 248/488 (51%), Gaps = 21/488 (4%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKT-HLSHHPFYATRIIRFYALNEDIVSARRLFDETPQR  348
             L Q   SN+ +   + +H +I  +  L  +    TR++  Y++      +R +F+   +R
Sbjct  26    LLQACSSNRELDVGRRVHELISSSKELMSNAVLTTRLLTMYSMCGSPSDSRHVFEGLERR  85

Query  349   SIFLWNSIIRAYARAHRFSNAFQLF-KDMLDSGTRPDNFTFACILRACSDKFDFSGLRVV  525
             ++F WN++I  YAR   +  A  LF + M  +  +PDNFT  C+L++C    D    R V
Sbjct  86    NLFQWNAMISGYARNELWDAAIDLFYRLMSTTDLKPDNFTLPCVLKSCGGLLDVEMGRTV  145

Query  526   HGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDW  705
             HG  +  GL  D+  S+ L+S Y K G +++A +VF+ ++  +LV WN+MI G    G  
Sbjct  146   HGIALKLGLGSDTFISNSLISVYGKCGFIDDAAQVFETMSARNLVSWNTMICGLSENGSL  205

Query  706   KKALLLFIKMQRMGE---KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             ++    F KM  +GE   +PD  T V ++        L +G+ VH L  K G      V 
Sbjct  206   QEGFDFFRKMISVGEGSMRPDEATVVTVLPMCAGEGWLEMGRAVHGLSAKLGLVHELRVS  265

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGG-  1053
             + L+ MY++C C+  A R+F   L  ++V+W+AMI G +++GD        REM+++ G 
Sbjct  266   NALIDMYAKCCCLFEARRLFGRTLGRNVVSWNAMIGGCARNGDADGTFHLLREMSVEDGV  325

Query  1054  KVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQ  1233
               + + + + L A    + +   +E HG+A+R     +  VS+ALI  Y+KCG L     
Sbjct  326   MANEVTVLNALPACLGPSELPNVKELHGYAIRNELQTDDLVSNALIAAYAKCGSLESAGH  385

Query  1234  VFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEV--LEKEYYNPDEATFSALLCACCH  1407
             VF  M  K + S+N++I     +G+  +A  +F ++  L +E   PD  +  +LL AC  
Sbjct  386   VFNGMEMKTVGSWNALIGGYAQNGDPRKAIDLFLQMASLGEE---PDWFSIGSLLLACAR  442

Query  1408  TGLVCDGRRY--FRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQ--GPVDF  1575
             +  + +G+    F + N   G++  +   + ++ L    GE   +  L  +++   PV  
Sbjct  443   SKDLLNGKSIHGFVLRN---GLERDSFIKISLLSLYIQCGETSASRVLFDAVEEKDPVS-  498

Query  1576  GIWGALLS  1599
               W A+++
Sbjct  499   --WNAMIA  504


 Score =   172 bits (437),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 120/458 (26%), Positives = 206/458 (45%), Gaps = 13/458 (3%)
 Frame = +1

Query  127   SYQLLHQMFIAFRSLLTQLSRSN--------QTISTTKLLHAIILKTHLSHHPFYATRII  282
             ++ LL +M +    +  +++  N          +   K LH   ++  L      +  +I
Sbjct  312   TFHLLREMSVEDGVMANEVTVLNALPACLGPSELPNVKELHGYAIRNELQTDDLVSNALI  371

Query  283   RFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNF  462
               YA    + SA  +F+    +++  WN++I  YA+      A  LF  M   G  PD F
Sbjct  372   AAYAKCGSLESAGHVFNGMEMKTVGSWNALIGGYAQNGDPRKAIDLFLQMASLGEEPDWF  431

Query  463   TFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGI  642
             +   +L AC+   D    + +HG V+ +GLE DS     L+S Y + G    +  +FD +
Sbjct  432   SIGSLLLACARSKDLLNGKSIHGFVLRNGLERDSFIKISLLSLYIQCGETSASRVLFDAV  491

Query  643   AEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGK  822
              E D V WN+MI+G+   G  + +L LF ++ R G +P      G  M     S LR+G+
Sbjct  492   EEKDPVSWNAMIAGYSQNGLPEDSLKLFRRLLRDGYEPSMIAMTGAFMACAELSALRLGR  551

Query  823   NVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSG  1002
               H   LK     +A VG  ++ MY++C  +  AC  F +L   D V+W+ MI G   +G
Sbjct  552   EAHGFALKANVSEDAFVGCSIIDMYAKCGSIEQACSFFSNLKNRDAVSWTVMITGYGING  611

Query  1003  DIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPG-RETHGFAVRCGYHLEVSVS  1179
                +A++ F EM  +G K D      +L A +   +V+ G R       + G   ++   
Sbjct  612   FGAEAINLFDEMRREGLKPDAFTYVGILLACSHAGMVEEGLRYFEEMKNKDGVEPKLEHY  671

Query  1180  SALIDMYSKCGFLNLGIQVFKAMP-SKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEY  1356
             + + DM  + G L    ++ + MP   +   + +++    +HG+ +   ++ E++LE E 
Sbjct  672   ACVADMLGRAGRLAEAARLVEEMPVEPDCRIWGALLGACRIHGDVSLGGKVAEKLLELE-  730

Query  1357  YNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQ  1470
               PD A    L      +    D  R  R    E G++
Sbjct  731   --PDRAEHHVLASNLYASAGRWDDARRVRKRMKEIGLR  766



>ref|XP_010648490.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, 
mitochondrial-like [Vitis vinifera]
 emb|CBI20844.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   321 bits (822),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 184/532 (35%), Positives = 284/532 (53%), Gaps = 2/532 (0%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H   +K       F +   +  Y     +  A   FD+   + I  WN++I  YA+ 
Sbjct  166   KCVHGYAVKIGFDSDLFVSGSTVYMYCKCGILDMAGLAFDQIENKDIVAWNTMITGYAQN  225

Query  394   HRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICS  573
                  A +LF  M   G +P++ TF C+L+A +   D +  R  H  V+  G  +D   +
Sbjct  226   CYEEEAIELFYQMELEGFKPNDTTFCCVLKASTAMSDSAVGRCFHAKVLKLGCSMDVFVA  285

Query  574   SQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEK  753
             + LV  YSK   +E+  + F  +++ +LV +N++I+G+  +G +++AL ++ ++Q  G +
Sbjct  286   TALVDMYSKFYDIEDVERAFGEMSKRNLVSFNALITGYSLMGKYEEALRVYSQLQSEGME  345

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PDSFT+VGL       S +  G  VH   +KFG DS+  VG+ +V+ YS+C    SA   
Sbjct  346   PDSFTFVGLFSSCSVSSTVAEGAQVHVHSVKFGLDSDVSVGNSIVNFYSKCGFTDSALEA  405

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F+S+  P+ V W+ +I G +Q+G+  KAL  F +M     K D    +SV+ A +  A V
Sbjct  406   FESINRPNSVCWAGIISGFAQNGEGEKALMQFCKMRKFIDKTDEFSSSSVIKAVSSWAAV  465

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + GR  H   ++ G    + V SA+IDMYSKCG +    +VF  MP KN++S+NSMI+  
Sbjct  466   EQGRHLHAHVMKSGLDCTIYVGSAVIDMYSKCGMVEDAQKVFSVMPEKNVVSWNSMITGY  525

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G   EA  +F+E+       P   TF  +L AC H GLV +GR ++ +M   +GI P
Sbjct  526   AQNGFCKEALLLFQEMTSSGIL-PTAVTFVGILFACSHAGLVEEGRNFYNLMVHNYGIPP  584

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
               EH   MV LLG AG LEEA   + S     + GIWG+LLS C +H N  +G   A+H 
Sbjct  585   SMEHCTCMVDLLGRAGYLEEAEAFLLSSSFSKEPGIWGSLLSACGVHKNSDVGSRAAQHC  644

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWISNIK  1806
                +   SS    +SN+YA    W  V ++R  M+ +   K PG SWI +++
Sbjct  645   LFLEPHYSSSYTALSNIYASKELWSEVSRIRDLMKDMGVEKEPGCSWIESLR  696


 Score =   176 bits (447),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 123/423 (29%), Positives = 199/423 (47%), Gaps = 7/423 (2%)
 Frame = +1

Query  343   QRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRV  522
             + ++  W S I   AR      A   F  ML +G  P+  T++  + AC+     S    
Sbjct  3     ETNVVRWTSKITDNARRGLVDQALSCFLQMLRAGIEPNAITYSATISACAQSTRPSLATS  62

Query  523   VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGD  702
             +H  ++  G       SS L+S YSK   ++EA  +FD + E D V WNSMI+G+   G 
Sbjct  63    LHCLILKKGFSNQLFVSSGLISMYSKHDRIKEARFLFDDMPERDDVSWNSMIAGYSQRGL  122

Query  703   WKKALLLFIKMQRMGEK----PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              ++A  LF  M    E        FT   ++         RIGK VH   +K GFDS+  
Sbjct  123   NEEACGLFCSMINSCENWKLLVSDFTLATVLKACGGLGCSRIGKCVHGYAVKIGFDSDLF  182

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
             V    V MY +C  +  A   FD +   D+V W+ MI G +Q+    +A++ F +M ++G
Sbjct  183   VSGSTVYMYCKCGILDMAGLAFDQIENKDIVAWNTMITGYAQNCYEEEAIELFYQMELEG  242

Query  1051  GKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGI  1230
              K +      VL A+  ++    GR  H   ++ G  ++V V++AL+DMYSK   +    
Sbjct  243   FKPNDTTFCCVLKASTAMSDSAVGRCFHAKVLKLGCSMDVFVATALVDMYSKFYDIEDVE  302

Query  1231  QVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHT  1410
             + F  M  +N++S+N++I+   L G   EA +++ + L+ E   PD  TF  L  +C  +
Sbjct  303   RAFGEMSKRNLVSFNALITGYSLMGKYEEALRVYSQ-LQSEGMEPDSFTFVGLFSSCSVS  361

Query  1411  GLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGA  1590
               V +G +   + + +FG+         +V      G  + A E  +SI  P     W  
Sbjct  362   STVAEGAQ-VHVHSVKFGLDSDVSVGNSIVNFYSKCGFTDSALEAFESINRPNSV-CWAG  419

Query  1591  LLS  1599
             ++S
Sbjct  420   IIS  422


 Score =   175 bits (444),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/430 (28%), Positives = 213/430 (50%), Gaps = 6/430 (1%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I + + ++  ++S +    T L H +ILK   S+  F ++ +I  Y+ ++ I  AR LFD
Sbjct  42    ITYSATISACAQSTRPSLATSL-HCLILKKGFSNQLFVSSGLISMYSKHDRIKEARFLFD  100

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTR----PDNFTFACILRACSDKF  501
             + P+R    WNS+I  Y++      A  LF  M++S         +FT A +L+AC    
Sbjct  101   DMPERDDVSWNSMIAGYSQRGLNEEACGLFCSMINSCENWKLLVSDFTLATVLKACGGLG  160

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
                  + VHG  V  G + D   S   V  Y K G L+ A   FD I   D+V WN+MI+
Sbjct  161   CSRIGKCVHGYAVKIGFDSDLFVSGSTVYMYCKCGILDMAGLAFDQIENKDIVAWNTMIT  220

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS  861
             G+      ++A+ LF +M+  G KP+  T+  ++      S   +G+  H+  LK G   
Sbjct  221   GYAQNCYEEEAIELFYQMELEGFKPNDTTFCCVLKASTAMSDSAVGRCFHAKVLKLGCSM  280

Query  862   NAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMN  1041
             +  V + LV MYS+   +    R F  + + ++V+++A+I G S  G   +AL  + ++ 
Sbjct  281   DVFVATALVDMYSKFYDIEDVERAFGEMSKRNLVSFNALITGYSLMGKYEEALRVYSQLQ  340

Query  1042  MKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
              +G + D      + S+ +  + V  G + H  +V+ G   +VSV +++++ YSKCGF +
Sbjct  341   SEGMEPDSFTFVGLFSSCSVSSTVAEGAQVHVHSVKFGLDSDVSVGNSIVNFYSKCGFTD  400

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
               ++ F+++   N + +  +IS    +G   +A   F + + K     DE + S+++ A 
Sbjct  401   SALEAFESINRPNSVCWAGIISGFAQNGEGEKALMQFCK-MRKFIDKTDEFSSSSVIKAV  459

Query  1402  CHTGLVCDGR  1431
                  V  GR
Sbjct  460   SSWAAVEQGR  469


 Score = 95.5 bits (236),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 132/288 (46%), Gaps = 5/288 (2%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
              F  L +  S S+ T++    +H   +K  L         I+ FY+      SA   F+ 
Sbjct  350   TFVGLFSSCSVSS-TVAEGAQVHVHSVKFGLDSDVSVGNSIVNFYSKCGFTDSALEAFES  408

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
               + +   W  II  +A+      A   F  M     + D F+ + +++A S        
Sbjct  409   INRPNSVCWAGIISGFAQNGEGEKALMQFCKMRKFIDKTDEFSSSSVIKAVSSWAAVEQG  468

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             R +H  V+ SGL+      S ++  YSK G +E+A KVF  + E ++V WNSMI+G+   
Sbjct  469   RHLHAHVMKSGLDCTIYVGSAVIDMYSKCGMVEDAQKVFSVMPEKNVVSWNSMITGYAQN  528

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCL-KFGFDSNAHV  873
             G  K+ALLLF +M   G  P + T+VG++       L+  G+N ++L +  +G   +   
Sbjct  529   GFCKEALLLFQEMTSSGILPTAVTFVGILFACSHAGLVEEGRNFYNLMVHNYGIPPSMEH  588

Query  874   GSLLVSMYSRCKCMGSA-CRIFDSLLEPDMVTWSAMI--CGLSQSGDI  1008
              + +V +  R   +  A   +  S    +   W +++  CG+ ++ D+
Sbjct  589   CTCMVDLLGRAGYLEEAEAFLLSSSFSKEPGIWGSLLSACGVHKNSDV  636


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (52%), Gaps = 0/130 (0%)
 Frame = +1

Query  943   LLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIVQPG  1122
             +LE ++V W++ I   ++ G + +AL  F +M   G + + +  ++ +SA AQ       
Sbjct  1     MLETNVVRWTSKITDNARRGLVDQALSCFLQMLRAGIEPNAITYSATISACAQSTRPSLA  60

Query  1123  RETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNLGLH  1302
                H   ++ G+  ++ VSS LI MYSK   +     +F  MP ++ +S+NSMI+     
Sbjct  61    TSLHCLILKKGFSNQLFVSSGLISMYSKHDRIKEARFLFDDMPERDDVSWNSMIAGYSQR  120

Query  1303  GNANEAFQIF  1332
             G   EA  +F
Sbjct  121   GLNEEACGLF  130



>ref|XP_010668439.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010668447.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=696

 Score =   320 bits (821),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/528 (34%), Positives = 297/528 (56%), Gaps = 6/528 (1%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAHR  399
             +H   +K     + F  + ++  Y+  +++ SAR +FD+     + +WN++I  YA+   
Sbjct  169   VHGYAMKIGFDSNEFVGSSLVGMYSKYDELGSARAMFDQLGSMDVVVWNTMITGYAQNGC  228

Query  400   FSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQ  579
                A +LF +M   G  P+  TF+ ++ A S   D +  R +H  ++ SG   D    + 
Sbjct  229   EEEAMELFLEMEIRGFSPNYTTFSVVIDASSVMPDETLGRKLHAKILKSGFLCDVYLGTA  288

Query  580   LVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKAL--LLFIKMQRMGEK  753
             +V  YSK   + +A + F  +++ +++ +N++I+G+G  GD +KAL     +++QRM  K
Sbjct  289   IVDLYSKFLIMTDAERAFSEMSKKNVISYNALITGYGLSGDHEKALKSYTLLRLQRM--K  346

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PD+ T++GL+          +G+ VHS  +K G D +  V + +V+ YS+C  + SA + 
Sbjct  347   PDACTFIGLLTSTATSCAFVVGEKVHSDSIKLGLDQDVLVRNSIVNFYSKCGRIDSAIKA  406

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             F++    D+V+W+A+I GL Q+ +  KAL+ F EM+    K D    +SV+ A A LA V
Sbjct  407   FETAQGSDIVSWTAIISGLVQNNEHTKALELFCEMHKLSEKADEFSSSSVIKAVASLAAV  466

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
               GR  HG+ ++ G    + V SALIDMYSK G +   +++F  MP KN++S+NSMI+  
Sbjct  467   AQGRNLHGYVLKVGLSDHIFVGSALIDMYSKFGVVEDALKLFSEMPDKNVVSWNSMITGY  526

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G ++EA  +F++++      P   TF  +L ACC+ GLV +GRRY+ +M   +GI P
Sbjct  527   AQNGFSDEALDLFDKMVRNGIL-PTSVTFVGVLLACCNAGLVQEGRRYYHLMGSHYGISP  585

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
               EHY  MV LLG +G + EA E + S     +  IW +LL+CC+ H ++ +   VA++ 
Sbjct  586   SVEHYSCMVNLLGHSGYVGEAEEFLLSSPFKEEHEIWKSLLNCCEAHRDFDVAARVAEYC  645

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDME-AIKGKMPGKSWI  1794
                K   SS   ++SN+YA    W  V++ R  M+ A   K PG SW+
Sbjct  646   SLLKPNDSSTYTILSNIYATKQLWSEVERTRDSMKMADIVKEPGCSWV  693


 Score =   175 bits (443),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 126/427 (30%), Positives = 209/427 (49%), Gaps = 16/427 (4%)
 Frame = +1

Query  346   RSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFD-FSGLRV  522
              ++  W S I++Y++   F  A  LF  M  +G  P+  TF+  L  CS   + + GL +
Sbjct  4     ENVVQWTSNIKSYSKKGFFHKALSLFLKMRKAGIEPNEITFSTTLSVCSQSTNKYFGLSL  63

Query  523   VHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGD  702
              H  ++  G E        L+S Y     + +A +VFD + E D V  N MI+ +   G 
Sbjct  64    -HNLILKKGYERQLFVCGGLISMYFNYDRISDARQVFDEMPERDEVVCNLMIAKYSQNGF  122

Query  703   WKKALLLFIKM-----QRMGEKPDSFTYVGLI-MCLDCPSLLRIGKNVHSLCLKFGFDSN  864
              K A  LF  M        G   D F+   ++  C D     R+G++VH   +K GFDSN
Sbjct  123   SKDACRLFCGMVNGCVHWRGFVSD-FSLASVVNACADHEGFCRLGESVHGYAMKIGFDSN  181

Query  865   AHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNM  1044
               VGS LV MYS+   +GSA  +FD L   D+V W+ MI G +Q+G   +A++ F EM +
Sbjct  182   EFVGSSLVGMYSKYDELGSARAMFDQLGSMDVVVWNTMITGYAQNGCEEEAMELFLEMEI  241

Query  1045  KGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNL  1224
             +G   +    + V+ A++ +     GR+ H   ++ G+  +V + +A++D+YSK   +  
Sbjct  242   RGFSPNYTTFSVVIDASSVMPDETLGRKLHAKILKSGFLCDVYLGTAIVDLYSKFLIMTD  301

Query  1225  GIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACC  1404
               + F  M  KN+ISYN++I+  GL G+  +A + +  +L  +   PD  TF  LL +  
Sbjct  302   AERAFSEMSKKNVISYNALITGYGLSGDHEKALKSY-TLLRLQRMKPDACTFIGLLTSTA  360

Query  1405  HTGLVCDGRRYFRIMND--EFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG  1578
              +     G    ++ +D  + G+         +V      G ++ A +  ++ QG  D  
Sbjct  361   TSCAFVVGE---KVHSDSIKLGLDQDVLVRNSIVNFYSKCGRIDSAIKAFETAQGS-DIV  416

Query  1579  IWGALLS  1599
              W A++S
Sbjct  417   SWTAIIS  423


 Score =   174 bits (440),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 121/435 (28%), Positives = 218/435 (50%), Gaps = 13/435 (3%)
 Frame = +1

Query  154   IAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFD  333
             I F + L+  S+S        L H +ILK       F    +I  Y   + I  AR++FD
Sbjct  42    ITFSTTLSVCSQSTNKYFGLSL-HNLILKKGYERQLFVCGGLISMYFNYDRISDARQVFD  100

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTR----PDNFTFACILRACSDKF  501
             E P+R   + N +I  Y++     +A +LF  M++          +F+ A ++ AC+D  
Sbjct  101   EMPERDEVVCNLMIAKYSQNGFSKDACRLFCGMVNGCVHWRGFVSDFSLASVVNACADHE  160

Query  502   DFSGL-RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMI  678
              F  L   VHG  +  G + +    S LV  YSK   L  A  +FD +   D+V WN+MI
Sbjct  161   GFCRLGESVHGYAMKIGFDSNEFVGSSLVGMYSKYDELGSARAMFDQLGSMDVVVWNTMI  220

Query  679   SGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLL---RIGKNVHSLCLKF  849
             +G+   G  ++A+ LF++M+  G  P+   Y    + +D  S++    +G+ +H+  LK 
Sbjct  221   TGYAQNGCEEEAMELFLEMEIRGFSPN---YTTFSVVIDASSVMPDETLGRKLHAKILKS  277

Query  850   GFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFF  1029
             GF  + ++G+ +V +YS+   M  A R F  + + ++++++A+I G   SGD  KAL  +
Sbjct  278   GFLCDVYLGTAIVDLYSKFLIMTDAERAFSEMSKKNVISYNALITGYGLSGDHEKALKSY  337

Query  1030  REMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
               + ++  K D      +L++ A       G + H  +++ G   +V V +++++ YSKC
Sbjct  338   TLLRLQRMKPDACTFIGLLTSTATSCAFVVGEKVHSDSIKLGLDQDVLVRNSIVNFYSKC  397

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
             G ++  I+ F+     +I+S+ ++IS L  +    +A ++F E + K     DE + S++
Sbjct  398   GRIDSAIKAFETAQGSDIVSWTAIISGLVQNNEHTKALELFCE-MHKLSEKADEFSSSSV  456

Query  1390  LCACCHTGLVCDGRR  1434
             + A      V  GR 
Sbjct  457   IKAVASLAAVAQGRN  471



>ref|XP_010999774.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Populus euphratica]
Length=879

 Score =   325 bits (833),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 194/534 (36%), Positives = 292/534 (55%), Gaps = 5/534 (1%)
 Frame = +1

Query  199   TISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIR  378
             ++   K +H  +LK  L         +I FY     +  AR+LFDE   R +  WNS+I 
Sbjct  220   SVKEGKWVHGFLLKLGLGSCNAVVNSLIAFYLKMRRVDVARKLFDELTDRDVISWNSMIS  279

Query  379   AYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLEL  558
              Y          +LFK ML SG   D  T   IL+AC++    S  R VHG  V + +  
Sbjct  280   GYVANGFSEKGVELFKKMLYSGVDMDLATMVSILQACANCGYVSLGRAVHGSAVKACVHG  339

Query  559   DSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQ  738
              +   + L+  Y+K G L+ AI+VFD ++   +V W S+I+ +   G   +A+ LF +M 
Sbjct  340   KTTFCNTLLDMYAKCGVLDGAIRVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMD  399

Query  739   RMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMG  918
             R G  PD FT   ++    C   L  GK+VH+   +    SN  V + L+ MY++C  M 
Sbjct  400   REGVSPDIFTITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSME  459

Query  919   SACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAA  1098
              A  +F  +   D+++W+ MI G S++    +AL  F  M ++  K D   +A +L A A
Sbjct  460   DANSVFLEIPVKDIISWNTMIGGYSKNSLPNEALSLFGAMVLE-MKPDGTTLACILPACA  518

Query  1099  QLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNS  1278
              LA +  G+E HG  +R G+  +  V++AL+DMY KCG   L   +F  +P+K++I++  
Sbjct  519   SLASLDKGKEVHGHILRNGFFSDQQVANALVDMYVKCGVPVLARLLFDMIPTKDLITWTV  578

Query  1279  MISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDE  1458
             MI+  G+HG  N A   F E +      PDE +F ++L AC H+GL+ +G R+F +M DE
Sbjct  579   MIAGYGMHGFGNNAITTFNE-MRLAGIEPDEVSFISILYACSHSGLLEEGWRFFNVMKDE  637

Query  1459  FGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGI  1638
               I+PK EHY  +V LL  +G+L  AY+ I+S+    D  IWGALLS C IH + +L   
Sbjct  638   CNIKPKLEHYACIVDLLARSGKLAMAYKFIKSMPIEPDATIWGALLSGCRIHHDVKLAEK  697

Query  1639  VAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLR--VDMEAIKGKMPGKSWI  1794
             VA+H+F+ + E + Y V+++N YA   +WE VKKLR  +    +K K PG SWI
Sbjct  698   VAEHVFELEPENTGYYVLLANTYAEAEKWEEVKKLRQKIGQRGLK-KNPGCSWI  750


 Score =   193 bits (490),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 122/412 (30%), Positives = 210/412 (51%), Gaps = 6/412 (1%)
 Frame = +1

Query  172   LTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRS  351
             + QLS   +++   K +H+ I  + +S      ++++  Y    D+   R +FD+     
Sbjct  110   ILQLSAELKSLQDGKKVHSFICSSGISIDSVLGSKLVFMYVTCGDLREGRPIFDKIRNEK  169

Query  352   IFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHG  531
             +FLWN ++  Y +   F  +  LF+ MLD G   ++ T +CIL+  +        + VHG
Sbjct  170   VFLWNLMMNGYTKIGDFKESVSLFRQMLDLGVEVNSHTVSCILKCFAALGSVKEGKWVHG  229

Query  532   GVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKK  711
              ++  GL   +   + L++ Y K+  ++ A K+FD + + D++ WNSMISG+   G  +K
Sbjct  230   FLLKLGLGSCNAVVNSLIAFYLKMRRVDVARKLFDELTDRDVISWNSMISGYVANGFSEK  289

Query  712   ALLLFIKMQRMGEKPDSFTYVGLIM-CLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLV  888
              + LF KM   G   D  T V ++  C +C   + +G+ VH   +K          + L+
Sbjct  290   GVELFKKMLYSGVDMDLATMVSILQACANC-GYVSLGRAVHGSAVKACVHGKTTFCNTLL  348

Query  889   SMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPL  1068
              MY++C  +  A R+FD +    +VTW+++I   ++ G   +A+  F EM+ +G   D  
Sbjct  349   DMYAKCGVLDGAIRVFDLMSVRTVVTWTSLIAAYAREGLSDEAIRLFHEMDREGVSPDIF  408

Query  1069  LIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAM  1248
              I +VL A A    ++ G++ H +         + V +AL+DMY+KCG +     VF  +
Sbjct  409   TITTVLHACACNGSLENGKDVHNYIRENDMQSNIFVCNALMDMYAKCGSMEDANSVFLEI  468

Query  1249  PSKNIISYNSMISNLGLHGNANEAFQIFEE-VLEKEYYNPDEATFSALLCAC  1401
             P K+IIS+N+MI     +   NEA  +F   VLE +   PD  T + +L AC
Sbjct  469   PVKDIISWNTMIGGYSKNSLPNEALSLFGAMVLEMK---PDGTTLACILPAC  517


 Score =   173 bits (438),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 185/357 (52%), Gaps = 3/357 (1%)
 Frame = +1

Query  361   WNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVV  540
             WN  I           A +L    +      ++ T   IL+  ++       + VH  + 
Sbjct  74    WNKKIYEVCEMGNIDKAIELL--YMSPKAEIESRTCCSILQLSAELKSLQDGKKVHSFIC  131

Query  541   VSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALL  720
              SG+ +DS+  S+LV  Y   G L E   +FD I    +  WN M++G+  +GD+K+++ 
Sbjct  132   SSGISIDSVLGSKLVFMYVTCGDLREGRPIFDKIRNEKVFLWNLMMNGYTKIGDFKESVS  191

Query  721   LFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYS  900
             LF +M  +G + +S T   ++ C      ++ GK VH   LK G  S   V + L++ Y 
Sbjct  192   LFRQMLDLGVEVNSHTVSCILKCFAALGSVKEGKWVHGFLLKLGLGSCNAVVNSLIAFYL  251

Query  901   RCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIAS  1080
             + + +  A ++FD L + D+++W++MI G   +G   K ++ F++M   G  +D   + S
Sbjct  252   KMRRVDVARKLFDELTDRDVISWNSMISGYVANGFSEKGVELFKKMLYSGVDMDLATMVS  311

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             +L A A    V  GR  HG AV+   H + +  + L+DMY+KCG L+  I+VF  M  + 
Sbjct  312   ILQACANCGYVSLGRAVHGSAVKACVHGKTTFCNTLLDMYAKCGVLDGAIRVFDLMSVRT  371

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
             ++++ S+I+     G ++EA ++F E +++E  +PD  T + +L AC   G + +G+
Sbjct  372   VVTWTSLIAAYAREGLSDEAIRLFHE-MDREGVSPDIFTITTVLHACACNGSLENGK  427



>ref|XP_004504288.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X1 [Cicer arietinum]
 ref|XP_004504289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=879

 Score =   325 bits (832),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 193/532 (36%), Positives = 291/532 (55%), Gaps = 3/532 (1%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +   K +H  +LK            +I  Y     + SA  LFDE   R +  WNS+I  
Sbjct  221   VKECKRVHGYVLKLGFGSSTAVVNSLIAAYFKFGGVESAHNLFDELSDRDVVSWNSMING  280

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
                     N  ++F  ML  G   D  T   +L AC++  + S  R +H   V +    +
Sbjct  281   CVVNGFSRNGLEIFIQMLILGVGVDLTTLVSVLVACANIGNLSLGRALHAFGVKAPFSGE  340

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
              + S+ L+  YSK G L  A +VF  + E  +V W S+I+ +   G +  A+ LF +MQ 
Sbjct  341   VVFSNTLLDMYSKCGNLNGATEVFVKMGETTIVSWTSIIAAYVREGLYDDAIGLFDEMQS  400

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              G +PD +T   ++    C + L  G++VHS  +K    SN  V + L++MY++C  M  
Sbjct  401   KGVRPDIYTVTSIVHACACSNSLDKGRDVHSYVIKNSMVSNLPVANALMNMYAKCGSMEE  460

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A  +F  +   D+V+W+ MI G S++     AL+ F +M ++  K D + +A VL A A 
Sbjct  461   ARLVFSQIPAKDIVSWNTMIGGYSKNSLPNGALELFSDM-VEQLKPDDITMACVLPACAG  519

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
             LA +  GRE HG  +R GY  ++ V+ AL+DMY+KCG L L   +F  +P K++IS+  M
Sbjct  520   LAALDKGREIHGHILRRGYFSDLHVACALVDMYAKCGLLVLAQILFDMIPKKDLISWTVM  579

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             I+  G+HG  NEA   F + +      PDE++F+A+L AC H+GL+ +G R+F  M +E 
Sbjct  580   IAGYGMHGFGNEAISTFNK-MRIAGIEPDESSFTAILNACSHSGLLNEGWRFFNSMRNEC  638

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIV  1641
              I+PK EHY  MV LLG AG L +AY+ I+S+    +  IWGALLS C IH + +L   V
Sbjct  639   SIEPKLEHYACMVDLLGRAGNLSKAYKFIESMPIKPNATIWGALLSGCRIHHDVKLAEKV  698

Query  1642  AKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKGKM-PGKSWI  1794
             A H+F+ + + + Y V+++N+YA   +WE  KKLR  M+    K  PG SWI
Sbjct  699   ADHVFELEPDNTRYYVVLANVYAEAEKWEEAKKLRERMQRRGFKQNPGCSWI  750


 Score =   203 bits (517),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/431 (28%), Positives = 216/431 (50%), Gaps = 2/431 (0%)
 Frame = +1

Query  142   HQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSAR  321
             H++ +     + QL    +++   K +H II+   +        +++  Y    D+V  R
Sbjct  100   HELGLNTYCSVLQLCAERKSLEDGKRIHFIIVSKGIPIKGALGAKLVFMYVNCGDLVKGR  159

Query  322   RLFDETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKF  501
              +FDE     +FLWN ++  YA+   +  +  LF  M   G   D++TF C+L+  +   
Sbjct  160   EIFDEILNDKVFLWNLMMSEYAKIGNYRESLGLFNKMQKLGIAGDSYTFTCVLKCFTALG  219

Query  502   DFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMIS  681
                  + VHG V+  G    +   + L++AY K G +E A  +FD +++ D+V WNSMI+
Sbjct  220   KVKECKRVHGYVLKLGFGSSTAVVNSLIAAYFKFGGVESAHNLFDELSDRDVVSWNSMIN  279

Query  682   GHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDS  861
             G    G  +  L +FI+M  +G   D  T V +++       L +G+ +H+  +K  F  
Sbjct  280   GCVVNGFSRNGLEIFIQMLILGVGVDLTTLVSVLVACANIGNLSLGRALHAFGVKAPFSG  339

Query  862   NAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMN  1041
                  + L+ MYS+C  +  A  +F  + E  +V+W+++I    + G    A+  F EM 
Sbjct  340   EVVFSNTLLDMYSKCGNLNGATEVFVKMGETTIVSWTSIIAAYVREGLYDDAIGLFDEMQ  399

Query  1042  MKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLN  1221
              KG + D   + S++ A A    +  GR+ H + ++      + V++AL++MY+KCG + 
Sbjct  400   SKGVRPDIYTVTSIVHACACSNSLDKGRDVHSYVIKNSMVSNLPVANALMNMYAKCGSME  459

Query  1222  LGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
                 VF  +P+K+I+S+N+MI     +   N A ++F +++E+    PD+ T + +L AC
Sbjct  460   EARLVFSQIPAKDIVSWNTMIGGYSKNSLPNGALELFSDMVEQ--LKPDDITMACVLPAC  517

Query  1402  CHTGLVCDGRR  1434
                  +  GR 
Sbjct  518   AGLAALDKGRE  528



>gb|KDP24179.1| hypothetical protein JCGZ_25836 [Jatropha curcas]
Length=604

 Score =   318 bits (814),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/529 (36%), Positives = 281/529 (53%), Gaps = 10/529 (2%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFY-ALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAH  396
             +HA ++K+ L    F    ++  Y  L  +    RRLFD    R +  W S++  Y +  
Sbjct  82    IHAHLIKSGLETDRFIGNSLLALYFKLGSNFFETRRLFDGLYFRDVISWTSMVTGYIKVG  141

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
             +  NA +LF +MLD G  P+ FT +  ++A SD  +    + +HG V+  G + + + SS
Sbjct  142   KPKNAIELFLEMLDFGIDPNGFTLSAAIKASSDLGNLRLGKCIHGVVISQGFDSNYVISS  201

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR-MGEK  753
              L+  Y +   LE+A ++FD + EPD + W S+IS       + KAL  F  MQR +G  
Sbjct  202   ALIDMYGRNYGLEDACRLFDDLLEPDAISWTSVISAFTRNDMYDKALGFFYLMQRKLGLA  261

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PD FT+  ++        L+ GK VH+  +  GF  N  V S LV MY +C  +  +  +
Sbjct  262   PDEFTFGTVLTACGNLRRLKRGKEVHARVITSGFSGNVVVESSLVDMYGKCGLVMESQHV  321

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD +   + V+WSA++ G  Q+GD    +  FRE+       D     +VL A + LA +
Sbjct  322   FDRMSIKNSVSWSALLGGYCQNGDFESVIRIFREVESH----DLYSFGTVLRACSGLAAI  377

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E HG  VR G   +V V SAL+D+Y+KCG ++   ++F  M  +N+I++NSMI   
Sbjct  378   RQGKEVHGQYVRRGGWRDVIVESALVDLYAKCGCIDFAHRIFSKMSVRNLITWNSMIYGF  437

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G   EA +IF E+L  E   PD  ++  +L AC HTGLV  GR++F  M  E+ I+P
Sbjct  438   AQNGRGEEALRIFNEML-GEGIKPDYISYIGVLFACSHTGLVDQGRKFFMSMTKEYEIKP  496

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
               EHY  MV LLG AG LEEA  LI++     D  +W  LL  C    N      +AK L
Sbjct  497   GIEHYNCMVDLLGRAGLLEEAENLIENSDCREDSSLWAVLLGACTPSTNSGAAEHIAKKL  556

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDME--AIKGKMPGKSWI  1794
                  +     V ++N+Y   GRW+   K+R  M+   +K KMPGKSWI
Sbjct  557   MKLDPDYHLSYVYLANIYRAVGRWDDAAKIRRLMKKRGVK-KMPGKSWI  604


 Score =   185 bits (470),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 113/368 (31%), Positives = 184/368 (50%), Gaps = 11/368 (3%)
 Frame = +1

Query  334   ETPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSG  513
             + PQ   F     I  Y ++    +A  +   +  +      F +A +L+ C+    F+ 
Sbjct  23    QNPQTKEFR----IIQYCKSGALFDALHILNSLDSAKLCNKPFLYASLLQTCTKVVSFNH  78

Query  514   LRVVHGGVVVSGLELDSICSSQLVSAYSKLGP-LEEAIKVFDGIAEPDLVQWNSMISGHG  690
                +H  ++ SGLE D    + L++ Y KLG    E  ++FDG+   D++ W SM++G+ 
Sbjct  79    GLQIHAHLIKSGLETDRFIGNSLLALYFKLGSNFFETRRLFDGLYFRDVISWTSMVTGYI  138

Query  691   CLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAH  870
              +G  K A+ LF++M   G  P+ FT    I        LR+GK +H + +  GFDSN  
Sbjct  139   KVGKPKNAIELFLEMLDFGIDPNGFTLSAAIKASSDLGNLRLGKCIHGVVISQGFDSNYV  198

Query  871   VGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKG  1050
             + S L+ MY R   +  ACR+FD LLEPD ++W+++I   +++    KAL FF  M  K 
Sbjct  199   ISSALIDMYGRNYGLEDACRLFDDLLEPDAISWTSVISAFTRNDMYDKALGFFYLMQRKL  258

Query  1051  GKV-DPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLG  1227
             G   D     +VL+A   L  ++ G+E H   +  G+   V V S+L+DMY KCG +   
Sbjct  259   GLAPDEFTFGTVLTACGNLRRLKRGKEVHARVITSGFSGNVVVESSLVDMYGKCGLVMES  318

Query  1228  IQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCH  1407
               VF  M  KN +S+++++     +G+     +IF EV   + Y     +F  +L AC  
Sbjct  319   QHVFDRMSIKNSVSWSALLGGYCQNGDFESVIRIFREVESHDLY-----SFGTVLRACSG  373

Query  1408  TGLVCDGR  1431
                +  G+
Sbjct  374   LAAIRQGK  381


 Score =   143 bits (361),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 107/397 (27%), Positives = 178/397 (45%), Gaps = 39/397 (10%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             K +H +++      +   ++ +I  Y  N  +  A RLFD+  +     W S+I A+ R 
Sbjct  182   KCIHGVVISQGFDSNYVISSALIDMYGRNYGLEDACRLFDDLLEPDAISWTSVISAFTRN  241

Query  394   HRFSNAFQLFKDMLDS-GTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
               +  A   F  M    G  PD FTF  +L AC +       + VH  V+ SG   + + 
Sbjct  242   DMYDKALGFFYLMQRKLGLAPDEFTFGTVLTACGNLRRLKRGKEVHARVITSGFSGNVVV  301

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
              S LV  Y K G + E+  VFD ++  + V W++++ G+   GD++  + +F    R  E
Sbjct  302   ESSLVDMYGKCGLVMESQHVFDRMSIKNSVSWSALLGGYCQNGDFESVIRIF----REVE  357

Query  751   KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
               D +++  ++      + +R GK VH   ++ G   +  V S LV +Y++C C+  A R
Sbjct  358   SHDLYSFGTVLRACSGLAAIRQGKEVHGQYVRRGGWRDVIVESALVDLYAKCGCIDFAHR  417

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             IF  +   +++TW++MI G +Q+G   +AL  F EM  +G K D +    VL A +   +
Sbjct  418   IFSKMSVRNLITWNSMIYGFAQNGRGEEALRIFNEMLGEGIKPDYISYIGVLFACSHTGL  477

Query  1111  VQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISN  1290
             V  GR+                            F     + ++  P   I  YN M+  
Sbjct  478   VDQGRK----------------------------FFMSMTKEYEIKPG--IEHYNCMVDL  507

Query  1291  LGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCAC  1401
             LG  G   EA    E ++E      D + ++ LL AC
Sbjct  508   LGRAGLLEEA----ENLIENSDCREDSSLWAVLLGAC  540



>emb|CAN75707.1| hypothetical protein VITISV_031420 [Vitis vinifera]
Length=708

 Score =   320 bits (821),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 187/530 (35%), Positives = 284/530 (54%), Gaps = 8/530 (2%)
 Frame = +1

Query  220   LHAIILKTHLSHHPFYATRIIRFY-ALNEDIVSARRLFDETPQRSIFLWNSIIRAYARAH  396
             +HA ++K+ L    F    ++  Y  L  D    R++FD    + +  W S+I  Y R  
Sbjct  140   IHAHVIKSGLEFDRFVGNSLLTLYFKLGTDFPETRKVFDGLFVKDVISWTSMISGYVRVG  199

Query  397   RFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSS  576
             +  N+ +LF  ML  G  P+ FT + +++ACS+  D    R+ HG V+  G + + + +S
Sbjct  200   KPMNSLELFWKMLAYGVEPNAFTLSAVIKACSELGDLKLGRIFHGVVLGRGFDSNYVIAS  259

Query  577   QLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR-MGEK  753
              L+  + +   L++A ++FD + EPD + W S+IS       + +AL  F  MQR  G  
Sbjct  260   ALIDMHGRNCALDDARQLFDELLEPDAICWTSIISALTRNDFFDEALRFFYSMQRDHGMC  319

Query  754   PDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRI  933
             PD FT+  ++        L+ GK VH+  +  GF  N  V S LV MY +C  +G + RI
Sbjct  320   PDGFTFGTVLTACGNLGRLKQGKEVHAKVITTGFCGNVVVESSLVDMYGKCGSVGESQRI  379

Query  934   FDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAIV  1113
             FD +   + V+WSA++ G  Q+GD    +  FR+M     KVD     ++L   A LA V
Sbjct  380   FDRMPIKNSVSWSALLGGYCQNGDFKSVIQIFRKME----KVDLYCFGTILRTCAGLAAV  435

Query  1114  QPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSMISNL  1293
             + G+E H   +R G   +V V SAL+D+Y+KCG +     +F  MP +N+I++NSMI   
Sbjct  436   RQGKEVHCQYIRKGGWRDVIVESALVDLYAKCGCIEYAQTIFDQMPVRNLITWNSMIGGF  495

Query  1294  GLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEFGIQP  1473
               +G   EA +IF +++ KE   PD  +F  +L AC H GLV +GR YF  M  ++GI+ 
Sbjct  496   AQNGRGEEALRIFNQMV-KEGIKPDYISFIGILFACSHRGLVDEGREYFISMTKDYGIKV  554

Query  1474  KTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFGIWGALLSCCDIHGNYRLGGIVAKHL  1653
               EHY  MV LLG AG LEEA  LI++     D  +W ALL  C    NY +   +AK +
Sbjct  555   GIEHYSCMVDLLGRAGLLEEAEILIETSDFRDDSSLWAALLGACTTCTNYEIAERIAKRV  614

Query  1654  FDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIK-GKMPGKSWISN  1800
              + + +     V+++N+Y   GRW    ++R  M+     KMPGKSWI  
Sbjct  615   MELEPDYHLSYVLLANVYKAVGRWNDALRIRRLMKDRGVNKMPGKSWIET  664


 Score =   181 bits (458),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 179/357 (50%), Gaps = 7/357 (2%)
 Frame = +1

Query  367   SIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVS  546
             S I    ++   S A QL K +           +A +L+ C+    F+    +H  V+ S
Sbjct  88    SKILQLCKSGELSGALQLLKSIDPGEISAKPVLYASLLQTCTKVLAFNHGLQIHAHVIKS  147

Query  547   GLELDSICSSQLVSAYSKLGP-LEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLL  723
             GLE D    + L++ Y KLG    E  KVFDG+   D++ W SMISG+  +G    +L L
Sbjct  148   GLEFDRFVGNSLLTLYFKLGTDFPETRKVFDGLFVKDVISWTSMISGYVRVGKPMNSLEL  207

Query  724   FIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSR  903
             F KM   G +P++FT   +I        L++G+  H + L  GFDSN  + S L+ M+ R
Sbjct  208   FWKMLAYGVEPNAFTLSAVIKACSELGDLKLGRIFHGVVLGRGFDSNYVIASALIDMHGR  267

Query  904   CKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKV-DPLLIAS  1080
                +  A ++FD LLEPD + W+++I  L+++    +AL FF  M    G   D     +
Sbjct  268   NCALDDARQLFDELLEPDAICWTSIISALTRNDFFDEALRFFYSMQRDHGMCPDGFTFGT  327

Query  1081  VLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKN  1260
             VL+A   L  ++ G+E H   +  G+   V V S+L+DMY KCG +    ++F  MP KN
Sbjct  328   VLTACGNLGRLKQGKEVHAKVITTGFCGNVVVESSLVDMYGKCGSVGESQRIFDRMPIKN  387

Query  1261  IISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGR  1431
              +S+++++     +G+     QIF ++ + + Y      F  +L  C     V  G+
Sbjct  388   SVSWSALLGGYCQNGDFKSVIQIFRKMEKVDLY-----CFGTILRTCAGLAAVRQGK  439


 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 170/338 (50%), Gaps = 8/338 (2%)
 Frame = +1

Query  214   KLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRAYARA  393
             ++ H ++L      +   A+ +I  +  N  +  AR+LFDE  +     W SII A  R 
Sbjct  240   RIFHGVVLGRGFDSNYVIASALIDMHGRNCALDDARQLFDELLEPDAICWTSIISALTRN  299

Query  394   HRFSNAFQLFKDM-LDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSIC  570
               F  A + F  M  D G  PD FTF  +L AC +       + VH  V+ +G   + + 
Sbjct  300   DFFDEALRFFYSMQRDHGMCPDGFTFGTVLTACGNLGRLKQGKEVHAKVITTGFCGNVVV  359

Query  571   SSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGE  750
              S LV  Y K G + E+ ++FD +   + V W++++ G+   GD+K  + +F KM    E
Sbjct  360   ESSLVDMYGKCGSVGESQRIFDRMPIKNSVSWSALLGGYCQNGDFKSVIQIFRKM----E  415

Query  751   KPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACR  930
             K D + +  ++      + +R GK VH   ++ G   +  V S LV +Y++C C+  A  
Sbjct  416   KVDLYCFGTILRTCAGLAAVRQGKEVHCQYIRKGGWRDVIVESALVDLYAKCGCIEYAQT  475

Query  931   IFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQLAI  1110
             IFD +   +++TW++MI G +Q+G   +AL  F +M  +G K D +    +L A +   +
Sbjct  476   IFDQMPVRNLITWNSMIGGFAQNGRGEEALRIFNQMVKEGIKPDYISFIGILFACSHRGL  535

Query  1111  VQPGRETHGFAVRCGYHLEVSVS--SALIDMYSKCGFL  1218
             V  GRE +  ++   Y ++V +   S ++D+  + G L
Sbjct  536   VDEGRE-YFISMTKDYGIKVGIEHYSCMVDLLGRAGLL  572



>gb|KGN62280.1| hypothetical protein Csa_2G348180 [Cucumis sativus]
Length=795

 Score =   323 bits (827),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 196/550 (36%), Positives = 300/550 (55%), Gaps = 9/550 (2%)
 Frame = +1

Query  157   AFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDE  336
              F  + T  S S +T    +  HA+ +KT   +  F  + +I  Y     ++ AR++FD 
Sbjct  200   TFSGVFTAASSSPETFGGLQA-HALAIKTSNFYDVFVGSSLINMYCKIGCMLDARKVFDT  258

Query  337   TPQRSIFLWNSIIRAYARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGL  516
              P+R+   W +II  YA       A++LF  M       D F +  +L A +        
Sbjct  259   IPERNTVSWATIISGYAMERMAFEAWELFLLMRREEGAHDKFIYTSVLSALTVPDLVHYG  318

Query  517   RVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCL  696
             + +H   + +GL   +   + LV+ Y K G L++A K F+   + D + W++MI+G+   
Sbjct  319   KQIHCLALKNGLLSIASVGNALVTMYGKCGCLDDAFKTFELSGDKDDITWSAMITGYAQA  378

Query  697   GDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVG  876
             GD  +AL LF  M   G KP  FT+VG+I        L  GK +H   LK G++   +  
Sbjct  379   GDSHEALNLFYNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYECQIYFM  438

Query  877   SLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGK  1056
             + LV MY++C  +  A + FD L EPD+V W++MI G +Q+G+   AL  +  M M+   
Sbjct  439   TALVDMYAKCGSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCRMQMERIM  498

Query  1057  VDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQV  1236
                L +ASVL A + LA ++ G++ H   ++ G+ LEV + SAL  MY+KCG L  G  V
Sbjct  499   PHELTMASVLRACSSLAALEQGKQIHAQTIKYGFSLEVPIGSALSTMYAKCGSLEDGNLV  558

Query  1237  FKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGL  1416
             F+ MPS++I+++N+MIS L  +G   +A ++FEE L      PD  TF  +L AC H GL
Sbjct  559   FRRMPSRDIMTWNAMISGLSQNGEGLKALELFEE-LRHGTTKPDYVTFVNVLSACSHMGL  617

Query  1417  VCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGA  1590
             V  G+ YFR+M DEFGI P+ EHY  MV +L  AG+L E  E I+S    +D G  +W  
Sbjct  618   VERGKVYFRMMLDEFGIIPRVEHYACMVDILSRAGKLHETKEFIES--ATIDHGMCLWRI  675

Query  1591  LLSCCDIHGNYRLGGIVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG  1770
             LL  C  + NY LG    + L +   ++SS  +++S++Y   GR + V+++R  M+ ++G
Sbjct  676   LLGACRNYRNYELGAYAGEKLMELGSQESSAYILLSSIYTALGRSDDVERVRRLMK-LRG  734

Query  1771  --KMPGKSWI  1794
               K PG SWI
Sbjct  735   VNKEPGCSWI  744


 Score =   220 bits (560),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 247/510 (48%), Gaps = 10/510 (2%)
 Frame = +1

Query  136   LLHQMFIAFRSLLTQLSRSNQTISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVS  315
             LL     +F  LL + +R  + +   K +HA +L+T      +    ++  YA    IV 
Sbjct  90    LLPPQHRSFVDLLLRCTR-QKDLQKGKAIHAQLLRTGSFSSVYLTNSLVNLYAKCGSIVK  148

Query  316   ARRLFDETPQRSIFLWNSIIRAYARAHRFSNAF--QLFKDMLDSGTRPDNFTFACILRAC  489
             A+ +F+    + +  WN +I  Y++      +F  +LF+ M    T P+  TF+ +  A 
Sbjct  149   AKLVFESITNKDVVSWNCLINGYSQKGTVGYSFVMELFQRMRAENTLPNGHTFSGVFTAA  208

Query  490   SDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWN  669
             S   +  G    H   + +    D    S L++ Y K+G + +A KVFD I E + V W 
Sbjct  209   SSSPETFGGLQAHALAIKTSNFYDVFVGSSLINMYCKIGCMLDARKVFDTIPERNTVSWA  268

Query  670   SMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKF  849
             ++ISG+       +A  LF+ M+R     D F Y  ++  L  P L+  GK +H L LK 
Sbjct  269   TIISGYAMERMAFEAWELFLLMRREEGAHDKFIYTSVLSALTVPDLVHYGKQIHCLALKN  328

Query  850   GFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFF  1029
             G  S A VG+ LV+MY +C C+  A + F+   + D +TWSAMI G +Q+GD  +AL+ F
Sbjct  329   GLLSIASVGNALVTMYGKCGCLDDAFKTFELSGDKDDITWSAMITGYAQAGDSHEALNLF  388

Query  1030  REMNMKGGKVDPLLIASVLSAAAQLAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKC  1209
               M++ G K        V++A + +  ++ G++ HG++++ GY  ++   +AL+DMY+KC
Sbjct  389   YNMHLNGNKPSEFTFVGVINACSDIGALEEGKQIHGYSLKAGYECQIYFMTALVDMYAKC  448

Query  1210  GFLNLGIQVFKAMPSKNIISYNSMISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSAL  1389
             G L    + F  +   +I+ + SMIS    +G    A  ++   ++ E   P E T +++
Sbjct  449   GSLVDARKGFDYLKEPDIVLWTSMISGYAQNGENETALTLYCR-MQMERIMPHELTMASV  507

Query  1390  LCACCHTGLVCDGRRYFRIMNDEFGIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPV  1569
             L AC     +  G++       ++G   +      +  +    G LE+   L+       
Sbjct  508   LRACSSLAALEQGKQ-IHAQTIKYGFSLEVPIGSALSTMYAKCGSLEDG-NLVFRRMPSR  565

Query  1570  DFGIWGALLSCCDIHGNYRLGGIVAKHLFD  1659
             D   W A++S    +G     G+ A  LF+
Sbjct  566   DIMTWNAMISGLSQNGE----GLKALELFE  591



>gb|KCW68026.1| hypothetical protein EUGRSUZ_F01709 [Eucalyptus grandis]
Length=610

 Score =   318 bits (814),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 188/535 (35%), Positives = 294/535 (55%), Gaps = 8/535 (1%)
 Frame = +1

Query  202   ISTTKLLHAIILKTHLSHHPFYATRIIRFYALNEDIVSARRLFDETPQRSIFLWNSIIRA  381
             +S  +  HA+ +KT      F  + ++  Y     +  AR++FD   +R+   W +++  
Sbjct  32    VSGGRQAHALTIKTASFGDVFVGSSLLNMYCKAGLVADARKVFDRMHERNSVSWATMVSG  91

Query  382   YARAHRFSNAFQLFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELD  561
             YA     + A  LF  M + G   + F F  +L A +        + +H      GL   
Sbjct  92    YASLRMAAEAVGLFLLMREEGEDQNEFVFTSVLSALTAPESVDCGKQIHCLAAKMGLLSF  151

Query  562   SICSSQLVSAYSKLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQR  741
             +   + LV+ Y+K G LE+A++ F+     + + W++MI+G+   G+  +AL LF  M  
Sbjct  152   ASVWNALVTMYAKCGGLEDALQAFEFSTAKNSITWSAMITGYAQSGESHEALKLFSSMHF  211

Query  742   MGEKPDSFTYVGLIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGS  921
              G  P  FT VG+I        ++ G+  H  C+K GF+   ++ + LV MY++C C+  
Sbjct  212   SGVAPSEFTLVGVINACSDIGAVKEGRQAHCYCVKLGFEEQIYIMTALVDMYAKCGCIDD  271

Query  922   ACRIFDSLLEPDMVTWSAMICGLSQSGDIMKALDFFREMNMKGGKVDPLLIASVLSAAAQ  1101
             A + FD L EPD+V W++MI G  Q+G+   AL  +  M  +G   + L +ASVL A A 
Sbjct  272   ARKGFDYLQEPDVVLWTSMIGGYVQNGENESALYLYCRMQSEGIIANELTMASVLKACAS  331

Query  1102  LAIVQPGRETHGFAVRCGYHLEVSVSSALIDMYSKCGFLNLGIQVFKAMPSKNIISYNSM  1281
             LA ++ G++ H   ++ G  L+V + SAL  MY+KCG L  G  VF+ MPS++++S+N+M
Sbjct  332   LAALEQGKQMHAGIIKHGLGLKVPIGSALSSMYAKCGSLEDGNLVFRRMPSRDVLSWNAM  391

Query  1282  ISNLGLHGNANEAFQIFEEVLEKEYYNPDEATFSALLCACCHTGLVCDGRRYFRIMNDEF  1461
             IS L  +G  N A ++FEE +  E   PD  TF  +L AC H GLV  G  Y+++M++EF
Sbjct  392   ISGLAQNGFGNAALELFEE-MRMEGVKPDYVTFVNVLSACSHMGLVDRGWAYYKMMSEEF  450

Query  1462  GIQPKTEHYVYMVKLLGMAGELEEAYELIQSIQGPVDFG--IWGALLSCCDIHGNYRLGG  1635
             GI+P+ EHY  MV LL  AG+L EA + I+S    VD G  +W  LL  C  H NY LG 
Sbjct  451   GIEPRVEHYACMVDLLSRAGKLNEAKDFIES--ATVDHGLCLWRILLGACRNHRNYDLGV  508

Query  1636  IVAKHLFDNKVEKSSYGVMVSNMYAGDGRWECVKKLRVDMEAIKG--KMPGKSWI  1794
                + L +    +SS  V++S++Y   G+ + V+++R  M+A +G  K PG SWI
Sbjct  509   YAGEKLMELGSPESSAYVLLSSIYTALGKRDDVERVRRLMKA-QGVCKEPGCSWI  562


 Score =   174 bits (440),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 174/339 (51%), Gaps = 1/339 (0%)
 Frame = +1

Query  418   LFKDMLDSGTRPDNFTFACILRACSDKFDFSGLRVVHGGVVVSGLELDSICSSQLVSAYS  597
             L   M +    P+  TFA +  A S+  D SG R  H   + +    D    S L++ Y 
Sbjct  3     LLLRMREENVLPNAHTFAGVFTAASNAVDVSGGRQAHALTIKTASFGDVFVGSSLLNMYC  62

Query  598   KLGPLEEAIKVFDGIAEPDLVQWNSMISGHGCLGDWKKALLLFIKMQRMGEKPDSFTYVG  777
             K G + +A KVFD + E + V W +M+SG+  L    +A+ LF+ M+  GE  + F +  
Sbjct  63    KAGLVADARKVFDRMHERNSVSWATMVSGYASLRMAAEAVGLFLLMREEGEDQNEFVFTS  122

Query  778   LIMCLDCPSLLRIGKNVHSLCLKFGFDSNAHVGSLLVSMYSRCKCMGSACRIFDSLLEPD  95