BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25333_g2_i1 len=1836 path=[14001:0-1321 11702:1322-1348
11729:1349-1419 11800:1420-1835]

Length=1836
                                                                      Score     E

ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          512   2e-172   
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    508   8e-171   
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          500   8e-168   
ref|XP_010100678.1|  hypothetical protein L484_023447                   495   2e-165   
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               481   1e-160   
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          479   4e-160   
gb|ABK94979.1|  unknown                                                 476   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_002301432.1|  basic helix-loop-helix family protein              475   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             468   3e-155   
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    467   9e-155   
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          466   2e-154   Vitis vinifera
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    467   2e-154   
ref|XP_002529965.1|  DNA binding protein, putative                      463   1e-153   Ricinus communis
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          464   1e-153   
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             464   2e-153   
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   462   9e-153   
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          459   1e-152   
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2-like          459   5e-152   
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          459   6e-152   
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               459   8e-152   
gb|KDP28433.1|  hypothetical protein JCGZ_14204                         453   1e-149   
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    450   2e-148   
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               449   7e-148   
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               438   1e-144   
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          426   1e-139   
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     426   4e-139   
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    424   4e-139   
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    424   6e-139   
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          425   8e-139   
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        421   4e-137   
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          411   2e-133   
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          403   1e-130   
gb|KHN15898.1|  Transcription factor bHLH14                             404   1e-130   
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          400   2e-129   
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    399   2e-128   
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    397   5e-128   
ref|XP_002320222.1|  basic helix-loop-helix family protein              394   1e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               395   1e-126   
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             385   1e-123   
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    385   1e-123   
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    375   2e-119   
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          369   2e-117   
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          365   3e-116   
ref|XP_002518914.1|  DNA binding protein, putative                      366   8e-116   Ricinus communis
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        363   4e-115   
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         353   1e-110   
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    352   1e-110   
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          349   2e-109   
gb|ADK91082.1|  LMYC2                                                   347   7e-109   
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               344   2e-107   Vitis vinifera
emb|CDP08631.1|  unnamed protein product                                341   3e-107   
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             343   4e-107   Populus trichocarpa [western balsam poplar]
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          342   1e-106   
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like          340   1e-106   
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like          340   2e-106   
gb|AEG74015.1|  lMYC5                                                   339   1e-105   
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          336   2e-104   
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             332   3e-103   
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          330   3e-102   
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          328   7e-102   
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          328   2e-101   
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        326   3e-101   
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          325   1e-100   
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          324   5e-100   
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          323   3e-99    
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             322   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        322   3e-99    
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          320   3e-98    
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          319   1e-97    
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          315   3e-97    
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          315   4e-97    
gb|KDP22548.1|  hypothetical protein JCGZ_26379                         316   1e-96    
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          310   2e-95    
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          309   2e-95    
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          309   4e-95    
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          310   6e-95    
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          311   9e-95    
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          308   2e-94    
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          310   4e-94    
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          307   5e-94    
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          307   2e-93    
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        308   2e-93    
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          306   1e-92    
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             304   2e-92    
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          303   3e-92    
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    304   3e-92    
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    303   9e-92    
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             302   1e-91    
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        299   2e-91    
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          300   1e-90    
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          297   4e-90    
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             293   5e-89    
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             294   3e-88    
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          291   3e-88    
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like          290   4e-87    
emb|CDX77688.1|  BnaC07g19420D                                          290   7e-87    
emb|CDY58502.1|  BnaA06g40330D                                          289   9e-87    
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like          291   1e-86    
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    289   3e-86    
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    288   3e-86    
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          285   9e-86    
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          287   2e-85    
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             285   4e-85    
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...    286   6e-85    
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          281   1e-83    
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...    283   1e-83    
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like          283   2e-83    
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like          282   3e-83    
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          278   6e-82    
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        276   9e-82    
ref|XP_008385247.1|  PREDICTED: transcription factor MYC3-like          274   7e-81    
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          271   1e-80    
ref|XP_009354516.1|  PREDICTED: transcription factor MYC3-like          270   3e-79    
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          269   5e-79    
ref|XP_004301652.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    262   3e-77    
emb|CDX73261.1|  BnaC05g28450D                                          261   2e-76    
emb|CDY03185.1|  BnaC09g19710D                                          262   2e-76    
emb|CDY26910.1|  BnaA05g18020D                                          261   3e-76    
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    262   5e-76    
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg             257   5e-75    
ref|XP_002529968.1|  transcription factor, putative                     250   5e-74    Ricinus communis
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        256   6e-74    
ref|XP_008386326.1|  PREDICTED: transcription factor MYC3-like          256   9e-74    
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                     254   4e-73    
ref|XP_009617148.1|  PREDICTED: transcription factor MYC4-like          245   2e-71    
ref|XP_010481407.1|  PREDICTED: transcription factor bHLH28-like        248   6e-71    
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like        243   9e-70    
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...    243   1e-69    
ref|XP_002872924.1|  predicted protein                                  240   2e-68    
ref|XP_002865159.1|  predicted protein                                  241   3e-68    
ref|NP_567195.1|  transcription factor bHLH14                           239   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428091.1|  PREDICTED: transcription factor bHLH14-like        236   6e-67    
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             235   8e-67    
emb|CBI38690.3|  unnamed protein product                                226   3e-64    
ref|NP_199495.1|  calcium-binding transcription factor NIG1             226   2e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KCW72571.1|  hypothetical protein EUGRSUZ_E01039                     222   3e-61    
gb|KHN47226.1|  Transcription factor bHLH14-like protein                216   2e-60    
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...    209   6e-58    
ref|XP_010058363.1|  PREDICTED: transcription factor MYC2-like          209   4e-57    
ref|XP_002302637.2|  basic helix-loop-helix family protein              211   1e-56    Populus trichocarpa [western balsam poplar]
emb|CBI34590.3|  unnamed protein product                                202   7e-56    
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             206   7e-55    
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          205   8e-55    
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   205   8e-55    
gb|ACF05947.1|  MYC1                                                    204   1e-54    Hevea brasiliensis [jebe]
ref|XP_009101673.1|  PREDICTED: transcription factor bHLH28-like        200   4e-54    
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                202   1e-53    
gb|AGO03813.1|  JAMYC2                                                  192   4e-52    
gb|ACF19982.1|  MYC2                                                    197   5e-52    Hevea brasiliensis [jebe]
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620          195   1e-51    
ref|XP_004309579.1|  PREDICTED: transcription factor MYC2-like          194   2e-51    
gb|AEG74013.1|  lMYC3                                                   195   2e-51    
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                    193   2e-50    
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             190   8e-50    
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          192   2e-49    
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    190   2e-49    
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          192   3e-49    
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               191   3e-49    
gb|ADK56287.1|  LMYC1                                                   189   3e-49    
ref|XP_010100202.1|  hypothetical protein L484_015347                   189   4e-49    
gb|ABS11038.1|  MYC                                                     191   4e-49    Brassica oleracea var. gemmifera
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    187   1e-48    
ref|XP_010554450.1|  PREDICTED: transcription factor bHLH3              187   1e-48    
ref|XP_010440156.1|  PREDICTED: transcription factor bHLH3-like i...    186   2e-48    
ref|XP_010440158.1|  PREDICTED: transcription factor bHLH3-like i...    186   2e-48    
ref|XP_010679205.1|  PREDICTED: transcription factor bHLH3-like         187   2e-48    
ref|NP_174541.1|  transcription factor MYC2                             189   3e-48    Arabidopsis thaliana [mouse-ear cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           188   3e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893732.1|  ATMYC2                                             189   3e-48    
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          186   4e-48    
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             187   7e-48    
dbj|BAA25078.1|  RD22BP1                                                187   7e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          188   8e-48    
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    187   1e-47    
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          187   1e-47    
gb|ADH04267.1|  MYC1a transcription factor                              187   1e-47    
emb|CDX84081.1|  BnaC08g07580D                                          185   2e-47    
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          186   2e-47    
gb|ADH04268.1|  MYC1b transcription factor                              187   2e-47    
ref|XP_010523814.1|  PREDICTED: transcription factor ABA-INDUCIBL...    185   2e-47    
gb|ACU18071.1|  unknown                                                 177   2e-47    Glycine max [soybeans]
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             187   2e-47    
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   187   2e-47    
ref|XP_008372342.1|  PREDICTED: transcription factor bHLH3-like         184   2e-47    
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          186   3e-47    
gb|AFZ93650.1|  transcription factor MYC2                               177   3e-47    
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          186   3e-47    
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             186   4e-47    
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     185   4e-47    Phaseolus vulgaris [French bean]
gb|AGZ94899.1|  MYC transcription factor 2                              186   4e-47    
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               186   5e-47    
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             185   5e-47    
ref|XP_009354912.1|  PREDICTED: transcription factor bHLH3-like         183   6e-47    
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          186   6e-47    
gb|AIO09733.1|  transcription factor MYC2                               184   6e-47    
gb|EEC67493.1|  hypothetical protein OsI_34761                          185   9e-47    Oryza sativa Indica Group [Indian rice]
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            185   1e-46    Oryza sativa [red rice]
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               185   1e-46    
ref|NP_001065478.1|  Os10g0575000                                       185   1e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                184   1e-46    
ref|XP_006282965.1|  hypothetical protein CARUB_v10007725mg             181   1e-46    
ref|XP_009142636.1|  PREDICTED: transcription factor ABA-INDUCIBL...    181   1e-46    
gb|AEG74014.1|  lMYC4                                                   181   2e-46    
ref|XP_006414350.1|  hypothetical protein EUTSA_v10025122mg             181   2e-46    
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               184   2e-46    
gb|AAD15818.1|  transcription factor MYC7E                              184   2e-46    Zea mays [maize]
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          184   2e-46    Sorghum bicolor [broomcorn]
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          184   2e-46    
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like          174   2e-46    
gb|ADL36595.1|  BHLH domain class transcription factor                  184   2e-46    
ref|XP_010434826.1|  PREDICTED: transcription factor bHLH3              181   2e-46    
ref|NP_001288107.1|  uncharacterized protein LOC101261048               183   3e-46    
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             183   3e-46    
gb|AHN63211.1|  transcription factor MYC2                               182   3e-46    
gb|AGL98101.1|  transcription factor MYC2-like protein                  183   3e-46    
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like          180   3e-46    
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           182   4e-46    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             182   4e-46    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193376.1|  transcription factor bHLH3                            180   4e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367720.1|  PREDICTED: transcription factor bHLH3-like         180   5e-46    
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               182   5e-46    
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          182   5e-46    
gb|KHM99167.1|  Transcription factor MYC4                               172   6e-46    
emb|CDX80023.1|  BnaA05g01330D                                          179   7e-46    
ref|XP_004289915.1|  PREDICTED: transcription factor bHLH3-like         179   8e-46    
emb|CAF74711.1|  MYC transcription factor                               182   8e-46    Solanum tuberosum [potatoes]
ref|XP_011083013.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    179   9e-46    
gb|KHN18804.1|  Transcription factor MYC4                               174   9e-46    
ref|XP_008235723.1|  PREDICTED: transcription factor bHLH3              179   9e-46    
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          181   1e-45    
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          180   1e-45    
emb|CDY35179.1|  BnaA09g18160D                                          180   1e-45    
dbj|BAJ91674.1|  predicted protein                                      181   1e-45    
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                177   1e-45    
dbj|BAJ91022.1|  predicted protein                                      181   1e-45    
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    181   1e-45    
ref|XP_009367780.1|  PREDICTED: transcription factor bHLH3-like         178   1e-45    
gb|EPS57820.1|  hypothetical protein M569_16997                         180   2e-45    
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             180   2e-45    
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               181   2e-45    
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             180   3e-45    
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          180   3e-45    
emb|CDY03195.1|  BnaC09g19610D                                          179   3e-45    
emb|CDY56874.1|  BnaC04g52120D                                          177   3e-45    
gb|EYU46482.1|  hypothetical protein MIMGU_mgv1a005352mg                177   3e-45    
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             179   3e-45    
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    179   4e-45    Brassica oleracea
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             179   4e-45    
dbj|BAJ86015.1|  predicted protein                                      180   4e-45    
ref|XP_010679204.1|  PREDICTED: transcription factor bHLH3-like         177   5e-45    
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          179   5e-45    
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               179   5e-45    
emb|CAF74710.1|  MYC transcription factor                               179   5e-45    Solanum tuberosum [potatoes]
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          179   6e-45    
gb|AIT39751.1|  transcription factor MYC2                               179   6e-45    
emb|CDY27319.1|  BnaC04g50860D                                          176   7e-45    
ref|XP_003612909.1|  BHLH transcription factor                          179   7e-45    
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               178   7e-45    
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          178   8e-45    
ref|NP_193522.1|  transcription factor MYC4                             178   8e-45    Arabidopsis thaliana [mouse-ear cress]
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           178   9e-45    Arabidopsis thaliana [mouse-ear cress]
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     179   9e-45    Phaseolus vulgaris [French bean]
gb|AGQ80897.1|  MYC1                                                    179   9e-45    
ref|XP_009631111.1|  PREDICTED: transcription factor bHLH3              176   9e-45    
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          178   1e-44    
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like          174   2e-44    
ref|XP_010100069.1|  hypothetical protein L484_005743                   176   2e-44    
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    177   2e-44    
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               177   2e-44    
ref|XP_002870159.1|  basic helix-loop-helix family protein              175   2e-44    
gb|ACO53628.1|  bHLH domain protein                                     177   2e-44    Gossypium hirsutum [American cotton]
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          177   2e-44    
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          177   2e-44    
gb|ADH04263.1|  bHLH2 transcription factor                              177   3e-44    
gb|KDP34321.1|  hypothetical protein JCGZ_12669                         177   3e-44    
gb|KHM99168.1|  Transcription factor MYC2                               174   3e-44    
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             177   3e-44    
gb|KGN55667.1|  hypothetical protein Csa_3G002860                       174   3e-44    
ref|XP_002868032.1|  basic helix-loop-helix family protein              176   3e-44    
emb|CDY34468.1|  BnaC01g21650D                                          174   3e-44    
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               177   3e-44    
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          177   3e-44    
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like          174   4e-44    
gb|KDO68498.1|  hypothetical protein CISIN_1g010728mg                   175   4e-44    
ref|XP_006443887.1|  hypothetical protein CICLE_v10019816mg             175   4e-44    
dbj|BAJ33793.1|  unnamed protein product                                176   4e-44    
ref|XP_009146001.1|  PREDICTED: transcription factor bHLH3              174   4e-44    
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          177   4e-44    
ref|XP_002302066.1|  basic helix-loop-helix family protein              174   4e-44    
emb|CDY32242.1|  BnaA01g17420D                                          174   4e-44    
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             176   5e-44    
emb|CDY44507.1|  BnaC01g10420D                                          176   6e-44    
gb|AGE32978.1|  hypothetical protein                                    166   7e-44    
gb|AGL98100.1|  transcription factor MYC2                               176   7e-44    
gb|AGE32656.1|  hypothetical protein 751129                             166   7e-44    
gb|ADH04269.1|  MYC2a transcription factor                              176   7e-44    
emb|CBI17963.3|  unnamed protein product                                174   8e-44    
ref|XP_009803066.1|  PREDICTED: transcription factor bHLH3              173   8e-44    
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               176   9e-44    
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          176   1e-43    
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          175   1e-43    
ref|XP_004242355.1|  PREDICTED: transcription factor bHLH3              173   1e-43    
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               175   1e-43    
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     175   1e-43    
gb|EPS71023.1|  hypothetical protein M569_03732                         174   1e-43    
ref|XP_007144718.1|  hypothetical protein PHAVU_007G179100g             173   2e-43    
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               175   2e-43    
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    175   2e-43    
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    175   2e-43    
emb|CDX78808.1|  BnaA01g08750D                                          174   2e-43    
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like          175   2e-43    
emb|CDP13028.1|  unnamed protein product                                175   2e-43    
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          174   2e-43    
gb|KGN60384.1|  Transcription factor AtMYC2                             175   2e-43    
ref|NP_001287804.1|  transcription factor bHLH3-like                    172   2e-43    
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     175   2e-43    
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          174   3e-43    
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    174   3e-43    
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          174   3e-43    
gb|KHN38923.1|  Transcription factor MYC2                               171   4e-43    
gb|ABD59338.1|  G-box element binding protein                           174   4e-43    
ref|XP_010104300.1|  hypothetical protein L484_023250                   174   5e-43    
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              173   5e-43    
gb|ACM48567.1|  JAMYC                                                   173   5e-43    
gb|KHG22989.1|  Transcription factor bHLH3 -like protein                171   6e-43    
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          173   6e-43    
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          172   8e-43    
gb|KFK26541.1|  hypothetical protein AALP_AA8G262400                    170   1e-42    
ref|XP_006352746.1|  PREDICTED: transcription factor bHLH3-like i...    170   1e-42    
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          172   1e-42    
ref|XP_003628820.1|  Transcription factor MYC2                          172   1e-42    
ref|XP_002282584.2|  PREDICTED: transcription factor bHLH3              170   1e-42    
ref|XP_009142421.1|  PREDICTED: transcription factor ABA-INDUCIBL...    169   2e-42    
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          172   2e-42    
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          172   2e-42    
ref|XP_002306828.2|  basic helix-loop-helix family protein              169   3e-42    
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          171   3e-42    
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          171   3e-42    
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                171   3e-42    
emb|CDY66312.1|  BnaA04g29670D                                          168   3e-42    
ref|XP_008461882.1|  PREDICTED: transcription factor bHLH3              169   3e-42    
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          171   4e-42    
emb|CDX90525.1|  BnaA03g42560D                                          168   4e-42    
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          171   5e-42    
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    169   5e-42    
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          170   6e-42    
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             167   8e-42    
gb|ADH04262.1|  bHLH1 transcription factor                              170   8e-42    
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          169   9e-42    
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          169   1e-41    
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          169   1e-41    
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                169   2e-41    
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          169   2e-41    
gb|AAQ14332.1|AF283507_1  MYC2                                          169   2e-41    
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          169   2e-41    
ref|XP_003569643.1|  PREDICTED: transcription factor bHLH13             166   2e-41    
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          169   3e-41    
emb|CDP12229.1|  unnamed protein product                                165   3e-41    
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          169   3e-41    
ref|XP_009136765.1|  PREDICTED: transcription factor bHLH3-like         164   6e-41    
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          167   6e-41    
ref|XP_010058366.1|  PREDICTED: transcription factor MYC4-like          164   7e-41    
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          167   8e-41    
gb|ABR16623.1|  unknown                                                 166   1e-40    
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          166   1e-40    
ref|XP_010058370.1|  PREDICTED: transcription factor MYC2-like          163   2e-40    
gb|AEB35640.1|  MYC2                                                    154   2e-40    
gb|AEB35567.1|  MYC2                                                    154   2e-40    
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          166   2e-40    
gb|AEB35656.1|  MYC2                                                    154   2e-40    
gb|AEB35595.1|  MYC2                                                    154   2e-40    
gb|AEB35703.1|  MYC2                                                    154   2e-40    
gb|AEB35671.1|  MYC2                                                    154   3e-40    
gb|AEB35606.1|  MYC2                                                    154   3e-40    
gb|AEB35597.1|  MYC2                                                    154   3e-40    
gb|AEB35604.1|  MYC2                                                    154   3e-40    
gb|AEB35565.1|  MYC2                                                    154   3e-40    
gb|AEB35674.1|  MYC2                                                    154   3e-40    
gb|AEB35692.1|  MYC2                                                    154   3e-40    
gb|AEB35658.1|  MYC2                                                    154   3e-40    
gb|AEB35676.1|  MYC2                                                    154   3e-40    
gb|AEB35596.1|  MYC2                                                    154   4e-40    
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             163   5e-40    
gb|AEB35587.1|  MYC2                                                    153   5e-40    
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    163   6e-40    
gb|AEB35649.1|  MYC2                                                    153   6e-40    
ref|XP_004151980.1|  PREDICTED: transcription factor bHLH3-like         162   7e-40    
gb|AEB35694.1|  MYC2                                                    153   7e-40    
gb|AEB35660.1|  MYC2                                                    153   7e-40    
gb|AEB35592.1|  MYC2                                                    153   7e-40    
gb|AEB35568.1|  MYC2                                                    152   9e-40    
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    163   1e-39    
gb|AEB35601.1|  MYC2                                                    152   1e-39    
gb|KHN04880.1|  Transcription factor MYC2                               161   1e-39    
gb|AEB35580.1|  MYC2                                                    152   1e-39    
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg             160   1e-39    
ref|XP_006601141.1|  PREDICTED: transcription factor MYC2-like          156   2e-39    
gb|AEB35706.1|  MYC2                                                    152   2e-39    
gb|AEB35575.1|  MYC2                                                    152   2e-39    
gb|KCW72573.1|  hypothetical protein EUGRSUZ_E01042                     159   2e-39    
gb|AEB35570.1|  MYC2                                                    151   3e-39    
gb|AEB35657.1|  MYC2                                                    151   3e-39    
gb|AEB35571.1|  MYC2                                                    151   4e-39    
gb|AEB35678.1|  MYC2                                                    151   4e-39    
gb|AEB35577.1|  MYC2                                                    150   5e-39    
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like          159   5e-39    
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          161   5e-39    
ref|XP_010058361.1|  PREDICTED: transcription factor MYC2-like          159   6e-39    
ref|XP_010058362.1|  PREDICTED: transcription factor MYC2-like          159   6e-39    
gb|AEB35578.1|  MYC2                                                    150   6e-39    
gb|AGO03814.1|  JAMYC4                                                  156   7e-39    
gb|KFK30669.1|  hypothetical protein AALP_AA6G012400                    156   1e-38    
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          158   2e-38    
ref|XP_003612908.1|  Transcription factor MYC2                          150   4e-38    
ref|XP_004493757.1|  PREDICTED: transcription factor bHLH3-like         157   4e-38    
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        157   5e-38    
emb|CDY35183.1|  BnaA09g18200D                                          157   5e-38    
gb|KEH27718.1|  basic helix loop helix (BHLH) family transcriptio...    151   5e-38    
ref|XP_006279851.1|  hypothetical protein CARUB_v10028430mg             156   6e-38    
ref|XP_010058368.1|  PREDICTED: transcription factor MYC2-like          155   6e-38    
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          158   6e-38    
ref|XP_002456225.1|  hypothetical protein SORBIDRAFT_03g032420          155   9e-38    
gb|AEB35573.1|  MYC2                                                    147   9e-38    
gb|AEB35556.1|  MYC2                                                    152   9e-38    
gb|KGN61317.1|  hypothetical protein Csa_2G080170                       152   1e-37    
ref|XP_009101672.1|  PREDICTED: transcription factor bHLH28-like        150   1e-37    
gb|AAM19778.1|  At2g46510/F13A10.4                                      156   2e-37    
ref|NP_566078.1|  transcription factor ABA-INDUCIBLE bHLH-TYPE          156   2e-37    
emb|CDX77699.1|  BnaC07g19530D                                          150   2e-37    
gb|EPS60924.1|  hypothetical protein M569_13876                         155   2e-37    
ref|XP_010463090.1|  PREDICTED: transcription factor MYC2-like          154   3e-37    
ref|XP_002882073.1|  basic helix-loop-helix family protein              155   4e-37    
emb|CDY33482.1|  BnaA06g35910D                                          149   4e-37    
ref|XP_001754025.1|  predicted protein                                  154   5e-37    
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810          155   7e-37    
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like          153   1e-36    
ref|XP_010451453.1|  PREDICTED: transcription factor bHLH3-like         147   3e-36    
ref|XP_008441948.1|  PREDICTED: transcription factor MYC4-like          147   4e-36    
gb|EMS55891.1|  Transcription factor MYC4                               148   5e-36    
gb|EPS74560.1|  hypothetical protein M569_00194                         150   5e-36    
ref|XP_009776798.1|  PREDICTED: transcription factor MYC2-like          145   7e-36    
ref|XP_009139989.1|  PREDICTED: transcription factor MYC4-like          146   8e-36    
gb|AEB35563.1|  MYC2                                                    146   1e-35    
gb|KEH23875.1|  ABA-inducible bHLH-type transcription factor            149   1e-35    
ref|XP_001765254.1|  predicted protein                                  152   1e-35    
dbj|BAJ87213.1|  predicted protein                                      149   2e-35    
ref|XP_006361064.1|  PREDICTED: transcription factor MYC4-like          142   3e-35    
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like          147   5e-35    
ref|XP_004152861.1|  PREDICTED: transcription factor bHLH14-like        143   8e-35    
ref|XP_010038016.1|  PREDICTED: transcription factor bHLH3              146   2e-34    
emb|CDY59973.1|  BnaA09g53560D                                          146   2e-34    
gb|KCW49812.1|  hypothetical protein EUGRSUZ_K03293                     145   2e-34    
ref|XP_007200616.1|  hypothetical protein PRUPE_ppa008004mg             143   3e-34    
emb|CDY03183.1|  BnaC09g19730D                                          145   4e-34    
emb|CDM83759.1|  unnamed protein product                                144   6e-34    
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        144   8e-34    
ref|XP_008358724.1|  PREDICTED: transcription factor MYC3-like          144   1e-33    
gb|AEB35693.1|  MYC2                                                    135   1e-33    
ref|XP_006361007.1|  PREDICTED: transcription factor bHLH14-like        134   2e-33    
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             144   2e-33    
gb|AAF04917.1|AF011557_1  jasmonic acid 3                               139   3e-33    
ref|XP_011080018.1|  PREDICTED: transcription factor bHLH3-like         141   7e-33    
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        142   1e-32    
gb|AEB35702.1|  MYC2                                                    132   2e-32    
gb|AEB35681.1|  MYC2                                                    132   2e-32    
ref|XP_006852614.1|  hypothetical protein AMTR_s00021p00226670          140   2e-32    
gb|AEB35699.1|  MYC2                                                    132   2e-32    
gb|KCW72577.1|  hypothetical protein EUGRSUZ_E01046                     137   2e-32    
emb|CDY09695.1|  BnaC07g33660D                                          140   2e-32    
gb|AEB35566.1|  MYC2                                                    131   3e-32    
gb|ABR16436.1|  unknown                                                 140   5e-32    
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        140   6e-32    
gb|AEB35704.1|  MYC2                                                    130   7e-32    
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g             140   8e-32    
gb|KHN16427.1|  Transcription factor bHLH13                             138   1e-31    
gb|EMS62462.1|  Transcription factor MYC2                               133   1e-31    
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like        138   2e-31    
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          136   2e-31    
gb|AEJ88337.1|  putative MYC protein                                    137   3e-31    
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          135   4e-31    
ref|XP_006662628.1|  PREDICTED: transcription factor MYC2-like          136   4e-31    
gb|AFB33094.1|  hypothetical protein 0_9408_01                          128   6e-31    
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          134   7e-31    
gb|AFB33098.1|  hypothetical protein 0_9408_01                          128   7e-31    
ref|XP_010508006.1|  PREDICTED: transcription factor ABA-INDUCIBL...    135   1e-30    
ref|XP_010506659.1|  PREDICTED: transcription factor ABA-INDUCIBL...    135   1e-30    
gb|AEW07707.1|  hypothetical protein 0_9408_01                          127   2e-30    
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13             135   3e-30    
emb|CDX77694.1|  BnaC07g19480D                                          129   3e-30    
gb|AFB33089.1|  hypothetical protein 0_9408_01                          126   3e-30    
gb|AEW07706.1|  hypothetical protein 0_9408_01                          126   3e-30    
ref|XP_010518324.1|  PREDICTED: transcription factor ABA-INDUCIBL...    134   3e-30    
dbj|BAJ85584.1|  predicted protein                                      135   3e-30    
ref|XP_008670327.1|  PREDICTED: transcription factor MYC2-like          130   5e-30    
ref|XP_006397843.1|  hypothetical protein EUTSA_v10001374mg             134   5e-30    
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like        135   6e-30    
ref|XP_002987548.1|  hypothetical protein SELMODRAFT_158887             126   7e-30    
ref|XP_002892077.1|  basic helix-loop-helix family protein              134   7e-30    
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        134   9e-30    
gb|EEE51454.1|  hypothetical protein OsJ_32566                          134   2e-29    



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score =   512 bits (1318),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 334/469 (71%), Gaps = 48/469 (10%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             STLQQ LQ+ILK QTDSW+YAIFWQTSN+DDGRLFLAWGDG F GTK  +G      V  
Sbjct  29    STLQQMLQYILKNQTDSWSYAIFWQTSNEDDGRLFLAWGDGHFHGTKVKKGE-----VNG  83

Query  1439  SHSTQQSERKKVISGIQALIGSTQNS--ENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  1266
              +     ERK VI GIQALI    +   E GD +TD EWFYVMSLA+SFS GDG+PGKAF
Sbjct  84    VNKASSLERKNVIKGIQALICENGDGVVEGGD-VTDIEWFYVMSLAQSFSIGDGIPGKAF  142

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
             S GS+VWL+GA +LQ  +CERAKEAQ+HGI+TLVCIPT  GV+ELGS ++IKENWSLVQ 
Sbjct  143   STGSIVWLTGAQQLQFCSCERAKEAQVHGIETLVCIPTSNGVLELGSSDLIKENWSLVQH  202

Query  1085  VKSLFQFPE----ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea  918
             VKSLF   +    E+TISFADIGLVS   L + G+  G +     +    G+    A   
Sbjct  203   VKSLFSLDQENGLEKTISFADIGLVSC--LQEDGQILGNNKNNTSKKPKTGEIFSAAGTT  260

Query  917   saaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQ  738
                       + +S+HSDSDCQ L + PIV+++   PKKRGRKPGA R TP NHVEAERQ
Sbjct  261   L---------FQDSDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPSNHVEAERQ  309

Query  737   RREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR--ESKKVK  564
             RREKLNHRFYALRSVVP+V++MDKASLLSDAV YINELK KV++LE QL  +    KK+K
Sbjct  310   RREKLNHRFYALRSVVPHVTKMDKASLLSDAVEYINELKAKVDDLELQLNNKSESKKKLK  369

Query  563   VEAVG----DNQstssaassv-----------------aSPVDVEVKIVGPDAMIRVQSE  447
             VE++     DNQST++  ++                     V+VEVKI+GPDAMIRVQSE
Sbjct  370   VESMDSTTLDNQSTTTTTTTSVDQIRPNSNSTSSFGPNNLTVEVEVKILGPDAMIRVQSE  429

Query  446   NANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             N NYPSA+LM  L++LEL VHHASISSVND+MLQDIVVKVP+ L +E+G
Sbjct  430   NVNYPSARLMRALQDLELHVHHASISSVNDLMLQDIVVKVPQCLGTENG  478



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   508 bits (1307),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 289/507 (57%), Positives = 349/507 (69%), Gaps = 65/507 (13%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             M+ELI++ SSSSS+ +   +   STLQQRLQF++++Q D WAYAIFWQTSND+ GRLFL 
Sbjct  1     MEELIISPSSSSSLVSFSQETPPSTLQQRLQFVIQSQQDWWAYAIFWQTSNDEHGRLFLT  60

Query  1508  WGDGFFQGTKAGR---GGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE----NGD  1350
             WGDG FQGTK      G  +  +   ++     ER+KV+ GIQALIG   + +    +G 
Sbjct  61    WGDGHFQGTKDTSPKLGANISNIPGLNN-----ERRKVMKGIQALIGDNHDIDMSMIDGT  115

Query  1349  LITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQT  1170
              ITDAEWFYVMSL RSFSAGDG+PGKA S GSLVWL+GAH LQ YNCERA+EAQ+H I+T
Sbjct  116   DITDAEWFYVMSLTRSFSAGDGIPGKALSTGSLVWLTGAHELQFYNCERAREAQMHAIET  175

Query  1169  LVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF-----------------------QFPE  1059
             LVCIPT  GV+ELGS E+I+ENW LVQQVKS+F                       QF  
Sbjct  176   LVCIPTSCGVLELGSSEMIRENWGLVQQVKSVFGSDLIGLVPKQSNPNPNLTPGPIQFL-  234

Query  1058  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  879
             +R ISFADIG+++G     Q   A  D+    ++          Q    +    ++SY +
Sbjct  235   DRNISFADIGIIAG----VQEEDASPDNRTKQENH-------NNQTKKDSTKPGQSSYVD  283

Query  878   SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  699
             SEHSDSDC  L    I  R    PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR
Sbjct  284   SEHSDSDCPLLAMNNIEKR---TPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALR  340

Query  698   SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  525
             +VVPNVSRMDKASLLSDAVSYINELK K+EELE QLQ RE KKVKVE V   DNQST+++
Sbjct  341   AVVPNVSRMDKASLLSDAVSYINELKAKIEELESQLQ-RECKKVKVEMVDAMDNQSTTTS  399

Query  524   assvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                 A P            ++ ++KI+G DAMIRVQSEN NYPSA+LM  LR+LE  VHH
Sbjct  400   VDQAARPSNSSSGTAGSGGLEFDIKIMGNDAMIRVQSENVNYPSARLMIALRDLEFQVHH  459

Query  380   ASISSVNDIMLQDIVVKVPEGLRSEDG  300
             AS+S VN++MLQDIVV+VP+GLR+E+G
Sbjct  460   ASMSCVNELMLQDIVVRVPDGLRTEEG  486



>ref|XP_009776117.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=496

 Score =   500 bits (1287),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 332/468 (71%), Gaps = 39/468 (8%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             STLQQ LQ +LK QTDSW+YAIFWQTSNDDDGRLFLAWGDG F GTK  +G      V  
Sbjct  29    STLQQMLQHVLKNQTDSWSYAIFWQTSNDDDGRLFLAWGDGHFHGTKVKKGE-----VNG  83

Query  1439  SHSTQQSERKKVISGIQALIGSTQNS--ENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  1266
             ++     ERK VI GIQALI    +   E+G  +TD EWFYVMSLA+SFS GDG+PGKAF
Sbjct  84    ANKASSLERKNVIKGIQALICENGDGVVEDGGDVTDIEWFYVMSLAQSFSIGDGIPGKAF  143

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
               GS VWL+GA +LQ  +CERAKEAQ+HGI+TLVCIPT  GV+ELGS ++IKENWSLVQQ
Sbjct  144   CTGSFVWLNGAQQLQFCSCERAKEAQVHGIETLVCIPTSNGVLELGSSDLIKENWSLVQQ  203

Query  1085  VKSLFQFPE----ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea  918
             VKSLF   +    E+T+SFA+IGLVS   L + G+    ++    ++  +   + +    
Sbjct  204   VKSLFSLDQENGLEKTVSFANIGLVSC--LQENGQILAINNNNHNKNNTSKKPKTEEIST  261

Query  917   saaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQ  738
             +A AA     + +S+HSDSDCQ L + PIV+++   PKKRGRKPGA R TP+NHVEAERQ
Sbjct  262   TATAATTL--FQDSDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPLNHVEAERQ  317

Query  737   RREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL-----------  591
             RREKLNHRFYALRSVVP+V++MDKASLLSDAV YINELK KV+ELE QL           
Sbjct  318   RREKLNHRFYALRSVVPHVTKMDKASLLSDAVEYINELKTKVDELELQLNKKSESKKKLK  377

Query  590   -----------QLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSEN  444
                        Q   +    V+ +  N ++SS+       V+VEVKI+GPDAMIRVQSEN
Sbjct  378   VESMDSTTLDNQTTTTTTTSVDQIRPNSNSSSSYGPNNLTVEVEVKILGPDAMIRVQSEN  437

Query  443   ANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              NYPSA+LM  L++LEL VHHASISSVND+MLQDIVVKVP+ L +E+G
Sbjct  438   VNYPSARLMRALQDLELHVHHASISSVNDLMLQDIVVKVPKCLGTENG  485



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score =   495 bits (1274),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 277/503 (55%), Positives = 335/503 (67%), Gaps = 78/503 (16%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI+K+Q D WAYAIFWQTSNDD+GRLFLAWGDG FQG K       P+   +S
Sbjct  26    TLQQRLQFIVKSQPDWWAYAIFWQTSNDDNGRLFLAWGDGHFQGVKDTIS---PINSNSS  82

Query  1436  HSTQQ---------SERKKVISGIQALIGSTQNSE-------NGDLITDAEWFYVMSLAR  1305
             ++            +ER+K++ GIQ+LI      +       NGD +TDAEWFYVMSL R
Sbjct  83    NNNNHYSAVSAGIHAERRKMLKGIQSLINDNNLPDIDNIMAINGD-VTDAEWFYVMSLTR  141

Query  1304  SFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
             SF AGDGVPGKAFS GSLVWL+G H LQ YNCERAKEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  142   SFLAGDGVPGKAFSTGSLVWLTGVHELQFYNCERAKEAQMHGIETLVCIPTSTGVLELGS  201

Query  1124  LEIIKENWSLVQQVKSLF--------------QFPEERTISFADIGLVSGHELLQQGRSA  987
              EII+ENW LVQQVKSLF              QF     ISFADIG+++G   +Q+    
Sbjct  202   SEIIRENWCLVQQVKSLFGSDLYTNQNDTGPIQFL-NGNISFADIGIIAG---VQEEDKY  257

Query  986   GADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLK-----EPPIVDR  822
               D++K        +                ++Y +SEHSDSDC  +         I   
Sbjct  258   SPDEIK------KKETLDLMMMKKRKKKEGNSAYVDSEHSDSDCPLITVNNNNNNNISTG  311

Query  821   QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
             ++ APKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAV
Sbjct  312   EKRAPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAV  371

Query  641   SYINELKGKVEELECQLQLRES-KKVKVEAVG----DNQstssaassvaSP---------  504
             SYINELK K+++LE QLQ  +S KKVK+EA      DNQST+++      P         
Sbjct  372   SYINELKAKIDDLESQLQRDQSNKKVKLEAADTMSLDNQSTTTSVDQTKPPNSNSSSNKS  431

Query  503   ------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVN  360
                         +++EVKI+G DAMIRVQSEN NYPSA+LM  LR+LE  VHHAS+SS+N
Sbjct  432   NNINSVTGNINGLEIEVKIIGTDAMIRVQSENVNYPSARLMGALRDLEFQVHHASVSSIN  491

Query  359   DIMLQDIVVKVPEG---LRSEDG  300
             D+MLQD+VVK+PEG   +R+++G
Sbjct  492   DLMLQDVVVKIPEGIVLMRTQEG  514



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 279/465 (60%), Positives = 324/465 (70%), Gaps = 60/465 (13%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQ+RLQ+IL+ Q D WAYAI WQTS DD+GR+ L+W DG FQGTK           +  
Sbjct  27    TLQKRLQYILQHQPDWWAYAILWQTSKDDNGRISLSWADGHFQGTKE----------KNP  76

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSAGDGVP  1278
              S  Q ERKKV+ GIQALIG     EN D+       +TDAEWFYVMSLA+SFS GDGV 
Sbjct  77    KSGSQPERKKVMRGIQALIG-----ENPDITGPVDGDVTDAEWFYVMSLAQSFSLGDGVV  131

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             GKAF+ GSL+WLSG ++L+ YNC+RAKEAQIHG+QT+VCIPT  GV+ELGS  +I ENWS
Sbjct  132   GKAFNSGSLIWLSGGNQLRFYNCQRAKEAQIHGMQTMVCIPTLNGVLELGSDVMITENWS  191

Query  1097  LVQQVKSLFQ---------------FPEERTISFADIGLVSGHELLQQGRSAGADDLKVL  963
             LVQQVKSLF+               FPE +TISFAD  L      L       A    VL
Sbjct  192   LVQQVKSLFESSSDPINNGSTHALKFPE-KTISFADTCL------LPNLPDEAAKTTPVL  244

Query  962   QSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG  783
               +       Q Q  S A  A   SY +SEHSDSDCQF   P  V+ ++  PKKRGRKP 
Sbjct  245   GKK-------QEQPNSKAQKAQIFSYLDSEHSDSDCQFFL-PETVETKR-TPKKRGRKPN  295

Query  782   AGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL  603
              GR  P+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI ELK KVEEL
Sbjct  296   LGRDAPLNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIKELKSKVEEL  355

Query  602   ECQLQLRESKKVKVEAVG---DNQstssaassv---aSPVDVEVKIVGPDAMIRVQSENA  441
             E QLQ RESKKVK E      DNQST+++   V    S ++VEVKIVG D MIRVQS+N 
Sbjct  356   ETQLQ-RESKKVKTETTAETLDNQSTTTSVDQVGPITSLLEVEVKIVGVDGMIRVQSDNG  414

Query  440   NYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             NYP+A+LM+ +RELEL VHHAS+S VND+MLQD+V++VP+GLR E
Sbjct  415   NYPAARLMDAIRELELQVHHASMSCVNDLMLQDVVIRVPDGLRCE  459



>ref|XP_006362125.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=457

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 281/490 (57%), Positives = 331/490 (68%), Gaps = 74/490 (15%)
 Frame = -2

Query  1688  MDELIVTssssssitaslS-QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLF  1515
             MDELIV+SSS    +         S LQQ+LQ ILK QTDSW+YAIFWQTSNDDD G LF
Sbjct  1     MDELIVSSSSFFIPSLLSQGTQTSSNLQQKLQNILKIQTDSWSYAIFWQTSNDDDDGHLF  60

Query  1514  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALI---GSTQNSENGDLI  1344
             LAWGDG F GTK+  G      VQ S   Q +ERK VI GIQALI   G  +  + G+ +
Sbjct  61    LAWGDGHFHGTKSKTG------VQASQ--QSTERKNVIKGIQALICENGEEKVDDAGE-V  111

Query  1343  TDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLV  1164
             TDAEWFYVMSLA+SFS GDGVPGKAFS GS++WL+GA +LQ +NCERAKEA +HGIQT V
Sbjct  112   TDAEWFYVMSLAQSFSIGDGVPGKAFSTGSIIWLTGAQQLQFHNCERAKEAHVHGIQTFV  171

Query  1163  CIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAG  984
             CIPT  GV+ELGS + IKENW L+QQVKS+F        S  D+GLV+    L+Q  +  
Sbjct  172   CIPTSNGVLELGSNQQIKENWILIQQVKSIFS-------SIPDLGLVT---CLEQNTTIN  221

Query  983   ADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPK  804
              +                       +   K    E+E SDSDCQ L E P+   ++  PK
Sbjct  222   NN-----------------------SKNPKTEETETETSDSDCQVLVEKPV---EKKTPK  255

Query  803   KRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINEL  624
             KRGRKPGA R TP+NHVEAERQRREKLNHRFYALRSVVP+V++MDKASLLSDAVSYINEL
Sbjct  256   KRGRKPGATRETPLNHVEAERQRREKLNHRFYALRSVVPHVTKMDKASLLSDAVSYINEL  315

Query  623   KGKVEELECQLQLRESKKVKVEAVG----DNQstssaassvaS-----------------  507
             K KV ELE QL  R+SKK+K+E       DN ST++  ++ +                  
Sbjct  316   KSKVTELEGQL-TRKSKKLKIECTDSITIDNHSTATTTTTNSVDQIRHNSSSAASFGVQN  374

Query  506   --PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVV  333
                V+VEVKI+GPDAM+RVQSEN NYPSA+LM  L++LEL VHHASISSVNDIMLQDIVV
Sbjct  375   NLKVEVEVKILGPDAMVRVQSENVNYPSARLMRALQDLELHVHHASISSVNDIMLQDIVV  434

Query  332   KVPEGLRSED  303
             KVP  L +ED
Sbjct  435   KVPIELSTED  444



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score =   476 bits (1225),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 263/478 (55%), Positives = 322/478 (67%), Gaps = 59/478 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K       P     S
Sbjct  24    TLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSKDT--SPKPNTFSNS  81

Query  1436  HST-QQSERKKVI-SGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPG  1275
               T   SERK+V+  GIQ+LIG   + +    +G+  TD+EWFYVMSL RSFS GDG+ G
Sbjct  82    RMTISNSERKRVMMKGIQSLIGECHDLDMSLMDGNDATDSEWFYVMSLTRSFSPGDGILG  141

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             KA++ GSL+WL+G H LQ YNCER KEAQ+HGI+TLVCIPT  GV+ELGS  +I+ENW L
Sbjct  142   KAYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLVCIPTSCGVLELGSSSVIRENWGL  201

Query  1094  VQQVKSLF---------------------QFPEERTISFADIGLVSGHELLQQGRSAGAD  978
             VQQ KSLF                     QF  +R+ISFAD+G+++G   LQ+  +   +
Sbjct  202   VQQAKSLFGSDLSAYLVPKGPNNSSEEPTQFL-DRSISFADMGIIAG---LQEDCAVDRE  257

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKR  798
                  ++  A                   SY  SEHSDSD   L     +  ++  PKKR
Sbjct  258   QKNARETEEANKRNANKPGL---------SYLNSEHSDSDFPLLA----MHMEKRIPKKR  304

Query  797   GRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKG  618
             GRKPG GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINELK 
Sbjct  305   GRKPGLGRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKA  364

Query  617   KVEELECQLQLRESKKVKVEAVG--DNQstssaassva----------SPVDVEVKIVGP  474
             KV+ELE QL+ RESKKVK+E     DNQST+++    A            ++VE+K VG 
Sbjct  365   KVDELESQLE-RESKKVKLEVADNLDNQSTTTSVDQSACRPNSAGGAGLALEVEIKFVGN  423

Query  473   DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             DAMIRVQSEN NYP+++LM  LRELE  VHHAS+S VN++MLQD+VV+VP+GLR+E+ 
Sbjct  424   DAMIRVQSENVNYPASRLMCALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEA  481



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 272/502 (54%), Positives = 335/502 (67%), Gaps = 60/502 (12%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             M+ELI++ SS SS  +   Q    TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL 
Sbjct  1     MEELIISPSSPSSPVSLS-QETPPTLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLG  59

Query  1508  WGDGFFQGTKAGRGGGVPVVVQTSHST-QQSERKKVI-SGIQALIGSTQNSE----NGDL  1347
             WGDG FQG+K       P     S  T   SERK+V+  GIQ+LIG   + +    +G+ 
Sbjct  60    WGDGHFQGSKDT--SPKPNTFSNSRMTISNSERKRVMMKGIQSLIGECHDLDMSLMDGND  117

Query  1346  ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTL  1167
              TD+EWFYVMSL RSFS GDG+ GKA++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL
Sbjct  118   ATDSEWFYVMSLTRSFSPGDGILGKAYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETL  177

Query  1166  VCIPTGAGVVELGSLEIIKENWSLVQQVKSLF---------------------QFPEERT  1050
             VCIPT  GV+ELGS  +I+ENW LVQQ KSLF                     QF  +R+
Sbjct  178   VCIPTSCGVLELGSSSVIRENWGLVQQAKSLFGSDLSAYLVPKGPNNSSEEPTQFL-DRS  236

Query  1049  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEH  870
             ISFAD+G+++G   LQ+  +   +     ++  A                   SY  SEH
Sbjct  237   ISFADMGIIAG---LQEDCAVDREQKNARETEEANKRNANKPGL---------SYLNSEH  284

Query  869   SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  690
             SDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYALR+VV
Sbjct  285   SDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRFYALRAVV  340

Query  689   PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaass  516
             PNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RESKKVK+E     DNQST+++   
Sbjct  341   PNVSRMDKASLLSDAVSYINELKAKVDELESQLE-RESKKVKLEVADNLDNQSTTTSVDQ  399

Query  515   va----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  366
              A            ++VE+K VG DAMIRVQSEN NYP+++LM  LRELE  VHHAS+S 
Sbjct  400   SACRPNSAGGAGLALEVEIKFVGNDAMIRVQSENVNYPASRLMCALRELEFQVHHASMSC  459

Query  365   VNDIMLQDIVVKVPEGLRSEDG  300
             VN++MLQD+VV+VP+GLR+E+ 
Sbjct  460   VNELMLQDVVVRVPDGLRTEEA  481



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   468 bits (1203),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 270/493 (55%), Positives = 330/493 (67%), Gaps = 78/493 (16%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK--AGRGG  1464
             Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K  + +  
Sbjct  19    QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSKDPSAKHH  78

Query  1463  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----------TDAEWFYVMS  1314
               P  +        SER+K++ GIQ+LI       + D I          +D EWFYVMS
Sbjct  79    NNPYGIL-------SERRKILKGIQSLINDNNPDHHQDSIMDHMGLDADVSDGEWFYVMS  131

Query  1313  LARSFSAGD-----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             LARSFS G+      VPGKAFS GS+VWL+G+H LQ YNC+RAKEAQ+HG QTLVCIPT 
Sbjct  132   LARSFSIGETTISASVPGKAFSSGSVVWLTGSHELQFYNCDRAKEAQMHGFQTLVCIPTP  191

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLF-----------QFPEERT--------ISFADIGL  1026
              GV+E+GS + I+ENWSLVQQ KSLF             PE R+         SFADIG+
Sbjct  192   TGVLEMGSSDSIRENWSLVQQAKSLFGSDLICSVADQPDPETRSPIDFINRNFSFADIGI  251

Query  1025  VSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFL  846
             ++G E  +  +   A DL +++ R  G+        S       N+ P+ ++SDSD    
Sbjct  252   IAGVEEEEDDKKEVALDLTMMK-RKGGNPGTGLYPDS-------NANPKPDYSDSDGP--  301

Query  845   KEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDK  666
                      +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDK
Sbjct  302   ---------KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDK  352

Query  665   ASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---QstssaassvaSP---  504
             ASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST+++   +A P   
Sbjct  353   ASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQSTTTSVEQIAKPPSS  410

Query  503   ------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  342
                   ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HHAS+S +N++MLQD
Sbjct  411   SANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHHASLSCINELMLQD  470

Query  341   IVVKVPEGLRSED  303
             IV+KVPE +RSED
Sbjct  471   IVLKVPENMRSED  483



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score =   467 bits (1201),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 322/476 (68%), Gaps = 56/476 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24    TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  1436  HSTQQSERKKVISGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGKA  1269
              ST  SERK+V+ GI +L+    + +    +G   TD EWFYVMSL RSFS GDG+ GKA
Sbjct  83    MSTSNSERKRVMKGIHSLLDECHDLDMSLMDGTDSTDIEWFYVMSLTRSFSPGDGILGKA  142

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
             ++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS  +I+ENW +VQ
Sbjct  143   YTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGSSCVIRENWGIVQ  202

Query  1088  QVKSLF---------------------QFPEERTISFADIGLVSGHELLQQGRSAGADDL  972
             QV+SLF                     QF  +R IS A+  +++G   LQ+  +      
Sbjct  203   QVRSLFVSDLNPCLVPKGPNNPCQEPIQFL-DRNISLAEGAIIAG---LQEDDNTIEHGE  258

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR  792
             K  Q RA        +           SY +SEHSDSD  F+     V+ ++  PKKRGR
Sbjct  259   KRTQERA--------ETKKDNVNKLGQSYVDSEHSDSDFHFVA----VNIEKRIPKKRGR  306

Query  791   KPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             KPG GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINE+K KV
Sbjct  307   KPGLGRGAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKV  366

Query  611   EELECQLQLRESKKVKVEAVG--DNQstssaassva-----------SPVDVEVKIVGPD  471
             ++LE QLQ RESKKVK+E     DNQST+++    A             ++VEVK VG D
Sbjct  367   DKLESQLQ-RESKKVKMEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGND  425

Query  470   AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             AMIRVQS+N NYP+++LM+ LR+LE  VHHAS+SSVN++MLQD+VV+VP+GLR+E+
Sbjct  426   AMIRVQSDNVNYPASRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEE  481



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 266/481 (55%), Positives = 320/481 (67%), Gaps = 70/481 (15%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG K    G VP   Q  
Sbjct  34    SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQGGK----GMVPR--QLG  87

Query  1436  HSTQQSE-----RKKVISGIQALIGSTQNSE-----NGDLITDAEWFYVMSLARSFSAGD  1287
                 QS      RKK I GIQALI  T+N +     +GD +TD EWFYVMSL R FSAGD
Sbjct  88    LRGDQSRAGLFTRKKAIKGIQALI--TENPDMDGLMDGD-VTDVEWFYVMSLTRCFSAGD  144

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             GVPGKA S GSLVWL+GA  L  YNCERAKEAQIHGI T VCIPTG GV+ELGS ++I+E
Sbjct  145   GVPGKALSSGSLVWLTGAQELMFYNCERAKEAQIHGIDTFVCIPTGNGVLELGSSDVIRE  204

Query  1106  NWSLVQQVKSLF-----------QFPEERTI--SFADIGLVSGHELLQQGRSAGADDLKV  966
             NW LVQQ KSLF             P    I  SFADIG++SG   +Q+      D   +
Sbjct  205   NWGLVQQAKSLFGSDHFIGLVSKHSPPSAPIHFSFADIGIISG---IQEEEGTRQDKKPM  261

Query  965   LQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
               ++  G                ++   ESEHSDSDC  +     V  ++  PKKRGRKP
Sbjct  262   GNAKKEG-----------IVNGCQSLCLESEHSDSDCPLVA----VTVEKRVPKKRGRKP  306

Query  785   GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE  606
               GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYINELK KV+E
Sbjct  307   RLGRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYINELKAKVDE  366

Query  605   LECQLQLRESKKVKVEAVG--DNQstssaassvaS-----------------PVDVEVKI  483
             LE Q+  +ESKKVK+E     DNQST+++                        ++VE+KI
Sbjct  367   LESQVH-KESKKVKLEMADTTDNQSTTTSVDQTGPTPPPPPPPPSSATGGGVALEVEIKI  425

Query  482   VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             VGPDAMIRVQS+N N+PSA+LM  LR+LE  VHHAS+SS+ND+MLQD+VV++P+  R+ED
Sbjct  426   VGPDAMIRVQSDNHNHPSARLMGALRDLEFQVHHASMSSINDLMLQDVVVRLPDRFRNED  485

Query  302   G  300
              
Sbjct  486   A  486



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 322/476 (68%), Gaps = 56/476 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24    TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  1436  HSTQQSERKKVISGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGKA  1269
              ST  SERK+V+ GI +L+    + +    +G   TD EWFYVMSL RSFS GDG+ GKA
Sbjct  83    MSTSNSERKRVMKGIHSLLDECHDLDMSLMDGTDSTDIEWFYVMSLTRSFSPGDGILGKA  142

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
             ++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS  +I+ENW +VQ
Sbjct  143   YTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGSSCVIRENWGIVQ  202

Query  1088  QVKSLF---------------------QFPEERTISFADIGLVSGHELLQQGRSAGADDL  972
             QV+SLF                     QF  +R IS A+  +++G   LQ+  +      
Sbjct  203   QVRSLFVSDLNPCLVPKGPNNPCQEPIQFL-DRNISLAEGAIIAG---LQEDDNTIEHGE  258

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR  792
             K  Q RA        +           SY +SEHSDSD  F+     V+ ++  PKKRGR
Sbjct  259   KRTQERA--------ETKKDNVNKLGQSYVDSEHSDSDFHFVA----VNIEKRIPKKRGR  306

Query  791   KPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             KPG GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINE+K KV
Sbjct  307   KPGLGRGAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKV  366

Query  611   EELECQLQLRESKKVKVEAVG--DNQstssaassva-----------SPVDVEVKIVGPD  471
             ++LE QLQ RESKKVK+E     DNQST+++    A             ++VEVK VG D
Sbjct  367   DKLESQLQ-RESKKVKMEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGND  425

Query  470   AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             AMIRVQS+N NYP+++LM+ LR+LE  VHHAS+SSVN++MLQD+VV+VP+GLR+E+
Sbjct  426   AMIRVQSDNVNYPASRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEE  481



>ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF32408.1| DNA binding protein, putative [Ricinus communis]
Length=486

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 269/497 (54%), Positives = 331/497 (67%), Gaps = 58/497 (12%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             MDELI++ SSSSS+ +   Q    TLQQRLQFIL++Q D WAYAIFWQT N D+GR+FLA
Sbjct  1     MDELIISPSSSSSLVSFS-QGTPPTLQQRLQFILQSQPDWWAYAIFWQTLNADNGRIFLA  59

Query  1508  WGDGFFQGTKAGRGGGVPVVVQ--TSH--STQQSERKKVISGIQALIGSTQNS-----EN  1356
             WGDG FQGT+        +  +   SH  S+  SERK+ + GIQALIGS  +       +
Sbjct  60    WGDGHFQGTRDTSPNQATINNKHIQSHRISSLNSERKRGMKGIQALIGSDNHDIDVSIMD  119

Query  1355  GDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGI  1176
             G   TDAEWFYVMSL RSFSAGDGVPGKA S GSLVWL+G   LQ YNCERAKEAQ+HGI
Sbjct  120   GSNATDAEWFYVMSLTRSFSAGDGVPGKALSTGSLVWLTGRQDLQFYNCERAKEAQMHGI  179

Query  1175  QTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF---QFPE---------ERTISFADI  1032
             +TLVCIPT  GV+ELGS ++I+ENW +VQQ KSLF     P          +  ISFADI
Sbjct  180   ETLVCIPTCDGVLELGSSDLIRENWGVVQQAKSLFGSDMMPNNPSPPIHLLDMNISFADI  239

Query  1031  GLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQ  852
             G+++G   +Q+G +    + K  ++ A  +                 S            
Sbjct  240   GIIAG---VQEGDTTTHANQKPQENDAKKE-----------------SNNAESEHSDSDS  279

Query  851   FLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRM  672
              L     +D++   PKKRGRKP  GR TP+NHVEAER RREKLNHRFYALR+VVPNVSRM
Sbjct  280   SLLAAASLDKK--TPKKRGRKPALGRDTPLNHVEAERLRREKLNHRFYALRAVVPNVSRM  337

Query  671   DKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaS---  507
             DKASLLSDAV YINELK K+EELE QL  + SK+VK+E     DNQST+++    AS   
Sbjct  338   DKASLLSDAVCYINELKAKIEELESQLHRKSSKRVKLEVADNTDNQSTTTSEDQAASKPI  397

Query  506   ---------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  354
                      P ++EVKI+  DAMIRVQSEN NYP+A+LM  LR+LE  VHH S+S+VN++
Sbjct  398   STVCTTTGFPPEIEVKILANDAMIRVQSENVNYPAARLMTALRDLEFQVHHVSMSTVNEL  457

Query  353   MLQDIVVKVPEGLRSED  303
             MLQD+VV+VP+GLR+E+
Sbjct  458   MLQDVVVRVPDGLRTEE  474



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score =   464 bits (1193),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 319/476 (67%), Gaps = 55/476 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQF+++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K      +     + 
Sbjct  24    TLQQRLQFMVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSK-DTSPKLNTFSNSR  82

Query  1436  HSTQQSERKKVI-SGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
              +   SERK+V+  GIQ+L+G   + +    +G+  TD+EWFYVMSL RSFS GDG+ GK
Sbjct  83    VTISNSERKRVMMKGIQSLVGECHDLDMSLMDGNDATDSEWFYVMSLTRSFSPGDGILGK  142

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A++ GSL+WL+G H LQ YNCER KEAQ+HGI+TLVCIPT  GV+ELGS  +I+ENW LV
Sbjct  143   AYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLVCIPTSCGVLELGSSSVIRENWGLV  202

Query  1091  QQVKSLFQ-------FPE-------------ERTISFADIGLVSGHELLQQGRSAGADDL  972
             QQ KSLF         P+             +R+ISFAD+G+++G   LQ+  +   +  
Sbjct  203   QQAKSLFGSDLSAYLVPKGPNNSSEEPTPFLDRSISFADMGIIAG---LQEDCAVDREQK  259

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR  792
                ++  A                    Y  SE SDSD   L     +  ++  PKKRGR
Sbjct  260   NAHETEEANKRNANKPGL---------PYLNSEPSDSDFPLLA----MHMEKRIPKKRGR  306

Query  791   KPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             KPG GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINELK KV
Sbjct  307   KPGLGRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKV  366

Query  611   EELECQLQLRESKKVKVEAVG--DNQstssaassva----------SPVDVEVKIVGPDA  468
             +ELE QL+ RE KKVK+E     DNQST+++    A            ++VEVK VG DA
Sbjct  367   DELESQLE-REFKKVKLEVADNLDNQSTTTSVDQSACRPNSAGGAGHALEVEVKFVGNDA  425

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             MIRVQSEN NYP+++LM  LRELE  VHHAS+S VN++MLQD+VV+VP+GLR+E+ 
Sbjct  426   MIRVQSENVNYPASRLMCALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEA  481



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 263/488 (54%), Positives = 328/488 (67%), Gaps = 57/488 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTKAGRGGG---VPVV  1449
             TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK         +P  
Sbjct  25    TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSE------NGDLITDAEWFYVMSLARSFSAGD  1287
                +      ERK+ IS I+ +  S    E      +G  +TD EWFYVMSL RSF AG 
Sbjct  85    APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG+A S GSLVWL+G+H LQ YNCERAKEAQ HGI+T VCIPT  GV+ELGS ++I+E
Sbjct  145   GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGSSDLIRE  204

Query  1106  NWSLVQQVKSLF--------------------QFPEERTISFADIGLVSGHELLQQGRSA  987
             NW LV QVKSLF                     F  +R ISFADIG+++G   +QQ    
Sbjct  205   NWGLVHQVKSLFGSDLITKPLNPNPTPAAPPMHF-LDRNISFADIGIIAG---VQQEEEE  260

Query  986   GADDLKVLQSRAAGDaekqaqea-----saaaaaaKNSYP-ESEHSDSDCQFLKEPPIVD  825
               ++ + L      D  K  +       +  ++  ++SY  +SEHSDSDC     PP V+
Sbjct  261   EEEEEEELSRPEEEDQNKVKKPRKDQGCTVKSSTGQSSYTVDSEHSDSDCPL---PPPVN  317

Query  824   R----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASL  657
                  ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASL
Sbjct  318   NISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASL  377

Query  656   LSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP---------  504
             LSDAVSYI ELK K+++LE QL  RESKKVK+E + DN ST+++                
Sbjct  378   LSDAVSYIRELKVKIDDLESQLLQRESKKVKLE-ISDNHSTTTSVDQARPSSAGSGGGFN  436

Query  503   VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             ++VE KI+G DAMIRVQSEN N+P+AKLM+ LR+L+L +HHAS+S VND+MLQDIVV+VP
Sbjct  437   LEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHHASMSCVNDLMLQDIVVRVP  496

Query  323   EGLRSEDG  300
             +GLR+ED 
Sbjct  497   DGLRTEDA  504



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   462 bits (1189),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 265/492 (54%), Positives = 328/492 (67%), Gaps = 65/492 (13%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTKAGRGGG---VPVV  1449
             TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK         +P  
Sbjct  25    TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSE------NGDLITDAEWFYVMSLARSFSAGD  1287
                +      ERK+ IS I+ +  S    E      +G  +TD EWFYVMSL RSF AG 
Sbjct  85    APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG+A S GSLVWL+G+H LQ YNCERAKEAQ HGI+T VCIPT  GV+ELGS ++I+E
Sbjct  145   GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGSSDLIRE  204

Query  1106  NWSLVQQVKSLF--------------------QFPEERTISFADIGLVSG---------H  1014
             NW LV QVKSLF                     F  +R ISFADIG+++G          
Sbjct  205   NWGLVHQVKSLFGSDLITKPLNPNPTPAAPPMHF-LDRNISFADIGIIAGVQQEQEEEEE  263

Query  1013  ELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP-ESEHSDSDCQFLKEP  837
             E  +  R    D  KV + R       + Q  +  ++  ++SY  +SEHSDSDC     P
Sbjct  264   EEEELSRPEEEDQNKVKKPR-------KDQGCTVKSSTGQSSYTVDSEHSDSDCPL---P  313

Query  836   PIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMD  669
             P V+     ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMD
Sbjct  314   PPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMD  373

Query  668   KASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-----  504
             KASLLSDAVSYI ELK K+++LE QL  RESKKVK+E + DN ST+++            
Sbjct  374   KASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKLE-ISDNHSTTTSVDQARPSSAGSG  432

Query  503   ----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIV  336
                 ++VE KI+G DAMIRVQSEN N+P+AKLM+ LR+L+L +HHAS+S VND+MLQDIV
Sbjct  433   GGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLDLQLHHASMSCVNDLMLQDIV  492

Query  335   VKVPEGLRSEDG  300
             V+VP+GLR+ED 
Sbjct  493   VRVPDGLRTEDA  504



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 259/466 (56%), Positives = 306/466 (66%), Gaps = 80/466 (17%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             S LQQ+LQ ILK QTDSW+YAIFWQT+NDDD G LFLAWGDG F GTK+  G      VQ
Sbjct  26    SNLQQKLQNILKIQTDSWSYAIFWQTTNDDDDGHLFLAWGDGHFHGTKSKTG------VQ  79

Query  1442  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITD---------AEWFYVMSLARSFSAG  1290
             +S   Q +ERK VI GIQALI      ENGD   D         AEWFYVMSLA+SFS G
Sbjct  80    SSE--QSTERKNVIKGIQALI-----CENGDEKVDDDDDDEVTDAEWFYVMSLAQSFSIG  132

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
             DGVPGKAFS  S++WL+G+  LQ + C+RAKEA +HGIQT VCIPT  GV+E+GS ++IK
Sbjct  133   DGVPGKAFSTASIIWLTGSQNLQFHTCKRAKEAHLHGIQTFVCIPTSNGVIEMGSNQLIK  192

Query  1109  ENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekq  930
             ENW L+QQVKS+F       ++            L+Q  +      +++    +      
Sbjct  193   ENWVLIQQVKSIFNNSIPHIVN-----------CLEQNTNINPKTEELVSVSVSA-----  236

Query  929   aqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVE  750
                             E   SDSDCQ L E       +  PKKRGRKPGA R TP+NHVE
Sbjct  237   ----------------ECNDSDSDCQLLVE-------KKTPKKRGRKPGATRETPLNHVE  273

Query  749   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK  570
             AERQRREKLNHRFYALRSVVP+V++MDKASLLSDAVSYINELK KV ELE QL  R+SKK
Sbjct  274   AERQRREKLNHRFYALRSVVPHVTKMDKASLLSDAVSYINELKSKVAELETQLT-RKSKK  332

Query  569   VKVEAVG----DNQstssaass-------------vaSPVDVEVKIVGPDAMIRVQSENA  441
             +K+E       DN ST++  ++                 V+VEVKI+GPDAM+RVQSEN 
Sbjct  333   LKIECTDSFSIDNNSTATTITNSVDQIRHNSFGVHSNLKVEVEVKILGPDAMVRVQSENV  392

Query  440   NYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             NYPS +LM  L++LEL VHHASISSVNDIMLQDIVVKVP GL +ED
Sbjct  393   NYPSTRLMRALQDLELHVHHASISSVNDIMLQDIVVKVPIGLSTED  438



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   459 bits (1182),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 270/514 (53%), Positives = 339/514 (66%), Gaps = 87/514 (17%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFL  1512
             MD+LI++ +SSSS+ +   +P  +TLQQRLQFIL++Q + W+YAIFW  SND ++GRL L
Sbjct  1     MDDLIISPTSSSSLVSLPHEP--ATLQQRLQFILQSQPELWSYAIFWLASNDVENGRLLL  58

Query  1511  AWGDGFFQGTK----------AGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNS  1362
              WGDG FQG +          +  G G         S   S+R+K++ GIQ+++  T N+
Sbjct  59    GWGDGHFQGPEDPSPDLNNRLSSSGDG---------SLLHSDRRKILKGIQSILNDTNNN  109

Query  1361  E-----------NGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSMGSLVWLSGAHRLQM  1218
                         NGD ++DAEWFYVMSL RSF+ GDG VPGKAF  GS VWLSGAH LQ 
Sbjct  110   NPELDMDNFMALNGD-VSDAEWFYVMSLTRSFAIGDGSVPGKAFGSGSFVWLSGAHELQF  168

Query  1217  YNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQF----PE---  1059
              +CERAKEAQIHGI+TL+CIPT  GV+E+GS  +++ENW L+QQ KSLF      PE   
Sbjct  169   NSCERAKEAQIHGIETLICIPTSNGVLEMGSSGLVRENWGLIQQAKSLFGSDQPDPETRP  228

Query  1058  ----ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKN  891
                  R  SFADIG+V+G  + ++  S+  DD K +                      +N
Sbjct  229   LEFINRNFSFADIGIVAG--VQEEDNSSYNDDKKHV----------LGYNKKKNNNGLQN  276

Query  890   SYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
               P ++ +DSD Q           +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRF
Sbjct  277   PTP-ADFADSDFQL----------KRTPKKRGRKPGMGRDTPLNHVEAERQRREKLNHRF  325

Query  710   YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  537
             YALR+VVPNVSRMDKASLLSDAVSYINELK KV+ELE QLQ RESKKVKVE     DNQS
Sbjct  326   YALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLQ-RESKKVKVEMADNLDNQS  384

Query  536   tssaassvaSP---------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
             T++ AS   +                +++EVKIVG DAMIRVQSEN NYPSA+LM  +R+
Sbjct  385   TTTTASVEQTQTVTPDNNNNNNNGSGLEIEVKIVGTDAMIRVQSENVNYPSARLMTAMRD  444

Query  401   LELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             LE  +HHAS+SS+ND+MLQDIVVKVP+ +++E+G
Sbjct  445   LEFQIHHASLSSINDLMLQDIVVKVPDNMKNEEG  478



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   459 bits (1182),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 267/489 (55%), Positives = 323/489 (66%), Gaps = 70/489 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  1461
             Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQG K      
Sbjct  19    QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDRQVDNGCLFLTWGDGHFQGPK----DA  74

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG--DLI----------TDAEWFYVM  1317
              P     +     SER+K++ GIQ+LI  T N +N   DLI          TD EWFYV 
Sbjct  75    SPNNHHHNPYGVLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNADVTDVEWFYVT  134

Query  1316  SLARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             SLARSFS G+     VPGKAFS GSLVWL+G+H LQ YNCERAKEAQ+HGIQTLVCIPT 
Sbjct  135   SLARSFSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTP  194

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQF------PE----------ERTISFADIGLVSG  1017
              GV+ELGS ++I+EN +LVQQ +SLF        P+           R  SFADIG+++G
Sbjct  195   TGVLELGSSDLIRENGNLVQQTESLFGADVVWGQPDPGTRSPIDLINRNFSFADIGIIAG  254

Query  1016  HELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEP  837
              E  +  +   A D+  ++ +         +        +  +    EHSDS  +F K  
Sbjct  255   VEE-EDDKKEVALDITAMKKKCG-------RACPGLLQLSNLNSLNPEHSDS--EFPKR-  303

Query  836   PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASL  657
                      PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASL
Sbjct  304   --------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASL  355

Query  656   LSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaSP-------  504
             LSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST+++      P       
Sbjct  356   LSDAVSYINELKSKVDELESQVQ-RESKKVKVETGDNLDNQSTTTSVEQTRPPNSSASGS  414

Query  503   --VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVK  330
               +++EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS+S +N++MLQD+VVK
Sbjct  415   TGLEMEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVVVK  474

Query  329   VPEGLRSED  303
             VP+ +RSE+
Sbjct  475   VPDNMRSEE  483



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   459 bits (1181),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 320/491 (65%), Gaps = 74/491 (15%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  1461
             Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+GRLFL WGDG FQG K      
Sbjct  19    QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHQVDNGRLFLTWGDGHFQGPKDAS---  75

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG--DLI----------TDAEWFYVM  1317
              P     +     SER+K++ GIQ+LI  T N +N   DLI          T+ EWFYV 
Sbjct  76    -PNNHHHNPYGGLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNAXVTNVEWFYVT  134

Query  1316  SLARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             SLARSFS G+     VPGKAFS GSLVWL+G+H LQ YNCERAKEAQ+HGIQTLVCIPT 
Sbjct  135   SLARSFSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTP  194

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQF------PE----------ERTISFADIGLVSG  1017
              GV+ELGS ++I+EN +LVQQ +SLF        P+           R  SFADIG+++G
Sbjct  195   TGVLELGSSDLIRENXNLVQQTESLFGSDVVWGQPDPGTRSPIDJINRNFSFADIGIIAG  254

Query  1016  HELLQQGRSAGADDLK--VLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLK  843
                       G +D K  V     A   +           +  NS    EHSDS  +F K
Sbjct  255   ---------VGEEDDKKEVALDITAMKKKCGXACPDLVQLSNLNSL-NPEHSDS--EFPK  302

Query  842   EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKA  663
                        PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKA
Sbjct  303   R---------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKA  353

Query  662   SLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaSP-----  504
             SLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST+++      P     
Sbjct  354   SLLSDAVSYINELKXKVDELESQVQ-RESKKVKVETGDNLDNQSTTTSVEQTRPPNSSAS  412

Query  503   ----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIV  336
                  + EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS+S +N++MLQD+V
Sbjct  413   GSTGFETEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVV  472

Query  335   VKVPEGLRSED  303
             VKVP+ +RSE+
Sbjct  473   VKVPBNMRSEE  483



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 311/453 (69%), Gaps = 46/453 (10%)
 Frame = -2

Query  1577  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVIS  1398
             +D W+YAIFWQTSNDD+GR+FLAWGDG FQ ++      +  +     +    ERK  + 
Sbjct  38    SDRWSYAIFWQTSNDDNGRIFLAWGDGHFQSSRQT-PPKLTTINNRIPAINSGERKIAMK  96

Query  1397  GIQALIGSTQNSENGDLI-TDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQ  1221
             GI AL G+  + +   +  T+AEWFYVMSL RSFSAG+G+PGK  S GSLVWL+GA  L+
Sbjct  97    GIHALFGNNNDIDCSMMDDTNAEWFYVMSLTRSFSAGEGIPGKVLSTGSLVWLTGAQELR  156

Query  1220  MYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQ------FPE  1059
              YNCERAKEAQ+HG++TLVCIPT  GV+ELGS ++I+ENW LVQ+ KSLF        P+
Sbjct  157   YYNCERAKEAQMHGLETLVCIPTYNGVLELGSCDVIRENWGLVQEAKSLFGSDLVDLMPK  216

Query  1058  ------------ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
                         +  ISFADIGL++G +          D    L+ +A    ++   EA 
Sbjct  217   NPNTNSASIQLLDMNISFADIGLIAGAQ----------DQEASLEQKA----QQTNYEAK  262

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQR  735
                      Y +SEHSDSDC  +   P V+++   PKKRGRKP  GR TP+NHVEAERQR
Sbjct  263   KDIDKPGQCYIDSEHSDSDCPLVA--PTVEKR--TPKKRGRKPSLGRETPLNHVEAERQR  318

Query  734   REKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA  555
             REKLNHRFYALR+VVPNVSRMDKASLLSDAV YINELK K++EL+ QLQ  +SK+VK+E 
Sbjct  319   REKLNHRFYALRAVVPNVSRMDKASLLSDAVCYINELKAKIDELDSQLQRDQSKRVKLEV  378

Query  554   VG--DNQstssaassva-SPV-----DVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  399
                 DNQST ++      SP+     D+EVKI+G DAMIRVQSEN NYP+AKL+  LR+L
Sbjct  379   TDNTDNQSTITSVDQARPSPISGFTLDIEVKILGDDAMIRVQSENVNYPAAKLLTALRDL  438

Query  398   ELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             E  VHHAS+S+VN++MLQD+VV+VP+G R+E+G
Sbjct  439   EFQVHHASMSTVNELMLQDVVVRVPDGFRTEEG  471



>ref|XP_009623534.1| PREDICTED: transcription factor MYC2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=487

 Score =   450 bits (1158),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 305/455 (67%), Gaps = 68/455 (15%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K   GG       +S 
Sbjct  71    LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAK---GGAAVNNKGSSS  127

Query  1433  STQQSERKKVISGIQALI-GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSM  1260
                QSERKKVI GIQALI G   N  +   +TD EWFYVMSLARSFS  +G VPGKAFS 
Sbjct  128   DAAQSERKKVIRGIQALIDGDNNNLMDDGNVTDIEWFYVMSLARSFSVDNGSVPGKAFSS  187

Query  1259  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVK  1080
             G+ VW +GA + Q+Y+CERAKEAQIHGIQTL+CIPT  GV+ELGS  +IKEN+ LVQQVK
Sbjct  188   GNFVWFTGAAQFQVYSCERAKEAQIHGIQTLLCIPTSNGVLELGSAHLIKENFDLVQQVK  247

Query  1079  SLF-QFPE----ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
             SLF   P     E++I FADIGLV+G   LQQ      D L                   
Sbjct  248   SLFLSCPPIHFLEKSICFADIGLVTG---LQQDNE---DKL-------------------  282

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEA  747
                        E +  DSD            ++   KKRGRKP  G     +  +NHVEA
Sbjct  283   -----------EKQQLDSD------------KKAVAKKRGRKPKGGDNNINMAALNHVEA  319

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL---QLRES  576
             ERQRREKLNHRFYALRS VPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL       +
Sbjct  320   ERQRREKLNHRFYALRSAVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHSSSSN  379

Query  575   KKVKVEAVGDNQstssaassvaSP---VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             KK K    G+NQST+++      P   ++VEVKIVGPDAMIRVQSEN NYPSAKLM+ LR
Sbjct  380   KKQKSNESGENQSTNTSVDQELRPNSSLEVEVKIVGPDAMIRVQSENVNYPSAKLMSALR  439

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              L+L VHHASISSVN++ML D+VVKVP+GLR+EDG
Sbjct  440   HLQLQVHHASISSVNNLMLHDVVVKVPQGLRTEDG  474



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   449 bits (1155),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 259/481 (54%), Positives = 321/481 (67%), Gaps = 72/481 (15%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG+         + + + 
Sbjct  32    TLQQRLQLMVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGSTK-------LTLAS-  83

Query  1436  HSTQQSERKKVISGIQALIGSTQNSE------------NGDLITDAEWFYVMSLARSFSA  1293
                 +S+R++++   QAL     NS              GD +TDAEWFYVMSL RSFSA
Sbjct  84    ----RSDRRRLL---QALPRDPSNSRPDAAADVPLPAPAGD-VTDAEWFYVMSLTRSFSA  135

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             GDG+PGKA S GSLVWL+GA  L+ Y C+RAKEA++HGI+T+VCIPTG GV+ELGS ++I
Sbjct  136   GDGIPGKALSTGSLVWLTGARELESYKCDRAKEAELHGIRTMVCIPTGDGVLELGSCDVI  195

Query  1112  KENWSLVQQVKSL-----------------FQFPEERT-ISFADIGLVSGHELLQQGRSA  987
              ENW LVQ+ KSL                 FQ   + + ISFADIG+++G   +Q+   A
Sbjct  196   PENWGLVQRAKSLFGSDLLLPKHPPPPPPPFQLHHDHSDISFADIGIIAG---VQENDFA  252

Query  986   GADD----LKVLQSRAAGDaekqaqeasaaaaaaKNSY-PESEHSDSDCQFLKEPPIVDR  822
               DD    +K  Q    G            A    +SY  ESEHSDSD  F+     V  
Sbjct  253   PHDDHEKKVKKKQPLVEG------AGGKPEAPFGCSSYLVESEHSDSDSPFMA---AVMT  303

Query  821   QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
             ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAV
Sbjct  304   EKRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAV  363

Query  641   SYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaassvaSP-------VDVEVK  486
             SYINELK K+ +LE QLQ RESK+VK E     +  +++ +   +SP       ++VEVK
Sbjct  364   SYINELKSKIGDLESQLQ-RESKRVKQEVTDATDNLSTTTSVDHSSPSGCGGSLLEVEVK  422

Query  485   IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             IVG DAMIRVQSENANYPSA+LM  +R+LEL +HHAS+S+VND+MLQD+VV VPEGL+ E
Sbjct  423   IVGCDAMIRVQSENANYPSARLMAAMRDLELHIHHASLSTVNDLMLQDVVVSVPEGLKGE  482

Query  305   D  303
             +
Sbjct  483   E  483



>ref|XP_009766909.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
 ref|XP_009766910.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
Length=444

 Score =   438 bits (1127),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 258/455 (57%), Positives = 307/455 (67%), Gaps = 67/455 (15%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQ  LQ+++K+Q D WAYAIFWQ+S+DD+G+ FLAWGDG+FQG K G          +S 
Sbjct  27    LQHMLQYVIKSQPDWWAYAIFWQSSSDDEGKAFLAWGDGYFQGAKGGAAANNNGSNSSSS  86

Query  1433  STQQSERKKVISGIQALIGSTQN-SENGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSM  1260
                QSERKKVI GIQALI    N  ++GD +TD EWFYVMSLARSF+  +G VPGKAFS 
Sbjct  87    EAAQSERKKVIRGIQALIDGDNNLIDDGD-VTDIEWFYVMSLARSFTVDNGSVPGKAFSG  145

Query  1259  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVK  1080
             G+ VW++GA + Q+ +CERAKEAQIHGIQTL+CIPT  GV+ELGS  +IKEN+ LVQQVK
Sbjct  146   GNFVWITGAAQFQLSSCERAKEAQIHGIQTLLCIPTSNGVLELGSSHLIKENFDLVQQVK  205

Query  1079  SLF------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea  918
             SLF      QF  E++I FADIGLV+G E          D  + L               
Sbjct  206   SLFLSCPPIQFL-EKSICFADIGLVTGLE---------QDSEEKL---------------  240

Query  917   saaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVE  750
                         E++  DSD            ++   KKRGRKP  G     +  +NHVE
Sbjct  241   ------------ENQQLDSD------------KKAVAKKRGRKPKGGDSNINMVALNHVE  276

Query  749   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--QLRES  576
             AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL      +
Sbjct  277   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINQLKTKVDELESQLIDHSNSN  336

Query  575   KKVKVEAVGDNQstssaassvaSP---VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             KK K    G+NQST+++      P    +VEVKIVGPDAMIRVQSEN N+PSAKLM+ LR
Sbjct  337   KKQKSNESGENQSTNTSVDQELRPNSSSEVEVKIVGPDAMIRVQSENVNHPSAKLMSALR  396

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              L+L VHHASISSVN++ML D+VVKVP GLRSEDG
Sbjct  397   HLQLQVHHASISSVNNLMLHDVVVKVPLGLRSEDG  431



>ref|XP_006357552.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=452

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 307/459 (67%), Gaps = 71/459 (15%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA-GRGGGVPVVVQTS  1437
             LQQ LQ+++K+Q + WAYAIFWQTS DDDG+ FLAWGDG+FQG        G      + 
Sbjct  30    LQQMLQYVVKSQPEWWAYAIFWQTSTDDDGKNFLAWGDGYFQGDGVVNNNKGSSSSSSSL  89

Query  1436  HSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  1269
              S  QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  90    KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  148

Query  1268  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             F     +W++G  + Q+ Y+CERAKEAQIHGIQTLVCIPT  GV ELGS ++IK+N SLV
Sbjct  149   FGSDDFLWITGPAQFQLHYSCERAKEAQIHGIQTLVCIPTSNGVFELGSTQLIKQNLSLV  208

Query  1091  QQVKSLF------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekq  930
             QQVKSLF      QF  E++I FADIGLV+G   LQQ      DD               
Sbjct  209   QQVKSLFLCCPPIQF-LEKSICFADIGLVTG---LQQ------DD---------------  243

Query  929   aqeasaaaaaaKNSYPESEHSDSDCQFLKEP-PIVDRQQNAPKKRGRKPGA-GRVTPVNH  756
                         N     E+S       K+P P+V     A KKRGRKP     +  +NH
Sbjct  244   ------------NDDKLRENSK------KQPQPVV-----AKKKRGRKPKEDANMAALNH  280

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--QLR  582
             VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL    +
Sbjct  281   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHTK  340

Query  581   ESKKVKVEAVGDNQstssaa------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKL  420
             + K V   +  DNQST++++      ++  +  +VEVKI+G DAMIRVQSEN +YPSAKL
Sbjct  341   KPKNVTESSSADNQSTTTSSDDQVIKANSTAAPEVEVKIIGTDAMIRVQSENVDYPSAKL  400

Query  419   MNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             M  L+ L++ VHHASISSVN ++L D+VV+VP+GL +ED
Sbjct  401   MIALQNLQMQVHHASISSVNHLVLHDVVVRVPQGLSTED  439



>gb|KCW83845.1| hypothetical protein EUGRSUZ_B00713 [Eucalyptus grandis]
Length=490

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 257/496 (52%), Positives = 320/496 (65%), Gaps = 54/496 (11%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHS-------TLQQRLQFILKTQTDSWAYAIFWQTSNDD  1530
             MD+LI+ SSSSSS+      P  +       TLQQRLQ ++++Q   WAYAIFWQ  N D
Sbjct  1     MDKLIIASSSSSSLVFKPMSPTATPPPSLGLTLQQRLQLVVQSQPQWWAYAIFWQLLNHD  60

Query  1529  DGRLFLAWGDGFFQG----TKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNS  1362
             DGRL LAWGDG FQG    T A R     +     H    S R    + + A  G     
Sbjct  61    DGRLLLAWGDGHFQGSAKLTLASRSDCGKLFQALPHDPSNS-RPDAAADVPAPTGD----  115

Query  1361  ENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIH  1182
                  +TDAEWFYVMSL RSFSAGDG+PGKA   GSLVWL+GA  L  Y C+R KEA++H
Sbjct  116   -----VTDAEWFYVMSLTRSFSAGDGIPGKALGTGSLVWLTGARDLGSYECDRTKEAELH  170

Query  1181  GIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL--------------FQFPEERT-I  1047
             GI+TLVCIPTG GV+ELGS ++I ENW LVQ+ KSL              FQ  ++   I
Sbjct  171   GIRTLVCIPTGHGVLELGSCDVIPENWGLVQRAKSLFGSDLLLPKHPPPPFQLHQDPCDI  230

Query  1046  SFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSY-PESEH  870
             SF DIG+++G   LQ+   A  DD +  +     +   +       A     SY  ESEH
Sbjct  231   SFFDIGIIAG---LQESDFASHDDYE--KKVKKKEPLVEGAGGKPEAPFGSCSYLVESEH  285

Query  869   SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  690
             SDS   F+    +V  ++  PKKRGRKPG G   P+NHVEAERQRREKLNHRFYALR+VV
Sbjct  286   SDSGSPFMA---VVMTEKRTPKKRGRKPGLGLDPPLNHVEAERQRREKLNHRFYALRAVV  342

Query  689   PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaassv  513
             PNVS+MDK+SLLSDAVSYINELK K+ +LE Q+Q RESKK K E     +  +S+++   
Sbjct  343   PNVSKMDKSSLLSDAVSYINELKSKISDLESQMQ-RESKKFKQEVTDATDNLSSTSSVDH  401

Query  512   aSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  354
             +SP       ++VEVKIVG DAMIRVQS+NANY SA+LM  +R+LEL +HHAS+S+VND+
Sbjct  402   SSPSGCGGSLLEVEVKIVGCDAMIRVQSQNANYMSARLMAVMRDLELHIHHASLSAVNDL  461

Query  353   MLQDIVVKVPEGLRSE  306
             +LQD+VV+VPEGL+ E
Sbjct  462   LLQDVVVRVPEGLKGE  477



>ref|XP_004230022.1| PREDICTED: transcription factor MYC2-like isoform X2 [Solanum 
lycopersicum]
Length=450

 Score =   424 bits (1091),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 257/462 (56%), Positives = 307/462 (66%), Gaps = 75/462 (16%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG              +S 
Sbjct  27    LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQGDGVVINNKGGGGSSSSL  86

Query  1433  STQ-QSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  1269
              +Q QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  87    KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  145

Query  1268  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             F     +W++G  + Q+ Y+CERAKEAQIHGIQTLV IPT  GV ELGS ++IK+N SLV
Sbjct  146   FGSDDFLWITGPDQFQLHYSCERAKEAQIHGIQTLVSIPTSNGVFELGSTQLIKQNLSLV  205

Query  1091  QQVKSLF------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekq  930
             QQVKSLF      QF  E+TISFADIGLV+G   LQQ      DD               
Sbjct  206   QQVKSLFLCCPPIQF-LEKTISFADIGLVTG---LQQ------DD---------------  240

Query  929   aqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPV  762
                         N Y   E+S       K  P+V       KKRGRKP  G     +  +
Sbjct  241   ------------NDYKLRENSR------KPHPVV------AKKRGRKPKGGEEDAHMAAL  276

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--Q  588
             NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL   
Sbjct  277   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDH  336

Query  587   LRESKKVKVEAVGDNQstssaas----svaSPV---DVEVKIVGPDAMIRVQSENANYPS  429
              ++ K V   +  DNQS ++++       A+P    +VEVKIVG DAMIRVQSEN +YPS
Sbjct  337   TKKPKIVTESSSADNQSATTSSDDQVIKAANPTAAPEVEVKIVGTDAMIRVQSENVDYPS  396

Query  428   AKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             AKLM  L+ L++ VHHASISSVN ++L D+VV+VP+GL +ED
Sbjct  397   AKLMIALQNLQMQVHHASISSVNHLVLHDVVVRVPQGLSTED  438



>ref|XP_004230021.1| PREDICTED: transcription factor MYC2-like isoform X1 [Solanum 
lycopersicum]
Length=451

 Score =   424 bits (1091),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 257/462 (56%), Positives = 307/462 (66%), Gaps = 75/462 (16%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG              +S 
Sbjct  27    LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQGDGVVINNKGGGGSSSSL  86

Query  1433  STQ-QSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  1269
              +Q QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  87    KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  145

Query  1268  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             F     +W++G  + Q+ Y+CERAKEAQIHGIQTLV IPT  GV ELGS ++IK+N SLV
Sbjct  146   FGSDDFLWITGPDQFQLHYSCERAKEAQIHGIQTLVSIPTSNGVFELGSTQLIKQNLSLV  205

Query  1091  QQVKSLF------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekq  930
             QQVKSLF      QF  E+TISFADIGLV+G   LQQ      DD               
Sbjct  206   QQVKSLFLCCPPIQF-LEKTISFADIGLVTG---LQQ------DD---------------  240

Query  929   aqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPV  762
                         N Y   E+S       K  P+V       KKRGRKP  G     +  +
Sbjct  241   ------------NDYKLRENSR------KPHPVV------AKKRGRKPKGGEEDAHMAAL  276

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--Q  588
             NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL   
Sbjct  277   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDH  336

Query  587   LRESKKVKVEAVGDNQstssaas----svaSPV---DVEVKIVGPDAMIRVQSENANYPS  429
              ++ K V   +  DNQS ++++       A+P    +VEVKIVG DAMIRVQSEN +YPS
Sbjct  337   TKKPKIVTESSSADNQSATTSSDDQVIKAANPTAAPEVEVKIVGTDAMIRVQSENVDYPS  396

Query  428   AKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             AKLM  L+ L++ VHHASISSVN ++L D+VV+VP+GL +ED
Sbjct  397   AKLMIALQNLQMQVHHASISSVNHLVLHDVVVRVPQGLSTED  438



>ref|XP_010031905.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=490

 Score =   425 bits (1093),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 246/465 (53%), Positives = 305/465 (66%), Gaps = 47/465 (10%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG----TKAGRGGGVPVV  1449
             TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG    T A R     + 
Sbjct  32    TLQQRLQLVVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGSAKLTLASRSDCGKLF  91

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKA  1269
                 H    S R    + + A  G          +TDAEWFYVMSL RSFSAGDG+PGKA
Sbjct  92    QALPHDPSNS-RPDAAADVPAPTGD---------VTDAEWFYVMSLTRSFSAGDGIPGKA  141

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
                GSLVWL+GA  L  Y C+R KEA++HGI+TLVCIPTG GV+ELGS ++I ENW LVQ
Sbjct  142   LGTGSLVWLTGARDLGSYECDRTKEAELHGIRTLVCIPTGHGVLELGSCDVIPENWGLVQ  201

Query  1088  QVKSL--------------FQFPEERT-ISFADIGLVSGHELLQQGRSAGADDLKVLQSR  954
             + KSL              FQ  ++   ISF DIG+++G   LQ+   A  DD +  +  
Sbjct  202   RAKSLFGSDLLLPKHPPPPFQLHQDPCDISFFDIGIIAG---LQESDFASHDDYE--KKV  256

Query  953   AAGDaekqaqeasaaaaaaKNSY-PESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG  777
                +   +       A     SY  ESEHSDS   F+    +V  ++  PKKRGRKPG G
Sbjct  257   KKKEPLVEGAGGKPEAPFGSCSYLVESEHSDSGSPFMA---VVMTEKRTPKKRGRKPGLG  313

Query  776   RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC  597
                P+NHVEAERQRREKLNHRFYALR+VVPNVS+MDK+SLLSDAVSYINELK K+ +LE 
Sbjct  314   LDPPLNHVEAERQRREKLNHRFYALRAVVPNVSKMDKSSLLSDAVSYINELKSKISDLES  373

Query  596   QLQLRESKKVKVEAV-GDNQstssaassvaSP-------VDVEVKIVGPDAMIRVQSENA  441
             Q+Q RESKK K E     +  +S+++   +SP       ++VEVKIVG DAMIRVQS+NA
Sbjct  374   QMQ-RESKKFKQEVTDATDNLSSTSSVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQSQNA  432

Query  440   NYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             NY SA+LM  +R+LEL +HHAS+S+VND++LQD+VV+VPEGL+ E
Sbjct  433   NYMSARLMAVMRDLELHIHHASLSAVNDLLLQDVVVRVPEGLKGE  477



>ref|XP_008345582.1| PREDICTED: transcription factor bHLH14-like [Malus domestica]
Length=492

 Score =   421 bits (1083),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 314/488 (64%), Gaps = 70/488 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  1461
             Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQ  K      
Sbjct  19    QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHLVDNGCLFLTWGDGHFQRPKDASPNN  78

Query  1460  VPVVVQTSHSTQQ--SERKKVISGIQALIGSTQNSENGDL--------ITDAEWFYVMSL  1311
                     H+  +  SER+K++ GIQ+LI  T N +N  L         T+ E F+V S 
Sbjct  79    ------HHHNPYEVLSERRKILKGIQSLINDTNNPDNHYLYNMGLNANTTNIEGFFVRSF  132

Query  1310  ARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  1143
             ARSFS G+     VP KAFS GSLVWL+G+H LQ Y CERAKEAQ+HGIQTLVCIPT  G
Sbjct  133   ARSFSVGESIXTNVPXKAFSSGSLVWLTGSHELQSYVCERAKEAQMHGIQTLVCIPTPTG  192

Query  1142  VVELGSLEIIKENWSLVQQVKSLF--------QFPEERT--------ISFADIGLVSGHE  1011
             V+ELGS ++I+ENW+LVQQ KSLF        Q P  R+         SF+D  +++G +
Sbjct  193   VLELGSSDLIRENWNLVQQTKSLFWSDLVSDQQEPGTRSPINLINRNFSFSDFDIIAGVQ  252

Query  1010  LLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPI  831
               ++ +     D+ V++         +A   S   +   N  PE     SD +F K    
Sbjct  253   -EEKNKKEVPLDITVMKKTCG-----RACPGSIPFSNLNNLNPEP----SDSEFPKR---  299

Query  830   VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  651
                    PKKRGRKPG G  T ++HVEAERQRREKLNHRF ALR+VVPNVSRMDKASLLS
Sbjct  300   ------TPKKRGRKPGLGXDTTLDHVEAERQRREKLNHRFCALRAVVPNVSRMDKASLLS  353

Query  650   DAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaSP---------  504
             DAVSYI ELK KV+E+E Q+Q RESKKVK E V   DNQS++++      P         
Sbjct  354   DAVSYIIELKSKVDEMESQVQ-RESKKVKAETVDNLDNQSSTTSVDQTRPPNSLVSGSTG  412

Query  503   VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             ++VEVKIV  DAMIRV+SEN NYPSA+LM  LR+L+  ++HAS+S +N++MLQD+VVKVP
Sbjct  413   LEVEVKIVCSDAMIRVRSENVNYPSARLMAALRDLDFEMYHASLSCMNELMLQDVVVKVP  472

Query  323   EGLRSEDG  300
             + +RSE+ 
Sbjct  473   DNMRSEES  480



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   411 bits (1056),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 290/455 (64%), Gaps = 72/455 (16%)
 Frame = -2

Query  1574  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  1395
             D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  41    DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  83

Query  1394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-------VPGKAFSMGSLVWLSG  1236
              + +   T ++ N   I DAEWFYV+SL R+F+  +        +PGK+F++GS++WL+ 
Sbjct  84    KKFMRAPTNDTNN---INDAEWFYVVSLTRTFAVNNNASSSSSSLPGKSFALGSVLWLNN  140

Query  1235  AHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFP--  1062
              H LQ YNCER+ EAQ+HGI+TL+CIPT  GVVE+GS + IK+NW+LVQ VKSLF  P  
Sbjct  141   MHELQFYNCERSNEAQVHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKSLFITPPD  200

Query  1061  -------EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaa  903
                    ++ TISFADIG+V+G   +Q+ +    +  +  +     D             
Sbjct  201   PVPVEILDDHTISFADIGIVAG---VQETKKRRINQTQTQKPPRKND-------------  244

Query  902   aaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
                 +Y  SEHSDSDC  L          + PKKRGRKP  GR TPVNHVEAERQRREKL
Sbjct  245   ----NYVNSEHSDSDCPTLPT--ATTPTTSEPKKRGRKPILGRETPVNHVEAERQRREKL  298

Query  722   NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--  549
             NHRFYALR+VVPNVSRMDKASLLSDAV+YI+ELK K+E LE Q     SKKVK E     
Sbjct  299   NHRFYALRAVVPNVSRMDKASLLSDAVAYISELKAKIEYLESQQPRDSSKKVKTEMTDTL  358

Query  548   DNQstssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             DN ST++ ++ V               ++V+VKIVGPDAM+RVQSEN N+P A+LM  LR
Sbjct  359   DNHSTTTISTVVDQSGPEPRLGPSPLGLEVDVKIVGPDAMVRVQSENVNHPGARLMGALR  418

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +LE  VHHAS+S VND+MLQD+VVK+P G+RSE+G
Sbjct  419   DLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEEG  453



>ref|XP_009592442.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=439

 Score =   403 bits (1035),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 238/482 (49%), Positives = 309/482 (64%), Gaps = 77/482 (16%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNH-STLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLF  1515
             M+E+I  ++SS S  A +SQ N  STLQQ+L++IL +QTDSWAY IFWQTSN D++G L 
Sbjct  1     MNEVIFPATSSFSTPALISQENQPSTLQQKLKYILNSQTDSWAYTIFWQTSNEDNNGSLL  60

Query  1514  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDA  1335
             L WGDG FQGT                                               D 
Sbjct  61    LTWGDGHFQGTNK---------------------------------------------DI  75

Query  1334  EWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIP  1155
             EWFYV+SLA+S+S  +GV GK FS  + VWL+GA ++Q  +CERAKEAQ +G++TLV + 
Sbjct  76    EWFYVLSLAQSYSVNEGVIGKVFSTATFVWLTGAQQVQFCSCERAKEAQNNGVKTLVYVS  135

Query  1154  TGAGVVELGSLEIIKENWSLVQQVKSLF----------QFPEERTISFADIGLVSGHELL  1005
                GV+ELGS +IIKE+WSLVQQVKSLF           F ++ TI FA+I LV+G  L 
Sbjct  136   ISNGVLELGSSDIIKEDWSLVQQVKSLFSSDQENGPIYNFLDQNTIYFANIDLVTG--LQ  193

Query  1004  QQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVD  825
             + G+ +  +  K  +S+     E               S+P+SE S SDCQ L+ P    
Sbjct  194   EDGQESENNSNKNQESKLKKFEEVATTSHV--------SFPDSELSASDCQLLEHPVQKS  245

Query  824   R---QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  654
             R   ++   KKRGRKPG      +NHVE ERQRREKLNHRFYALRSVVP V+RMDKASLL
Sbjct  246   RVGSKKRTYKKRGRKPGEDCDKQMNHVEVERQRREKLNHRFYALRSVVPQVTRMDKASLL  305

Query  653   SDAVSYINELKGKVEELECQLQ--LRESKKVKVEA--VGDNQstssaassvaSPVDVEVK  486
             SDAV+YINELK KV++LE +L   L   KK+++E+    DNQS++++       ++VEVK
Sbjct  306   SDAVAYINELKAKVDKLESKLHRNLELKKKLQMESNDAVDNQSSTNSVDLT---LEVEVK  362

Query  485   IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             +VGP+AMIRVQSENANYPS +LM  L++LEL VHHASISSVN+I+LQ+IV++VP+ L++E
Sbjct  363   MVGPNAMIRVQSENANYPSTRLMCALQDLELHVHHASISSVNNILLQNIVIRVPKELKTE  422

Query  305   DG  300
             DG
Sbjct  423   DG  424



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   404 bits (1037),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 291/460 (63%), Gaps = 81/460 (18%)
 Frame = -2

Query  1574  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  1395
             D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39    DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  1394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-------------VPGKAFSMGS  1254
                 +  T  ++N   I DAEWFYVMSL RSF+  +              +PGK+F++GS
Sbjct  82    KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSLPGKSFALGS  138

Query  1253  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL  1074
             ++W +  H LQ YNCER+ EA +HGI+TL+CIPT  GVVE+GS + IK+NW+LVQ VKSL
Sbjct  139   VLWQNNRHELQFYNCERSNEAHVHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKSL  198

Query  1073  F---------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqe  921
             F         Q  ++ TISFADIG+V+G +  ++ +       ++ Q+  + +       
Sbjct  199   FHTSPDPVTIQILDDHTISFADIGIVAGIQETKKRK-------QITQTAPSKN-------  244

Query  920   asaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAER  741
                      ++Y +SEHSDSDC  L          + PKKRGRKP  GR TP+NHVEAER
Sbjct  245   ---------DNYVDSEHSDSDCPTLPT--ATTPTASEPKKRGRKPVLGRETPINHVEAER  293

Query  740   QRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKV  561
             QRREKLNHRFYALR+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K 
Sbjct  294   QRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMKT  353

Query  560   EAVG--DNQstssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAK  423
             E     DNQS ++ ++ V               ++V+V+IVGPDAM+RVQSEN N+P A+
Sbjct  354   EMTDTLDNQSATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGAR  413

Query  422   LMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             LM  LR+LE  VHHAS+S VND+MLQD+VVK+P G+RSE+
Sbjct  414   LMGALRDLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEE  453



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   400 bits (1028),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 220/461 (48%), Positives = 290/461 (63%), Gaps = 82/461 (18%)
 Frame = -2

Query  1574  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  1395
             D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39    DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  1394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--------------VPGKAFSMG  1257
                 +  T  ++N   I DAEWFYVMSL RSF+  +               +PGK+F++G
Sbjct  82    KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSSLPGKSFALG  138

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             S++W +  H LQ YNCER+ EA +HGI+TL+CIPT  GVVE+GS + IK+NW+LVQ VKS
Sbjct  139   SVLWQNNRHELQFYNCERSNEAHMHGIETLICIPTQNGVVEMGSYDTIKQNWNLVQHVKS  198

Query  1076  LF---------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaq  924
             LF         Q  ++  ISFADIG+V+G +  ++ +       ++ Q+  + +      
Sbjct  199   LFHTSPDPVTVQILDDHIISFADIGIVAGIQETKKRK-------QITQTAPSKN------  245

Query  923   easaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAE  744
                       ++Y +SEHSDSDC  L          + PKKRGRKP  GR TP+NHVEAE
Sbjct  246   ----------DNYVDSEHSDSDCPTLPT--ATTPTASEPKKRGRKPVLGRETPINHVEAE  293

Query  743   RQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVK  564
             RQRREKLNHRFYALR+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K
Sbjct  294   RQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMK  353

Query  563   VEAVG--DNQstssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSA  426
              E     DNQS ++ ++ V               ++V+V+IVGPDAM+RVQSEN N+P A
Sbjct  354   TEMTDTLDNQSATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGA  413

Query  425   KLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             +LM  LR+LE  VHHAS+S VND+MLQD+VVK+P G+RSE+
Sbjct  414   RLMGALRDLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEE  454



>ref|XP_008233076.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2 [Prunus 
mume]
Length=483

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 304/493 (62%), Gaps = 91/493 (18%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK--AGRGG  1464
             Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K  + +  
Sbjct  19    QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSKDPSAKHH  78

Query  1463  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----------TDAEWFYVMS  1314
               P  +        SER+K++ GIQ+LI       + D +          +D EWFYVMS
Sbjct  79    NNPYGIL-------SERRKILKGIQSLINDNNPDHHQDSVMDHMGLDADVSDGEWFYVMS  131

Query  1313  LARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             LARSFS G+      VPGKAFS GS+VWL+GAH LQ YNC+RAKEAQ+HG QTLVCIPT 
Sbjct  132   LARSFSIGESAISASVPGKAFSSGSVVWLTGAHELQFYNCDRAKEAQMHGFQTLVCIPTP  191

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQF-----------PE--------ERTISFADIGL  1026
              GV+E+GS +         QQ KSLF             PE         R  SFADIG+
Sbjct  192   TGVLEMGSSDXXXX--XXXQQAKSLFGSDLICSVADKPDPETTSPIDFINRNFSFADIGI  249

Query  1025  VSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFL  846
             ++G E  +  +   A DL +++ R  G+        S       N+ P+ ++SDSD    
Sbjct  250   IAGVEEEEDDKKEVALDLTMMK-RKGGNPGTGLYPDS-------NANPKPDYSDSDGP--  299

Query  845   KEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDK  666
                      +  PKKRGRKPG GR TP+NHVEAERQRR K+ H               DK
Sbjct  300   ---------KRTPKKRGRKPGLGRDTPLNHVEAERQRRGKIKHPVSG-----------DK  339

Query  665   ASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---QstssaassvaSP---  504
             ASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST+++   +A P   
Sbjct  340   ASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQSTTTSVEQIAKPPSS  397

Query  503   ------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  342
                   ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HHAS+S +N++MLQD
Sbjct  398   SANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHHASLSCINELMLQD  457

Query  341   IVVKVPEGLRSED  303
             IV+KVPE +RSED
Sbjct  458   IVLKVPENMRSED  470



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   397 bits (1019),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 216/483 (45%), Positives = 304/483 (63%), Gaps = 91/483 (19%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P   TLQQ+LQF+++TQ+++W YAI WQT+ D+ G+  L+WG+G+FQGTK          
Sbjct  21    PQTLTLQQKLQFLVQTQSENWVYAILWQTTKDEKGKPLLSWGEGYFQGTK----------  70

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----V  1281
              +T++S +Q                  N  N     DAEWFYVMSL R FS G+     +
Sbjct  71    -ETTNSNKQ------------------NDSNTCANKDAEWFYVMSLTRIFSIGNASSISL  111

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PGK+F++ S++WL+  H LQ+YNCER+ EA +HGI+TL+CIPT  GV+E+GS + I++NW
Sbjct  112   PGKSFALDSVLWLNSKHELQIYNCERSNEAHVHGIETLICIPTTNGVIEMGSYDNIQQNW  171

Query  1100  SLVQQVKSLFQF---------------PEERTI--SFADIGLVSGH----ELLQQGRSAG  984
             +LV Q KS+FQ                P ++++  +FADIG+VSG     +  Q+  +  
Sbjct  172   NLVHQAKSMFQTSSSESNSEIDLISTNPLDKSMFQTFADIGIVSGSGEDTDETQKTMNQK  231

Query  983   ADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSD-CQFLKEPPIVDRQQNA-  810
                +  + S  + D                     SE+SDS+ C  L  P     ++++ 
Sbjct  232   LQQMNNIVSSCSID---------------------SENSDSEYCPPLATPTKTRTEKDSF  270

Query  809   ----PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
                 PKKRGRKP +G  TP+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV
Sbjct  271   EKREPKKRGRKPLSGTQTPMNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAV  330

Query  641   SYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstssaass-------vaSPVDVEV  489
              YINELK K+E+LE  +Q +ESKKVK+E   + DN S ++ ++          +  +++V
Sbjct  331   DYINELKSKIEDLES-VQQKESKKVKMETMEIVDNNSATTTSTVVDQKRPCNVNAFEIDV  389

Query  488   KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             KI+G DAM+RVQSEN N+P A+LM+ L++LE  VHHASIS+VN++M+QD+VV++P  +  
Sbjct  390   KIIGNDAMVRVQSENVNHPGARLMSVLKDLEFQVHHASISTVNEVMVQDVVVRIPNEMNK  449

Query  308   EDG  300
             E+ 
Sbjct  450   EES  452



>ref|XP_002320222.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE98537.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=430

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 231/473 (49%), Positives = 290/473 (61%), Gaps = 111/473 (23%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI+++Q D W+Y+IFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24    TLQQRLQFIVQSQPDRWSYSIFWQASKDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
              ST  SERK+                         WFYVMSL RSFS GDG+ GKA++ G
Sbjct  83    MSTSNSERKR-------------------------WFYVMSLTRSFSPGDGILGKAYTTG  117

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             SL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS  +I+ENW +VQQ KS
Sbjct  118   SLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGSSCVIRENWGIVQQAKS  177

Query  1076  LF---------------------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQ  960
             LF                     QF  +R IS AD G+++G   LQ+      DD  +  
Sbjct  178   LFVSDLNSCLVPKGPNNPCQEPIQFL-DRNISLADGGIIAG---LQE------DDHTI--  225

Query  959   SRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGA  780
                                         EH +   Q   E      +++   K G+  GA
Sbjct  226   ----------------------------EHGEKRTQERAET-----KKDNVNKLGQS-GA  251

Query  779   GRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE  600
                 P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE
Sbjct  252   ----PLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLE  307

Query  599   CQLQLRESKKVKVEAVG--DNQstssaassva-----------SPVDVEVKIVGPDAMIR  459
              +LQ RESKKVK+E     DNQST+++    A             ++VEVK VG DAMIR
Sbjct  308   SKLQ-RESKKVKLEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIR  366

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             VQS+N NYP ++LM+ LR+LE  VHHAS+SSVN++MLQD+VV+VP+GLR+E+ 
Sbjct  367   VQSDNVNYPGSRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEEA  419



>ref|XP_010267440.1| PREDICTED: transcription factor MYC2 [Nelumbo nucifera]
Length=522

 Score =   395 bits (1015),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 250/494 (51%), Positives = 326/494 (66%), Gaps = 66/494 (13%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQ+RL+F+++++ + W YAIFW+TSND++G L LAW DG F+GT+  R           
Sbjct  28    TLQERLRFLVQSRPEWWVYAIFWRTSNDNNGHLVLAWADGLFRGTR-DRASSSSRYSNRL  86

Query  1436  HSTQQS-----ERKKVISGIQALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGDGV  1281
                QQ      ERKKV+ GIQALI    +   S +GD +TDAEWFY++S+ RSF+ GDG+
Sbjct  87    QCQQQKLEIDWERKKVMKGIQALINDIPDIDASVDGD-VTDAEWFYMVSITRSFNIGDGL  145

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PGKA S GS VWL+GA +L+  NCERAKEA +HGI+TLV IP  +GV+ELGS + I ENW
Sbjct  146   PGKAISSGSPVWLTGAQQLRFCNCERAKEALVHGIETLVYIPISSGVLELGSSDTIAENW  205

Query  1100  SLVQQVKSLF------------------QFPE--------ERTISFADIGLVSGH--ELL  1005
              LV Q KSLF                  + P         +R +SF DIG+++G   E +
Sbjct  206   GLVHQAKSLFGSDVISPVPVAVSLPVQERSPSQGGLIPFLDRDLSFPDIGIINGERGEGI  265

Query  1004  QQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP-ESEHSDSDCQFLKEPPIV  828
              Q R       +  +++  G+        +A A  A +S   ESEH DSD   +      
Sbjct  266   HQERHR-----QEARTKKNGETTTTITMTTAPAPPATHSSSVESEHFDSDALLITS---A  317

Query  827   DRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  648
             D ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL+D
Sbjct  318   DMEKRRPKKRGRKPGKGRDMPLNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLAD  377

Query  647   AVSYINELKGKVEELECQLQL-RESKKVKVEAVGDNQstssaassv--------------  513
             AVSYINELKGK+E+LE +L L R SKKVK+E + D+QST + A++V              
Sbjct  378   AVSYINELKGKIEDLEGRLGLGRHSKKVKME-MDDHQSTITTATTVFDYGQTRSSSIYGS  436

Query  512   ---aSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  342
                 + +DVEVKI+G DA+IRVQSEN NYPSA+LM+ LR L+L VHHAS+SSV ++MLQD
Sbjct  437   GGLITSMDVEVKILGTDALIRVQSENVNYPSARLMDALRGLKLQVHHASVSSVKELMLQD  496

Query  341   IVVKVPEGLRSEDG  300
             +V+++P+G++SE+G
Sbjct  497   VVIRLPDGVKSEEG  510



>ref|XP_007135301.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
 gb|ESW07295.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
Length=464

 Score =   385 bits (990),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 220/460 (48%), Positives = 283/460 (62%), Gaps = 82/460 (18%)
 Frame = -2

Query  1574  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVVVQTSHSTQQSERKKVIS  1398
             D W YAIFWQ S+DD+G L+L++G+G FQGTK        P+  +    T  +E      
Sbjct  41    DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTKETSPKFPTPISTKKFTKTPTTEN-----  95

Query  1397  GIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----------VPGKAFSMGSLV  1248
                              I DAEWFYVMSL R+F+  +           + GK+F++GS++
Sbjct  96    -----------------INDAEWFYVMSLTRTFTVTNSSSSTPPTPSSLLGKSFALGSVL  138

Query  1247  WLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQ  1068
             WL+    LQ Y C+R+ EA +HGIQTL+ IPT  GVVE+GS + IK+NW+LVQ VKSLFQ
Sbjct  139   WLNNKQELQFYKCDRSNEAHLHGIQTLISIPTQDGVVEMGSYDSIKQNWNLVQHVKSLFQ  198

Query  1067  -FPE--------ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
               P+        + TISFADIG+V+G +  ++ + A                        
Sbjct  199   PLPDPLPVQVLNDNTISFADIGIVAGIQETKKRKQA-----------------------Q  235

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQR  735
                   K+ Y +SEHSDSDC  L          + PKKRGRKP  GR TP+NHVEAERQR
Sbjct  236   TPPNNKKDIYVDSEHSDSDCPMLPT--TTTPTASEPKKRGRKPVIGRETPMNHVEAERQR  293

Query  734   REKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA  555
             REKLNHRFYALR+VVPNVSRMDKASLLSDAV+YINELK K+E LE Q Q   +K+VK E 
Sbjct  294   REKLNHRFYALRAVVPNVSRMDKASLLSDAVTYINELKAKIEYLESQQQREGNKRVKTEM  353

Query  554   VG--DNQstssaassvaSP-------------VDVEVKIVGPDAMIRVQSENANYPSAKL  420
             +   DNQST++  +S                 ++++VKI+GPDAM+RVQSENAN+P A+L
Sbjct  354   MDTMDNQSTTTTTTSTIVDQSRPGAGGPCPFGLEIDVKIMGPDAMVRVQSENANHPGARL  413

Query  419   MNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             M  LR+LE  VHHAS+S VND+MLQD+V+ VP G+RSE+G
Sbjct  414   MGALRDLEFQVHHASMSCVNDLMLQDVVINVPNGMRSEEG  453



>ref|XP_009623539.1| PREDICTED: transcription factor MYC3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 236/453 (52%), Positives = 279/453 (62%), Gaps = 103/453 (23%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K   GG       +S 
Sbjct  71    LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAK---GGAAVNNKGSSS  127

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  1254
                QSERKKVI GIQALI    + +N +L+ D                            
Sbjct  128   DAAQSERKKVIRGIQALI----DGDNNNLMDD----------------------------  155

Query  1253  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL  1074
                  GA + Q+Y+CERAKEAQIHGIQTL+CIPT  GV+ELGS  +IKEN+ LVQQVKSL
Sbjct  156   -----GAAQFQVYSCERAKEAQIHGIQTLLCIPTSNGVLELGSAHLIKENFDLVQQVKSL  210

Query  1073  F-QFPE----ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaa  909
             F   P     E++I FADIGLV+G   LQQ      D L                     
Sbjct  211   FLSCPPIHFLEKSICFADIGLVTG---LQQDNE---DKL---------------------  243

Query  908   aaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEAER  741
                      E +  DSD            ++   KKRGRKP  G     +  +NHVEAER
Sbjct  244   ---------EKQQLDSD------------KKAVAKKRGRKPKGGDNNINMAALNHVEAER  282

Query  740   QRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL---QLRESKK  570
             QRREKLNHRFYALRS VPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL       +KK
Sbjct  283   QRREKLNHRFYALRSAVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHSSSSNKK  342

Query  569   VKVEAVGDNQstssaassvaSP---VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  399
              K    G+NQST+++      P   ++VEVKIVGPDAMIRVQSEN NYPSAKLM+ LR L
Sbjct  343   QKSNESGENQSTNTSVDQELRPNSSLEVEVKIVGPDAMIRVQSENVNYPSAKLMSALRHL  402

Query  398   ELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +L VHHASISSVN++ML D+VVKVP+GLR+EDG
Sbjct  403   QLQVHHASISSVNNLMLHDVVVKVPQGLRTEDG  435



>ref|XP_007039384.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
 gb|EOY23885.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
Length=473

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 211/471 (45%), Positives = 295/471 (63%), Gaps = 62/471 (13%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRLQFI++++ + W Y+IFWQ S D  G L L+WGDG+F+GT+   G     ++   
Sbjct  19    TLQQRLQFIVQSRPEWWVYSIFWQASRDAHGHLVLSWGDGYFRGTRNFSGESCNKLISQP  78

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSAGDGVP  1278
                   ERK+    +QAL      SE  DL       +TD EW+Y +S+ RSF+ GDG+ 
Sbjct  79    KLVSNLERKRSNKEMQALF-----SEEMDLDRMVDVDVTDYEWYYTVSITRSFAIGDGIL  133

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+AF  GS +WLSG    Q+Y CER ++A++ G QTLVC+ T  GVVELGS E+IKE+W 
Sbjct  134   GRAFGSGSYIWLSGDEEFQLYECERVRDARMRGFQTLVCLSTSFGVVELGSSEMIKEDWG  193

Query  1097  LVQQVKSLF----------------QFP-EERTISFADIGLVSGHELLQQGRSAGADDLK  969
             +VQ  KS+F                QF    +++ F D G+VSG +              
Sbjct  194   MVQLAKSIFDSEINCLGSKQPSNESQFQISTKSVPFLDFGMVSGDQ-----------KEW  242

Query  968   VLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRK  789
             +L+ +  G+A+K+      +++ +      +  S             D++ N   KRGRK
Sbjct  243   ILEEKQQGEAKKETTGLGRSSSDSGPDSDGNFAS------------ADKEFNVRSKRGRK  290

Query  788   PGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  609
             PG+G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLLSDAV+YI EL+ KVE
Sbjct  291   PGSGKDSPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLSDAVAYIKELRSKVE  350

Query  608   ELECQLQLRESKKVKVEAVG--DNQstssaassva-------SPVDVEVKIVGPDAMIRV  456
             ELE +L++ +S+K K+ A+   DNQ T+S   +           ++V+VKIVG +AMIRV
Sbjct  351   ELEAKLRV-QSQKSKLNAINVFDNQITTSTFENTRPSPSYGPKTIEVDVKIVGSEAMIRV  409

Query  455   QSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             Q  + NYP+A+LM+ LR+LEL VHHASIS+V +++LQD+VV+VP G  S++
Sbjct  410   QCPDVNYPAARLMDALRDLELHVHHASISNVKELVLQDVVVRVPTGFISDE  460



>ref|XP_010909816.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=437

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 282/448 (63%), Gaps = 68/448 (15%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQRLQ++L  +++ WAYAIFW+ S D      L++G+G F+GT+         V +  H
Sbjct  34    LQQRLQYLLHARSEWWAYAIFWRASPDHH---LLSFGEGHFRGTRD--------VDRKPH  82

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDA---EWFYVMSLARSFSAGDGV-PGKAF  1266
               +       + GIQAL+     +  GD+ +D    EWFYV+SL RSF+A + V P +A+
Sbjct  83    GLRSR-----VGGIQALLSEVTGTTAGDIASDGDDVEWFYVVSLTRSFAAQEPVLPARAY  137

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
                + VW++GAH LQ   C+RA+EAQ+HGI+TLVC+P   GV+ELGS ++I ENW LVQQ
Sbjct  138   GSLAPVWVAGAHALQTCGCDRAREAQLHGIETLVCVPLSGGVLELGSSDLIGENWVLVQQ  197

Query  1085  VKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaa  906
              K++   P++     A +G +     L   + AGA                         
Sbjct  198   AKAILSAPDD-----AIVGPMVPAPPLVMNKVAGAG------------------------  228

Query  905   aaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
                 +S  +SEHSDS+   + E       Q  PKKRGRKPG GR TPVNHVEAERQRREK
Sbjct  229   ITGLSSSVDSEHSDSEGALMME-------QRRPKKRGRKPGTGRETPVNHVEAERQRREK  281

Query  725   LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
             LNHRFYALRSVVPNVSRMDKASLL+DAVSYI  L+ KVEELE      E+K++K E +GD
Sbjct  282   LNHRFYALRSVVPNVSRMDKASLLADAVSYIKVLRAKVEELEA-----EAKRIKKEVIGD  336

Query  545   N-------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                      ST++  SS    +++EVK++GPDA+IRV S+N N+P+AKLM  LR+LE+ V
Sbjct  337   QGVGGAATTSTTTTVSSGPLTMELEVKMLGPDALIRVHSDNLNHPTAKLMGALRDLEVNV  396

Query  386   HHASISSVNDIMLQDIVVKVPEGLRSED  303
             HHAS+S+V ++MLQD+VV+VP  L+ +D
Sbjct  397   HHASVSTVKEVMLQDVVVRVPYALQGDD  424



>ref|XP_009775258.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=425

 Score =   365 bits (936),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 227/484 (47%), Positives = 295/484 (61%), Gaps = 95/484 (20%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLF  1515
             MDELI  SS S+SI+    QP  ST QQRLQ+ILK+QT+ WAYAIFWQT++  D++G  F
Sbjct  1     MDELIFPSSFSASISQEN-QP--STFQQRLQYILKSQTNCWAYAIFWQTTSNKDNNGSFF  57

Query  1514  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDA  1335
             L  GDG FQG+                                               D 
Sbjct  58    LTCGDGHFQGSNK---------------------------------------------DV  72

Query  1334  EWFYVMSLARSFSAGDGVPGKAF-SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  1158
             EWFYV+SLA+S+S  +GV GKAF S  S VWL+GA  LQ  +CERAKEAQ +G++TLVC+
Sbjct  73    EWFYVLSLAKSYSGNEGVIGKAFTSTASFVWLTGAQLLQFCSCERAKEAQYNGVKTLVCV  132

Query  1157  PTGAGVVELGSLEIIKENWSLVQQVKSLF---------QFPEERTISFADIGLVSGHELL  1005
             P   GV+ELGS +IIKE+W+LVQQVKSLF          F ++ TI FA+   V+G   +
Sbjct  133   PISNGVLELGSSDIIKEDWTLVQQVKSLFCSVQENGPMNFLDQNTIYFANFDFVTG---M  189

Query  1004  QQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEP----  837
             Q+      +  K + + +                    S+ +SE S+SDCQ L+ P    
Sbjct  190   QKDVQESDNSSKKVATTSHA------------------SFLDSELSNSDCQLLEYPVQKS  231

Query  836   PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASL  657
              +  + +   +KRGRK G      +NHVEAERQRREKLNHRFY LRSVVP V+ +DKASL
Sbjct  232   RVGSKIRRTYRKRGRKHGVDCDKQMNHVEAERQRREKLNHRFYMLRSVVPQVTGIDKASL  291

Query  656   LSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVGDNQstssaassvaSPVD-VEVK  486
             LSDAV+YINELK KV++LE +L   L   KK ++E   D         S  + VD VEVK
Sbjct  292   LSDAVAYINELKAKVDKLESKLHTNLELKKKPEMEHNDD-----VDNQSSTNSVDHVEVK  346

Query  485   IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVK-VP-EGLR  312
             ++GPDAMIRVQSE+ NYPS +LM  L++LEL V+HA+ISSVN+I++QDIV++ VP +GL+
Sbjct  347   MIGPDAMIRVQSEDVNYPSTRLMCALQDLELHVYHANISSVNNIVVQDIVIRDVPNKGLK  406

Query  311   SEDG  300
             +EDG
Sbjct  407   TEDG  410



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score =   366 bits (939),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 220/475 (46%), Positives = 292/475 (61%), Gaps = 71/475 (15%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQRLQ+IL+++ + W YAIFWQ S + +GRL L+WGDG F+ +K        + V+ S+
Sbjct  25    LQQRLQYILQSRPEWWVYAIFWQASKEPNGRLVLSWGDGDFRDSKG-------LAVKPSN  77

Query  1433  STQQS-------ERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDG  1284
             + Q         ERKKV    Q+L G   + E   + D +T+  WFY +S+ +SF+ G+G
Sbjct  78    NKQNQLKYGFNLERKKVTRDFQSLFGDEMDLERLADAD-VTNYGWFYTVSVTQSFNVGEG  136

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             + G+ F  G+  WL+G H LQ+Y C R KEA++HGIQTLVCI T  GVVELGS  +I E+
Sbjct  137   ILGQTFGSGTFTWLTGDHELQLYECGRVKEARMHGIQTLVCIATSTGVVELGSSNMINED  196

Query  1103  WSLVQQVKSLF------------------QFPEERTISFADIGLVSGHELLQQGRSAGAD  978
             WSLVQ  KSLF                  Q P +R+ S  DIG+ SG +      +    
Sbjct  197   WSLVQLCKSLFVQDVTCLIPKQPRPEAQLQIP-DRSASVLDIGMFSGCQKQASPETHNEG  255

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKR  798
             D+K   +   G                  S  +S   DSD  F  E    DR     KKR
Sbjct  256   DIKKDATNDLG-----------------RSSSDSGPFDSDGNFAVES--TDR----IKKR  292

Query  797   GRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKG  618
             GRKP  G+  P+NHVEAERQRRE+LN+RFYALRSVVPNVS+MDKASLL+DAV+YI ELK 
Sbjct  293   GRKPVKGKELPLNHVEAERQRRERLNNRFYALRSVVPNVSKMDKASLLADAVTYIQELKA  352

Query  617   KVEELECQLQLRESKKVKVEA--VGDNQsts--------saassvaSPVDVEVKIVGPDA  468
             KV+EL+ Q+QL  SKK K+    V DN STS        +++   A  ++V+V+IVG +A
Sbjct  353   KVDELKTQVQL-VSKKSKISGNNVFDNNSTSSMIDRHLMTSSIYRAKEMEVDVRIVGSEA  411

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             MIRV+S + +YP+A+LMN +RELE  VHHASISS+ D++LQDIVV + +GL SE+
Sbjct  412   MIRVRSPDIDYPAARLMNAIRELEFQVHHASISSIKDVVLQDIVVSIRDGLTSEE  466



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   363 bits (933),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 207/472 (44%), Positives = 285/472 (60%), Gaps = 80/472 (17%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TL+Q+LQF+L+ Q + W YAIFWQT+ D+   +FL WG+G F  TK         V    
Sbjct  34    TLEQKLQFLLQAQPNHWVYAIFWQTTKDERDNIFLTWGEGHFHDTKETTTTSSETVNDND  93

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----VPGKA  1269
               T                       NGD    A  FY+MSL+R+FS G+     +PGKA
Sbjct  94    TCT-----------------------NGD----ALLFYIMSLSRTFSVGNSSSNSLPGKA  126

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
             F++ S++WL+  H LQ YNC+R+ EA +HGI+TL+CIPT  GV+E+GS E I++NW+LV 
Sbjct  127   FALNSVLWLNSKHELQFYNCDRSNEAHVHGIETLICIPTTNGVIEMGSYENIQQNWNLVH  186

Query  1088  QVKSLFQF---------------PEER------TISFADIGLVSGHELLQQGRSAGADDL  972
             Q KS+FQ                P +R       I F D+G++SG            D++
Sbjct  187   QAKSMFQTSLSESNSKLDLFSTDPLDRIKTFDQNILFTDVGIISG-------TGEETDEM  239

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDR-QQNAPKKRG  795
             + + +R                    + Y +SE+SDS+     E    D  ++  PKKRG
Sbjct  240   QKMMNRTW----------LQKPKTVSSCYVDSEYSDSEYYPQLETKKNDSFEKREPKKRG  289

Query  794   RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
             RKP  G  TP++HVEAERQRREK+NHRFYALR+VVPNVSRMDKASLLSDAV +INELK K
Sbjct  290   RKPLLGNPTPMSHVEAERQRREKINHRFYALRAVVPNVSRMDKASLLSDAVDFINELKSK  349

Query  614   VEELECQLQLRESKKVKVEAVGDNQstssaass--------vaSPVDVEVKIVGPDAMIR  459
             + ELE + Q +E KK+K+E + DNQST++ ++             ++++VKI+G DAM+R
Sbjct  350   IVELELE-QQKELKKLKIENM-DNQSTATTSTVVDQKRISCNNISLEIDVKIIGGDAMVR  407

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             VQ EN N+P A+LM+ L++LE  VHHASIS VN+IM+QD+VV+VP  +R+E+
Sbjct  408   VQCENVNHPGARLMSVLKDLEFQVHHASISCVNEIMVQDVVVQVPINMRNEE  459



>gb|KDP25207.1| hypothetical protein JCGZ_20363 [Jatropha curcas]
Length=482

 Score =   353 bits (905),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 210/479 (44%), Positives = 274/479 (57%), Gaps = 60/479 (13%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P+   +QQRLQ+IL+   + W YAIFWQ S D  GRL L+WGDG F+G+        P  
Sbjct  17    PHPLPIQQRLQYILQNHPEWWLYAIFWQASKDASGRLVLSWGDGSFRGSNKDFAATRPNK  76

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSAG  1290
                     Q ERK+  S +         SEN DL       +T+ +WFY +S+ RSFS G
Sbjct  77    HNQFKFGFQLERKR--SSVNKDQLQYLFSENVDLDRLGDVDVTEDDWFYTVSVTRSFSVG  134

Query  1289  DGVPGKAFSMGS-LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             DG+ G+AF   S  +WLSG   LQ+Y CER KEA +HGI+TL CI T  GVVELGS   I
Sbjct  135   DGILGRAFITPSGFIWLSGDRDLQLYECERVKEASMHGIKTLACISTSCGVVELGSFNTI  194

Query  1112  KENWSLVQQVKSLF-----------------QFPEERTISFADIGLVSGHELLQQGRSAG  984
              E+WSLVQ  KS+F                   PE    SF DIG+   H   Q+  S+ 
Sbjct  195   NEDWSLVQLCKSIFGADVACLISKQPTHQLPNIPEGSNSSFLDIGISGAHR--QKDTSSD  252

Query  983   ADD------LKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDR  822
               +      + + +  A G                  S  +S   DSD +F      VDR
Sbjct  253   KHNQNEGNMMLIKKDNATG--------------QLGRSSSDSGPCDSDGKF-APGSTVDR  297

Query  821   QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
                  KKRGRKP  G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL DAV
Sbjct  298   F----KKRGRKPINGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLEDAV  353

Query  641   SYINELKGKVEELECQLQLRESKKVKVEAVGDNQst------ssaassvaSPVDVEVKIV  480
             +YI +LK KV ELE +LQ    K   V  +  N +          + +    ++V+VKIV
Sbjct  354   TYIKDLKAKVNELETKLQAVRKKSKNVTNINANTNNYVVIGPEVMSHNKVMTMEVDVKIV  413

Query  479   GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             G +AMIRVQS + NYP+A+LM+ LRELE+ VHHAS+S + +++L D+V+++P+GL +E+
Sbjct  414   GSEAMIRVQSLDVNYPAARLMDALRELEIKVHHASVSRIKEMVLLDVVIRLPDGLTNEE  472



>gb|KEH18599.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=454

 Score =   352 bits (902),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 277/469 (59%), Gaps = 102/469 (22%)
 Frame = -2

Query  1577  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVIS  1398
             +++W Y I WQT+ D+ G+ FL+WG+G+FQGTK           +T+ S +         
Sbjct  35    SENWIYGILWQTTKDEKGKPFLSWGEGYFQGTK-----------ETTTSNK---------  74

Query  1397  GIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----VPGKAFSMGSLVWLSGAH  1230
                                DAEWFYVMSL R FS G+     +PGKAF++ S++WL+  H
Sbjct  75    -------------------DAEWFYVMSLTRKFSIGNASSISLPGKAFALDSVLWLNSKH  115

Query  1229  RLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQ------  1068
              LQ+YNCER+ EA +HGI+TL+CIPT  GV+E+GS + I++NW+LV Q KS+FQ      
Sbjct  116   ELQIYNCERSNEAHMHGIETLICIPTTNGVIEMGSYDNIQQNWNLVHQAKSMFQTSSSES  175

Query  1067  -----------FPEERTI----SFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
                        F + +T     SFA++G+VSG       R    +  K LQ +       
Sbjct  176   NSNLDLTSTTPFDKCKTFIQNTSFANMGVVSG----GSAREDPHEKPKNLQEKHKN----  227

Query  932   qaqeasaaaaaaKNSYPESEHSDSD-CQFLKEPPIVDR----QQNAPKKRGRKPGAGRVT  768
                          +   +SE SDS+ C  L       +    ++  PKKRGRKP  G  T
Sbjct  228   -----------VSSCSLDSEDSDSEYCPLLATKTTTAKNDSFEKREPKKRGRKPLTGTQT  276

Query  767   PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ  588
             P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YINELK K+E+L+   Q
Sbjct  277   PMNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVDYINELKAKIEDLKLG-Q  335

Query  587   LRESKK--VKVEAVGDNQstssaa----------ssvaSPVDVEVKIVGPDAMIRVQSEN  444
              +ESKK  +K   + DN S ++ +          S     ++++VKI+G DAM+RVQS N
Sbjct  336   QKESKKAMMKTMKIVDNNSATTTSIVVDQNKPSCSKNLIALEIDVKIIGHDAMVRVQSLN  395

Query  443   ANYPSAKLMNGLRELELAVHHASISSVND-IMLQDIVVKVPEGLRSEDG  300
              N+PSA+LM+ L++LE  VH ASIS+VN  +M+QD++VKVP  +R+E+ 
Sbjct  396   VNHPSARLMSVLKDLEYQVHQASISTVNKVVMVQDVIVKVPNEMRNEES  444



>ref|XP_011026782.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=471

 Score =   349 bits (895),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 210/484 (43%), Positives = 298/484 (62%), Gaps = 83/484 (17%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K         
Sbjct  18    QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNKK-------Y  70

Query  1451  VVQTSHSTQQS------ERKKVIS---GIQALIGSTQNSENGDLITDAEWFYVMSLARSF  1299
               + S+    S      ERK + S    +  L+        GD+   AEW+Y +S+ R+F
Sbjct  71    ASKDSNKQNHSKFGFNLERKSLFSEDMDMDRLV-------EGDV---AEWYYTVSVTRAF  120

Query  1298  SAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  1119
             + GDG+ G+AFS G+ +WL+G H LQ+Y+CER KEA++HGIQT VC+ T +GV+ELGS +
Sbjct  121   AVGDGILGRAFSSGAFIWLTGDHELQIYDCERVKEARMHGIQTFVCVSTPSGVLELGSPD  180

Query  1118  IIKENWSLVQQVKSLF-------QFPEE-----------RTIS-FADIGLVSGHELLQQG  996
             +I E+W+LVQ  KS+F        FP++           RT+S F D G+ S     Q+ 
Sbjct  181   LISEDWALVQLAKSIFGADINAGSFPKQANQESQPQIPNRTVSNFLDFGMFSSP---QKE  237

Query  995   RSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQ  816
             R+        L+++   D  K+      +++ +  S  ++  ++++  F           
Sbjct  238   RTTS------LENQKESDTRKEPSGQGRSSSDSGRSDSDAGFTENNIGF-----------  280

Query  815   NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
                KKRGRKPG G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +Y
Sbjct  281   ---KKRGRKPG-GKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATY  336

Query  635   INELKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDV  495
             I ELK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V
Sbjct  337   IKELKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEV  395

Query  494   EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  315
             +VKI+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V D++LQD+V+ +P+GL
Sbjct  396   DVKILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKDLVLQDVVIIIPDGL  455

Query  314   RSED  303
              +E+
Sbjct  456   VTEE  459



>gb|ADK91082.1| LMYC2 [Hevea brasiliensis]
Length=475

 Score =   347 bits (891),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 211/471 (45%), Positives = 282/471 (60%), Gaps = 58/471 (12%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK         
Sbjct  23    QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTKEFAAKACNK  82

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDGV  1281
               Q        ERK +    Q L     + +   + D+I D EWFY +S+ RSF+  DG+
Sbjct  83    QNQPKFGFNL-ERKVINKESQTLFTDDMDMDRLPDVDVI-DYEWFYTVSVTRSFAIDDGI  140

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
              G+ F  G+ +WL+G + LQMY+CER KEA++HGIQTLVCI T   VVELGS   I ++W
Sbjct  141   LGRTFGSGAFIWLTGNNELQMYDCERVKEARMHGIQTLVCISTSCAVVELGSSNTIDKDW  200

Query  1100  SLVQQVKSLF------------------QFPEERTISFADIGLVSGHELLQQGRSAGADD  975
             SLVQ  KSLF                  Q P     SF DIG+ S     Q+  SA    
Sbjct  201   SLVQLCKSLFGGDTACLVSKEPSHESQLQIP---NTSFLDIGMFSAS---QKDTSA----  250

Query  974   LKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRG  795
                 + +  GD +K       +++ +  S  E   +  +   L             KKRG
Sbjct  251   ----EKQNEGDKKKDPTGQGRSSSDSARSDSEGNFAAGNTDRL-------------KKRG  293

Query  794   RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
             R    G+   +N+VEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI ELK K
Sbjct  294   RAQLNGKELTLNYVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKELKAK  353

Query  614   VEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDAMIRV  456
             V+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +AMI+ 
Sbjct  354   VDELESKLQAV-SKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEAMIQF  412

Query  455   QSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
              S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  413   LSPDVNYPAARLMDALREVEFKVHHASMSSIKEVVLQDVVARVPDGLTNEE  463



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 289/477 (61%), Gaps = 71/477 (15%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ---GTKAGRGGG  1461
             Q N  +LQQRL FI++ + + WAYAIFWQ + D +G   L+W DG+     G+K      
Sbjct  18    QENTPSLQQRLHFIIQNRPEWWAYAIFWQPAKDPNGNHVLSWADGYCNKDLGSKDCNKLS  77

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQN---SENGDLITDAEWFYVMSLARSFSAG  1290
              P+           ERKKV  GI AL   +     S +GD+ T  EW+Y++S+ +SF  G
Sbjct  78    QPLF------GFDLERKKVNRGIHALFHDSSEIDGSMDGDVAT-WEWYYMVSVTKSFVVG  130

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
             DGV G+ FS G+ VWL+    LQ Y+CER  EA+++GI+TL+C+ T  GV+ELGSL++IK
Sbjct  131   DGVLGRVFSSGAFVWLTD-RELQCYDCERVTEARMNGIRTLLCVSTSCGVLELGSLDMIK  189

Query  1109  ENWSLVQQVKSLF-----------QFPEERTISFADIGLVSG-----HELLQQGRSAGAD  978
             E+W LV   KSLF           Q P+ R +S  DIG  SG     HE  QQ       
Sbjct  190   EDWGLVLLAKSLFGSKPSTQVSQIQIPD-RNLSIFDIGAASGVQRESHEGKQQ-------  241

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNA-PKK  801
               K    + AG    ++   S  + +                   EP      +N  PKK
Sbjct  242   --KDHDKKDAGTTVGRSSSDSGHSDS------------------DEPFASALTENIRPKK  281

Query  800   RGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELK  621
             RGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+ELK
Sbjct  282   RGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIHELK  341

Query  620   GKVEELECQL--QLRESKKVKVEAVGDNQstssa---------assvaSPVDVEVKIVGP  474
              K+++LE +L  ++R+ K    E + DNQST++          +S  A  ++V+VKI+G 
Sbjct  342   TKIDDLETKLREEVRKPKACLAE-MYDNQSTTTTSIVDHGRSSSSYGAIRMEVDVKIIGS  400

Query  473   DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             +AMIRVQ  + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+VV++PEGL SE+
Sbjct  401   EAMIRVQCPDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEE  457



>emb|CDP08631.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 219/456 (48%), Positives = 264/456 (58%), Gaps = 117/456 (26%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             S+LQ  LQ+IL+TQ+D WAYAI                   F+Q                
Sbjct  32    SSLQLNLQYILQTQSDCWAYAI-------------------FWQS---------------  57

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
               S  Q++            G   +      +TDAEWFYVMSLA+SF A DG PGKAFS 
Sbjct  58    --SNDQTD------------GQNDDGSVDCDVTDAEWFYVMSLAQSFFADDGAPGKAFSS  103

Query  1259  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE-NWSLVQQV  1083
             G+LVWL+G  +LQ YNC+RA+EAQIHGI+TLVCIPT  GV+ELGS  +I++ NW LVQQ 
Sbjct  104   GNLVWLTGGQQLQFYNCQRAREAQIHGIETLVCIPTAGGVLELGSNALIQDINWGLVQQA  163

Query  1082  KSLFQFPE---ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
             KSLF       E  ISFAD GLVS                                    
Sbjct  164   KSLFGPAADMLEGAISFADFGLVS------------------------------------  187

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEA  747
                    S+ ES  SDSDC  + E      Q         KKRGRK G GR TP+NHVEA
Sbjct  188   -------SFLES--SDSDCVVVVETTTRSHQVERKGGVGGKKRGRKAGTGRETPLNHVEA  238

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK-  570
             ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV+YI ELKGKV+ELE QL+  E  K 
Sbjct  239   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVAYIKELKGKVDELESQLKRIEGNKK  298

Query  569   -VKVEAVGDN-------------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYP  432
              VK+E    N              S+ S    ++S V VEVK+VG DAM+RVQS+++ YP
Sbjct  299   SVKIEVADSNGNTTDNHSTTTASSSSCSGGGGMSSNVQVEVKMVGTDAMVRVQSDSSGYP  358

Query  431   SAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             +A+LM+ +R+LEL VHHAS+S VND+MLQD+V++VP
Sbjct  359   TARLMDAIRDLELRVHHASMSHVNDLMLQDVVIRVP  394



>ref|XP_002299425.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
 gb|EEE84230.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
Length=471

 Score =   343 bits (879),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 288/482 (60%), Gaps = 79/482 (16%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K         
Sbjct  18    QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNKK--------  69

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSE-------NGDLITDAEWFYVMSLARSFSA  1293
                +  S +Q+  K    G      S  N +        GD+   AEW+Y +S+ R+F+ 
Sbjct  70    -YASKESNKQNHSK---FGFNLERKSLFNEDMDMDRLVEGDV---AEWYYTVSVTRAFAV  122

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             GDG+ G+AFS G+ +WL+G H LQ+Y+CER KEA++HGIQT VC+ T +GV+ELGS ++I
Sbjct  123   GDGILGRAFSSGAFIWLTGDHELQIYDCERVKEARMHGIQTFVCVSTPSGVLELGSPDLI  182

Query  1112  KENWSLVQQVKSLF-------------------QFPEERTISFADIGLVSGHELLQQGRS  990
              E+W LVQ  KS+F                   Q P     +F D G+ S         S
Sbjct  183   SEDWGLVQLAKSIFGADINAGSVPKQANQESQPQIPNRTVSNFLDFGMFS---------S  233

Query  989   AGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNA  810
                +    L+++   D  K+      +++ +  S  ++  ++++  F             
Sbjct  234   PQKERTTCLENQKESDTRKEPSGQGRSSSDSGRSDSDAGFTENNIGF-------------  280

Query  809   PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
              KKRGRKP +G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +YI 
Sbjct  281   -KKRGRKP-SGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATYIK  338

Query  629   ELKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDVEV  489
             ELK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V+V
Sbjct  339   ELKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEVDV  397

Query  488   KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             KI+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V +++LQD+V+ +P+GL +
Sbjct  398   KILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKELVLQDVVIIIPDGLVT  457

Query  308   ED  303
             E+
Sbjct  458   EE  459



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score =   342 bits (876),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 212/476 (45%), Positives = 285/476 (60%), Gaps = 66/476 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             +P  STLQ RLQFIL+++ + W YAIFWQ + D DGR  L+WGDG +QGTK+       V
Sbjct  17    EPPPSTLQNRLQFILQSRREWWNYAIFWQATKDADGRFVLSWGDGHYQGTKSAAN----V  72

Query  1451  VVQTSHSTQQS----ERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG  1284
              V   H+ Q S    E+ K+  GI+ L G    S  GD +T++EWFY+ S+ ++F A D 
Sbjct  73    TVTHGHTPQNSIPNIEKSKLALGIEVLFGE---SCGGD-VTESEWFYMASVTKTFEAADD  128

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +  +AFS  S VWL+G   LQ  +CER KEAQ+HGI TLV +PT  GVVELGS ++IKE+
Sbjct  129   LVFRAFSTASNVWLAGHQELQFSDCERTKEAQLHGITTLVWVPTSFGVVELGSSDLIKED  188

Query  1103  WSLVQQV-KSLFQF-------PEERTI-----SFADIGLVSGHELLQQGRSAGADDLKVL  963
             W L+Q + KSL          P++  I     S +   + S H +   G     D+ KVL
Sbjct  189   WGLMQLIGKSLLNANYGTNYDPDQAQISLSSQSPSSFNIFSTHNINHYG-----DEKKVL  243

Query  962   QSRAAGDaekqaqeasaaaaaaKNSYPESEHSD-------SDCQFLKEPPIVDRQQNAPK  804
              +   G                  S P+S +SD        D   +K  P   R +N+ +
Sbjct  244   ANNING-----------------KSSPDSGNSDVSGNPFGPDHSTIKTLPSRKRARNS-E  285

Query  803   KRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINEL  624
               GR      +TP NHVEAERQRREKLN RFYALRS+VPNVSRMDKASLL+DAV+YI EL
Sbjct  286   NVGRNQ---LMTPANHVEAERQRREKLNQRFYALRSIVPNVSRMDKASLLADAVTYIKEL  342

Query  623   KGKVEELE--CQLQ-LRESKKVKVEAVGDNQstssaassvaSP-----VDVEVKIVGPDA  468
             K K+  LE  C+++ L++  +  +  + D +ST S      S      +DVEVKI+G +A
Sbjct  343   KAKISGLEAKCRVESLKQEPRTGLLEMYDTKSTFSTVDFTRSASGCVIMDVEVKILGSEA  402

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             MIRVQS + NYP A+LMN L +LE  + HAS+SSV D+M QD++++VP+GL SE+ 
Sbjct  403   MIRVQSPDVNYPCARLMNVLGDLEFQISHASVSSVRDVMFQDVIIRVPDGLPSEEA  458



>ref|XP_004140617.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
 gb|KGN46541.1| hypothetical protein Csa_6G107910 [Cucumis sativus]
Length=431

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 197/458 (43%), Positives = 264/458 (58%), Gaps = 73/458 (16%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ                  
Sbjct  17    LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ-----------------F  59

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  1254
              +Q      ++                D  TD +WFY+MSL  SF A D +PGK+F+  S
Sbjct  60    PSQHPLSPPLLP---------------DDPTDLDWFYMMSLTSSFPAADALPGKSFTSSS  104

Query  1253  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL  1074
             +VWL+G+  L +++C R KEA+ HGIQT +C+PT  GV+EL S +II E+W L+QQ+KSL
Sbjct  105   VVWLTGSEELHLHDCHRVKEAKSHGIQTFLCVPTSYGVLELASQQIIPEDWGLIQQIKSL  164

Query  1073  FQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaK  894
             F         F +    +   L    +    +D+  +   A  + E   ++ +       
Sbjct  165   FD------SDFVNFSTTTDTPLPFLDQDFNFEDIGFISEVAEEEMETPLRKKTKTG----  214

Query  893   NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  714
                 E E SDSD   LK        +   +KRGRKP   +   +NHVEAERQRREKLN+R
Sbjct  215   ----EWELSDSDSPVLK----TGVMKKTGQKRGRKPNMSKENAMNHVEAERQRREKLNNR  266

Query  713   FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  534
             FYALRSVVPNVSRMDKASLLSDAVSYIN LK KVEE+E  LQLRESKK + E  GDNQST
Sbjct  267   FYALRSVVPNVSRMDKASLLSDAVSYINALKAKVEEME--LQLRESKKSRDEG-GDNQST  323

Query  533   ssaassvaS--------------------PVDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
             ++ +  +                        DVEVKI+G DAM+RVQS N N+PSA +M 
Sbjct  324   TTTSEELMKGNSGGGVTTPTITTTTTTMTRFDVEVKIIGRDAMVRVQSHNLNFPSAIVMG  383

Query  413   GLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
               R++E  + HASI++VNDIMLQD+++K+P G  +++ 
Sbjct  384   VFRDMEFEIQHASITNVNDIMLQDVLIKLPHGFSTDEA  421



>ref|XP_004166899.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
Length=431

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 197/458 (43%), Positives = 265/458 (58%), Gaps = 73/458 (16%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ                  
Sbjct  17    LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ-----------------F  59

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  1254
              +Q      ++                D  TD +WFY+MSL  SF A D +PGK+F+  S
Sbjct  60    PSQHPLSPPLLP---------------DDPTDLDWFYMMSLTSSFLAADALPGKSFTSSS  104

Query  1253  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL  1074
             +VWL+G+  L +++C R KEA+ HGIQT +C+PT  GV+EL S +II E+W L+QQ+KSL
Sbjct  105   VVWLTGSEELHLHDCHRVKEAKSHGIQTFLCVPTSYGVLELASQQIIPEDWGLIQQIKSL  164

Query  1073  FQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaK  894
             F         F +    +   L    +    +D+  +   A  + E   ++ +       
Sbjct  165   FD------SDFVNFSTTTDAPLPFLDQDFNFEDIGFISEVAEEEMETPLRKKTKTG----  214

Query  893   NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  714
                 E E SDSD   LK        +   +KRGRKP   +   +NHVEAERQRREKLN+R
Sbjct  215   ----EWELSDSDSPVLK----TGVMKKTGQKRGRKPNMSKENAMNHVEAERQRREKLNNR  266

Query  713   FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  534
             FYALRSVVPNVSRMDKASLLSDAVSYIN LK KVEE+E  LQLRESKK + E  GDNQST
Sbjct  267   FYALRSVVPNVSRMDKASLLSDAVSYINALKAKVEEME--LQLRESKKSRDEG-GDNQST  323

Query  533   ssaassvaS--------------------PVDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
             ++ +  +                        DVEVKI+G DAM+RVQS+N N+PSA +M 
Sbjct  324   TTTSEELMKGNSGGGVTTPTITTTTTTMTRFDVEVKIIGRDAMVRVQSQNLNFPSAIVMG  383

Query  413   GLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
               R++E  + HASI++VNDIMLQD+++K+P G  +++ 
Sbjct  384   VFRDMEFEIQHASITNVNDIMLQDVLIKLPHGFSTDEA  421



>gb|AEG74015.1| lMYC5 [Hevea brasiliensis]
Length=475

 Score =   339 bits (870),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 277/471 (59%), Gaps = 53/471 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q +  +LQQRL  IL++    W YAIFWQ S +  G L  +WGDG F+G+K       P 
Sbjct  18    QESSPSLQQRLHVILQSCPGWWIYAIFWQVSKNASGHLVFSWGDGNFRGSKEFFTK--PS  75

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAE--WFYVMSLARSFSAGDGVP  1278
                  H +  +  +K    +QAL     + +      D++  WFY  S  R+F+ G+G+ 
Sbjct  76    NTLNQHKSGFNLERKASKELQALFSDDMDMDRLADAYDSDYGWFYNASATRTFAVGEGIV  135

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+ F  G   WL+G HRLQ+Y CER KEA++HGIQTLVC+ T  GVVELGS  +I E+WS
Sbjct  136   GQTFGSGGFTWLTGDHRLQLYRCERVKEARMHGIQTLVCVSTSCGVVELGSSHMINEDWS  195

Query  1097  LVQQVKSLF------------------QFPEERTISFADIGLVSGHELLQQGRSAGADDL  972
             LVQ  KSLF                  Q P +R  SF DIG+ S  ++          D 
Sbjct  196   LVQLCKSLFGADVACLISKQLSHESQLQIP-DRGASFLDIGMFSCAQMETFPEKQNEGDK  254

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR  792
             K        DA    Q  S++ +   +S       +++ +F K              RGR
Sbjct  255   K-------RDASAFGQGRSSSDSGPSDSDVNLAAGNTNGRFKK--------------RGR  293

Query  791   KPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             KP  G+  P+NHVEAERQRR++LNHRFYALRSVVPNVS+MDKASLL+DAV+YI ELK KV
Sbjct  294   KPN-GKELPLNHVEAERQRRKRLNHRFYALRSVVPNVSKMDKASLLADAVTYIEELKAKV  352

Query  611   EELECQLQ-LRESKKVKVEAVGDNQstss-------aassvaSPVDVEVKIVGPDAMIRV  456
             +ELE +LQ + +  K+    + DNQST+        ++S     ++V+VKIVG +AM+RV
Sbjct  353   DELEAKLQAVSKQSKITSTIIYDNQSTNYMVNHLRPSSSYRDKAMEVDVKIVGSEAMVRV  412

Query  455   QSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
              S + NYP+ +LM+ LRELE  VHHAS+SS+N+++LQD+VV VPEGL SE+
Sbjct  413   HSPDVNYPAVRLMDALRELEFQVHHASVSSINEMVLQDVVVNVPEGLTSEE  463



>ref|XP_009412473.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   336 bits (861),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 204/460 (44%), Positives = 272/460 (59%), Gaps = 77/460 (17%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             +P  S LQ RLQ +L ++ + W YAIFW+ S D      LA+GDG F+G +   G  VP 
Sbjct  55    RPATSALQHRLQCLLGSRPEWWTYAIFWRASPDHH---LLAFGDGHFRGNRELDGRRVP-  110

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPG  1275
                         R     G+ A++   +   +GD   DAEWFYV+SL R F+AG+  VP 
Sbjct  111   -----------PRSGSGGGVHAVL-IDEACTDGD---DAEWFYVVSLTRCFAAGEAAVPA  155

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             + +   +LVWL+GAH LQ   C+R +EAQ+HGI+T+VC+P   GV+ELGS E++ ENW L
Sbjct  156   RVYGTLALVWLTGAHALQTCGCDRTREAQLHGIETIVCVPVAGGVLELGSSELVGENWVL  215

Query  1094  VQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
             VQQ K++F  P++     AD GL     L             V +   +G +        
Sbjct  216   VQQAKAIFSVPDDE----ADAGLAPVVTLPS----------PVSKKEVSGPSM-------  254

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRK----PGAGRVTPVNHVEA  747
                     S    + SDS+             Q     RG+K    PG+ R TPVNHVEA
Sbjct  255   --------SVDTEQFSDSEG-----------GQTVEGLRGKKRGRKPGSRRETPVNHVEA  295

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKV  567
             ERQRREKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI ELK K+E+LE   + R  K++
Sbjct  296   ERQRREKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKELKSKLEDLEADSK-RAKKEI  354

Query  566   KVEAVGDN------------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAK  423
              V    +              ++SS  ++  + ++VEVK +GPDAMIRVQ+EN ++P+AK
Sbjct  355   NVVDASNRPCGAMASSTGTATTSSSVVTAGPATMEVEVKSLGPDAMIRVQTENVSHPTAK  414

Query  422   LMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             LM  LRELEL VHHAS+SSV ++ML D+VV+VP+GL++ED
Sbjct  415   LMEVLRELELQVHHASVSSVKEVMLHDVVVRVPDGLQAED  454



>ref|XP_010556617.1| PREDICTED: transcription factor bHLH14 [Tarenaya hassleriana]
Length=439

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 219/488 (45%), Positives = 284/488 (58%), Gaps = 87/488 (18%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHS-TLQQRLQFILKTQT-DSWAYAIFWQT-SNDDDGRL  1518
             MDEL V+ SSS+S+     +P  + +LQQ+L+ +++T + D WAY IFWQ  S+D  GR 
Sbjct  1     MDELRVSPSSSTSLVTVTEEPPATGSLQQKLRSVIETSSPDRWAYVIFWQKLSDDQSGRC  60

Query  1517  FLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD  1338
             FLAWGDG F+G               +H + Q+     +    A+ G       GD + D
Sbjct  61    FLAWGDGHFRGVH-------------NHKSHQNLTNDNMECEAAVDG-------GDSVCD  100

Query  1337  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  1158
              EWFYVMSL  SF  GD  P K F+ GSL+WL+GA  L++++C+RAKEA +HG+QT V +
Sbjct  101   LEWFYVMSLTSSFHDGDESPRKDFTGGSLLWLTGADDLRLHDCDRAKEASLHGVQTFVSV  160

Query  1157  PTGAGVVELGSLEIIKENWSLVQQVKSLF-QFPEE-------------RTISFADIGLVS  1020
             P    ++ELGS + I +NWSLV  V+SLF   P E             R +SFAD+G+ +
Sbjct  161   PLRNSIIELGSPDKIPQNWSLVNLVRSLFGSDPPEIPLTKPPPLDSLGRYVSFADMGITT  220

Query  1019  GHELLQ-------QGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDS  861
                LLQ        G S G   L +                            +SE+SD 
Sbjct  221   A--LLQGQKTRTGSGPSPGRPPLLLT---------------------------DSEYSDF  251

Query  860   DCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNV  681
             D  F         Q N   KR +K G     PVNHVEAERQRR KLNHRFYALR+VVPNV
Sbjct  252   DGIF---------QGN---KRRKKLGTPAAVPVNHVEAERQRRVKLNHRFYALRAVVPNV  299

Query  680   SRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaass--vaS  507
             SRMDKASLLSDAVSYINELK ++EELE QLQ +           +NQS ++++ +  V  
Sbjct  300   SRMDKASLLSDAVSYINELKARIEELETQLQTQTQSPSCSNNNNNNQSNTTSSEAGGVIP  359

Query  506   PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  327
               +V+VK+VG +A++RVQSEN N+P+A LM  LRE+E  V HAS S VND+M+QD VV V
Sbjct  360   GAEVQVKMVGDEAVVRVQSENVNHPTAALMGALREMECRVIHASASRVNDLMVQDAVVWV  419

Query  326   PEGLRSED  303
             P GLRSED
Sbjct  420   PIGLRSED  427



>ref|XP_011022409.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=463

 Score =   330 bits (846),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 196/476 (41%), Positives = 279/476 (59%), Gaps = 73/476 (15%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q   STLQ+RLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K         
Sbjct  18    QETSSTLQKRLQFFLYSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNKK--------  69

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD--AEWFYVMSLARSFSAGDGVP  1278
                 S  + +    K    I+     T++++   L+    AEW+Y +S+ R F+ GDG+ 
Sbjct  70    --YASKDSNKQNHPKFGFNIERKSLFTEDTDMDRLVDGDVAEWYYTVSVTRVFAVGDGIL  127

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+AF+ GS +WL+G   LQ+Y CER  EA++HGIQT VC+ T +GV+ELGS   I E+WS
Sbjct  128   GRAFTSGSSIWLTGDPELQIYECERVTEARMHGIQTFVCVSTPSGVLELGSPVFISEDWS  187

Query  1097  LVQQVKSLF-------------------QFPEERTISFADIGLVSGHELLQQGRSAGADD  975
             LVQ  KS+F                   Q P     +  DIGL S     Q  R++  ++
Sbjct  188   LVQLAKSIFGAEINANPVPKQSNHESQPQIPNCNVSNLLDIGLFSSP---QTERTSSLEN  244

Query  974   LKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRG  795
              K +  +    ++    ++            ++   +   +F              KKRG
Sbjct  245   KKEVFGQGRSSSDSGRSDS------------DAGFREDHIEF--------------KKRG  278

Query  794   RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
             RKPG G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI ELK +
Sbjct  279   RKPG-GKESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVTYIKELKRR  337

Query  614   VEELECQLQLRESKKVKVEA---VGDNQstssaassvaSP--------VDVEVKIVGPDA  468
             V ELE  LQ+  SKK K+ +   + DNQSTS+  + +  P        V+V+VKI+G D 
Sbjct  338   VNELEANLQV-VSKKSKISSCANIYDNQSTSTMVNHIRPPPNYMSNNAVEVDVKILGSDG  396

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +IRVQS + NYP+A+LM+ LRELE  +HH S++ V +++LQD V+++ +GL +E+ 
Sbjct  397   LIRVQSPDINYPAARLMDTLRELEFPIHHLSVTRVKELVLQDAVIRIDDGLVTEEA  452



>ref|XP_008780029.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=440

 Score =   328 bits (841),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 211/453 (47%), Positives = 273/453 (60%), Gaps = 71/453 (16%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             PN   LQ RLQ +L    + W YAIFW+ + D      L++G+G F+GT+          
Sbjct  34    PN---LQHRLQHLLHAHPEWWVYAIFWRATPDHH---LLSFGEGHFRGTRD---------  78

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD---AEWFYVMSLARSFSAGD-GV  1281
             V   H   Q      + GIQAL+        GD+ +D   AEWFYVMSL RSF+ G+  V
Sbjct  79    VDRKHRGPQGS----VGGIQALLSDVSGPAAGDIASDGDDAEWFYVMSLTRSFAVGEPAV  134

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             P +A+     VW++GA  LQ   C+RA+EAQ+HGI+TLVCIP   GV+ELGS ++I ENW
Sbjct  135   PARAYGSLVPVWVAGADALQTCGCDRAREAQLHGIETLVCIPLSGGVLELGSNDLIWENW  194

Query  1100  SLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqe  921
              LVQQ K +   P++     A +G V     L   + AGA                    
Sbjct  195   VLVQQAKGIISAPDD-----AIVGPVVPALPLVMNKDAGAG-------------------  230

Query  920   asaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAER  741
                      +S  +SEHSD +   + E       +  PKKRGRKPG GR TPVNHVEAER
Sbjct  231   -----VTGLSSSVDSEHSDLEGALMVE-------RRRPKKRGRKPGTGRETPVNHVEAER  278

Query  740   QRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKV  561
             QRREKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE      E K+VK 
Sbjct  279   QRREKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKELRAKVEELEA-----EGKRVKK  333

Query  560   EAVGDN-------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
             E V D+        ST++   S    +++EVK +GPDA+IRV SEN N+P+AKLM  LR+
Sbjct  334   ETVVDHGVSGAAATSTTTTELSGRVTMELEVKKLGPDALIRVHSENLNHPAAKLMGVLRD  393

Query  401   LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             LE+ V+HAS+S++ ++MLQD+VV+VP  L+++D
Sbjct  394   LEVHVNHASVSTLKEVMLQDVVVRVPYALQTDD  426



>ref|XP_008374122.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=467

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 206/468 (44%), Positives = 274/468 (59%), Gaps = 50/468 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  TLQ RLQFI++ + + W Y+IFWQ S D +G ++L+W  G F+ T   R      
Sbjct  15    QENSLTLQ-RLQFIIQNRPEWWVYSIFWQASKDSNGLVYLSWAGGHFRST---RDLASKR  70

Query  1451  VVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFYVM--SLARSFSAGDG-  1284
                 ++     ERKK I   ++AL     + + GD +TDAEWFY    SL +SF+A  G 
Sbjct  71    SYNKANDFDXVERKKGIRKEVEALFYEHMDLDGGD-VTDAEWFYFYTASLTQSFTASHGN  129

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             + G  F  G  VWL+G H LQ Y CER KEA++HGI TLVCI T  GV+EL S ++IK +
Sbjct  130   ILGGTFCSGDFVWLAGDHELQFYECERVKEARMHGIHTLVCIATSCGVLELASFDVIKVD  189

Query  1103  WSLVQQVKSLFQFPEERTISFADIGLVSGHE------LLQQGRSAGADDLKVLQSRAAGD  942
             W LV+  KSLF      ++S     L S  E      LL++G  +GA+ ++        +
Sbjct  190   WGLVEMSKSLFGSKNNNSVSKQ---LCSSREDHVLVPLLERGMFSGAEQIEWTTQGGTKE  246

Query  941   aekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGA--GRV-  771
              +                      SDS   F  E    + +    KKRGR   +  GR  
Sbjct  247   VDPVTIG--------------GSXSDSVGNFTSE----NMENIRLKKRGRSSNSETGRSE  288

Query  770   TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL  591
             TP+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV+YINELK +V +LE ++
Sbjct  289   TPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVAYINELKARVVQLEAKI  348

Query  590   QLRESKKV-------KVEAVGDNQs----tssaassvaSPVDVEVKIVGPDAMIRVQSEN  444
             Q +  K V           V  +Q+    +SS  +  A  + ++VKIVG +AMIRVQ  +
Sbjct  349   QAQPGKPVVDIGGQTTCSIVDHHQTRPRQSSSYNNRAAGAMKIDVKIVGSEAMIRVQCPD  408

Query  443   ANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              +YP+A+LMN L+ LEL V+HASISSV ++MLQD+V +VP+G  SE+ 
Sbjct  409   CDYPNARLMNALKSLELQVYHASISSVKELMLQDVVARVPQGFTSEEA  456



>ref|XP_009590627.1| PREDICTED: transcription factor bHLH14-like [Nicotiana tomentosiformis]
Length=425

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 197/454 (43%), Positives = 268/454 (59%), Gaps = 65/454 (14%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +TLQ+ LQ+I+ +  + W YAIFWQ S D +GRL  +WGDG F+GTK             
Sbjct  8     NTLQKHLQYIIHSSQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTKD------------  55

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
                         +S + A +G+T+   N   I+D E FY++S+ + F A + +  +A++ 
Sbjct  56    ------------LSNL-AKVGTTKVDNN---ISDTELFYMVSVPKYFVADNELIVRAYNP  99

Query  1259  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVK  1080
              S +WL+  H LQ+YN +RAKEA +HGI+TLVCIPT +GVVELGS EII+ENW LV+  +
Sbjct  100   TSYIWLNNYHELQLYNYDRAKEAHLHGIRTLVCIPTPSGVVELGSSEIIQENWDLVRLSR  159

Query  1079  SLFQFPEERT-----ISFADI---GLVS-GHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
             SLF            I+  D+     VS G     +  S  A D K+ Q    G+     
Sbjct  160   SLFGLSNNNINTPSPINHQDLSSFNFVSLGENQKVENDSPQATDAKLRQETVIGNISLG-  218

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV----N  759
                               +SDS      E   ++   N P KR RK G+ R T      N
Sbjct  219   ------------------NSDS---IENESSTINNIINRPIKRERKAGSSRTTGTEMAKN  257

Query  758   HVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRE  579
             HVEAERQRREKLN+RFYALRSVVPNVS+MD+ASLL+DAV+YINELK KVEELE    L +
Sbjct  258   HVEAERQRREKLNNRFYALRSVVPNVSKMDRASLLADAVTYINELKAKVEELESYKILSQ  317

Query  578   SKK--VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
               K      +V    ST    ++ +  ++VEVKI+G +AM+RV+S + NYP A+LMN LR
Sbjct  318   KPKGQCATTSVQSVPSTVVNRANNSFEMEVEVKIIGLEAMVRVRSPDMNYPCARLMNVLR  377

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             ELEL V+HAS+SSV ++MLQD+V++VP  + +E+
Sbjct  378   ELELQVNHASVSSVKNLMLQDVVLRVPNEVANEE  411



>ref|XP_006352213.1| PREDICTED: transcription factor ATR2-like [Solanum tuberosum]
Length=456

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 270/464 (58%), Gaps = 56/464 (12%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK   G     
Sbjct  13    QPN--TLQKILQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTKDTIGSAKIG  70

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
               Q      Q ++K   +GI        N  N + +TD EWFY++S+ + F A D +  +
Sbjct  71    YDQY----HQLQKKFGFNGI--------NDTNNN-VTDTEWFYMVSMPQCFVAEDELVLR  117

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A++  S VWL+  + LQ+YNCERAKEA +HGI+T+VCI T +GVVELGS +II+ENW  V
Sbjct  118   AYTSASHVWLASYYELQLYNCERAKEANLHGIRTIVCISTTSGVVELGSSDIIQENWEFV  177

Query  1091  QQVKSLF----QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaq  924
             Q ++SLF           +    + L   H++ + G     +D+ V Q  A G       
Sbjct  178   QFIRSLFGSNNNMNTTSHLPVNQVTLGDHHKVAKCGSPQQEEDIIVKQEVAIG-------  230

Query  923   easaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVN----H  756
                       N   ES +SD +     +   ++   N   KR +K  +  +T       H
Sbjct  231   ----------NLLSESGNSDFEND---DSSTINNIVNRSIKRAKKGDSSNITREMAMDVH  277

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES  576
             VEAER+RREKLNHRFYALRSVVP VS+MDKASLL DAV+YINELK K++ LE +L   + 
Sbjct  278   VEAERKRREKLNHRFYALRSVVPYVSKMDKASLLGDAVTYINELKAKIKNLESKLIEPQK  337

Query  575   KKVKVE-------------AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANY  435
             K + +E               G N  +  +++   + +++EVKI+G + +IRVQS + NY
Sbjct  338   KHILMEQHDSHSASSTIVTEHGANNKSLFSSNGARNGMEIEVKIIGSEGVIRVQSLDMNY  397

Query  434   PSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             P  +LMN ++EL+  ++HASISSV D+MLQDIV++VPE   +E+
Sbjct  398   PCTRLMNAMKELKFQIYHASISSVKDLMLQDIVIRVPEEFLNEE  441



>ref|XP_010691764.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=457

 Score =   324 bits (830),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 197/457 (43%), Positives = 274/457 (60%), Gaps = 56/457 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTS--NDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             T QQ+L+F+L+ Q   W YAIFWQTS  N D+  + L WG+G F G K+           
Sbjct  22    TQQQKLEFLLQNQQQWWNYAIFWQTSTNNVDNSSISLVWGEGHFHGMKSP----------  71

Query  1442  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSF-----SAGDGVP  1278
                S++  ++  +   ++  +    +S +  ++TDAEWFY+ S  RS+     + G G P
Sbjct  72    ---SSKPKKKPNLFVQVEDELDEGVSSMDDVVVTDAEWFYMTSPPRSYPLKQRNGGSG-P  127

Query  1277  G----KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
             G    KA++ GSLVWLSGAH L++YNCERAKEA  HG+QTLVCIP   GV+ELGS+E  +
Sbjct  128   GNTLAKAYTTGSLVWLSGAHYLRLYNCERAKEAHSHGLQTLVCIPVPNGVLELGSVESFE  187

Query  1109  ENWSLVQQVKSLF---QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDa  939
             ENW+L+QQ  SLF      +   +   D G+  G  L + G   G       Q++A    
Sbjct  188   ENWALIQQAHSLFGPLSNLDHLGLDKPDFGIDRGFSLYEPGLFGGTSTTHQAQTQAQ---  244

Query  938   ekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGA---GRVT  768
                             + P+   S  D  F  + P+   +Q   +KRGR+P     G+V 
Sbjct  245   --------------TQAQPDLMSSFED--FDSDGPV--SRQRVVRKRGRRPITSREGQVV  286

Query  767   PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ  588
              +NHVEAERQRREK+N RFYALRSVVP V+RMDKASLL+DAV+YIN+LK K+  LE Q Q
Sbjct  287   TMNHVEAERQRREKMNSRFYALRSVVPTVTRMDKASLLADAVAYINDLKNKISSLELQFQ  346

Query  587   LRESKKVKVEAVG---DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  417
             +  + +  + +      N +  +   +   P+DVEV+++G +AMIRVQSEN N+PSA+LM
Sbjct  347   VTNNDRNTLMSSSSGISNTNIHNNVVNSRIPLDVEVRVLGNEAMIRVQSENVNHPSARLM  406

Query  416   NGLRELELAVHHASISSVNDIMLQDIVV-KVPEGLRS  309
             N  ++L L VHHAS+S+V  +MLQD+V+ KVP+ LRS
Sbjct  407   NVFKQLNLQVHHASVSTVEQMMLQDVVIAKVPQELRS  443



>ref|XP_008374121.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=500

 Score =   323 bits (829),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 207/473 (44%), Positives = 279/473 (59%), Gaps = 52/473 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  TLQ RLQFI++ + + W Y+IFWQ S  +   + L+W  G F+ T+         
Sbjct  40    QENSPTLQ-RLQFIVQNRPEWWVYSIFWQPSKHBSDLVSLSWAGGHFRSTRDLASKRSYH  98

Query  1451  VVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAGDG-  1284
               Q        E+K+ IS  ++AL     + + GD +TDA+WFY    SL +SF+AG G 
Sbjct  99    KHQPGFGFNVVEKKRAISREVEALFHEDVDLDGGD-VTDAQWFYFYTASLTQSFTAGHGN  157

Query  1283  --VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
               + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL++IK
Sbjct  158   SNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLELASLDVIK  217

Query  1109  ENWSLVQQVKSLFQ------FPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSR--  954
             E+W L+Q  KSLF+       P++ + S  D   VS   LL+ G  +GAD     Q R  
Sbjct  218   EDWGLLQLSKSLFESDNKNVVPKQLSSSREDQVHVS---LLESGMFSGADKEWATQGRTK  274

Query  953   -AAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG--  783
              AA      +   S  + +  N   E                 + +    KKRGR     
Sbjct  275   EAAPANVSGSSSDSGPSDSVGNLTSE-----------------NTENIRLKKRGRSSNRE  317

Query  782   AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE  606
              GR  +P+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV YIN+LK ++ +
Sbjct  318   TGRTESPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVVYINDLKARIGQ  377

Query  605   LECQLQLRESKKVKVEAVGDN-----------QstssaassvaSPVDVEVKIVGPDAMIR  459
             LE ++   + +K  V+  G             + +SS  +S A  V+++VKIVG +AMIR
Sbjct  378   LEAKIHA-QPQKPGVDIGGQTSSXVDHHQTRPRLSSSYNNSAAGAVEIDVKIVGSEAMIR  436

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             VQ  + NYP+A+LMN L++LEL V+HASISSV ++MLQD+V +VP+G  S++ 
Sbjct  437   VQCPDCNYPNARLMNALKDLELQVYHASISSVKELMLQDVVARVPKGFTSDEA  489



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score =   322 bits (826),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 275/462 (60%), Gaps = 43/462 (9%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q   STLQQRLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K         
Sbjct  18    QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNKK--------  69

Query  1451  VVQTSHSTQQSERKKVISGIQ--ALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGD  1287
                +S  + +    K    I+  +L     + E   +GD+   AEW+Y  S+ R F+ GD
Sbjct  70    --YSSKVSNKQNHPKFGFNIERKSLFNEDMDLERLVDGDV---AEWYYTASVTRVFAVGD  124

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+ G+AF+ GS +WL+G   LQ++ CER  EA++HGIQT VC+ T +GV+ELGS   I E
Sbjct  125   GILGRAFTSGSSIWLTGDRELQIFECERVTEARMHGIQTFVCVSTPSGVLELGSPVFISE  184

Query  1106  NWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
             +WSL+Q  KS+  F  E  I+   +   S HE   Q  +    +L  +   ++   E+ +
Sbjct  185   DWSLLQLAKSI--FGAE--INANPVPKQSNHESQPQISNCNVSNLLDIGLFSSPQTERTS  240

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEA  747
                +      +                +E  I        KKRGRKPG G+ +P+NHVEA
Sbjct  241   SLENKKEVFGQGRSSSDSGRSDSDAGFRENHI------GFKKRGRKPG-GKESPLNHVEA  293

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKV  567
             ERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI ELK KV ELE  LQ+  SKK 
Sbjct  294   ERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVNYIKELKRKVNELEANLQV-VSKKS  352

Query  566   KVEA---VGDNQstssaas----------svaSPVDVEVKIVGPDAMIRVQSENANYPSA  426
             K+ +   + DNQSTS++               + V+V+VKI+G + +IRVQS + NYP+A
Sbjct  353   KISSCANIYDNQSTSTSTMVNHIRPPPNYMSNNAVEVDVKILGSEGLIRVQSPDINYPAA  412

Query  425   KLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +LM+ LRELE  VHH S++ V +++LQD+V++  +GL +E+ 
Sbjct  413   RLMDALRELEFPVHHLSVTRVKELVLQDVVIRFDDGLVTEEA  454



>ref|XP_004244656.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=452

 Score =   322 bits (825),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 266/464 (57%), Gaps = 61/464 (13%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK   G     
Sbjct  14    QPN--TLQKTLQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTKDTTGS----  67

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
               +T H      +KK         G    SE  + +TD EWFY++S+ + F A D +  +
Sbjct  68    -TKTGHGQYHQFQKK--------FGFNDISETNNNVTDTEWFYMVSMPQCFVADDDLVIR  118

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A++  S VWL+  + LQ+YNCERAKEA +HGI+T+VCI T +GVVELGS ++I+ENW  V
Sbjct  119   AYTSASHVWLASYYELQIYNCERAKEANLHGIRTIVCISTTSGVVELGSSDVIQENWEFV  178

Query  1091  QQVKSLF----QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaq  924
             Q ++SLF           +    + L   H++ + G      ++ V Q    G       
Sbjct  179   QFIRSLFGSNNNMNTTSHLPVNQVTLGDDHKVAKCG-----SNIIVKQEMTIG-------  226

Query  923   easaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVN----H  756
                       N   ES  SD +     +   ++   N   KR +K  +  +        H
Sbjct  227   ----------NLLSESGISDFEND---DSLTINNVMNGSIKRAKKGDSSHIRREMAMDVH  273

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES  576
             VEAER+RREKLNHRFYALRSVVP VS+MDKASLL DAV+YINELK K++ LE +L   + 
Sbjct  274   VEAERKRREKLNHRFYALRSVVPYVSKMDKASLLGDAVTYINELKAKIKNLESKLIEPQK  333

Query  575   KKVKVEA-------------VGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANY  435
             K + +E               G N  +  +++ V + +++EVKI+G + +IRVQS + NY
Sbjct  334   KHILMEQHDSHSASSTIVTDHGANNKSLFSSNGVRNGMEIEVKIIGSEGVIRVQSLDMNY  393

Query  434   PSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             P  +LMN ++E++  ++HASISSV D+MLQDIV++VPE   +E+
Sbjct  394   PCTRLMNAMKEMKFQIYHASISSVKDLMLQDIVIRVPEEFSNEE  437



>ref|XP_009359541.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=481

 Score =   320 bits (820),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 204/470 (43%), Positives = 279/470 (59%), Gaps = 45/470 (10%)
 Frame = -2

Query  1622  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             +S  QQRLQF+L+ + + W Y+IFW+ S   +  + L+W  G FQ T+           +
Sbjct  17    NSPTQQRLQFLLQNRPERWIYSIFWEASKHSNDLVSLSWAGGHFQSTRDLTSQ--KTYNK  74

Query  1442  TSHSTQQS-----ERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAGD  1287
              SH   +      ERK+ IS  ++AL     + + GD +TDAEWFY   +SL +SF+AG 
Sbjct  75    ISHHQPKLGFDVLERKRAISREVEALFHEDMDVDGGD-VTDAEWFYFYTVSLTQSFTAGH  133

Query  1286  G---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
             G   + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL++
Sbjct  134   GNSNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLELASLDV  193

Query  1115  IKENWSLVQQVKSLFQFPEERT----ISFADIGLVSGH-ELLQQGRSAGADDLKVLQSRA  951
             IKENW LVQ  KSLF+     T    +S      +  H  LL+ G  +GAD  K   +  
Sbjct  194   IKENWGLVQLSKSLFESDNTTTTTDKVSKQLSSRLENHVPLLESGMFSGAD--KNEWATQ  251

Query  950   AGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG--AG  777
              G  E        +++ +  S      +  + + ++            KKRGR      G
Sbjct  252   GGTKEAAPVNVGGSSSDSGPSDSVGNLTSKNTENIR-----------LKKRGRSSNRETG  300

Query  776   RV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE  600
             R  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV YINELK +V +LE
Sbjct  301   RPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVYINELKARVGQLE  360

Query  599   CQLQLRESKK-----VKVEAVGDNQst-----ssaassvaSPVDVEVKIVGPDAMIRVQS  450
              ++Q +  K       +  ++ D+  T     SS  +     ++++VKIVG +AM+RVQ 
Sbjct  361   SKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAVGDMEMDVKIVGSEAMLRVQC  420

Query  449   ENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              + NYP+A+LMN L++LEL V+HASISSV ++M+QD+VV+VP G  SE+ 
Sbjct  421   PDCNYPNARLMNALKDLELQVYHASISSVKELMIQDVVVRVPHGFTSEEA  470



>ref|XP_008370020.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=481

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 207/473 (44%), Positives = 280/473 (59%), Gaps = 46/473 (10%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  TLQ RLQF+L+ + + W Y+IFW+ S   +  + L+W  G FQ T+         
Sbjct  15    QENSPTLQ-RLQFLLQNRPERWVYSIFWEASKHSNDLVSLSWAGGHFQSTRDLTSQ--KT  71

Query  1451  VVQTSHSTQQS-----ERKKVISG-IQALIGSTQNSENGDLITDAEW--FYVMSLARSFS  1296
               + SH   +      ERK+ IS  ++AL     + + GD +TDAEW  FY +SL +SF+
Sbjct  72    YNKVSHHQPKLGFDVLERKRAISREVEALFHEDMDLDGGD-VTDAEWVYFYTVSLTQSFT  130

Query  1295  AGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
             AG G   + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL S
Sbjct  131   AGQGNSNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLELAS  190

Query  1124  LEIIKENWSLVQQVKSLFQFPEERTISF-ADIGLVSGHE----LLQQGRSAGADDLKVLQ  960
             L++IKENW LVQ  KSLF+     T +      L S  E    LL+ G  +GAD  K   
Sbjct  191   LDVIKENWGLVQLSKSLFESDNTATTTNKVSKQLSSSLENHVPLLESGMFSGAD--KNEW  248

Query  959   SRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG-  783
             +   G  E        +++ +  S      +  + + ++            KKRGR    
Sbjct  249   ATQGGTKEAAPVNVGGSSSDSGPSDSVGNLTSKNIENIR-----------LKKRGRSSNR  297

Query  782   -AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  609
               GR  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV YINELK +V 
Sbjct  298   ETGRPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVYINELKARVG  357

Query  608   ELECQLQLRESKK-----VKVEAVGDNQstssaassvaS-----PVDVEVKIVGPDAMIR  459
             +LE ++Q +  K       +  ++ D+  T    SS  +      ++++VKIVG +AM+R
Sbjct  358   QLESKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAGGALEMDVKIVGSEAMLR  417

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             VQ  + +YP+A+LMN L++LEL V+HASISSV ++MLQD+VV+VP G  SE+ 
Sbjct  418   VQCPDCDYPNARLMNALKDLELQVYHASISSVKELMLQDVVVRVPHGFTSEEA  470



>ref|XP_006361006.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=407

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 197/448 (44%), Positives = 252/448 (56%), Gaps = 99/448 (22%)
 Frame = -2

Query  1613  LQQRLQFILKTQTD---SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             LQ RLQ+I K QT+    WAYAIFWQ+SN+    L L WGDG                  
Sbjct  33    LQHRLQYIFKNQTNYYSDWAYAIFWQSSNNS---LSLTWGDGHLN---------------  74

Query  1442  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
                                 + +T N        D EWFY+MSLA+ FS G+GV GK FS
Sbjct  75    --------------------MKTTNNK-------DVEWFYLMSLAQCFSVGEGVVGKCFS  107

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQ-IHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
               S VWL+G  + +  +CERAKEA  +HGI T V IP  +GV+ELGS  +IK++ +LVQQ
Sbjct  108   SDSFVWLTGDQQFEFCHCERAKEAHYVHGINTFVYIPISSGVLELGSSTVIKQDLNLVQQ  167

Query  1085  VKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaa  906
             VKSLF F  E      D GL +  E  Q G+ A   ++ V                    
Sbjct  168   VKSLF-FGYETIGPIDDFGLFNCLE--QYGQEAKKGEIVV--------------------  204

Query  905   aaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
                  + P+                V  +    KKRGRK      T  NHVEAERQRREK
Sbjct  205   ----GTTPQENK-------------VGFKSKTSKKRGRKGREICETQGNHVEAERQRREK  247

Query  725   LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ-------LRESKKV  567
             LN RFYALR VVPNV++MDKA+LLSDAV+YI +LK KV+ELE +L        + +  K+
Sbjct  248   LNSRFYALREVVPNVTKMDKATLLSDAVTYITQLKAKVDELESKLHNNYYYSVMEKKHKM  307

Query  566   KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
             + + V DNQ   S+ +S    +++EVK+VG DAM+RVQSEN NYPS +LM  L+E+EL V
Sbjct  308   ENDNVVDNQ---SSTTSWDHTMEIEVKMVGQDAMLRVQSENMNYPSTRLMCALQEVELHV  364

Query  386   HHASISSVNDIMLQDIVVKVPEGLRSED  303
             +HA+ISSVND+ML DI+VKVP+GL +ED
Sbjct  365   YHANISSVNDLMLHDILVKVPQGLETED  392



>ref|XP_009796881.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=424

 Score =   315 bits (807),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 263/456 (58%), Gaps = 70/456 (15%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +TLQ+ LQ+I+ ++ + W YAIFWQ S D +GRL  +WGDG F+GTK             
Sbjct  8     NTLQKHLQYIIHSRQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTK-------------  54

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
                        + +     I +  N+     ++D E FY++S+ + F A + +  +A++ 
Sbjct  55    ----------NLANSATVRIPNVDNN-----VSDTELFYMVSVPKYFVADNELIVRAYNP  99

Query  1259  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVK  1080
              S +WL+    LQ+YN +RAKEA +HGI+TLVCIPT  GVVELGS EII+ENW +VQ  +
Sbjct  100   TSYIWLNNYDELQLYNYDRAKEAHLHGIRTLVCIPTPNGVVELGSSEIIQENWEIVQLSR  159

Query  1079  SLFQFPEERTI-----------SFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
             SLF       +           SF  + L   H++  +  S  A D K+ Q    G+   
Sbjct  160   SLFGLSNNNIVTPSPINHQDLSSFNFVPLGENHKV--ENDSPQATDTKLKQETVDGNISL  217

Query  932   qaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV---  762
                                 +SDS   F  E   ++   N P KRGRK  +   T     
Sbjct  218   G-------------------NSDS---FENESSTIN-NINRPIKRGRKSSSSNATGTEMA  254

Query  761   -NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ--L  591
               HVEAERQRREKLN+RFYALRSVVPNVS+MD+ASLL+DAV+YINELK KVEELE    L
Sbjct  255   KKHVEAERQRREKLNNRFYALRSVVPNVSKMDRASLLADAVTYINELKAKVEELESYKIL  314

Query  590   QLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  411
               +  ++    +V    ST    ++ +  ++VEVKI+G +AM+RV+S + NYP A+LMN 
Sbjct  315   SQKPKRQCATNSVQTVPSTVLNRANNSFGMEVEVKIIGLEAMVRVRSPDVNYPCARLMNV  374

Query  410   LRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             LRELEL V+HAS+SSV ++MLQD+V+KV   + +E+
Sbjct  375   LRELELQVNHASVSSVKNLMLQDVVIKVTNEVANEE  410



>gb|KDP22548.1| hypothetical protein JCGZ_26379 [Jatropha curcas]
Length=469

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 272/470 (58%), Gaps = 65/470 (14%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA--------GRGG  1464
             S L  RLQFIL+++ + W YA+FWQ + D  G L L+W DG F G K          + G
Sbjct  22    SPLHHRLQFILQSRPECWLYAVFWQATKDATGSLVLSWADGSFHGAKEFAAKASNHNKFG  81

Query  1463  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAG-D  1287
               P   +T+      E   + S    + G      + D+I D EWFY +S+ RS++   D
Sbjct  82    FNPEKRKTTMINSNKEFPTLFSDEMDMDGLA----DVDVI-DYEWFYTVSVTRSYAVDRD  136

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYN-CERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
             G+  +AF  G+ +WL+G + LQ+Y+ C+R KEA++HGIQTLVCI T  GVVE GS  +I 
Sbjct  137   GILSRAFGSGNFIWLTGDNELQLYDYCDRVKEARMHGIQTLVCISTCNGVVEFGSSTLIN  196

Query  1109  ENWSLVQQVKSLF--------QFPEE------RTISFADIGLVSG---HELLQQGRSAGA  981
             E+WSLVQ  KSLF        Q P+        +  F DIG+ S     E  Q+ ++ G 
Sbjct  197   EDWSLVQHCKSLFGVENSHQLQIPKNGNNASPSSSCFLDIGIFSDSHQKETCQEKKNEGE  256

Query  980   DDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKK  801
               +K        D    +Q+    ++ + ++YP        C                KK
Sbjct  257   TSIK-----RKKDGVSNSQQGGRTSSDSGSTYP--------C----------------KK  287

Query  800   RGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELK  621
             R RK  AG+ T +NHVEAERQRRE+LNHRFY+LRSVVP VS+MDKASLL+DAV+YI ELK
Sbjct  288   RSRKQSAGKETHLNHVEAERQRRERLNHRFYSLRSVVPTVSKMDKASLLADAVTYIKELK  347

Query  620   GKVEELECQLQ---LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVG-PDAMIRVQ  453
              KV+ELE + Q   + ++     +    N    S +S  A  ++V+VKI+G  +AMIRV 
Sbjct  348   AKVDELETKQQAIIMSKNNNNHNKLNNGNDIFRSFSSHRAKVIEVDVKILGSSEAMIRVL  407

Query  452   SENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             S N N+P+A+LM+ LRE E  VHH S+SS+ D++LQD++V+VP+GL+ E+
Sbjct  408   SPNVNHPAARLMDALREAECQVHHGSVSSIKDMLLQDVMVRVPDGLKDEE  457



>ref|XP_004248095.1| PREDICTED: transcription factor MYC2-like [Solanum lycopersicum]
Length=393

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 199/453 (44%), Positives = 249/453 (55%), Gaps = 106/453 (23%)
 Frame = -2

Query  1613  LQQRLQFILKTQTD---SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             LQ RLQ+I+K QT+    WAY IFWQ+SN+   R  L WGDG                  
Sbjct  15    LQHRLQYIVKNQTNYCSDWAYIIFWQSSNN---RSCLTWGDGHLN---------------  56

Query  1442  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
                                 +  T N        D EWFY+MSLA+SF  G+GV GK FS
Sbjct  57    --------------------MKITNNK-------DVEWFYLMSLAQSFCVGEGVVGKCFS  89

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQ-IHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
              GSLVWL+G  + +  +CERAKEA  +HGI T VCIP  +GV+ELGS  +IK++ +LVQQ
Sbjct  90    SGSLVWLAGDQQFEFCHCERAKEAHYVHGINTFVCIPISSGVLELGSSTMIKQDLNLVQQ  149

Query  1085  VKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaa  906
             VKS+F F  E    F D GL +  EL   G  A   ++ V                    
Sbjct  150   VKSMF-FGYETIDQFDDFGLFNCLELY--GEEAKKGEVVV--------------------  186

Query  905   aaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
                  + P    +               +    KKR R+      T  NHVEAERQRREK
Sbjct  187   ----GTTPHENKAG-------------LKNKTSKKRRREICE---TQGNHVEAERQRREK  226

Query  725   LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK--------K  570
             LN RFYALR VVPNV++MDKA+LLSDAV+YI +LK KV+ELE +L              K
Sbjct  227   LNSRFYALREVVPNVTKMDKATLLSDAVTYITQLKAKVDELESKLHSNNYHYYYPEMKIK  286

Query  569   VKVEA----VGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
              K+E     V DNQS+ + +      +++EVK+VG DAMIRVQSEN NYPS +LM  L+E
Sbjct  287   HKMENHDINVVDNQSSITTSRDH--TMEIEVKMVGQDAMIRVQSENVNYPSTRLMCALQE  344

Query  401   LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             +EL V+HA+ISSVND ML DIVVKVP+GL +ED
Sbjct  345   VELHVYHANISSVNDFMLHDIVVKVPQGLETED  377



>ref|XP_006343781.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=388

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/447 (41%), Positives = 245/447 (55%), Gaps = 99/447 (22%)
 Frame = -2

Query  1610  QQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHS  1431
             Q+RL +I+  + + W YAIFWQ S D +GRL  +WGDG F+ T       V +    S+ 
Sbjct  17    QKRLHYIIHNRQEWWVYAIFWQASKDTNGRLIFSWGDGHFRDTNDLALTKVHIANADSN-  75

Query  1430  TQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSL  1251
                                         ++D E FY +S    F + D +   A++ GS 
Sbjct  76    ----------------------------VSDMEMFYAVSAPNCFVSEDDLIVHAYNSGSY  107

Query  1250  VWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF  1071
             VWL+  + LQ+YN +RAKEA +HGI+TLVCI T  GVVELGS ++I EN  LVQ +KSLF
Sbjct  108   VWLNNYYELQLYNYDRAKEAHLHGIRTLVCISTPHGVVELGSSQVIPENLELVQLIKSLF  167

Query  1070  QF-------PEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
                      P +   SF  + L  G  +LQ+  +      +++    + D          
Sbjct  168   GLSNNNNNSPSQGVSSFNFVPL--GDHILQREMNTK----EIIMGNKSSD----------  211

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG---RVTPVNHVEAER  741
                        S +SD D     E   +++  N+PKKRGRK  +    R T  NHVEAER
Sbjct  212   -----------SGNSDYD----NESSAINKDANSPKKRGRKSSSSTIERATAKNHVEAER  256

Query  740   QRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKV  561
             QRREKLNHRFYALRSVVPNVS+MDKASLL+DAV+YINELK KVEE               
Sbjct  257   QRREKLNHRFYALRSVVPNVSKMDKASLLADAVTYINELKAKVEEF--------------  302

Query  560   EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
             +A G               ++VEVKI+G +AMIRV+S N NYP A+LMN LRELE  +HH
Sbjct  303   KAYG---------------MEVEVKIIGVEAMIRVRSPNVNYPCARLMNVLRELEFQIHH  347

Query  380   ASISSVNDIMLQDIVVKVPEGLRSEDG  300
             AS+SSV ++M QD+V+K+P  + +++ 
Sbjct  348   ASVSSVKEMMQQDVVIKIPHNVTNDEA  374



>ref|XP_006362123.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=402

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 194/448 (43%), Positives = 248/448 (55%), Gaps = 104/448 (23%)
 Frame = -2

Query  1613  LQQRLQFILKTQTD---SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             LQ RLQ+I K QT+    WAYAIFWQ+SN+    L L WGDG                  
Sbjct  33    LQHRLQYIFKNQTNYYSDWAYAIFWQSSNNS---LSLTWGDGHLN---------------  74

Query  1442  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
                                 + +T N        D EWFY+MSLA+ FS G+GV GK FS
Sbjct  75    --------------------MKTTNNK-------DVEWFYLMSLAQCFSVGEGVVGKCFS  107

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQ-IHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
               S VWL+G  + +  +CERAKEA  +HGI T V IP  +GV+ELGS  +IK++ +LVQQ
Sbjct  108   SDSFVWLTGDQQFEFCHCERAKEAHYVHGINTFVYIPISSGVLELGSSTVIKQDLNLVQQ  167

Query  1085  VKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaa  906
             VKSLF                 G+E + Q      DD  +     A              
Sbjct  168   VKSLF----------------FGYETIDQ-----FDDFGLFYCLEA-----------KKG  195

Query  905   aaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
                  + P+                V  +    KKRGRK      T  NHVEAERQRREK
Sbjct  196   EIVVGTTPQENK-------------VGFKSKTSKKRGRKGREICETQGNHVEAERQRREK  242

Query  725   LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL-------QLRESKKV  567
             LN RFYALR VVPNV++MDKA+LLSDAV+YI +LK KV+ELE +L       + ++  K+
Sbjct  243   LNSRFYALREVVPNVTKMDKATLLSDAVTYITQLKAKVDELESKLHNNYYYSEHKKKHKM  302

Query  566   KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
             + + V DNQ   S+ +S    +++EVK+VG DAMIRVQSEN NYPS +LM  L+E+EL V
Sbjct  303   ENDNVVDNQ---SSTTSWDHTMEIEVKMVGQDAMIRVQSENVNYPSTRLMCALQEVELHV  359

Query  386   HHASISSVNDIMLQDIVVKVPEGLRSED  303
             +HA+ISSVND+ML DI+VKVP+GL +ED
Sbjct  360   YHANISSVNDLMLHDILVKVPQGLETED  387



>ref|XP_010940945.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=448

 Score =   310 bits (795),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 277/457 (61%), Gaps = 77/457 (17%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQ RLQ++L  +++ WAYAIFW+ + D      L++G+G F+G +            T  
Sbjct  38    LQHRLQYLLHARSEWWAYAIFWRAAPDHH---LLSFGEGHFRGVR-----------DTGP  83

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGD-GVPGKAFSMG  1257
                         GI AL+       +GD   +AEWFYV+SL+RSF AGD  VP +A+   
Sbjct  84    RGSCGGGGGGGGGIHALLSDDAGPTDGD---EAEWFYVVSLSRSFVAGDPAVPARAYGSL  140

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             + VWL+GAH LQ   C+RA+EAQ+HGI+TLVC+P   GV+ELGS +II ENW+LVQQ ++
Sbjct  141   APVWLTGAHALQSCGCDRAREAQLHGIETLVCVPLPGGVLELGSSDIIGENWALVQQARA  200

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             +   P++  +  A   L     ++++   AG   L                         
Sbjct  201   ILSAPDDAIVGPAVPALPP---VVKKEAGAGVTGL-------------------------  232

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  717
              +S  +SEHSDS+   + E       +  PKKRGRKPG GR TPVNHVEAERQRREKLNH
Sbjct  233   -SSSVDSEHSDSEGLLMME-------RRRPKKRGRKPGTGRETPVNHVEAERQRREKLNH  284

Query  716   RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQs  537
             RFYALRSVVPNVSRMDKASLL+DAV+YI EL+ KV+ELE      E+K+VK E + D   
Sbjct  285   RFYALRSVVPNVSRMDKASLLADAVAYIKELRAKVDELET-----EAKRVKKEVIVDQGV  339

Query  536   tssaassva------------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  411
               +A ++                    + +++EVK++GPDA+IRV SEN ++P+AKLM+ 
Sbjct  340   GGAATTTTTTTTTTTMSSVVSCGGGGPATMELEVKMLGPDALIRVHSENLSHPTAKLMSA  399

Query  410   LRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             LR+LE+ VHHAS+SSV ++M+QD+VV+VP  L+  DG
Sbjct  400   LRDLEVHVHHASVSSVKEVMVQDVVVRVPYALQFSDG  436



>ref|XP_008346662.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=475

 Score =   311 bits (796),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 273/471 (58%), Gaps = 48/471 (10%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             Q N  TLQ RLQFI++ +   W Y+IFWQ +S D D  + L+W  G F+ T   R     
Sbjct  15    QENSPTLQ-RLQFIIQNRPVRWVYSIFWQASSKDSDDLVSLSWAGGHFRST---RDLASI  70

Query  1454  VVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFYVM--SLARSFSAGDG  1284
                  ++  +  ERKK IS  ++AL     + + GD +TDAEWFY    SL +SF+AG G
Sbjct  71    QSYNKANVFEVVERKKGISREVEALFYEGMDLDGGD-VTDAEWFYFYTDSLTQSFTAGHG  129

Query  1283  ---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
                + G+ F  G  VWL+G H LQ Y CER K+A++HGIQTLVCI T  GVVEL SL+ I
Sbjct  130   NSNILGRTFCSGGFVWLAGDHELQFYECERVKKARMHGIQTLVCIATSCGVVELASLDAI  189

Query  1112  KENWSLVQQVKSLF-------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSR  954
             K +W LVQ  KSLF          ++ + S  D  LV    LL+ G  +GA      + R
Sbjct  190   KVDWDLVQISKSLFGSKNNNNMVSKQLSSSREDHVLVP---LLESGMFSGA------EQR  240

Query  953   AAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGR  774
                      +        + +S P     +   + ++   +  R +++ ++ GR      
Sbjct  241   DWTTQGGTKEVPPVTMGGSSDSGPSDSVGNFTSENMENIRLKKRGRSSNREXGRSE----  296

Query  773   VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ  594
              TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV YINELK +VE+LE +
Sbjct  297   -TPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVYINELKARVEQLEAK  355

Query  593   LQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVKIVGPDAMIRVQ  453
             +Q +  K V    +G   ++S        P             +++E KIVG +AMIRVQ
Sbjct  356   IQAQHLKPVV--DIGGQTTSSIIDPHQTRPRLSSSYNNRAAGAMEIEXKIVGSEAMIRVQ  413

Query  452   SENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
               + +YP+A+LMN L++LEL V+HASISSV  +MLQD+V +VP+G  SE+ 
Sbjct  414   CPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDVVARVPQGFTSEEA  464



>ref|XP_009418327.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 203/481 (42%), Positives = 271/481 (56%), Gaps = 94/481 (20%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             MDELI++ SSSSS      QP  + LQ RLQ +L  + + WAYAIFW+ S D      L+
Sbjct  1     MDELIISPSSSSSCLH---QPTATALQHRLQRLLDARPEWWAYAIFWRASPD---HRLLS  54

Query  1508  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG-DLITDAE  1332
             + DG F+G +                                  S  +  +G D + DAE
Sbjct  55    FADGHFRGAR----------------------------------SVADRRSGADAVDDAE  80

Query  1331  WFYVMSLARSFS-AGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQT  1170
             WFY +SL+RSF  AGD      VP + +S  + VWL+GAH LQ   C+R +EAQ+HGI+T
Sbjct  81    WFYAVSLSRSFVVAGDATAVAAVPARVYSSLAPVWLAGAHALQACGCDRTREAQLHGIET  140

Query  1169  LVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQ-FPEERTISFADIGLVSGHELLQQGR  993
             L C+    GV+ELGS +II ENW ++QQ K++F   P        D  L +G        
Sbjct  141   LACVQVPGGVLELGSTDIIGENWVVMQQAKAVFSTLPH-------DAALATG-----TAP  188

Query  992   SAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQN  813
             +        ++   AG                 +S  +S HSDSD     E         
Sbjct  189   TIATAPSPAVRKDGAG----------------HSSSVDSGHSDSDGGLTVE-------HR  225

Query  812   APKKRGRKPGAG-RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
              PKKRGRK  +G R  P +HVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL+DAV+Y
Sbjct  226   RPKKRGRKTVSGTREAPASHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLADAVAY  285

Query  635   INELKGKVEELECQLQLRESKKVKVEAVGDNQs---------tssaassvaSPVDVEVKI  483
             I ELK KV++LE + +    K++ VE    + +         T+SA +   + ++VEVK+
Sbjct  286   IQELKAKVDKLEAEGK-PAMKEITVEQTAGHSADAGAATSSTTTSATTLTKAAMEVEVKL  344

Query  482   VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             +G +A+IRVQSE+  +PSA+LM  LR+LEL VHHAS+SS+  ++LQD+V KVP  L+ ED
Sbjct  345   LGAEALIRVQSEDRGHPSARLMAALRDLELRVHHASVSSLEQVVLQDVVAKVPTELQRED  404

Query  302   G  300
             G
Sbjct  405   G  405



>ref|XP_008245390.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=483

 Score =   310 bits (793),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 195/476 (41%), Positives = 271/476 (57%), Gaps = 50/476 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q N S  Q+RLQFI + + + W Y+IFWQ SND + ++ L+W  G F+  +     +   
Sbjct  15    QENSSIFQKRLQFIFQNRPEWWLYSIFWQASNDSNDQVSLSWAGGDFRINRDLATKKSNK  74

Query  1460  VPVVVQTSHSTQQSERKKVIS-GIQALIGSTQNS----ENGDLITDAEWFYV--MSLARS  1302
             V             ER+KV++  ++ L           ++GD +TD+EWFY   +SL ++
Sbjct  75    VVNNYNPKFGFNSVERRKVVNKDVEDLFHEDMVDLAMVDHGD-VTDSEWFYFYSVSLTQT  133

Query  1301  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  1131
             F+AG   + V G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  134   FAAGHATNNVLGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCGVLEL  193

Query  1130  GSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGH---ELLQQGRSAGADDLKVLQ  960
              SL++IKE+W LV   KSLF       +S    G   G+    LL+ G  +GA      Q
Sbjct  194   ASLDVIKEDWGLVHLSKSLFGSDNNNKVS--QEGSCEGNALVHLLENGVFSGAQREMTRQ  251

Query  959   --SRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
               ++ A           + + +  N   E+                + +    ++     
Sbjct  252   GGTKEAAHINICDSSPDSPSDSVGNFTSEN--------------TANTRSKKKRRSSSTN  297

Query  785   GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  609
             GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAVSYIN+LK KVE
Sbjct  298   GASRASQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVSYINQLKAKVE  357

Query  608   ELECQLQLRESKKVKVEAVGD-------------NQstssaassvaSPVDVEVKIVGPDA  468
             ELE ++Q  + K  KV                  N   SS ++   +P++V+VKI+G DA
Sbjct  358   ELEAKVQ-EQPKNPKVSNASSLDHQSSQSTSSIANHPHSSYSNRSVAPLEVDVKILGSDA  416

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             MIRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V +VP G  SE+ 
Sbjct  417   MIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARVPYGFTSEEA  472



>ref|XP_009765330.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=423

 Score =   307 bits (787),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 184/454 (41%), Positives = 254/454 (56%), Gaps = 81/454 (18%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             QPN   LQ+ LQ+I+ ++ + W Y+IFWQ + D + R  L+WGD  F+GTK         
Sbjct  13    QPN--ALQKILQYIVHSRQEWWVYSIFWQATKDVNNRFILSWGDAHFRGTKDISSA----  66

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
               +T H  Q+              G   N      +TD+EWFY++S+ + F A D +  +
Sbjct  67    --KTGHQLQKK------------FGFETN------VTDSEWFYMVSMPQCFVAEDELVVR  106

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A+S  + VWL+  + LQ+YNCERAKEA  HGI+TLVCI T  GVVELGS ++I+ENW  V
Sbjct  107   AYSSATHVWLASHYELQLYNCERAKEADSHGIRTLVCIATPCGVVELGSSDVIQENWEFV  166

Query  1091  QQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
             Q ++SLF        S   I  V+               L+  Q    G           
Sbjct  167   QLIRSLFGSNNNNITSHLPINQVT---------------LRDHQKERDGS----------  201

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRV------TPVNHVE  750
                      P+ E      + + E  I     N  + R RK  +  +        +NHVE
Sbjct  202   ---------PQQEPDKRKQEIVTETAI----NNINRSRKRKADSSSIITGRSEMAMNHVE  248

Query  749   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK  570
             AER RREKLNHRFYALRSVVP VS+MDKASLL+DAV+YI ELK KVE+LE ++Q ++ K 
Sbjct  249   AERIRREKLNHRFYALRSVVPYVSKMDKASLLADAVTYIKELKAKVEDLESKIQSQKPKN  308

Query  569   VKVE---------AVGD--NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAK  423
               +E         AV D  N  + S+++   + +++EVKI+G +AMIRVQS + NYP A+
Sbjct  309   NLMEQHDSHSASSAVFDPANNKSFSSSNGGRNGMEIEVKIIGTEAMIRVQSLDVNYPCAR  368

Query  422   LMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  321
             LMN  RE+E  ++HAS+SS  D+MLQDIV++VP+
Sbjct  369   LMNVFREMEFQIYHASVSSFKDLMLQDIVIRVPD  402



>ref|XP_009360190.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=468

 Score =   307 bits (787),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 204/475 (43%), Positives = 273/475 (57%), Gaps = 63/475 (13%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT------KAG  1473
             Q N  TLQ RLQFI++ + + W Y+IFWQ S+ D   L  L+W  G F+ T      ++ 
Sbjct  15    QENSLTLQ-RLQFIIQNRPEQWVYSIFWQASSKDSNDLVSLSWAGGHFRSTGDLASKQSY  73

Query  1472  RGGGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARS  1302
                 V  VV         +RK  IS  ++AL     + + GD +TDAEWFY    SL +S
Sbjct  74    NKANVFDVV---------DRKNGISREVEALFYEDMDLDGGD-VTDAEWFYFYTASLTQS  123

Query  1301  FSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
             F+AG G + G+ F  G  VWL+G H LQ Y CER KEA++HGI TLVCI T  GV+EL S
Sbjct  124   FTAGHGNILGRTFCSGDFVWLAGDHELQFYECERVKEARMHGIHTLVCIATSCGVLELAS  183

Query  1124  LEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHE------LLQQGRSAGADDLKVL  963
             L+ IK +W LVQ  KSLF       +S     L S  E      LL+ G  +GA+ ++  
Sbjct  184   LDAIKVDWGLVQISKSLFGSKNNNMVSKQ---LSSSREDHVLVPLLESGMFSGAEQIEGT  240

Query  962   QSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG  783
                   + +                      SDS   F  E    + +    KKRGR   
Sbjct  241   TQGGTKEVDPVTIG--------------GSPSDSVGNFTSE----NMENIRLKKRGRSSN  282

Query  782   A--GRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             +  GR  TP+NHVEAERQRR+KLN RFYALR+VVPNVSRMDKASLLSDAV YINELK +V
Sbjct  283   SETGRSETPINHVEAERQRRDKLNRRFYALRAVVPNVSRMDKASLLSDAVIYINELKARV  342

Query  611   EELECQLQLRESKKV------KVEAVGDN-----QstssaassvaSPVDVEVKIVGPDAM  465
              +LE ++Q +  K V         ++ D+     Q +S+  +  A  + ++VKI+G +AM
Sbjct  343   VQLEAKIQAQPGKPVVDIGGQTTTSIVDHHQTRPQQSSNYNNKAAGAMKIDVKILGSEAM  402

Query  464   IRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             IRVQ  + +YP+A+LMN L++LEL V+HAS+SSV + MLQD+V +VP+G  SE+ 
Sbjct  403   IRVQCPDCDYPNARLMNVLKDLELQVYHASLSSVKEWMLQDVVGRVPQGFTSEEA  457



>ref|XP_008245386.1| PREDICTED: transcription factor bHLH14-like [Prunus mume]
Length=495

 Score =   308 bits (788),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 201/499 (40%), Positives = 280/499 (56%), Gaps = 84/499 (17%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q   +T QQRLQFI++ + + W YAIFWQ S D + ++ L+W  G F+ +K   + R   
Sbjct  15    QETAATCQQRLQFIVQNRPEWWVYAIFWQASKDSNDQISLSWAGGHFKSSKDLASKRSNK  74

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFYV--MS  1314
             V    Q        +RKKVI+   A     ++ E+ D+         +TD+EWFY   +S
Sbjct  75    VMNNYQPKFGFNNVQRKKVINRGCAESLFHEDLEDLDMRLVDHGVGDVTDSEWFYFYSVS  134

Query  1313  LARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  1143
             L +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  G
Sbjct  135   LTQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCG  194

Query  1142  VVELGSLEIIKENWSLVQQVKSLFQFPEERT-----------ISFADIGLVSGHEL---L  1005
             V+EL SL++IKE+W LV   KSLF     R            + F + G+ SG +     
Sbjct  195   VLELASLDVIKEDWGLVHLSKSLFGSDNNRISKQGSRDGNAPVPFPESGMFSGPQKDFPR  254

Query  1004  QQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVD  825
             Q+G +  A  + +      G +   +   S     ++N+                     
Sbjct  255   QEGDTKEAAPINI------GGSSSDSPSDSVGNFTSENT---------------------  287

Query  824   RQQNAPKKRGRKP--GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  654
              ++   KKRGR    G GR + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL
Sbjct  288   -ERTRLKKRGRSTNHGPGRESQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLL  346

Query  653   SDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP----------  504
             +DAV+YIN+LK KVEELE ++Q  +++  K+  V +    SS ++S              
Sbjct  347   ADAVAYINQLKSKVEELEAKIQ-SQTQNPKMGNVSNLDHHSSQSTSSIVDFHHSSNNNNN  405

Query  503   -----------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  357
                        V+V+VKI+G +AMIRVQ  + +YP AKLMN L+ L L ++HASISSV +
Sbjct  406   NNNNNNNRAGVVEVDVKILGSEAMIRVQCPDQDYPYAKLMNALKSLGLQIYHASISSVKE  465

Query  356   IMLQDIVVKVPEGLRSEDG  300
             +M+QDIV +VP G  SE+ 
Sbjct  466   MMIQDIVARVPYGFSSEEA  484



>ref|XP_008245388.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=493

 Score =   306 bits (783),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 192/479 (40%), Positives = 279/479 (58%), Gaps = 55/479 (11%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  1455
             N +T QQRLQFI++ + + WAY+IFWQ S D + ++ L+W  G F+ ++     R   + 
Sbjct  17    NSATFQQRLQFIVQNRPEWWAYSIFWQASKDSNDQVVLSWAGGHFKSSRDFAFKRSNKMT  76

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFY--VMSLA  1308
                Q        ERKKV +    ++   ++  + D+         +TD+EWFY   +SL 
Sbjct  77    NNYQPKFGFSNVERKKVNNREVEVLFDEEDMVDLDMSLVDHGVGDVTDSEWFYFYTVSLT  136

Query  1307  RSFSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVV  1137
             +SF+AG G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVC+ T  GV+
Sbjct  137   QSFAAGHGNNSILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCVATPCGVL  196

Query  1136  ELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELL----QQGRSAGADDLK  969
             EL SL +IKE+W LVQ  KSLF+    R    +  G   G+ L+     +  S G  DL 
Sbjct  197   ELASLYVIKEDWGLVQLSKSLFESDNNRV---SKQGSHDGNVLVSLLENEMFSGGQKDL-  252

Query  968   VLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRK  789
               Q +  G  ++        +++   S      + ++ + ++            KKRGR 
Sbjct  253   TRQGKQQGGVKEATPVNIGGSSSDSPSDSVGNFTSANAKNIR-----------LKKRGRS  301

Query  788   P--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
                G G+ +   HV+AERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK K
Sbjct  302   SNHGTGKESST-HVKAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKEK  360

Query  614   VEELECQLQLR-ESKKV---------------KVEAVGDNQstssaassvaSPVDVEVKI  483
             VEELE ++Q + ++ KV                  ++ D++S+S   +   + ++V+VKI
Sbjct  361   VEELEAKIQAQTQNPKVGHVSNLDHYHHHSSQSTGSIVDHRSSSYNINKAGAALEVDVKI  420

Query  482   VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             +G +AMIRVQ  + +YP AKLMN L+ L   V+HASISSV ++M+QD+V +VP G  SE
Sbjct  421   LGSEAMIRVQCPDQDYPYAKLMNALKALGFQVYHASISSVKELMIQDVVARVPYGFNSE  479



>ref|XP_007210206.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
 gb|EMJ11405.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
Length=459

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 267/473 (56%), Gaps = 68/473 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  T QQRLQFI + + + W Y IFWQ+S D + ++ L+W  G F+   +        
Sbjct  15    QENLGTFQQRLQFIFQNRPEWWLYWIFWQSSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  1451  VVQTSHSTQQSERKKVIS--GIQALIGSTQNSENGDL---------ITDAEWFYV--MSL  1311
              V  +H  +    KKV S    +AL     + +  DL         +T++EWFY   +SL
Sbjct  74    KVSNNHQPKFGFNKKVTSREAEEALF----DEDMADLEMRLVDHEDVTESEWFYFYSVSL  129

Query  1310  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  1140
              +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV
Sbjct  130   TQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCGV  189

Query  1139  VELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQ  960
             +EL SL++IKE+W  V   KSLF                + + + QQ  S G  +     
Sbjct  190   LELASLDVIKEDWGFVHLSKSLF----------GSDNNNNNNRVSQQKGSPGTKEAAPFN  239

Query  959   SRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGA  780
                                    S PES  S S   F  E     R +   ++R    GA
Sbjct  240   --------------------IGGSSPES-LSGSVGNFTCENTGNTRSK--KRRRSSNNGA  276

Query  779   GRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL  603
              R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK KVEEL
Sbjct  277   SRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAYINQLKAKVEEL  336

Query  602   E--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVEVKIVGPDAMIR  459
             E   Q Q +  KKV V  + DNQ + S +S          +   PV+V+VKI+G +A+IR
Sbjct  337   ELKTQAQPQNPKKVSVNNL-DNQCSQSTSSIVDHHSSYNNTKVVPVEVDVKIMGSEAIIR  395

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             VQ ++ +YP A+LMN L+ L L V+HASISSV ++M+QD+V +VP G  SE+ 
Sbjct  396   VQCQDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARVPYGFTSEEA  448



>ref|XP_008810069.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=434

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 266/457 (58%), Gaps = 80/457 (18%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             PN+   QQRLQ++L  + + WAY IFW+ S D      L++G+G F+G +          
Sbjct  32    PNY---QQRLQYLLHARPEWWAYGIFWRASPDHH---LLSFGEGHFRGVR----------  75

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGD-GVPGK  1272
                            + GI AL+       +GD   +AEWFYV+SL RSF+AGD   P +
Sbjct  76    ------DNGPRGSGGVGGIHALLSDDAGPADGD---EAEWFYVVSLTRSFAAGDPAAPAR  126

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A+   + +WL+GAH LQ   C+RA EAQ+HGI+TLVC+P   GV+ELGS E+I ENW+LV
Sbjct  127   AYGSLAPLWLTGAHALQTCGCDRALEAQLHGIETLVCVPLPGGVLELGSSELIGENWALV  186

Query  1091  QQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
             QQ + +   P++   +     + +   ++++   AG   L                    
Sbjct  187   QQARVILSTPDD---AIVGPVVPALPPVVKKEAGAGITGL--------------------  223

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRR  732
                   +S  +SEHSDS+   + E     ++   P         GR TPVNHVEAERQRR
Sbjct  224   ------SSSVDSEHSDSEGLLMVERRRPKKRGRKPGT-------GRETPVNHVEAERQRR  270

Query  731   EKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV  552
             EKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE      E+K+VK E +
Sbjct  271   EKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKELRTKVEELEA-----EAKRVKKEII  325

Query  551   GDNQstssaassva-------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  411
              D     +A ++               + +++EVK++GPDA+IRV SEN ++P+AKLM  
Sbjct  326   VDQGVGGAATTTSTTVSSVVSCGGGGLATMELEVKMLGPDALIRVHSENLSHPTAKLMGA  385

Query  410   LRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             LRELE+ VHHAS+S+V ++ +QD+VV+VP  L+  DG
Sbjct  386   LRELEVHVHHASVSTVKEVTVQDVVVRVPYALQVNDG  422



>ref|XP_008238755.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=483

 Score =   304 bits (779),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 208/477 (44%), Positives = 285/477 (60%), Gaps = 52/477 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+   +        
Sbjct  15    QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  1451  VVQTSHSTQQSERKKV--ISGIQALIGS------TQNSENGDLITDAEWFYV--MSLARS  1302
              V  +H  +    KKV  I   +AL+         +  ++GD +T +EWFY   +SL +S
Sbjct  74    KVTNNHQPKFGFNKKVTSIEAEEALLDEDMVDLEMRLVDHGD-VTGSEWFYFYSVSLTQS  132

Query  1301  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  1131
             F+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  133   FAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPYGVLEL  192

Query  1130  GSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLK-VLQSR  954
              SL++IKE+W  V   KSLF       +S  D    + + + QQ  S   + L  +L++R
Sbjct  193   ASLDVIKEDWGFVHLSKSLF-------VSDND----NNNRVSQQNGSRKGNVLAPLLENR  241

Query  953   A-AGDaekqaqeasaaaaaaKN---SYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
               +G  +K  ++A    AA  N   S PES  S S   F  E    + +    KKR R  
Sbjct  242   IFSGSQKKLTRQAGTKEAAPFNIGGSSPES-LSGSVGNFTCE----NTENTRSKKRSRSS  296

Query  785   --GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
               GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK K
Sbjct  297   NNGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAYINQLKAK  356

Query  614   VEELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVEVKIVGPD  471
             VEELE   Q Q +  ++V V  + DNQ + S  S          +   PV+V+VKI+G +
Sbjct  357   VEELELKTQAQPQNPQRVSVNNL-DNQCSQSTNSIVDHHSSYNNTKVVPVEVDVKIMGSE  415

Query  470   AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             A+IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V ++P G  SE+ 
Sbjct  416   AIIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARMPYGFTSEEA  472



>ref|XP_008238754.1| PREDICTED: transcription factor MYC4-like isoform X1 [Prunus 
mume]
Length=484

 Score =   303 bits (776),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 278/476 (58%), Gaps = 49/476 (10%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+   +        
Sbjct  15    QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  1451  VVQTSHSTQQSERKKV--ISGIQALIGS------TQNSENGDLITDAEWFYV--MSLARS  1302
              V  +H  +    KKV  I   +AL+         +  ++GD +T +EWFY   +SL +S
Sbjct  74    KVTNNHQPKFGFNKKVTSIEAEEALLDEDMVDLEMRLVDHGD-VTGSEWFYFYSVSLTQS  132

Query  1301  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  1131
             F+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  133   FAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPYGVLEL  192

Query  1130  GSLEIIKENWSLVQQVKSLFQFPEERTISFAD-IGLVSGH---ELLQQGRSAGADDLKVL  963
              SL++IKE+W  V   KSLF    +     +   G   G+    LL+    +G+   K L
Sbjct  193   ASLDVIKEDWGFVHLSKSLFVSDNDNNNRVSQQNGSRKGNVLAPLLENRIFSGSQ--KKL  250

Query  962   QSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP-  786
               +AAG          AA      S PES  S S   F  E    + +    KKR R   
Sbjct  251   TRQAAG-------TKEAAPFNIGGSSPES-LSGSVGNFTCE----NTENTRSKKRSRSSN  298

Query  785   -GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
              GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK KV
Sbjct  299   NGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAYINQLKAKV  358

Query  611   EELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVEVKIVGPDA  468
             EELE   Q Q +  ++V V  + DNQ + S  S          +   PV+V+VKI+G +A
Sbjct  359   EELELKTQAQPQNPQRVSVNNL-DNQCSQSTNSIVDHHSSYNNTKVVPVEVDVKIMGSEA  417

Query  467   MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V ++P G  SE+ 
Sbjct  418   IIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARMPYGFTSEEA  473



>ref|XP_007208833.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
 gb|EMJ10032.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
Length=474

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 192/486 (40%), Positives = 270/486 (56%), Gaps = 79/486 (16%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q   +T QQRLQFI++ + + W YA FWQ S D + ++ L+W  G F+ +K   + R   
Sbjct  15    QETSATCQQRLQFIVQNRPEWWVYATFWQASKDSNDQISLSWAGGHFKSSKDLASKRSNK  74

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFYV--MS  1314
             V    Q        ERKKVI+   A     ++ E+ D+         +TD+EWFY   +S
Sbjct  75    VMNNYQPKFGFNNVERKKVINRGCAESLFPEDLEDLDMRLVDHGVGDVTDSEWFYFYSVS  134

Query  1313  LARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  1143
             L +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  G
Sbjct  135   LTQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCG  194

Query  1142  VVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVL  963
             V+EL SL++IKE+W LV   KSLF                            G+++ ++ 
Sbjct  195   VLELASLDVIKEDWGLVHLSKSLF----------------------------GSENNRIS  226

Query  962   QSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPG  783
             +  + GD ++ A      +++   S      +  + +         R +   + R    G
Sbjct  227   KQGSQGDTKEAAPINIGGSSSDSPSDSVGNFTSENTE---------RTRLKKRGRSTNHG  277

Query  782   AGRVTP-VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE  606
              GR +  +NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK KVEE
Sbjct  278   PGRESQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKSKVEE  337

Query  605   LECQLQ-------------LRESKKVKVEAVGDNQstssaassvaSP-----------VD  498
             LE ++Q             L         ++ D   +SS  ++  +            V+
Sbjct  338   LEAKIQSQPQNPNMGNVSNLDHHSSQSTSSIVDFHHSSSNNNNNNNNNNNNNNKGAGVVE  397

Query  497   VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  318
             V+VKI+G +AMIRVQ  + +YP AKLMN L+ L L V+HASISSV ++M+QDIV +VP G
Sbjct  398   VDVKILGSEAMIRVQCPDQDYPYAKLMNALKSLGLQVYHASISSVKEMMIQDIVARVPYG  457

Query  317   LRSEDG  300
               SE+ 
Sbjct  458   FTSEEA  463



>ref|XP_004246085.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=387

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/445 (39%), Positives = 241/445 (54%), Gaps = 93/445 (21%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQ+RL +I+  + + W Y IFWQ S D +GRL  +WGDG F+                  
Sbjct  17    LQKRLHYIIHNRQEWWVYGIFWQASKDANGRLIFSWGDGHFRDLA---------------  61

Query  1433  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  1254
                              +    N+     ++D E FY +S    F + D +   A++ GS
Sbjct  62    -----------------LAKVHNAN----VSDMEMFYAVSAPNCFLSEDDLIVHAYNSGS  100

Query  1253  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSL  1074
              VWL+  + LQ+YN +RAKEA +HGI+TL+CI T  GVVELGS ++I+EN  LVQ +KSL
Sbjct  101   YVWLNNYYELQIYNYDRAKEAHLHGIRTLLCISTPHGVVELGSSQVIQENLELVQLIKSL  160

Query  1073  FQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaK  894
             F    +   +F  +G     + +  G  +G  D                           
Sbjct  161   FGQINDHGFNFVPLGDPMDTKTITMGSDSGNSD---------------------------  193

Query  893   NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  714
                 ES   + D               +PKKR RK    +    NHVEAERQRREKLNHR
Sbjct  194   ----ESSAMNKD---------------SPKKRARKSTTAK----NHVEAERQRREKLNHR  230

Query  713   FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVK------VEAV  552
             FYALRSVVPNVS+MDKASLL+DAV+YINELK KVEEL+ ++++   K ++        AV
Sbjct  231   FYALRSVVPNVSKMDKASLLADAVTYINELKAKVEELKAKIEVSTKKLIQKRNCVSSSAV  290

Query  551   GD-NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
              D      +  SS    ++VEVKI+G +AMIRV+S N NYP A+LMN LRELE  +HHA+
Sbjct  291   VDGTNINININSSFVDGMEVEVKIIGVEAMIRVRSPNVNYPCARLMNVLRELEFQIHHAT  350

Query  374   ISSVNDIMLQDIVVKVPEGLRSEDG  300
             +SS+ ++M QD+V++VP  + +E+ 
Sbjct  351   VSSMKEMMQQDVVIRVPHNVTNEEA  375



>ref|XP_008238769.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=485

 Score =   300 bits (769),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 201/483 (42%), Positives = 274/483 (57%), Gaps = 71/483 (15%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N +  QQRLQF+++++ + W Y+IFW+ S D +G++ L+WG G FQ  +        +  
Sbjct  17    NPAIFQQRLQFLVQSRPECWVYSIFWRASKDSNGQVALSWGAGDFQIDR-------DLTS  69

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSE----------------NGDLITDAEWFYV--  1320
             +T++    + + K+  G+   + S +  E                +GD +T +EWFY   
Sbjct  70    KTTNKVTNNYQPKI--GLTKKVTSREAEEALFHEDMVDLEMRLVDHGD-VTGSEWFYFYS  126

Query  1319  MSLARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             +SL +SF+AG   + + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T 
Sbjct  127   VSLTQSFAAGHATNNILGRAFCSGGFVWLAGVHELQFYECERVKEARMHGIQTLVCIATS  186

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHEL---LQQGRSAGAD  978
              GV+EL S+++IKE+W LV    SLF     R    +  G   G  L   L+ G   G  
Sbjct  187   CGVLELASVDVIKEDWGLVHLSISLFGSDNNR---ISQQGSRDGDVLVPPLENGMFLGVQ  243

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKR  798
               K L  +  G  E         +       PES  SDS   F  E     R     KKR
Sbjct  244   --KELTRQECGRKEVAPTNIGGLS-------PESP-SDSIGNFTSENTAKPRS----KKR  289

Query  797   GRKP--GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
             GR    GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MDK+SLL+DAVSYIN+
Sbjct  290   GRSSTNGASRESALSNHVEAERQRREKLNHRFYVLRSVVPNVSKMDKSSLLADAVSYINQ  349

Query  626   LKGKVEELECQLQLRESKKVKVEAVG--DNQ--------------stssaassvaSPVDV  495
             LK KVEELE ++Q  +    K  +V   D+Q                SS  +    PV+V
Sbjct  350   LKAKVEELEAKIQ-EQPPTPKTGSVSHLDHQLSKSSSSIVDSHHHHHSSYNNRTVVPVEV  408

Query  494   EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  315
             +VKI+G +A+IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V +VP G 
Sbjct  409   DVKIMGSEAIIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARVPYGF  468

Query  314   RSE  306
              S+
Sbjct  469   NSD  471



>ref|XP_010910582.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=441

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 260/455 (57%), Gaps = 82/455 (18%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-----LFLAWGDGFFQGTKAGRGGGVPV  1452
             TLQ RLQ +L ++ + WAYAI W+ S+ +DG      L L+W  G F+G +         
Sbjct  33    TLQLRLQCLLHSRLEWWAYAILWRPSSAEDGAAAGCPLVLSWEAGHFRGAR---------  83

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--VP  1278
                       ++  + ++G  A++GS   + +G  +TD EWFYV+SL RSF+AGD   +P
Sbjct  84    ---------DADPPRKVAG-DAVVGS---AADGCGVTDVEWFYVLSLPRSFTAGDAATLP  130

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
              + F   S VWL+G   L    CERA+EAQ+HG++TLVC+P G GV+E+GS E+I E+W+
Sbjct  131   ARVFRSLSPVWLAGGDALHACRCERAREAQLHGVETLVCVPAGGGVLEMGSAELIPEDWT  190

Query  1097  LVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea  918
             LV+Q ++                          G   GA D       AAG     A+  
Sbjct  191   LVEQARAFLD-----------------------GAQIGAVD-------AAGSEAAPARPP  220

Query  917   saaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQ  738
                     +S+ +SE S     + KE   V       KK GR+ G G+   VNHV+AERQ
Sbjct  221   LQPRTGKLSSWVDSEQS-----YAKEGTTVR-----GKKLGRRLGTGKEVTVNHVDAERQ  270

Query  737   RREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVE  558
             RREKLN RFYALRSVVPNVSRMDKASLL+DAV YI EL+ ++EELE +++  + +   V+
Sbjct  271   RREKLNQRFYALRSVVPNVSRMDKASLLADAVDYIKELRARIEELEDEIKTAKKEPEVVD  330

Query  557   AVGDNQstssaassvaSP------------VDVEVKIVGP-DAMIRVQSENANYPSAKLM  417
              VG   + ++  +S  S             V++EV  VG  +A++RV++EN  +P A+LM
Sbjct  331   QVGSGHAITATITSSNSTVSSEMAEGGEKVVELEVVAVGAEEAVVRVRTENVKHPPARLM  390

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
               LR+LE  VHHA ++SV+ +M+QD+VV++P GLR
Sbjct  391   GALRDLEAVVHHAIVASVDGVMVQDVVVRMPRGLR  425



>ref|XP_007151965.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
 gb|ESW23959.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
Length=404

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 256/442 (58%), Gaps = 67/442 (15%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             + LQQRLQFIL+T+ + W YAIFWQ + + D RL L +GDGF+ G+K GR G      + 
Sbjct  19    NALQQRLQFILQTRPEWWVYAIFWQATKESDSRLTLEYGDGFYMGSK-GREG-----TEV  72

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
               S +Q                T+N  N     D EWFY +S  RS++AGDGV G AF  
Sbjct  73    RMSEEQ----------------TRNHVN-----DIEWFYRVSQTRSYAAGDGVVGCAFGS  111

Query  1259  GSLVWLSGAHRLQMYNC-ERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
             G  VWLSG +  ++  C ER  EA+ HGIQTLVC+    G++ELGS E++K ++ ++Q V
Sbjct  112   GVDVWLSGVNEFEVNECDERVGEARRHGIQTLVCVSVARGILELGSHEVLKLDYGVLQMV  171

Query  1082  KSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaa  903
             KS+F   EER     +   V    ++  G+    +  + L+                   
Sbjct  172   KSVF---EERECGSENP--VRRRWMVVPGKEKEKERRRELEG------------------  208

Query  902   aaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVT-PVNHVEAERQRREK  726
                +S   S  SD D + L     V+   + P   GR+ G  R T PVNHVEAERQRREK
Sbjct  209   ---SSTDSSGPSDHDAEALL--AFVEANNSVPMM-GRRAGRERETLPVNHVEAERQRREK  262

Query  725   LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
             LN RFYALRS VPNVS+MDKASLLSDAV YINELK K+ +L+  L+     + + +A   
Sbjct  263   LNQRFYALRSAVPNVSKMDKASLLSDAVDYINELKAKISQLQSALEAEPEAQAQTQA---  319

Query  545   NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  366
                     SS  + + VEV+++G +AMIRVQS N N+P A+LM+ LR++ L + HA+IS+
Sbjct  320   ------QPSSATTDMRVEVQMLGSEAMIRVQSLNINHPWARLMDALRDVNLEILHATISN  373

Query  365   VNDIMLQDIVVKVPEGLRSEDG  300
             + ++MLQD+VV+VP  L +++ 
Sbjct  374   IKEMMLQDVVVRVPHDLMTQEA  395



>ref|XP_007210924.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
 gb|EMJ12123.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
Length=478

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 188/482 (39%), Positives = 271/482 (56%), Gaps = 67/482 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK---AGRGG  1464
             Q N +T  QRLQFI++ + + WAY+IFWQ S D+ D ++ L+W  G F+ ++   + R  
Sbjct  15    QENSATFHQRLQFIVQNRPEWWAYSIFWQASKDNNDDQVVLSWAGGHFKSSRDFASKRSN  74

Query  1463  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFY--VM  1317
              +    Q        ERK V +    ++   ++  + D          +TD+EWFY   +
Sbjct  75    KMTNNYQPKFGFSSVERKNVNNREVEVLFDEEDMVDLDTSLVDHGVGDVTDSEWFYFYTV  134

Query  1316  SLARSFSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  1146
             SL +SF+AG G   +  +AF  G  VWL+G H LQ Y CER KEA++HGIQTLVC+ T  
Sbjct  135   SLTQSFAAGHGNNSILDRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCVATPC  194

Query  1145  GVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELL----QQGRSAGAD  978
             GV+EL SL++IKE+W LV   KSLF+    R    +  G   G+ L+     +  S G  
Sbjct  195   GVLELASLDVIKEDWGLVHLSKSLFESNNNRV---SKQGSRDGNVLVSLLENEMFSGGQK  251

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKR  798
             DL    +R  G +     ++     +A                 K   +  R +++    
Sbjct  252   DL----TRQGGSSSDSPSDSVGNFTSAN---------------AKNIRLKKRGRSSNHGT  292

Query  797   GRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKG  618
             GR+          HVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK 
Sbjct  293   GRESST-------HVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKE  345

Query  617   KVEELECQLQLR-ESKKV---------------KVEAVGDNQstssaassvaSPVDVEVK  486
             KVEELE ++Q + ++ KV                  ++ D+ S+S   +   + ++V+VK
Sbjct  346   KVEELEAKIQAQPQNPKVGHVSNLDHHHHHNSQSTGSIVDHHSSSYNINKAGAALEVDVK  405

Query  485   IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             I+G +AMIRVQ  + +YP AKLMN L+ L   V+HASISSV ++M+QD+V +VP G  SE
Sbjct  406   ILGSEAMIRVQCPDQDYPYAKLMNALKALGFQVYHASISSVKELMIQDVVARVPYGFNSE  465

Query  305   DG  300
             + 
Sbjct  466   EA  467



>ref|XP_009420803.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 192/469 (41%), Positives = 257/469 (55%), Gaps = 88/469 (19%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             MDELI++ S SSS+ A    P  + LQ RLQ  L  + + WAYAIFW+ S D      L+
Sbjct  1     MDELIISPSCSSSLNA----PAAADLQYRLQSFLLARPEWWAYAIFWRASPD---HRVLS  53

Query  1508  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEW  1329
             +GDG F+G +  RG                                    + D + D EW
Sbjct  54    FGDGNFRGARKSRG------------------------------------SDDSVDDGEW  77

Query  1328  FYVMSLARSFSA---GDGVPGKAFSMGSL--VWLSGAHRLQMYNCERAKEAQIHGIQTLV  1164
             FYV+SL+RSF     GD  P  A   GSL  VWL+G   LQ   C+R +EAQ+HGI+TL 
Sbjct  78    FYVVSLSRSFVVARDGDANPVPARVYGSLAPVWLAGVRALQACGCDRTREAQLHGIETLA  137

Query  1163  CIPTGAGVVELGSLEIIKENWSLVQQVKSLFQF-PEERTISFADIGLVSGHELLQQGRSA  987
             C P   GV+ELGS + I ENW LVQQV ++F   P +  I+ A+              +A
Sbjct  138   CFPVPGGVLELGSADYIAENWVLVQQVSAIFNTTPHDAAIAGAE-------------PTA  184

Query  986   GADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAP  807
                 L   +   AG                 +S  +SEHSDSDC  L E     ++    
Sbjct  185   APAPLSAARKDGAG----------------LSSSVDSEHSDSDCHLLAERRRPKKRGRK-  227

Query  806   KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
             ++ G   G     P NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV+YI E
Sbjct  228   QESGSHEG-----PANHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVAYIKE  282

Query  626   LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSE  447
             L+ KV++LE + +      +K          ++  ++  + ++VEVK++G +A+IR QS+
Sbjct  283   LEAKVDKLEAEAK----TAMKETTTSATTHGTTTTTTSETAMEVEVKLLGAEALIRAQSD  338

Query  446   NANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             + N+P A+LM  LR+L L VHHAS+S V + +LQD+VV+VP  L+  +G
Sbjct  339   DRNHPPARLMVALRDLGLHVHHASVSCVKESVLQDVVVEVPCELQGHEG  387



>ref|XP_008803328.1| PREDICTED: transcription factor MYC3-like [Phoenix dactylifera]
Length=438

 Score =   290 bits (741),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 195/450 (43%), Positives = 267/450 (59%), Gaps = 74/450 (16%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQ RLQ +L ++ + WAYAI W+ S  +D    L+WGDG+F+G    R   +P      
Sbjct  32    TLQLRLQCLLHSRPEWWAYAILWRPSAAEDRPAVLSWGDGYFRGP---RDADLP------  82

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--VPGKAFS  1263
                +++ R + I           ++ +G  +TD EWFYV+SL RSF+AGD   VP  AF 
Sbjct  83    ---RKAARNEPIG----------SAADGCGVTDMEWFYVLSLTRSFAAGDTATVPTSAFG  129

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
               S VWL+GAH LQ+  CERA+EAQ+HGI+TLVC+P G GV+ELGS E+I E+W+LV+Q 
Sbjct  130   SLSPVWLAGAHALQVCGCERAREAQLHGIETLVCVPAGEGVLELGSAELIPEDWALVEQA  189

Query  1082  KSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaa  903
             ++      +          V G                 LQ R  G              
Sbjct  190   RTFLAAATDVAADATVPLAVPGR--------------PPLQPRWDG--------------  221

Query  902   aaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
                +S+ +SEHSD++     E  +VDR++   KKRGR+ G G+  PVNHVEAERQRREKL
Sbjct  222   --LSSWVDSEHSDAE-----EGTVVDRRRG--KKRGRRAGTGKEVPVNHVEAERQRREKL  272

Query  722   NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
             NHRFYALRSVVPNVSRMDKASLL+DAV+YI EL+ +VEELE + +  + +   V+  G  
Sbjct  273   NHRFYALRSVVPNVSRMDKASLLADAVTYIKELRARVEELEGEARKAKEEPKVVDQGGSG  332

Query  542   QstssaassvaSPVDVEVKIVG-------------PDAMIRVQSENANYPSAKLMNGLRE  402
                ++  +S  S V  E+   G              +AM+RVQ+EN  +P A+LM  LR+
Sbjct  333   HGITTTTTSSNSTVSSEMGEGGEKVVQLEVVVVGTEEAMLRVQTENVKHPPARLMGALRD  392

Query  401   LELAVHHASISSVNDIMLQDIVVKVPEGLR  312
             LE+ VHHAS++S+  +M+QD+VV+VP+GLR
Sbjct  393   LEVGVHHASVASLKGVMVQDVVVRVPQGLR  422



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score =   290 bits (741),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 254/450 (56%), Gaps = 81/450 (18%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRG  1467
             Q N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG+++G +    
Sbjct  47    QFNEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPTGDNAVVLGWGDGYYKGEEDKE-  105

Query  1466  GGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGD  1287
                      S+  +Q  RK+ +                   TD EWF+++S+ +SF+ G 
Sbjct  106   --KKKKSSNSNPAEQEHRKREV-------------------TDTEWFFLVSMTQSFANGV  144

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG++F    ++WLSG+  L    CERA + QI+G+QT+VCI    GVVELGS E I +
Sbjct  145   GLPGESFLNSRVIWLSGSGALTGSGCERASQGQIYGLQTMVCIAAENGVVELGSSEAISQ  204

Query  1106  NWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
             +  L+ +V SLF          ++ G++S   +++    +G                   
Sbjct  205   SSDLMDKVNSLFN---------SNNGMLSFSTVVRSTAKSG-------------------  236

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEA  747
                            ES+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEA
Sbjct  237   ---------------ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEA  280

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLR  582
             ERQRREKLN RFY+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL 
Sbjct  281   ERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLD  340

Query  581   ESKKVKVEAVGDNQs-----tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  417
                K      G +++     +S   S+ +  ++++VKI+G D MIRVQ    N+P ++ M
Sbjct  341   GMSKEGNGKSGASRAVRERKSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFM  400

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKV  327
             + L+EL+L V+HAS+S VND+M+Q   VK+
Sbjct  401   DALKELDLEVNHASLSVVNDLMIQQATVKM  430



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score =   289 bits (740),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 255/450 (57%), Gaps = 81/450 (18%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRG  1467
             Q N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG+++G +    
Sbjct  44    QFNEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPAGDNAVVLGWGDGYYKGEEDKE-  102

Query  1466  GGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGD  1287
                      S+  +Q  RK+ +                   TD EWF+++S+ +SF+ G 
Sbjct  103   --KKKKSSNSNPAEQEHRKREV-------------------TDTEWFFLVSMTQSFANGV  141

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG++F    ++WLSG+  L    CERA + QI+G+QT+VCI    GVVELGS E I +
Sbjct  142   GLPGESFLNSRVIWLSGSGALTGSGCERANQGQIYGLQTMVCIAAENGVVELGSSEAISQ  201

Query  1106  NWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
             +  L+ +V SLF          +  G++S   +++    +G                   
Sbjct  202   SSDLMDKVNSLFN---------SSNGMLSFSTVVRSTAKSG-------------------  233

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEA  747
                            ES+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEA
Sbjct  234   ---------------ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEA  277

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKV  567
             ERQRREKLN RFY+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E + +  + +  
Sbjct  278   ERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLD  337

Query  566   KVEAVGDNQstssaa----------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  417
              +   G+ +S +S A          S+ +  ++++VKI+G D MIRVQ    N+P ++ M
Sbjct  338   GMSKEGNGKSGASRAVKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFM  397

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKV  327
             + L+EL+L V+HAS+S VND+M+Q   VK+
Sbjct  398   DALKELDLEVNHASLSVVNDLMIQQATVKM  427



>ref|XP_008342536.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=517

 Score =   291 bits (744),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 205/504 (41%), Positives = 272/504 (54%), Gaps = 72/504 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTK----AGRG  1467
             Q   ST QQRLQFI++ + + W Y+IFWQ S      ++ L+W  G F  T     + R 
Sbjct  15    QETSSTFQQRLQFIVQNRPEWWVYSIFWQASKVSISDQVSLSWAGGHFWNTHDHLASKRS  74

Query  1466  GGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLI-----TDAEWFY--VMSL  1311
              GV    Q        ER KVI+  ++AL+       +  L+     TD+EWFY   +SL
Sbjct  75    SGVINSYQPKFGFSNGERSKVINQEVEALLHDDMVDLDMRLVDHEDATDSEWFYFYTVSL  134

Query  1310  ARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  1146
              +SFSAG G     + G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  
Sbjct  135   TQSFSAGQGNNSKNIVGRAFGSGGFVWLAGDHDFQFYECERVKEARMHGIQTLVCIATPC  194

Query  1145  GVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDL--  972
             GV+EL SL++IKE+W LV   KSLF        S  +I + +  +L +Q  +   + L  
Sbjct  195   GVLELASLDVIKEDWGLVHLSKSLFG-------SDGNINMNNKKKLSKQQTTRDGNVLVP  247

Query  971   ---KVLQSRAAGDaekqaqeasaaaaaaKN---SYPESEHSDSDCQFLKEPPIVDRQQNA  810
                  L S A  +  +Q    S   AA  N   S PE+  SDS   F  E        N 
Sbjct  248   ILENGLFSAAQKELIRQDHGGSINEAAPINLGESSPETP-SDSVGNFTLENT---ENMNR  303

Query  809   PKKRGRKPGAGRVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
              +KRGR    G  +     +NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV
Sbjct  304   LRKRGRSSNHGAASRELQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAV  363

Query  641   SYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVD------------  498
              YIN+LK KVEELE ++Q  +++K K      N     ++ S +S VD            
Sbjct  364   LYINQLKSKVEELEAKVQ-EQTQKPKAGNNASNNLDHHSSQSTSSIVDQHHYSYYNISNN  422

Query  497   ------------------VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  372
                               V+VKI G D +IRVQ  + +YP AKLMN L+ L L V+HASI
Sbjct  423   SNSNNNSISDRAAAAAVEVDVKIFGSDVIIRVQCPDQDYPYAKLMNALKGLGLQVYHASI  482

Query  371   SSVNDIMLQDIVVKVPEGLRSEDG  300
              SV ++M+QD+V ++P G   ++ 
Sbjct  483   WSVKELMVQDVVARLPYGFTGKEA  506



>ref|XP_008245384.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=476

 Score =   289 bits (739),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 192/479 (40%), Positives = 270/479 (56%), Gaps = 63/479 (13%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +         
Sbjct  15    QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPRDLASKRSNK  74

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----------ITDAEW--FYVMSL  1311
             +V   H     ERKKVI+  +A    +   E  DL           +TD EW  FY +SL
Sbjct  75    MVNNKHFV---ERKKVINNREA---ESLFHEEMDLDMRLVDHGVGDVTDCEWLYFYSISL  128

Query  1310  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  1140
              +SF AG   + + G++F  G  VWL+G H LQ Y CER K+A++HGI++LVCI T  GV
Sbjct  129   TQSFVAGHATNNILGRSFCSGGFVWLAGDHELQFYECERVKKARMHGIKSLVCIATPCGV  188

Query  1139  VELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHEL---LQQGR-SAGADDL  972
             +EL SL++IKE+  LV   KSLF   +   +S  D     G+ L   L+ G  S G  DL
Sbjct  189   LELASLDVIKEDLGLVLLSKSLF-LSDNNRVSKQDSR--DGNALVPPLESGMFSGGQKDL  245

Query  971   KVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR  792
                 ++  GD ++ A      ++           SDS   F  +    + +    KKRGR
Sbjct  246   ----TKQEGDTKEAAPINIGGSS-----------SDSADNFTSD----NTESTRLKKRGR  286

Query  791   KPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
                      + HVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK K+
Sbjct  287   SSSNHAPQLLKHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKAKI  346

Query  611   EELE--CQLQLRESKKVKVE-------------AVGDNQstssaassvaSPVDVEVKIVG  477
             EELE   Q Q +  K+  V               V  + S ++  +  A  ++V+VKI+G
Sbjct  347   EELEDKIQSQPQNPKRGNVSNADHHHYSQSTSPIVDFHHSNNNNTNRAADALEVDVKILG  406

Query  476   PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              +A+IRVQ  +  YP AKLMN L+ L L V+HASIS+V ++M+Q++VV+VP G  S++ 
Sbjct  407   SEAVIRVQCPDQEYPYAKLMNALKSLRLQVYHASISNVKELMIQNVVVRVPYGFTSDEA  465



>ref|XP_008245385.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=475

 Score =   288 bits (738),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 188/488 (39%), Positives = 264/488 (54%), Gaps = 82/488 (17%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +         
Sbjct  15    QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPRDLASKRSNK  74

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----------ITDAEW--FYVMSL  1311
             +V   H     ERKKVI+  +A    +   E  DL           +TD EW  FY +SL
Sbjct  75    MVNNKHFV---ERKKVINNREA---ESLFHEEMDLDMRLVDHGVGDVTDCEWLYFYSISL  128

Query  1310  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  1140
              +SF AG   + + G++F  G  VWL+G H LQ Y CER K+A++HGI++LVCI T  GV
Sbjct  129   TQSFVAGHATNNILGRSFCSGGFVWLAGDHELQFYECERVKKARMHGIKSLVCIATPCGV  188

Query  1139  VELGSLEIIKENWSLVQQVKSLFQFPEERT-----------ISFADIGLVSG--HELLQQ  999
             +EL SL++IKE+  LV   KSLF     R            +   + G+ SG   +L +Q
Sbjct  189   LELASLDVIKEDLGLVLLSKSLFLSDNNRVSKQDSRDGNALVPPLESGMFSGGQKDLTKQ  248

Query  998   GRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQ  819
             G +  A  + +  S                             SDS   F  +    + +
Sbjct  249   GDTKEAAPINIGGSS----------------------------SDSADNFTSD----NTE  276

Query  818   QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  639
                 KKRGR         + HVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+
Sbjct  277   STRLKKRGRSSSNHAPQLLKHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVA  336

Query  638   YINELKGKVEELE--CQLQLRESKKVKVE-------------AVGDNQstssaassvaSP  504
             YIN+LK K+EELE   Q Q +  K+  V               V  + S ++  +  A  
Sbjct  337   YINQLKAKIEELEDKIQSQPQNPKRGNVSNADHHHYSQSTSPIVDFHHSNNNNTNRAADA  396

Query  503   VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             ++V+VKI+G +A+IRVQ  +  YP AKLMN L+ L L V+HASIS+V ++M+Q++VV+VP
Sbjct  397   LEVDVKILGSEAVIRVQCPDQEYPYAKLMNALKSLRLQVYHASISNVKELMIQNVVVRVP  456

Query  323   EGLRSEDG  300
              G  S++ 
Sbjct  457   YGFTSDEA  464



>ref|XP_010523833.1| PREDICTED: transcription factor MYC3-like [Tarenaya hassleriana]
Length=418

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 189/455 (42%), Positives = 250/455 (55%), Gaps = 84/455 (18%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +T QQRLQFI+  Q + W YAI W+   D+   + L W DG F+G      G     V T
Sbjct  14    TTPQQRLQFIVNAQPELWCYAINWKIVPDEFAGMCLYWSDGHFRGA----NGRNIAHVST  69

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFS-AGDGVPGKAFS  1263
              HS                           +++D E FY++S  + F  AGDG+PG+A  
Sbjct  70    IHSR--------------------------IVSDIELFYLISSTKIFPVAGDGLPGRASV  103

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
              G+ VW+SG + L+  NC RA EAQ+HGI+TLVC+PT  GV+ELGS E+I  +  LV+ V
Sbjct  104   TGT-VWISGDNELRFQNCNRANEAQMHGIRTLVCVPTSDGVLELGSSEMIGYDPHLVRLV  162

Query  1082  KSLF--------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
             KSLF         +P +    F+D  +           S    D+ V      GD  +  
Sbjct  163   KSLFGSDLSDPKPYPRQNPPRFSDRVI-----------SVPRTDITV-----DGDDSEFP  206

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEA  747
               A         S P           LK  PI       P++R RK  +    P+NH+EA
Sbjct  207   CNAKEYEGDETGSGPA----------LKLDPI-------PERRRRKANSTGEQPLNHIEA  249

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKV  567
             ERQRREKLNHRFYALRSVVP VSRMDKASLLSDAVSYINELK K++ELE +L+  ++K+V
Sbjct  250   ERQRREKLNHRFYALRSVVPRVSRMDKASLLSDAVSYINELKRKIDELESKLK-PDNKRV  308

Query  566   KVEAVG----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  417
             K+E +            N S +  +    S V+V+VKIVG +A+IRVQ+EN +YP A L 
Sbjct  309   KLEEMTTGLSNDQSGIKNASEALVSKRGYSKVEVDVKIVGDEAVIRVQTENLSYPVAALT  368

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
               LREL+L + H S+SSV ++M+Q +VV VP G R
Sbjct  369   AALRELKLKIRHGSMSSVEELMVQQMVVTVPRGTR  403



>ref|XP_008356558.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=515

 Score =   287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 200/503 (40%), Positives = 267/503 (53%), Gaps = 72/503 (14%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK----AGRG  1467
             Q   S  QQ LQFI++ + + W Y+IFWQ S D    ++ L+W  G FQ T+    + R 
Sbjct  15    QETSSKFQQSLQFIIQNRPEWWVYSIFWQASKDSISDQVSLSWAAGHFQDTRDHLASKRS  74

Query  1466  GGVPVVVQTSHSTQQSERKKVIS-GIQALIGSTQNS------ENGDLITDAEWFY--VMS  1314
               V    Q         RKK+I+  ++AL+            + GD +TD EWFY   +S
Sbjct  75    NRVTNSYQPKFGFNNVGRKKMINREVEALLHDDMVDLDMRLVDQGD-VTDTEWFYFYTVS  133

Query  1313  LARSFSAG-----DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             L +SFSA      D + G+AF  G  VWL+  H  Q Y CER KEA++HGIQTLVCI T 
Sbjct  134   LTQSFSASHGNNSDNILGRAFGSGGFVWLAADHEFQFYECERVKEARMHGIQTLVCIATP  193

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGH---ELLQQGRSAGAD  978
              GV+EL SL++IKE+W LVQ  KSLF        + +      G+    +L+ G  + A 
Sbjct  194   CGVLELASLDVIKEDWGLVQLSKSLFGSDGNINKTLSQQTNHDGNVIAPILENGLFSAAQ  253

Query  977   DLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKR  798
                  Q R             AA      S PES  SDS   F  E           KKR
Sbjct  254   KELTRQDRGG--------INEAAPINLGRSSPESP-SDSVDNFTSENT---ESMTRTKKR  301

Query  797   GRKPGAGRVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
             GR    G  +     +NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN
Sbjct  302   GRSSNHGSASRESQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYIN  361

Query  629   ELKGKVEELECQLQLR-------------------ESKKVKVE--------------AVG  549
             +LK KVEELE ++Q +                   +S   KVE              +  
Sbjct  362   QLKSKVEELEAKVQEQPQKPKAGNNASNSLDHHSGQSTSSKVEQRHCSNNNDGNIINSNN  421

Query  548   DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
             +N +  ++    A+ V+V+VKI+G +A+I VQ  +  YP AKLMN L+ L L V+HASIS
Sbjct  422   NNNNNINSDRGAAAVVEVDVKILGSEAIIHVQCPDQGYPYAKLMNALKGLGLQVYHASIS  481

Query  368   SVNDIMLQDIVVKVPEGLRSEDG  300
             SV ++M+QD+V ++P G   E+ 
Sbjct  482   SVKELMIQDVVARLPYGFTGEEA  504



>ref|XP_007210118.1| hypothetical protein PRUPE_ppa022201mg [Prunus persica]
 gb|EMJ11317.1| hypothetical protein PRUPE_ppa022201mg [Prunus persica]
Length=476

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 192/477 (40%), Positives = 268/477 (56%), Gaps = 59/477 (12%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G  +  +         
Sbjct  15    QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHCKSPRDLASKRSNK  74

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----------ITDAEWFYV--MSL  1311
             +V   H     ERKKVI+  +A    +   E  DL           +TD+EWFY   +SL
Sbjct  75    MVNNKHFV---ERKKVINNREA---ESLFHEEMDLDMRLVDHVVGDVTDSEWFYFYSISL  128

Query  1310  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  1140
              +SF AG   + + G++F  G  VWL+G H LQ Y CER K+A++HGIQ+LVCI T  GV
Sbjct  129   TQSFVAGHATNNILGRSFCSGGFVWLAGDHELQFYECERVKKARMHGIQSLVCIATPCGV  188

Query  1139  VELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGH-ELLQQGR-SAGADDLKV  966
             +EL S ++IKE+  LV   KSLF   +   +S  D   V+     L+ G  S G  DL  
Sbjct  189   LELASPDVIKEDLGLVHLSKSLF-LSDNNRVSKQDSRDVNALVPPLESGMFSGGQKDL--  245

Query  965   LQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
               ++  GD ++ A      ++           SDS   F  +    + +    K RGR  
Sbjct  246   --TKQEGDTKEAAPINIGGSS-----------SDSADNFTSD----NTESTRMKTRGRSS  288

Query  785   GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE  606
                    +NHVEAERQRREKLNHRFYALRSVVPNVS+MD++SLL+DAV+YIN+LK K EE
Sbjct  289   SNHAPQLLNHVEAERQRREKLNHRFYALRSVVPNVSKMDRSSLLADAVAYINQLKAKTEE  348

Query  605   LE--CQLQLRESKKVKVE-------------AVGDNQstssaassvaSPVDVEVKIVGPD  471
             LE   Q Q +  K+  V               V  + S ++  +  A+ ++V+VKI+G +
Sbjct  349   LEDKIQSQPQNPKRGNVSNADHHHYSQSTSPIVDFHHSNNNNTNRAAAALEVDVKILGSE  408

Query  470   AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             A+IRVQ  +  YP AKLMN L+ L L V HASIS+V D+M+Q++VV+VP G  S++ 
Sbjct  409   AVIRVQCPDQEYPYAKLMNALKSLRLQVCHASISNVKDLMIQNVVVRVPYGFISDEA  465



>ref|XP_008342518.1| PREDICTED: transcription factor MYC3-like isoform X1 [Malus domestica]
Length=513

 Score =   286 bits (732),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 204/521 (39%), Positives = 278/521 (53%), Gaps = 88/521 (17%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFL  1512
             MDE+I + S++        Q    T QQRLQFI++ + + W Y+IFWQ S D    ++ L
Sbjct  1     MDEIISSCSTNFC------QETSPTFQQRLQFIVQNRPEWWVYSIFWQASKDSISDQVSL  54

Query  1511  AWGDGFFQGTK----AGRGGGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNS-----  1362
             +W  G F+ T+    + R   +    Q        ERK+V +  +++L+           
Sbjct  55    SWAGGHFRNTRDHLASKRSSRIANNYQLKFGFNNVERKRVNNREVESLLHDDMVDLDMRL  114

Query  1361  -ENGDLITDAEWFY--VMSLARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCE  1206
              ++GD +TD+EWFY   +SL +SFS   G     + G+AF  G  VWL+G H  Q Y CE
Sbjct  115   VDHGD-VTDSEWFYFYTVSLTQSFSGSHGNNSTNILGRAFGSGGFVWLAGDHEFQFYECE  173

Query  1205  RAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF------------QFP  1062
             R KEA++HGIQTLVCI T  GV+EL SL++IKE+W LV   KSLF            +  
Sbjct  174   RVKEARMHGIQTLVCIATPCGVLELASLDVIKEDWGLVHLSKSLFGSDDNINMNNNNRLS  233

Query  1061  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  882
             + +T    D+ LV    +L+ G  + A    + Q +  G          AA      S P
Sbjct  234   KRQTSRDGDV-LVP---ILENGLFSAAQKELIPQDQGGG-------INEAAPINLGGSSP  282

Query  881   ESEHSDSDCQFLKEPPIVDRQQNA--PKKRGRKPGAGRVTP----VNHVEAERQRREKLN  720
             ES  SDS   F  E       +N    KKRGR    G        +NHVEAERQRREKLN
Sbjct  283   ESP-SDSVGNFTSE-----NTENTIRSKKRGRSSKHGAANRESQLLNHVEAERQRREKLN  336

Query  719   HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQ  540
             HRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK KV+ELE ++Q  + +K K      N 
Sbjct  337   HRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKSKVQELEAKVQ-EQPQKPKAGNNPSNN  395

Query  539   stssaassvaSPVD--------------------------VEVKIVGPDAMIRVQSENAN  438
                 ++ S +S VD                          V+VKI   +AMI VQ  + +
Sbjct  396   LDHHSSQSTSSIVDQHHYSNKNNNSINSSNSDRAASAVMEVDVKISASEAMIHVQCPDED  455

Query  437   YPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  315
             YP AKLMN L+ L L V+HASISSV ++M+QD+V ++P G 
Sbjct  456   YPYAKLMNALKSLGLQVYHASISSVKELMIQDVVARLPYGF  496



>ref|XP_009393178.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=454

 Score =   281 bits (719),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 256/455 (56%), Gaps = 78/455 (17%)
 Frame = -2

Query  1631  QPNHST-LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             QP  +T LQ+RLQ +L+ + + WAYAIFW+ S D      L++GDG F+G +        
Sbjct  53    QPAPATELQRRLQCLLQARPEWWAYAIFWRASPD---HRVLSFGDGHFRGARC-------  102

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENG-DLITDAEWFYVMSLARSFSAGDGVP  1278
                     T +  R           G     E G D + DAEWFY+MSL+RSF  G  +P
Sbjct  103   -------PTDRRPR-----------GCYAADEAGADAVDDAEWFYIMSLSRSFVGGGAIP  144

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
              + +    L+WL+GAH LQ   C+R++EAQ+HGIQTL C+P   GV+ELGS ++I +NW 
Sbjct  145   ARVYGSLELLWLTGAHALQACGCDRSREAQLHGIQTLACVPVPGGVLELGSPDLIGDNWV  204

Query  1097  LVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea  918
             LV Q K++F                          S G +D       A       +   
Sbjct  205   LVHQAKAVF--------------------------SEGPNDASPTAGAALAAVAFPSPAV  238

Query  917   saaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQ  738
                 A   +S  +SEHSDS+     E      ++   K+  R     R    NHVEAERQ
Sbjct  239   RKEGAGLSSSV-DSEHSDSEGGTTVE------RRRPKKRGRRPGSGSRDCTSNHVEAERQ  291

Query  737   RREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVE  558
             RREKLNHRFYALRSVVPNVSRMDKASLL+DAV+YI +LK KVE LE      E+K  K E
Sbjct  292   RREKLNHRFYALRSVVPNVSRMDKASLLADAVTYIEDLKAKVEILEA-----EAKMAKKE  346

Query  557   AVGDNQstssaassvaS----------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  408
                D  +TS   ++ A+           +++EVK++G DA+IRVQSE+ N+P AKLM  L
Sbjct  347   TAADQAATSITNAASATTGSPPTAVTVAIEMEVKLLGNDALIRVQSEDQNHPPAKLMCAL  406

Query  407   RELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             R+LEL+VHHAS+S++ D++LQD+VVKVP  L+ ED
Sbjct  407   RDLELSVHHASVSTLKDVVLQDVVVKVPTELQVED  441



>ref|XP_008342523.1| PREDICTED: transcription factor MYC3-like isoform X2 [Malus domestica]
Length=511

 Score =   283 bits (723),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 203/521 (39%), Positives = 277/521 (53%), Gaps = 90/521 (17%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFL  1512
             MDE+I + S++        Q    T QQRLQFI++ + + W Y+IFWQ S D    ++ L
Sbjct  1     MDEIISSCSTNFC------QETSPTFQQRLQFIVQNRPEWWVYSIFWQASKDSISDQVSL  54

Query  1511  AWGDGFFQGTK----AGRGGGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNS-----  1362
             +W  G F+ T+    + R   +    Q        ERK+V +  +++L+           
Sbjct  55    SWAGGHFRNTRDHLASKRSSRIANNYQLKFGFNNVERKRVNNREVESLLHDDMVDLDMRL  114

Query  1361  -ENGDLITDAEWFY--VMSLARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCE  1206
              ++GD +TD+EWFY   +SL +SFS   G     + G+AF  G  VWL+G H  Q Y CE
Sbjct  115   VDHGD-VTDSEWFYFYTVSLTQSFSGSHGNNSTNILGRAFGSGGFVWLAGDHEFQFYECE  173

Query  1205  RAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF------------QFP  1062
             R KEA++HGIQTLVCI T  GV+EL SL++IKE+W LV   KSLF            +  
Sbjct  174   RVKEARMHGIQTLVCIATPCGVLELASLDVIKEDWGLVHLSKSLFGSDDNINMNNNNRLS  233

Query  1061  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  882
             + +T    D+ LV    +L+ G  + A    + Q     +         AA      S P
Sbjct  234   KRQTSRDGDV-LVP---ILENGLFSAAQKELIPQGGGINE---------AAPINLGGSSP  280

Query  881   ESEHSDSDCQFLKEPPIVDRQQNA--PKKRGRKPGAGRVTP----VNHVEAERQRREKLN  720
             ES  SDS   F  E       +N    KKRGR    G        +NHVEAERQRREKLN
Sbjct  281   ESP-SDSVGNFTSE-----NTENTIRSKKRGRSSKHGAANRESQLLNHVEAERQRREKLN  334

Query  719   HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQ  540
             HRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK KV+ELE ++Q  + +K K      N 
Sbjct  335   HRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKSKVQELEAKVQ-EQPQKPKAGNNPSNN  393

Query  539   stssaassvaSPVD--------------------------VEVKIVGPDAMIRVQSENAN  438
                 ++ S +S VD                          V+VKI   +AMI VQ  + +
Sbjct  394   LDHHSSQSTSSIVDQHHYSNKNNNSINSSNSDRAASAVMEVDVKISASEAMIHVQCPDED  453

Query  437   YPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  315
             YP AKLMN L+ L L V+HASISSV ++M+QD+V ++P G 
Sbjct  454   YPYAKLMNALKSLGLQVYHASISSVKELMIQDVVARLPYGF  494



>ref|XP_009359542.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=520

 Score =   283 bits (723),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 197/506 (39%), Positives = 267/506 (53%), Gaps = 83/506 (16%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK----AGRG  1467
             Q    T QQRLQF+++ +++ W Y+IFWQ S      ++ L+W  G F  T     + R 
Sbjct  15    QETSFTFQQRLQFMVQNRSEWWVYSIFWQASKGSISDQVSLSWAGGHFWNTHDHLASKRS  74

Query  1466  GGVPVVVQTSHSTQQSERKKVIS-GIQALIGSTQNSENGDLI-----TDAEWFY--VMSL  1311
              GV    Q        ER KVI+  ++ L+       +  L+     TD+EWFY   +SL
Sbjct  75    SGVINSYQPKFGFSNGERSKVINREVEDLLHDDMVDLDMRLVDREDVTDSEWFYFYTLSL  134

Query  1310  ARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  1146
              +SFSA  G     + G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  
Sbjct  135   TQSFSASQGNNSKNIVGRAFGSGGFVWLAGDHDFQFYECERVKEARMHGIQTLVCIATPC  194

Query  1145  GVVELGSLEIIKENWSLVQQVKSLF---------------QFPEERTISFADIGLVSGHE  1011
             GV+EL SL++IKE+W LV   KSLF               +  +++T    ++ LV    
Sbjct  195   GVLELASLDVIKEDWGLVHLSKSLFGLDGNINMNNNNNKKKLSKQQTTRDGNV-LVP---  250

Query  1010  LLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPI  831
             +L+ G  + A    + Q +          +   A      S PE+  SDS   F  E   
Sbjct  251   ILENGLFSAAQKELIRQDQGGS-------KNEDAPINLGESSPETP-SDSVGNFTSENT-  301

Query  830   VDRQQNAPKKRGRKPGAGRVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKA  663
                     KKRGR    G  +      NHVEAERQRREKLNHRFY LRSVVPNVS+MD++
Sbjct  302   --ENMTRLKKRGRSSNHGAASRELQLSNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRS  359

Query  662   SLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVD-----  498
             SLL+DAV YIN+LK KVEELE ++Q  +++K K +   +N     ++ S +S VD     
Sbjct  360   SLLADAVLYINQLKSKVEELEAKVQ-EQTQKPKADNNANNNLDHHSSQSTSSIVDQHHYS  418

Query  497   -------------------------VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  393
                                      V+VKI+G D +IRVQ  + +YP AKLMN L+ L L
Sbjct  419   YYNISNNSNSNNNSNSDRAAAAAVEVDVKIMGSDVIIRVQCPDEDYPYAKLMNALKGLGL  478

Query  392   AVHHASISSVNDIMLQDIVVKVPEGL  315
              V+HASISSV + M+QD+V ++P G 
Sbjct  479   QVYHASISSVKEFMVQDVVARLPYGF  504



>ref|XP_009370919.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=519

 Score =   282 bits (721),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 190/501 (38%), Positives = 264/501 (53%), Gaps = 74/501 (15%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK----AGRGGGVPV  1452
             T QQRLQFI++ +++ W Y+IFWQ S      ++ L+W  G F  T     + R  GV  
Sbjct  20    TFQQRLQFIVQNRSEWWVYSIFWQASKGSISDQVSLSWAGGHFWNTHDHLASKRSSGVIN  79

Query  1451  VVQTSHSTQQSERKKVIS-GIQALIGSTQNSENGDLI-----TDAEWFY--VMSLARSFS  1296
               Q        ER KVI+  ++ L+       +  L+     TD+EWFY   +SL +SFS
Sbjct  80    SYQPKFGFSNGERSKVINREVEDLLHDDMVDLDMRLVDREDVTDSEWFYFYTLSLTQSFS  139

Query  1295  AGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  1131
             A  G     + G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  140   ASQGNNSKNIVGRAFGSGGFVWLAGDHDFQFYECERVKEARMHGIQTLVCIATPFGVLEL  199

Query  1130  GSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHE----------LLQQGRSAGA  981
              SL++IKE+W LV   KSLF       ++  +   +S  +          +L+ G  + A
Sbjct  200   ASLDVIKEDWGLVHLSKSLFGLDGNINMNNNNKKKLSKQQTTRDGNVLVPILENGLFSAA  259

Query  980   DDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKK  801
                 + Q +          +   A      S PE+  +       +    + R +    K
Sbjct  260   QKELIRQDQGGS-------KNEDAPINLGESSPETPSASVGNLTTENTENMTRLK----K  308

Query  800   RGRKPGAGRVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  633
             RGR    G  +     +NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV YI
Sbjct  309   RGRSSNHGAASRELQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVLYI  368

Query  632   NELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVD---------------  498
             NELK KVEELE ++Q  +++K K     +N     ++ S +S VD               
Sbjct  369   NELKSKVEELEAKVQ-EQTQKPKAGNNANNNLDHHSSQSTSSIVDQHHYSYYNISNNSNS  427

Query  497   ---------------VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  363
                            V+VKI+G D +IRVQ  + +YP  KLMN L+ L L V+HASISSV
Sbjct  428   NNNSNSDRAAAAAVEVDVKIMGADVIIRVQCPDEDYPYVKLMNALKGLGLQVYHASISSV  487

Query  362   NDIMLQDIVVKVPEGLRSEDG  300
              ++M+QD+V ++P G   ++ 
Sbjct  488   KELMVQDVVARLPYGFTGKEA  508



>ref|XP_009358714.1| PREDICTED: transcription factor MYC4-like [Pyrus x bretschneideri]
Length=516

 Score =   278 bits (712),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 196/500 (39%), Positives = 262/500 (52%), Gaps = 73/500 (15%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK----AGRGGGVP  1455
             S  QQ LQFI++ + + W Y+IFWQ S D    ++ L+W  G FQ T+    + R   V 
Sbjct  19    SKFQQSLQFIIQNRPEWWVYSIFWQASKDSISDQVSLSWAAGHFQNTRDHLESKRSNRVT  78

Query  1454  VVVQTSHSTQQSERKKVISG-IQALIGSTQNS------ENGDLITDAEWFY--VMSLARS  1302
                Q         RKK I+  ++AL+            + GD + D EWFY   +SL +S
Sbjct  79    NSYQPKFGFNNVGRKKTINREVEALLHDDMVDLDMRLVDQGD-VADNEWFYSYTVSLTQS  137

Query  1301  FSAG-----DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVV  1137
             FSA      D + G+AF  G  VWL+  H  Q Y CER KEA ++GIQTLVCI T  GV+
Sbjct  138   FSASHGNNSDNILGRAFGSGGFVWLAADHEFQFYECERVKEAGMNGIQTLVCIATPCGVL  197

Query  1136  ELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGH---ELLQQGRSAGADDLKV  966
             EL SL++IKE+W LVQ  KSLF        + +      G+    +L+ G  + A+    
Sbjct  198   ELASLDVIKEDWGLVQLSKSLFGSDGNINKTLSKQTSHDGNVIAPILENGLFSAAEKELT  257

Query  965   LQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
              Q R             AA      S PES  SDS   F  E           KKRGR  
Sbjct  258   RQDRGG--------INEAAPINLGRSSPESP-SDSVDNFTSENT---ESMTRTKKRGRSS  305

Query  785   GAGRVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKG  618
               G  +     +NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN+LK 
Sbjct  306   NHGSASRESQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYINQLKS  365

Query  617   KVEELECQLQLR-------------------ESKKVKVE---------------AVGDNQ  540
             KV ELE ++Q +                   +S   KVE                  +N 
Sbjct  366   KVGELEVKVQEQPQKPKACNNASNSLDHHSGQSTSSKVEQRHCSNNNDSNIISSNNNNNN  425

Query  539   stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVN  360
             +  ++    A+ V+V+VKI+G +A+I VQ  +  YP AKLMN L+ L L V+HASISSV 
Sbjct  426   NNINSDRGAAAVVEVDVKIMGSEAIIHVQRSDQGYPYAKLMNALKGLGLQVYHASISSVK  485

Query  359   DIMLQDIVVKVPEGLRSEDG  300
             ++M+QD+V ++P G   E+ 
Sbjct  486   ELMIQDVVARLPYGFTGEEA  505



>ref|XP_010441529.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=461

 Score =   276 bits (706),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 174/453 (38%), Positives = 240/453 (53%), Gaps = 57/453 (13%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT---KAGRGGGVPV  1452
             +TLQ+RL  +L    + W YAIFW+ S+ D  G   L WGDG + G    K GR     +
Sbjct  33    TTLQKRLHAVLSGTHEPWTYAIFWKPSDFDLSGESVLKWGDGVYNGDDEEKTGRRLRRTI  92

Query  1451  VVQTSHSTQQSER-KKVISGIQALIG-------STQNSENGDLITDAEWFYVMSLARSFS  1296
                   S ++ ER  KV+  + ++I           ++++   +TD EWF+++S+  +F 
Sbjct  93    KKTIPSSPEEKERWSKVLRELNSMISGEPFPVVEEDDAKDDVEVTDTEWFFLVSMTWTFG  152

Query  1295  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
              G G+ GKAF+  + VW++G+ ++    C+RAK+  + G+QT+VCIP+  GV+ELGS E 
Sbjct  153   NGSGLAGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGVLGLQTIVCIPSDNGVLELGSTEQ  212

Query  1115  IKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDae  936
             I +N +L  +++ LF        SF      SG     Q RS+                 
Sbjct  213   ISQNSNLFNKIRYLF--------SFEGSKYFSGAPTSAQFRSS-----------------  247

Query  935   kqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNH  756
                           N  P   +         E  ++   +   KKRGRKP  GR  P+NH
Sbjct  248   ------------IHNPNPNPVYQPIQINLSGEEMVIPEMKPG-KKRGRKPMHGREKPLNH  294

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE-----CQL  591
             VEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YINELK   E  E      Q 
Sbjct  295   VEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENAESERNAVQN  354

Query  590   QLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  411
             QL E KK+       +    +      S + +EVK +G D MIRV+S   N+P A+LMN 
Sbjct  355   QLNELKKITGRQNATSSVVCNDDKENVSELKIEVKAMGSDVMIRVESGKRNHPGARLMNA  414

Query  410   LRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
             L +LEL V HASIS +ND+M+Q   VK+  GLR
Sbjct  415   LMDLELEVSHASISVMNDLMIQQATVKM--GLR  445



>ref|XP_008385247.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=459

 Score =   274 bits (700),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 187/470 (40%), Positives = 264/470 (56%), Gaps = 69/470 (15%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQT-DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
              P+ ST +QRLQFI++    + W YAIFW+ + D++    L+WG G ++           
Sbjct  16    NPSSSTFKQRLQFIVENNAAECWVYAIFWEATGDNN----LSWGGGHYKS----------  61

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYV--MSLARSFSAGDGV  1281
                    S   S + K+       +G   N+++GD +TD+EWFY   +SL +SF+A + +
Sbjct  62    -------SDINSYQPKLGFSDVDFVG---NNDDGD-VTDSEWFYFYSVSLTQSFTADNNI  110

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
              G+AF  G  VWL+G H  Q+Y CER KEA++HGIQTLVCI T +GVVEL SL++IK++W
Sbjct  111   LGQAFCSGGFVWLAGDHEFQLYECERVKEARMHGIQTLVCIATLSGVVELASLDVIKQDW  170

Query  1100  SLVQQVKSLFQFPEE---------RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAA  948
              LV   KSLF+  ++         +  S    GLV     L+ GR  GA +    Q    
Sbjct  171   GLVHLTKSLFRSNDDDDGHNRLSNQQASREASGLV---PTLKNGRCLGAQEELTTQESGG  227

Query  947   GDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP----GA  780
              +A+      S+ +       P    S+S  +F  +    + +    KKRGR       A
Sbjct  228   NEAKPINIGGSSIS-------PPDSRSNSVGKFTSK----NIENTQSKKRGRPSSNHGAA  276

Query  779   GRVTP-VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL  603
              R +  ++HVEAER RR K NH F  LRSVVPNVS+MD++SLL+DAV+YIN+LK KVE L
Sbjct  277   TRASQLLSHVEAERLRRVKFNHLFCVLRSVVPNVSKMDRSSLLADAVAYINQLKAKVEAL  336

Query  602   EC--QLQLRESKKVKVE---------AVGDNQstssaassvaSPVDVEVKIVG-PDAMIR  459
             E   Q QL   +K KV+          +G N S  S        V+V+VKI+G  +A+IR
Sbjct  337   EAKIQAQLPPPQKSKVDHNNNVINIINLGKNSSYDSNRVGGCG-VEVDVKIIGSSEAIIR  395

Query  458   VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             V   N +YP A+LMN L+ L L V H SISSVN++M+Q++V ++P G  S
Sbjct  396   VLCPNQDYPYARLMNVLKGLGLQVSHGSISSVNELMIQNVVTRLPYGFTS  445



>ref|XP_003520013.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=379

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 167/444 (38%), Positives = 235/444 (53%), Gaps = 101/444 (23%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             + +QQRLQFIL+++ + W YAIFWQ + D D RL L +GDG+F+G               
Sbjct  24    NAVQQRLQFILQSRPEWWVYAIFWQATKDSDSRLKLEYGDGYFRGK--------------  69

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
                 ++ E ++           T+N      + D EWFY MS  RS+ AGDGV G A+S 
Sbjct  70    ----EEKEEEQ-----------TRN------VNDIEWFYRMSQTRSYVAGDGVVGCAYSS  108

Query  1259  GSLVWLSGAHRLQMYNCE-RAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
             G  VWLSG +  ++ +C+ R +EA+ HGI TLVC+    G++ELGS  +    + L++  
Sbjct  109   GVDVWLSGVNEFELNDCDDRVREARSHGIHTLVCVYVPGGILELGSCHVFTLGYGLLEMA  168

Query  1082  KSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaa  903
             KS+F+  + +      +G+         G S  + D                        
Sbjct  169   KSVFEESQNQNPLNNPMGMNDATAAKVDGSSTDSSD------------------------  204

Query  902   aaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRV---TPVNHVEAERQRR  732
                        +D+D  F    P+  R            G GR     P+NHVEAERQRR
Sbjct  205   -----------ADADATF----PMTRR------------GGGRAREALPMNHVEAERQRR  237

Query  731   EKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV  552
             EKLN RFY LRS VPNVS+MDKASLL DAV YINELK K+  LE      +  +V     
Sbjct  238   EKLNQRFYTLRSAVPNVSKMDKASLLLDAVDYINELKAKINHLESSANRPKQAQV-----  292

Query  551   GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  372
                     +++S +S + VEVKI+G +AMI VQS N N+P A+LM+ LR+L L + HA++
Sbjct  293   ------IHSSTSASSNMRVEVKILGAEAMIMVQSLNLNHPPARLMDALRDLNLQILHATM  346

Query  371   SSVNDIMLQDIVVKVPEGLRSEDG  300
             S++ ++MLQD+VVKVP  L ++D 
Sbjct  347   SNIKEMMLQDVVVKVPHDLMTQDA  370



>ref|XP_009354516.1| PREDICTED: transcription factor MYC3-like [Pyrus x bretschneideri]
Length=460

 Score =   270 bits (689),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 184/471 (39%), Positives = 261/471 (55%), Gaps = 70/471 (15%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQT--DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGV  1458
              P+ ST +QRLQFI+++    + W YAIFW+ + D++    L+WG G ++          
Sbjct  16    NPSSSTFKQRLQFIVESNNAAECWVYAIFWEATGDNN----LSWGGGHYKS---------  62

Query  1457  PVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYV--MSLARSFSAGDG  1284
                     S   S + K+       +G   N+++GD +TD+EWFY   +SL +SF+A + 
Sbjct  63    --------SNINSYQPKLGFSDVDFVG---NNDDGD-VTDSEWFYFYSVSLTQSFTADNN  110

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             + G+AF  G  VWL+G H  Q+Y CER KEA++HGIQTLVCI T  GV+EL SL++IK++
Sbjct  111   ILGRAFCSGGFVWLAGDHEFQLYECERVKEARMHGIQTLVCIATLRGVLELASLDVIKQD  170

Query  1103  WSLVQQVKSLF----------QFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSR  954
             W LV   KSLF          + P ++    A  GLV     L+ GR  GA +    Q  
Sbjct  171   WGLVHLTKSLFRSNDNDDDHNRLPNQQASREAS-GLVPP---LKNGRFLGAQEELTTQEG  226

Query  953   AAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGR-KPGAG  777
                +A       S+ +       P    S+S   F  +    + +    KKRGR     G
Sbjct  227   GGNEATPINIGGSSIS-------PPDSRSNSVGNFTSK----NIENTQSKKRGRPSSNHG  275

Query  776   RVTP----VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  609
               T     ++HVEAER RR K N  F  LRSVVPNVS+MD++SLL+DAV+YIN+LK KVE
Sbjct  276   AATRESQLLSHVEAERLRRVKFNRLFCVLRSVVPNVSKMDRSSLLADAVAYINQLKAKVE  335

Query  608   ELEC--QLQLRESKKVKVEAVG--------DNQstssaassvaSPVDVEVKIVG-PDAMI  462
             ELE   Q QL   +K KV+           +  S+  +       V+V+VKI+G  +A+I
Sbjct  336   ELETKIQAQLPPPQKSKVDHNNNVINIINLEKNSSYDSNRVGGCGVEVDVKIIGSSEAII  395

Query  461   RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             RV   N +YP A+LMN L+ L L V HASISS+N++M+Q++V ++P G  S
Sbjct  396   RVLCPNQDYPYARLMNVLKGLGLQVSHASISSINELMIQNVVTRLPYGFTS  446



>ref|XP_010056012.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=472

 Score =   269 bits (688),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 168/458 (37%), Positives = 247/458 (54%), Gaps = 43/458 (9%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQ L F+L+ + D W Y+IFW+ + DD G L L WGDG F+G K          + T +
Sbjct  24    LQQYLHFLLQIRPDDWVYSIFWRPTRDDRGCLVLTWGDGQFRGMKG---------LATHN  74

Query  1433  STQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
             S  Q   K++ +   A   S+ N       + + D E ++++S+ RS+S+ + + G+A  
Sbjct  75    SNNQRVSKELGTPEGADFRSSSNMNTKLVQNEVCDLERYFIVSVTRSYSSKESILGRALC  134

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI--PTGAGVVELGSLEIIKENWSLVQ  1089
              G+ +WL G   L  Y CER +EA + GI+++VCI  P   GV+ELGS + ++E+WSLV 
Sbjct  135   SGTYIWLCGEDELGSYECERVREASMTGIKSIVCISTPHDTGVLELGSTKRLQEDWSLVH  194

Query  1088  QVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAG--Daekqaqeas  915
               KSLF         F   G++       Q      ++   L    A   D         
Sbjct  195   SAKSLFNS------HFLSTGIIPHVHGEHQSNGVLKEECSTLDGAGASRCDTCPSDTFGP  248

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQR  735
                 +       S +  S C+       + + +    +  + P   R+   NHVEAERQR
Sbjct  249   WGFKSDIKRAGASHNITSPCKR----AAITKMETDDAEPAQSPFPSRL---NHVEAERQR  301

Query  734   REKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK----KV  567
             REKL  RFYALRSVVP V++MDKASLLSDAVSYI EL+ ++ ELE +++    K    KV
Sbjct  302   REKLKQRFYALRSVVPKVTKMDKASLLSDAVSYIKELRSRINELEGEVKFLPQKPSLNKV  361

Query  566   KVEAVGDNQstssaassvaSP----------VDVEVKIVGPDAMIRVQSENANYPSAKLM  417
                   + + T   +    SP          ++VEVK+VG +A++RV+S N ++P+A+LM
Sbjct  362   ASPLGNETEKTLQVSKIGWSPSLNVAMGLSKMEVEVKVVGDEAVVRVRSPNRDHPAARLM  421

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             + L+ELEL VHHAS+SSV   MLQD+V++ P G  SE+
Sbjct  422   DALKELELEVHHASLSSVKGTMLQDVVIRTPIGWASEE  459



>ref|XP_004301652.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Fragaria vesca subsp. vesca]
Length=383

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 174/449 (39%), Positives = 239/449 (53%), Gaps = 108/449 (24%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +  QQRLQFIL+ +   W Y+I                   F+Q +  G           
Sbjct  19    TVFQQRLQFILQNRPGYWVYSI-------------------FWQASTDG-----------  48

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLA--RSFSAGDG---VPG  1275
                                        N       EWFY  +++  +SF+AGDG   + G
Sbjct  49    --------------------------NNAVSCDRPEWFYFYTISSTQSFAAGDGNSNILG  82

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             + F  G+ VWL+G H L+ Y CER   A++HGIQTLVCI T  GV+EL SLE+IKE+W  
Sbjct  83    RTFCSGAFVWLAGDHGLRFYECERVNMARMHGIQTLVCIATPNGVLELASLEVIKEDWGF  142

Query  1094  VQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
             VQ  KS+F                 G +++    + GA  L  +Q    G       +  
Sbjct  143   VQLSKSIF-----------------GSDII----TTGAGSLNSMQ----GHLHVPQLQNV  177

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQR  735
              + +    S P   H  S   +LK+    D+  NA ++          + VNH +AERQR
Sbjct  178   HSGSIQARSGP---HKTS---WLKKRERPDKHVNAWQE----------SSVNHSKAERQR  221

Query  734   REKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK---KVK  564
             R KLNHRFYALRSVVPNVS+MDKASLLSDA+ YIN LK K+EELE ++Q R  K    + 
Sbjct  222   RAKLNHRFYALRSVVPNVSKMDKASLLSDAIVYINSLKTKIEELEAKIQARPMKPKASII  281

Query  563   VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQS---ENANYPSAKLMNGLRELEL  393
              ++V D+QS +S   + A+ ++V+VKI+G +A+IRV +   +N + P A+LMN  R+LEL
Sbjct  282   SDSVLDSQSNNSKTYASATAMEVDVKILGSEAIIRVITISPDNHDNPCARLMNSFRDLEL  341

Query  392   AVHHASISSVNDIMLQDIVVKVPEGLRSE  306
              +HHASISSVN +MLQD+VV+VP+G  SE
Sbjct  342   KIHHASISSVNQLMLQDVVVRVPDGFASE  370



>emb|CDX73261.1| BnaC05g28450D [Brassica napus]
Length=443

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 172/449 (38%), Positives = 232/449 (52%), Gaps = 92/449 (20%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  1455
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  1275
                 T     Q  RKKV+  +                             SF+ G G+ G
Sbjct  112   PPFSTP--ADQEYRKKVLRELN----------------------------SFACGSGLAG  141

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             KAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELGS E I+++  L
Sbjct  142   KAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQSSDL  201

Query  1094  VQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
             + +V+ LF F                        + GA DL  L                
Sbjct  202   MNKVRVLFNF------------------------NGGAGDLSCLN---------------  222

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRV----TPVNHVEA  747
                    N  P+   +D    ++ +P  V  Q N       +  A  +     P+NHVEA
Sbjct  223   ------WNLDPDQGENDP-SMWINDPIGVPEQGNGAPSSSSQLFAKSIQFENEPLNHVEA  275

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLR  582
             ERQRREKLN RFYALR+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL 
Sbjct  276   ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLE  335

Query  581   ESKK----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
             E K      K  A GD  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+
Sbjct  336   EVKMELAGRKASAGGDLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMS  395

Query  413   GLRELELAVHHASISSVNDIMLQDIVVKV  327
              L +LEL V+HAS+S VND+M+Q   VK+
Sbjct  396   ALMDLELEVNHASMSVVNDLMIQQATVKM  424



>emb|CDY03185.1| BnaC09g19710D [Brassica napus]
Length=473

 Score =   262 bits (670),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 172/464 (37%), Positives = 246/464 (53%), Gaps = 63/464 (14%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAG---RGGGVPV  1452
             S LQ+RLQ +L    ++W YAI W  S  D  G   L WGDG ++G +A    R      
Sbjct  37    SALQKRLQAVLNGTHEAWTYAILWTPSYYDYSGESVLKWGDGIYKGEEADNTRRKRRRMT  96

Query  1451  VVQTSH---------STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSF  1299
             V +  H         S    E   VI G           E+   ++D EWFY++S+  SF
Sbjct  97    VAEREHWSIILPELSSMTSDEDLPVIDG-----------EDDVEVSDTEWFYMVSMTVSF  145

Query  1298  SAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  1119
              +  G+PGKAF+    VW++G+  +    CERAK+    G+QT+VCIP   GV+ELGS  
Sbjct  146   GSETGLPGKAFATYKPVWVTGSDHILASGCERAKKGGYSGLQTIVCIPLDNGVLELGSTV  205

Query  1118  IIKENWSLVQQVKSLFQFPEER-------TISFADIGLVSGHELLQQG--RSAGADDLKV  966
              IK+N  L  +++ +F F   R       T++FA   L        Q        DD ++
Sbjct  206   EIKQNPDLFNKIRVVFSFEGSRDFSVYPQTVNFATSTLERALHSPNQNYPEQIPIDDGEL  265

Query  965   LQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP  786
             L S  AGD +                   S+HSD +   + E    ++Q+   KKRGRK 
Sbjct  266   LHS--AGDIDG------------------SDHSDIEATVVPE----NKQK---KKRGRKL  298

Query  785   GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE  606
               GR  P+NHV+AER RREKLN RFYALR+ VPNVS+MDK SLL DA+SYI ELK + E 
Sbjct  299   ANGRKEPLNHVQAERLRREKLNQRFYALRATVPNVSKMDKTSLLGDAISYIKELKSRAEN  358

Query  605   LECQLQLRES--KKVKVEAVGDNQs-tssaassvaSPVDVEVKIVGPDAMIRVQSENANY  435
              E +    +    K+K E  G N        +S     +++VKI+G DAM+R++S   N+
Sbjct  359   AESERNAIQILLNKLKEEMAGRNAVCRGGKNASEIETANIDVKILGCDAMVRLESSKRNH  418

Query  434   PSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             P+A+LMN   +L++ ++HASIS ++D+M+Q   VK+   + ++D
Sbjct  419   PAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQD  462



>emb|CDY26910.1| BnaA05g18020D [Brassica napus]
Length=443

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 172/449 (38%), Positives = 232/449 (52%), Gaps = 92/449 (20%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  1455
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  1275
                 T     Q  RKKV+  +                             SF+ G G+ G
Sbjct  112   PPFSTP--ADQEYRKKVLRELN----------------------------SFACGSGLAG  141

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             KAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELGS E I+++  L
Sbjct  142   KAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQSSDL  201

Query  1094  VQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeas  915
             + +V+ LF F                        + GA DL  L                
Sbjct  202   MNKVRVLFNF------------------------NGGAGDLSGLN---------------  222

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRV----TPVNHVEA  747
                    N  P+   +D    ++ +P  V  Q N       +  A  +     P+NHVEA
Sbjct  223   ------WNLDPDQGENDP-TMWINDPIGVAEQGNGAPSSSSQLFAKSIQFENEPLNHVEA  275

Query  746   ERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLR  582
             ERQRREKLN RFYALR+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL 
Sbjct  276   ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLE  335

Query  581   ESKK----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
             E K      K  A GD  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+
Sbjct  336   EVKMELAGRKASAGGDLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMS  395

Query  413   GLRELELAVHHASISSVNDIMLQDIVVKV  327
              L +LEL V+HAS+S VND+M+Q   VK+
Sbjct  396   ALMDLELEVNHASMSVVNDLMIQQATVKM  424



>gb|KFK31426.1| hypothetical protein AALP_AA6G110400 [Arabis alpina]
Length=506

 Score =   262 bits (670),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 170/479 (35%), Positives = 261/479 (54%), Gaps = 52/479 (11%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             +TLQ+RL  +L    ++W YA+FW+ S  D  G   L WGDG ++G      G  P   +
Sbjct  23    TTLQKRLHAVLNCTHEAWTYAVFWKPSYYDFSGDSVLKWGDGIYKG----EDGDTPRRRR  78

Query  1442  TSHSTQQSERKKVISGIQALIG--STQNSENGDL-------ITDAEWFYVMSLARSFSAG  1290
              + + ++  R KV+  + ++I   + Q    GD        ++D EWFY++S+  SF  G
Sbjct  79    KT-TAEKEHRNKVLKELTSMISGEAFQVMNEGDDDDDDDVEVSDTEWFYLVSMTWSFGRG  137

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ GKAF+  + VW++G+ ++    C RAK+    G+QT+VCIP+  GV+ELGS+E I+
Sbjct  138   SGLAGKAFATYNPVWVTGSDQIYGSGCNRAKQGGDLGLQTIVCIPSDNGVLELGSMEQIQ  197

Query  1109  ENWSLVQQVKSLFQFPEERTISFA----DIGLVSGH-------------ELLQQGRSAGA  981
             +N  L  +++ LF F   +  + A     + L  G+              +  Q ++   
Sbjct  198   QNSDLFNKIRFLFNFEGSKDFTGAPNLMSVQLEKGNFSTVPNSPNPDPSPVYMQMQNGFT  257

Query  980   DDLKVLQSRA------AGDaekqaqeasaaaaaaKNSYP----ESEHSDSDCQFLKEPPI  831
              DL    + +      +G+          +    +NSY     + E   S      +  I
Sbjct  258   QDLNFSTATSTSARDLSGEILSFGDNVKHSLNPDRNSYSGQIQKEEGKMSTSGEKMDDSI  317

Query  830   VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  651
             +  +    K+RGRKP   R  P++HV+AER RREKLN RFYALR+VVPNV++MDK SLL 
Sbjct  318   LVPENKREKRRGRKPAKDREVPLSHVQAERLRREKLNQRFYALRAVVPNVTKMDKTSLLG  377

Query  650   DAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVK  486
             DA+ YINELK K E  E      Q+QL    K+K +  G  ++  S+     +  +++VK
Sbjct  378   DAICYINELKLKSENAETEKNAVQIQL---NKLKEQITGRRRNAISSGGEKNAFSEIDVK  434

Query  485   IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             I+G DAMIRV+S  +N+P A+ MN L +LE+ V+HASIS +N +M+Q   VK+  GLR+
Sbjct  435   IIGCDAMIRVESNKSNHPGARFMNALMDLEVEVNHASISVINHLMIQQATVKM--GLRN  491



>ref|XP_006287856.1| hypothetical protein CARUB_v10001082mg [Capsella rubella]
 gb|EOA20754.1| hypothetical protein CARUB_v10001082mg [Capsella rubella]
Length=411

 Score =   257 bits (656),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 171/447 (38%), Positives = 239/447 (53%), Gaps = 90/447 (20%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             LQQ+L+FI++T  D WAY IFWQ   DD   R +L W DG F+G K           Q +
Sbjct  31    LQQKLRFIVETSPDQWAYIIFWQKMIDDQLDRSYLVWVDGHFRGNKN-------YTSQEN  83

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
             H+T+  E + ++ G             GDL    E FY    A SF   DG+  K  S  
Sbjct  84    HTTKSIECELMMDG-------------GDL----EMFY----ATSFYGEDGLWRKEISDE  122

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             SLVWL+G   L+  + ERAKEA  HG+ T V  P    ++ELGS + I +NW+ + +VKS
Sbjct  123   SLVWLTGLDELRFSSYERAKEASFHGVHTFVSAPIHNCIIELGSSDSINKNWNFINRVKS  182

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             +  F   +T+           EL  Q  S                               
Sbjct  183   IL-FGSGKTL-----------ELTNQTGSY------------------------------  200

Query  896   KNSYP-ESEHSD-SDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
               S P ES+HS+  + QF        R +N   K+  K        V+HVEAERQRREKL
Sbjct  201   --SKPVESDHSEIGNQQF--------RSENKRMKKLEKTDGATAKEVSHVEAERQRREKL  250

Query  722   NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
             NHRFYALR++VPNVSRMDKASLL+DAVSYI +LK +++ LE +++  ++   + + +  N
Sbjct  251   NHRFYALRAIVPNVSRMDKASLLADAVSYIEDLKSRIDHLETEMKSLKTTMTETDKLDHN  310

Query  542   Qstssaass-------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
              S +S +S          + ++V+ KIVG +A++RVQ+EN N+P+  LM+ L E++  V 
Sbjct  311   SSNTSPSSVDQVNQKPSEANLEVQAKIVGDEAVVRVQTENVNHPTCALMSTLMEMDCRVQ  370

Query  383   HASISSVNDIMLQDIVVKVPEGLRSED  303
              A+ S +  IM+QD+VV VP+GLRSED
Sbjct  371   RANASRLGQIMVQDVVVLVPDGLRSED  397



>ref|XP_002529968.1| transcription factor, putative [Ricinus communis]
 gb|EEF32411.1| transcription factor, putative [Ricinus communis]
Length=288

 Score =   250 bits (638),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 190/299 (64%), Gaps = 50/299 (17%)
 Frame = -2

Query  1118  IIKENWSLVQQVKSLF---QFPEE---------RTISFADIGLVSGHELLQQGRSAGADD  975
             +I+ENW LVQQ KSLF     P             ISFAD+G++SG   +Q+G +  A++
Sbjct  1     MIRENWGLVQQAKSLFGSDMMPNNPNPPIQLLGMNISFADMGIISG---IQEGDTTHANE  57

Query  974   LKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRG  795
                              +        +++  +SEHSDSD        +   ++ +PKKRG
Sbjct  58    -----------------KPQENDEKKESNNVDSEHSDSDFSLFAAASL---EKKSPKKRG  97

Query  794   RKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGK  615
             RKP  G    + HVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYIN+LK K
Sbjct  98    RKPALGGDKALKHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINDLKAK  157

Query  614   VEELECQLQLRESKKVKVEAVG--DNQstssaassvaS-------------PVDVEVKIV  480
             ++ELE QL +  SK VK+E     DNQST++ +   A+             P++VEVK +
Sbjct  158   IDELESQLHIDSSKTVKLEVADTKDNQSTTTTSDDQAASRPISSVSTTNGFPLEVEVKSL  217

Query  479   GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             G DAMIRVQSEN NYP+A+LM  LRELE  VH  ++S+VN++MLQD+VV+VP+GLR+E+
Sbjct  218   GNDAMIRVQSENVNYPAARLMTALRELEFQVHRVTMSTVNELMLQDVVVRVPDGLRTEE  276



>ref|XP_010494874.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=478

 Score =   256 bits (654),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 169/458 (37%), Positives = 246/458 (54%), Gaps = 48/458 (10%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT---KAGRGGGVPV  1452
             +TLQ+RL  +L    + W YAIFW+ S  D  G   L WGDG + G    K GR     +
Sbjct  33    TTLQKRLHAVLSGTHEPWTYAIFWKPSYFDLSGESVLKWGDGVYNGDDEEKTGRRLRRTI  92

Query  1451  VVQTSHSTQQSERK-KVISGIQALIGST------QNSENGDL-----ITDAEWFYVMSLA  1308
                   S ++ ER+ KV+  + ++I         +     D+     +TD EWF+++S+ 
Sbjct  93    KKTILSSPEEKERRSKVLRELNSMISGEPFPVVEEEDAKDDIDDVVEVTDTEWFFLVSMT  152

Query  1307  RSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  1128
              +F  G G+PGKAF+  + VW++G+ ++    C+RAK+    G+QT+VCIP+  GV+ELG
Sbjct  153   WTFGNGSGLPGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGGLGLQTIVCIPSHNGVLELG  212

Query  1127  SLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAA  948
             S E I++N  L  +++ LF F   +  S A   +     + +   +      + +Q   +
Sbjct  213   STEHIRQNSDLFNKIRFLFSFEGSKDCSGAPTSVQFPSSVHKYSNTNPNPVSQPIQIHFS  272

Query  947   GDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVT  768
             G+                      E   S   ++ E  I +++    + R    G  R  
Sbjct  273   GE----------------------ERKRSSDDWMDETVIPEKKPGKKRGRKPMHG--REK  308

Query  767   PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE----  600
             P+NHVEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YINELK   E  E    
Sbjct  309   PLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENAESEKN  368

Query  599   -CQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAK  423
               Q QL E KK+       +   +    +V+  + +EVK +G D MIRV+S   N+P A+
Sbjct  369   AVQNQLNELKKITGRQNATSSVCNDDKENVSD-LKIEVKAMGSDVMIRVESGKRNHPGAR  427

Query  422   LMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  309
             LMN L +LEL V+HASIS +ND+M+Q   VK+  GLR+
Sbjct  428   LMNALMDLELEVNHASISVMNDLMIQQATVKM--GLRT  463



>ref|XP_008386326.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=493

 Score =   256 bits (654),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 185/486 (38%), Positives = 260/486 (53%), Gaps = 68/486 (14%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +T QQRLQF+++   + W Y+IFW+ S D     F   G   F   +          + +
Sbjct  17    TTFQQRLQFLVQNVPEWWVYSIFWRASKDSSSDKFPVMGWRTFSEHRDH--------LAS  68

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAE--WFYVMSLARSFSAGDG-----V  1281
               S Q +   + +     +    +  ++GD +TD+E  +FY +SL +SFSA  G     +
Sbjct  69    KRSNQVNREVEALLHDDVMYLDMRLVDHGD-VTDSELFYFYTVSLTQSFSASHGNNSNNI  127

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
              G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  GVVEL SL++IKE++
Sbjct  128   FGRAFGSGGFVWLAGDHEFQFYECERVKEARMHGIQTLVCIATPCGVVELASLDVIKEDY  187

Query  1100  SLVQQVKSLF-----QFPEERTISFADIGLVSGHEL--LQQGRSAGADDLKVLQSRAAGD  942
              LV   KSLF          R +S     L  G+ L  + +     AD  ++ +  A G 
Sbjct  188   GLVHLSKSLFGSDGNHNNNNRRLSKHQTSL-EGNILDPILENELFSADQNELTRQDAGG-  245

Query  941   aekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTP-  765
                     +AA      S  ES  S+S   F  E     + +   K RGR    G  +  
Sbjct  246   -----INEAAAPINVGGSSLESP-SNSVGNFTSENT---KNKTRSKNRGRSSNNGAASRQ  296

Query  764   ---VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ  594
                 NHVEAE+QRREKLNHRF+ LRSVVPNVS+MD++SLL+DAV+YIN+LK KVEEL+ +
Sbjct  297   SQLSNHVEAEKQRREKLNHRFFVLRSVVPNVSKMDRSSLLADAVAYINQLKSKVEELDAK  356

Query  593   LQLRESKKVKVEAVGDNQstssaassvaSPV-----------------------------  501
             +Q  +++K K      N     ++ S ++ V                             
Sbjct  357   VQ-EQAQKPKAGNNXSNNLDHQSSQSTSAIVGQHHYSNINFNDNTISNSNRAAAAAVVEV  415

Query  500   DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  321
             DV VKI+G +A IRVQS + +YP AKLM+ L+ L L V+HASISSV ++M+QD+V ++P 
Sbjct  416   DVYVKIMGSEAKIRVQSPDQDYPYAKLMSALKGLGLQVYHASISSVKELMIQDVVARLPY  475

Query  320   GLRSED  303
             G  SE+
Sbjct  476   GFTSEE  481



>gb|KCW72574.1| hypothetical protein EUGRSUZ_E01043 [Eucalyptus grandis]
Length=472

 Score =   254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 167/458 (36%), Positives = 243/458 (53%), Gaps = 43/458 (9%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQ   F+L+ + D W Y+IFWQ S DD G   L WGDG F+G K          +   +
Sbjct  24    LQQYFHFLLQIRPDDWVYSIFWQPSRDDRGCPVLIWGDGQFRGMKD---------LTPKN  74

Query  1433  STQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
             ST Q   K+V +   A   ++ N +     + ++D E +Y++S  RS+S  + + G A  
Sbjct  75    STNQRVFKEVGTLGSAGFNASSNMDTKLVQNEVSDLERYYIVSATRSYSFEESILGWALC  134

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI--PTGAGVVELGSLEIIKENWSLVQ  1089
              G+ +WL G   L +Y CER +EA+  GI+++VCI  P   GV+ELGS + + E+WSLV+
Sbjct  135   SGTHIWLCGEDELGIYECERVREARTTGIKSIVCISTPCDTGVLELGSTKRLHEDWSLVR  194

Query  1088  QVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAG--Daekqaqeas  915
               KSLF      T  F   G+        Q      +    L        D         
Sbjct  195   LAKSLF------TSHFLSTGITPHVHEEHQSNGVPKEACSALDGTGTSRSDTCPSETYGL  248

Query  914   aaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQR  735
               +         S++  S  + +     + + +    +  R P   R+   NHVEAERQR
Sbjct  249   LGSKRDLKRVGVSQNITSSNKSV----TIAKMERDETEIARLPSPLRL---NHVEAERQR  301

Query  734   REKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK----KV  567
             REKL   FYALRSVVP V++MDKASLLSDAVSYI EL+ +++ELE +L+    K    KV
Sbjct  302   REKLKQGFYALRSVVPKVTKMDKASLLSDAVSYIKELRSRIDELEGELKFPPPKIGLSKV  361

Query  566   KVEAVGDNQstssaassvaSP----------VDVEVKIVGPDAMIRVQSENANYPSAKLM  417
                     +  S  +   +SP          ++V VK+VG +A++ V+S N ++P+A+LM
Sbjct  362   AGRFGDKTEPISPVSKIGSSPWLNVVKGLSKMEVGVKVVGDEAVVWVRSPNWDHPAARLM  421

Query  416   NGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
               L+EL+L VHHAS+SSV D+MLQD+V++ P G  SE+
Sbjct  422   GALKELQLEVHHASMSSVKDMMLQDVVIRTPIGWASEE  459



>ref|XP_009617148.1| PREDICTED: transcription factor MYC4-like [Nicotiana tomentosiformis]
Length=344

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/348 (43%), Positives = 204/348 (59%), Gaps = 42/348 (12%)
 Frame = -2

Query  1313  LARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVE  1134
             + + F A D +  +A+S  + VWL+  + LQ+YNCERAKEA +HGI+TLVCI T +GVVE
Sbjct  1     MPQCFVAEDELVVQAYSSATQVWLASHYELQLYNCERAKEADLHGIRTLVCIATPSGVVE  60

Query  1133  LGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSR  954
             LGS ++I+ENW  +Q +KSLF        S   I  V    L    +  G    +V   R
Sbjct  61    LGSSDVIQENWEFLQLIKSLFGSNNYNITSHLPINQVP---LRDHQKERGGSPQQVPDKR  117

Query  953   AAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGR  774
                                     E E+SD D     E   ++   N  + R RK G+  
Sbjct  118   ---------------KQEMITETAEFENSDFD----NESSAIN---NINRSRKRKAGSSS  155

Query  773   V------TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV  612
             +        +NHVEAER RREKLNHRFYALRSVVP VS+MDKASLL+DAV+YI ELK KV
Sbjct  156   IIIGRSEMAMNHVEAERIRREKLNHRFYALRSVVPYVSKMDKASLLADAVTYIKELKVKV  215

Query  611   EELECQLQLRESKKVKVEAVGD-----------NQstssaassvaSPVDVEVKIVGPDAM  465
             E+LE ++Q ++ K   +E               N  + S+ +   + +++EVKI+G +A+
Sbjct  216   EDLESKIQSQKPKNNIIEQHDSHSASSSVFNPANNKSFSSCNGGRNGMEIEVKIIGTEAI  275

Query  464   IRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  321
             IRVQS + N+P A+LMN  RE+E  ++HAS+SSV D+MLQDIV++VP+
Sbjct  276   IRVQSLDVNFPCARLMNVFREMEFQIYHASVSSVKDLMLQDIVIRVPD  323



>ref|XP_010481407.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=474

 Score =   248 bits (633),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 240/456 (53%), Gaps = 50/456 (11%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGG-----GV  1458
             +TLQ+RL  +L    + W YAIFW+ S  D  G   L W DG + G    + G      +
Sbjct  33    TTLQKRLHTVLSGTHEPWTYAIFWKPSYFDLSGESVLKWSDGVYNGDDEEKTGRRLRRTI  92

Query  1457  PVVVQTSHSTQQSERKKVISGIQALIGST---------QNSENGDLITDAEWFYVMSLAR  1305
                + +S   ++  R+ +      + G T         ++  +   +TD EWF+++S+  
Sbjct  93    KKTIPSSPEEKERRRRVLRELNSMISGETFPVVEEDDAKDDVDDVEVTDTEWFFLVSMTW  152

Query  1304  SFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
             +F  G G+ GKAF+  + VW++G+ ++    C+RAK+    G+QT+VCIP+  GV+ELGS
Sbjct  153   TFGNGSGLAGKAFTTYNPVWVTGSDQIYGSGCDRAKQGGGLGLQTIVCIPSDNGVLELGS  212

Query  1124  LEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAG  945
              E I++N  L  +++ LF F   +  S A       H  +           + +Q   +G
Sbjct  213   TEQIRQNSDLFNKIRFLFSFEGSKDFSGAPTS-AQFHSSIHNPNPNPV--YQPIQINFSG  269

Query  944   DaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTP  765
             +                    E + S  D     E P    +    KKRGRKP  GR  P
Sbjct  270   E--------------------EFKRSSDDRMDEMEIP----EMKPGKKRGRKPMHGREKP  305

Query  764   VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELE-----  600
             +NHVEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YINELK   E  E     
Sbjct  306   LNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENAESERNA  365

Query  599   CQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKL  420
              Q QL E KK+       +   +    +++  + +EVK +G D MIRV+S   N+P A+L
Sbjct  366   VQNQLNELKKITGRQNATSSVCNDDKENLSE-LKIEVKAMGSDVMIRVESGKRNHPGARL  424

Query  419   MNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
             MN L +LEL V HASIS +ND+M+Q   VK+  GLR
Sbjct  425   MNALMDLELEVSHASISVMNDLMIQQATVKM--GLR  458



>ref|XP_010422737.1| PREDICTED: transcription factor bHLH14-like [Camelina sativa]
Length=428

 Score =   243 bits (621),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 169/455 (37%), Positives = 229/455 (50%), Gaps = 100/455 (22%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDG-RLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             LQQ+L+F+++T  D WAY IFWQ   DD   + +L W DG F G K  +        Q +
Sbjct  34    LQQKLRFLVETSPDQWAYIIFWQKMIDDQSDQSYLVWVDGHFCGNKNNKS-------QEN  86

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
             H+T+  E + ++ G             GDL    E FY    A SF   DG   K  S  
Sbjct  87    HTTKSIECELMMDG-------------GDL----ELFY----ATSFYGEDGSRRKEISDE  125

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             SLVWL+G   L+  + ERAKEA  HG+ T V  P   G +ELGS + IK+NW+ + +V S
Sbjct  126   SLVWLTGLDELRFSSYERAKEASFHGVHTFVSAPIHNGTIELGSSDSIKQNWNFINRVTS  185

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             +F             G     EL  Q                                  
Sbjct  186   MF-------------GSGQTLELTNQ----------------------------------  198

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV---------NHVEAE  744
               SYP+ E SD       +    ++Q  + K R  K     V            +HVEAE
Sbjct  199   TGSYPKPEESD-------DSETGNQQITSEKIRRTKLETTDVATAKENHPSRGFSHVEAE  251

Query  743   RQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ-LRESKKV  567
             RQRREKLNHRFYALR+VVPNVS MDKASLLSDAVS I  LK K+ +LE +++ L+     
Sbjct  252   RQRREKLNHRFYALRAVVPNVSGMDKASLLSDAVSNIQNLKTKINDLETEIKRLKTILTA  311

Query  566   KVEAVGDNQstss-------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  408
             + + + +N S  S             S ++V+VK+VG +A++RVQ+EN N+P+  LM+ L
Sbjct  312   ETDPLDNNSSNRSPSFVDKVNQRPSESNLEVQVKVVGDEAVVRVQTENVNHPTCALMSTL  371

Query  407   RELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
              E++  V HA+ S +  IM+QD+VV VP+ LRSED
Sbjct  372   MEMDCRVQHANASRLGQIMVQDVVVLVPDKLRSED  406



>ref|XP_010456175.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Camelina 
sativa]
Length=415

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 170/458 (37%), Positives = 233/458 (51%), Gaps = 105/458 (23%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDG-RLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             LQQ+L+F+++   D WAY IFWQ   DD   + +L W DG F G K  +        Q +
Sbjct  20    LQQKLRFLVEKSPDQWAYIIFWQKIIDDQSDQSYLVWVDGHFCGNKNNK-------TQEN  72

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
             H+T+  E + ++             + GD+    E FY    A SF   DG   K  S  
Sbjct  73    HTTKSIECELMM-------------DCGDI----ELFY----ATSFYGDDGSRRKEISDE  111

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             SLVWL+G   L+  N ERAKEA  HG+ T V  P   G++ELGS + IK+NW+ + +V S
Sbjct  112   SLVWLTGLDELRFSNYERAKEASFHGVHTFVSAPIHNGIIELGSSDSIKQNWNFINRVTS  171

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             +F     +T+   D          Q G                                 
Sbjct  172   MF--GSGQTLELTD----------QTG---------------------------------  186

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNAPK-KRGRKPGAGRVTP--------VNHVEAE  744
               SYP+ E SD          I ++Q  + K +R +    G  T          +HVEAE
Sbjct  187   --SYPKPEESDY-------SEIGNQQITSEKIRRTKLETTGVATAKENHPSPGFSHVEAE  237

Query  743   RQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVK  564
             RQRREKLNHRFYALR+VVPNVS MDKASLLSDAVSYI  LK ++ +LE +++   + K  
Sbjct  238   RQRREKLNHRFYALRAVVPNVSGMDKASLLSDAVSYIQSLKTRINDLESEIK---NLKTI  294

Query  563   VEAVGD------NQstssaassvaSP----VDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
             + A  D      N+S S        P    ++V+VK+VG +A++RVQ+EN N+P+  LM 
Sbjct  295   LTAETDHNYNSSNRSPSFVDKVNQKPSKSNLEVQVKVVGDEAVVRVQTENVNHPTCALMT  354

Query  413   GLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
              L E++  V HA+ S +  IM+QD+VV VP+ LRSED 
Sbjct  355   TLMEMDCRVQHANASRLGQIMVQDVVVLVPDRLRSEDS  392



>ref|XP_002872924.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49183.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=428

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 247/466 (53%), Gaps = 104/466 (22%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             P    LQQ+L+F+++T  D WAY IFW    D+   R +L W DG F G K  +      
Sbjct  29    PADLALQQKLRFVVETSPDRWAYIIFWHKMFDEPSNRSYLVWVDGHFCGNKNNKS-----  83

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
               Q +++T   E + ++ G             GD   D E FY    A SF + DG P K
Sbjct  84    --QENYTTNSIECELMMDG-------------GD---DLELFY----ATSFYSEDGSPRK  121

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
                  SLVWL+G   L+  N ERAKEA  HG+ TLV IP   G++ELGS + I +N + +
Sbjct  122   EIFDESLVWLTGLDELRFSNYERAKEAGFHGVHTLVSIPINNGIIELGSSDSIIQNRNFI  181

Query  1091  QQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
              +V+S+  F   +T               +     G+D                      
Sbjct  182   NRVQSI--FGSGKTP--------------EHTNQTGSDPKPA------------------  207

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVT---------PV-  762
                       ES+HS+          I +RQ  + +KR RK     V          PV 
Sbjct  208   ----------ESDHSE----------IGNRQSGSERKRRRKLETMDVAVAAEEKHHPPVL  247

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             +HVEAERQRREKLNHRFYALR++VP VSRMDKASLLSDAVSYI  LK K+++LE +++  
Sbjct  248   SHVEAERQRREKLNHRFYALRAIVPKVSRMDKASLLSDAVSYIESLKSKIDDLETEIKKL  307

Query  581   ESKKVKVEAVGDNQstss------------aassvaSPVDVEVKIVGPDAMIRVQSENAN  438
             ++K  + + + +N S +S            + S+  S ++V+VK+VG +A+IRVQ+EN N
Sbjct  308   KTKMTETDKLDNNSSNTSPFSVEYQINQKPSESNRVSDLEVQVKVVGYEAIIRVQTENVN  367

Query  437   YPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             +P++ LM+ L E++  V HA+ S ++ +++QD+VV VPEGLRSEDG
Sbjct  368   HPTSALMSALMEMDCRVQHANASRLSQVVVQDVVVLVPEGLRSEDG  413



>ref|XP_002865159.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 172/471 (37%), Positives = 251/471 (53%), Gaps = 49/471 (10%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDD--GRLFLAWGDGFFQG-------TKAGRG  1467
             +TL +RL  +L    + W Y IFW+ S D D  G   L W DG + G        +  R 
Sbjct  31    TTLPKRLHAVLNGTNEPWTYVIFWKPSYDYDISGESVLKWSDGVYNGGDEEKTRERLRRK  90

Query  1466  GGVPVVVQTSHSTQQSERKKVISGIQALIGS-----------TQNSENGDLITDAEWFYV  1320
               +P     S   ++  R  V+  + ++I              ++ +    +TD EWF++
Sbjct  91    KTIP-----SSPAERERRSNVLRELNSMISGEAFPVVEDEYVNKDDDVEAEVTDMEWFFL  145

Query  1319  MSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  1140
             +S+  SF +G G+ GKAF+  + VW++G+ ++    C+RAK+    G+QT+VCIP+  GV
Sbjct  146   VSMTWSFGSGSGLAGKAFASYNPVWVTGSDQIYGSGCDRAKQGGDLGLQTIVCIPSDNGV  205

Query  1139  VELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQ  960
             +ELGS E I++N  L  +++  F F  + +  F     ++  EL       G        
Sbjct  206   LELGSTEHIQQNSDLFNRIR--FLFNFDGSKDFPGAPNLNS-ELFSFQLETGFSSTVTDN  262

Query  959   SRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAP--------K  804
                + +       +++A A+  +    S+      + L      D+ QNA         K
Sbjct  263   PNPSYNLNFSTSCSTSARASCGDVLSFSDIVKQSSENLNPNTYSDQIQNATVMPEKKQGK  322

Query  803   KRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINEL  624
             KRGRKP  GR  P+NHVEAER RREKLNHRFYALR+VVPN+S+MDK SLL DAV YINEL
Sbjct  323   KRGRKPAHGRDQPLNHVEAERMRREKLNHRFYALRAVVPNISKMDKTSLLEDAVHYINEL  382

Query  623   KGKVEELEC-----QLQLRESKKVKVEAVGDNQs--tssaassvaSPVDVEVKIVGPDAM  465
             K K E  E      Q+QL E K    E  G   +  +       AS + +EVKI+G DAM
Sbjct  383   KSKAENAESEKNAIQIQLNELK----EMAGQRNAIPSVFKYEENASEMKIEVKIMGNDAM  438

Query  464   IRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
             +RV+S  +++P A+LMN L +LEL V++AS+S +ND M+Q   VK+  GLR
Sbjct  439   VRVESSKSHHPGARLMNALMDLELEVNNASMSVMNDFMIQQANVKM--GLR  487



>ref|NP_567195.1| transcription factor bHLH14 [Arabidopsis thaliana]
 sp|O23090.1|BH014_ARATH RecName: Full=Transcription factor bHLH14; AltName: Full=Basic 
helix-loop-helix protein 14; Short=AtbHLH14; Short=bHLH 14; 
AltName: Full=Transcription factor EN 33; AltName: Full=bHLH 
transcription factor bHLH014 [Arabidopsis thaliana]
 gb|AAB62853.1| similar to the myc family of helix-loop-helix transcription factors 
[Arabidopsis thaliana]
 emb|CAB80896.1| AT4g00870 [Arabidopsis thaliana]
 emb|CAD58596.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AEE81947.1| transcription factor bHLH14 [Arabidopsis thaliana]
Length=423

 Score =   239 bits (610),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 177/466 (38%), Positives = 240/466 (52%), Gaps = 108/466 (23%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-RLFLAWGDGFFQGTKAGRGGGVPV  1452
             P    LQQ+L+F+++T  D WAY IFWQ   DD   R +L W DG F G K         
Sbjct  30    PPDLVLQQKLRFVVETSPDRWAYVIFWQKMFDDQSDRSYLVWVDGHFCGNKNNNS-----  84

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
               Q +++T   E + ++ G             GD   D E FY    A SF   D  P K
Sbjct  85    --QENYTTNSIECELMMDG-------------GD---DLELFY----AASFYGEDRSPRK  122

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
               S  SLVWL+G   L+  N ERAKEA  HG+ TLV IP   G++ELGS E I +N + +
Sbjct  123   EVSDESLVWLTGPDELRFSNYERAKEAGFHGVHTLVSIPINNGIIELGSSESIIQNRNFI  182

Query  1091  QQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
              +VKS+F             G  + H                                  
Sbjct  183   NRVKSIF-----------GSGKTTKH----------------------------------  197

Query  911   aaaaaKNSYPE---SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTP--------  765
                    SYP+   S+HS S  Q          Q  + +KR RK    RV          
Sbjct  198   --TNQTGSYPKPAVSDHSKSGNQ----------QFGSERKRRRKLETTRVAAATKEKHHP  245

Query  764   --VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ-  594
               ++HVEAE+QRREKLNHRFYALR++VP VSRMDKASLLSDAVSYI  LK K+++LE + 
Sbjct  246   AVLSHVEAEKQRREKLNHRFYALRAIVPKVSRMDKASLLSDAVSYIESLKSKIDDLETEI  305

Query  593   --LQLRESKKV-------KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENA  441
               +++ E+ K+          +V    +   + S+  S ++V+VKIVG +A+IRVQ+EN 
Sbjct  306   KKMKMTETDKLDNSSSNTSPSSVEYQVNQKPSKSNRGSDLEVQVKIVGEEAIIRVQTENV  365

Query  440   NYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             N+P++ LM+ L E++  V HA+ S ++ +M+QD+VV VPEGLRSED
Sbjct  366   NHPTSALMSALMEMDCRVQHANASRLSQVMVQDVVVLVPEGLRSED  411



>ref|XP_010428091.1| PREDICTED: transcription factor bHLH14-like [Camelina sativa]
Length=431

 Score =   236 bits (602),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 168/460 (37%), Positives = 228/460 (50%), Gaps = 105/460 (23%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDG-RLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             LQQ+L+F+++T  D WAY IFWQ   DD   + +L W DG F G K  +        Q +
Sbjct  34    LQQKLRFLVETSPDQWAYIIFWQKMIDDQSDQSYLVWVDGHFCGNKNNKS-------QEN  86

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
             H+T+  E + ++ G             GDL    E FY    A SF   DG   +  S  
Sbjct  87    HTTKSIECELMMDG-------------GDL----ELFY----ATSFYGEDGSRRRELSDE  125

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             SLVWL+G   L+  N ERAKEA  HG+ T V  P   G++ELGS + IK+NW+ + +V S
Sbjct  126   SLVWLTGLDELRFSNYERAKEASFHGVHTFVSAPIHNGIIELGSSDFIKQNWNFINRVTS  185

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             +  F   +T+   D          Q G     +                           
Sbjct  186   M--FGSGQTLELTD----------QTGSYRKPE---------------------------  206

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNA-----PKKRGRKPGAGRVTPVNHVEAERQRR  732
                  ES+HS+   Q +    I   +         K+    PG       +HVEAERQRR
Sbjct  207   -----ESDHSEIGNQQITSEKIRRTKLETTDVATAKENHHSPG------FSHVEAERQRR  255

Query  731   EKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV  552
             EKLNHRFYALR++VPNVS MDKASLLSDAVSYI  LK K+ +LE ++     K++K    
Sbjct  256   EKLNHRFYALRAIVPNVSGMDKASLLSDAVSYIQSLKTKISDLETEI-----KRLKTILT  310

Query  551   GDNQstssaassvaSPVDVE----------------VKIVGPDAMIRVQSENANYPSAKL  420
              +        SS  SP  V+                VK+VG +A++RVQ+EN N+P+  L
Sbjct  311   AETDQLDYNDSSNRSPSFVDKVNQRPSESNLEVEVEVKVVGDEAVVRVQTENVNHPTCAL  370

Query  419   MNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
             M+ L E++  V HA+ S +  IM+QD+VV VP+ LRSED 
Sbjct  371   MSTLMEMDCRVQHANASRLGQIMVQDVVVLVPDRLRSEDS  410



>ref|XP_006294316.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
 gb|EOA27214.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
Length=409

 Score =   235 bits (599),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 159/440 (36%), Positives = 227/440 (52%), Gaps = 66/440 (15%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P  + +Q+ LQ +L      W YAI+WQ S D+ G   L WGDGF++G +  +       
Sbjct  11    PVETAVQKLLQAVLDGTHRGWTYAIYWQPSFDNSGETVLVWGDGFYKGQEDSKRKT----  66

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI-TDAEWFYVMSLARSFSAGDGVPGK  1272
                S    Q    KV+  ++         E+ D+I TD EWFY+ S++ SFS G G+ G 
Sbjct  67    --KSTPADQEPWNKVMLELKP--------EDSDVIVTDIEWFYLKSMSWSFSRGSGLVGH  116

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             AFS  + VW+SG+ +++    ERAKE    G +T+ CIP   GV+ELGS E+I ++  L+
Sbjct  117   AFSTSTPVWVSGSDQIRRSGIERAKEEGDFGGETIACIPLANGVLELGSTELIPQSSDLI  176

Query  1091  QQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  912
              ++++LF                     L    S   D + V QS ++    K  +  +A
Sbjct  177   NKIQNLFN--------------------LNTLHSLSPDWVNVAQSSSSRVISKSRKLENA  216

Query  911   aaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRR  732
                    S P +     D + LK             KR  +    R  P +HVEAERQRR
Sbjct  217   C------SNPTNSSEVPDQKLLK-------------KRVTRSSKSREKPRDHVEAERQRR  257

Query  731   EKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKV  567
               LN  FYALR+VVP VS+MDK SLLSD ++YINELK KV     E  E ++QL E KK 
Sbjct  258   NNLNQLFYALRAVVPKVSKMDKESLLSDTITYINELKAKVDKAVSERNEIEIQLEEVKKE  317

Query  566   KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
               E          A+S     +++EVK++   AMI+V+S   N+P A++M  L ++EL V
Sbjct  318   LAE-------RRVASSKEPEGMEIEVKVIESYAMIKVKSSKQNHPEARMMKALMDMELEV  370

Query  386   HHASISSVNDIMLQDIVVKV  327
              HAS+  VND+M+Q   VK+
Sbjct  371   DHASVVVVNDLMVQQATVKM  390



>emb|CBI38690.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 131/187 (70%), Gaps = 33/187 (18%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG K              
Sbjct  17    SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQGGKG-------------  63

Query  1436  HSTQQSERKKVISGIQALIGSTQNSE-----NGDLITDAEWFYVMSLARSFSAGDGVPGK  1272
                          GIQALI  T+N +     +GD +TD EWFYVMSL R FSAGDGVPGK
Sbjct  64    ------------MGIQALI--TENPDMDGLMDGD-VTDVEWFYVMSLTRCFSAGDGVPGK  108

Query  1271  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLV  1092
             A S GSLVWL+GA  L  YNCERAKEAQIHGI T VCIPTG GV+ELGS ++I+ENW LV
Sbjct  109   ALSSGSLVWLTGAQELMFYNCERAKEAQIHGIDTFVCIPTGNGVLELGSSDVIRENWGLV  168

Query  1091  QQVKSLF  1071
             QQ KSLF
Sbjct  169   QQAKSLF  175


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 5/96 (5%)
 Frame = -2

Query  815  NAPKK--RGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV  642
            NA K+  RGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAV
Sbjct  194  NAKKEGIRGRKPRLGRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAV  253

Query  641  SYINELKGKVEELECQLQLRESKKVKVEAVG--DNQ  540
            SYINELK KV+ELE Q+  +ESKKVK+E     DNQ
Sbjct  254  SYINELKAKVDELESQVH-KESKKVKLEMADTTDNQ  288



>ref|NP_199495.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
 sp|Q9LUK7.1|BH028_ARATH RecName: Full=Transcription factor bHLH28; AltName: Full=Basic 
helix-loop-helix protein 28; Short=AtbHLH28; Short=bHLH 28; 
AltName: Full=Transcription factor EN 40; AltName: Full=bHLH 
transcription factor bHLH028 [Arabidopsis thaliana]
 gb|AAL55721.1|AF252636_1 putative transcription factor bHLH28 [Arabidopsis thaliana]
 dbj|BAA97217.1| bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAH30619.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95431.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
Length=511

 Score =   226 bits (577),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 173/477 (36%), Positives = 249/477 (52%), Gaps = 54/477 (11%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  1443
             +TL +RL  +L    + W+YAIFW+ S DD  G   L WGDG + G    +  G     +
Sbjct  32    TTLPKRLHAVLNGTHEPWSYAIFWKPSYDDFSGEAVLKWGDGVYTGGNEEKTRGRLRRKK  91

Query  1442  T--SHSTQQSERKKVISGIQALIG--------STQNSENGDLITDAEWFYVMSLARSFSA  1293
             T  S   ++  R  VI  +  +I            + ++   +TD EWF+++S+  SF  
Sbjct  92    TILSSPEEKERRSNVIRELNLMISGEAFPVVEDDVSDDDDVEVTDMEWFFLVSMTWSFGN  151

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+ GKAF+  + V ++G+  +    C+RAK+    G+QT++CIP+  GV+EL S E I
Sbjct  152   GSGLAGKAFASYNPVLVTGSDLIYGSGCDRAKQGGDVGLQTILCIPSHNGVLELASTEEI  211

Query  1112  KENWSLVQQVK-----------------SLFQFPEERTISFADIGLVSGHELLQQGRSA-  987
             + N  L  +++                  LF F  E + S    G  +   +  Q R   
Sbjct  212   RPNSDLFNRIRFLFGGSKYFSGAPNSNSELFPFQLESSCSSTVTGNPNPSPVYLQNRYNL  271

Query  986   -GADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNA  810
               +     L     GD     +    +     N  P + +SD   Q +     V  ++  
Sbjct  272   NFSTSSSTLARAPCGDVLSFGENVKQSFE---NRNPNT-YSD-QIQNVVPHATVMLEKKK  326

Query  809   PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
              KKRGRKP  GR  P+NHVEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YIN
Sbjct  327   GKKRGRKPAHGRDKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVCYIN  386

Query  629   ELKGKVEELEC-----QLQLRESKKV-----KVEAVGDNQstssaassvaSPVDVEVKIV  480
             ELK K E +E      ++Q  E K++      + +V   +  +S        + +EVKI+
Sbjct  387   ELKSKAENVELEKHAIEIQFNELKEIAGQRNAIPSVCKYEEKASEM------MKIEVKIM  440

Query  479   -GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  312
                DAM+RV+S   ++P A+LMN L +LEL V+HASIS +ND+M+Q   VK+  GLR
Sbjct  441   ESDDAMVRVESRKDHHPGARLMNALMDLELEVNHASISVMNDLMIQQANVKM--GLR  495



>gb|KCW72571.1| hypothetical protein EUGRSUZ_E01039 [Eucalyptus grandis]
Length=490

 Score =   222 bits (566),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 227/442 (51%), Gaps = 51/442 (12%)
 Frame = -2

Query  1580  QTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVI  1401
             + D W Y+IFW+ + DD G L L WGDG F+G K          + T +S  Q   K++ 
Sbjct  71    RPDDWVYSIFWRPTRDDRGCLVLTWGDGQFRGMKG---------LATHNSNNQRVSKELG  121

Query  1400  SGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAH  1230
             +   A   S+ N       + + D E ++++S+ RS+S+ + + G+A   G+ +WL G  
Sbjct  122   TPEGADFRSSSNMNTKLVQNEVCDLERYFIVSVTRSYSSKESILGRALCSGTYIWLCGED  181

Query  1229  RLQMYNCERAKEAQIHGIQTLVCI--PTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEE  1056
              L  Y CER +EA + GI+++VCI  P   GV+ELGS + ++E+WSLV   KSLF     
Sbjct  182   ELGSYECERVREASMTGIKSIVCISTPHDTGVLELGSTKRLQEDWSLVHSAKSLFNS---  238

Query  1055  RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAG--DaekqaqeasaaaaaaKNSYP  882
                 F   G++       Q      ++   L    A   D             +      
Sbjct  239   ---HFLSTGIIPHVHGEHQSNGVLKEECSTLDGAGASRCDTCPSDTFGPWGFKSDIKRAG  295

Query  881   ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
              S +  S C+       + + +    +  + P   R   +NHVEAERQRREKL  RFYAL
Sbjct  296   ASHNITSPCK----RAAITKMETDDAEPAQSPFPSR---LNHVEAERQRREKLKQRFYAL  348

Query  701   RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRE---------SKKVKVEAVG  549
             RSVVP   R           S INEL+G+V+ L  +  L +          K ++V  +G
Sbjct  349   RSVVPKELR-----------SRINELEGEVKFLPQKPSLNKVASPLGNETEKTLQVSKIG  397

Query  548   DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
                S S   +   S ++VEVK+VG +A++RV+S N ++P+A+LM+ L+ELEL VHHAS+S
Sbjct  398   --WSPSLNVAMGLSKMEVEVKVVGDEAVVRVRSPNRDHPAARLMDALKELELEVHHASLS  455

Query  368   SVNDIMLQDIVVKVPEGLRSED  303
             SV   MLQD+V++ P G  SE+
Sbjct  456   SVKGTMLQDVVIRTPIGWASEE  477



>gb|KHN47226.1| Transcription factor bHLH14-like protein [Glycine soja]
Length=355

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/444 (33%), Positives = 213/444 (48%), Gaps = 125/444 (28%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             + +QQRLQFIL+++ + W YAIFWQ + D D RL L +GDG+F+G               
Sbjct  24    NAVQQRLQFILQSRPEWWVYAIFWQATKDSDSRLKLEYGDGYFRGK--------------  69

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  1260
                 ++ E ++           T+N      + D EWFY MS  RS+ AGDGV G A+S 
Sbjct  70    ----EEKEEEQ-----------TRN------VNDIEWFYRMSQTRSYVAGDGVVGCAYSS  108

Query  1259  GSLVWLSGAHRLQMYNC-ERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
             G  VWLSG +  ++ +C +R +EA+ HGI TLVC+    G++ELGS  +    + L++  
Sbjct  109   GVDVWLSGVNEFELNDCDDRVREARSHGIHTLVCVYVPGGILELGSCHVFTLGYGLLEMA  168

Query  1082  KSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaa  903
             KS+F+  + +      +G+         G S  + D                        
Sbjct  169   KSVFEESQNQNPLNNPMGMNDATAAKVDGSSTDSSD------------------------  204

Query  902   aaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGR---VTPVNHVEAERQRR  732
                        +D+D  F    P+  R            G GR     P+NHVEAERQRR
Sbjct  205   -----------ADADATF----PMTRR------------GGGRAREALPMNHVEAERQRR  237

Query  731   EKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV  552
             EKLN RFY LRS                          K+  LE      +  +V     
Sbjct  238   EKLNQRFYTLRSA------------------------AKINHLESSANRPKQAQV-----  268

Query  551   GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  372
                     +++S +S + VEVKI+G +AMI VQS N N+P A+LM+ LR+L L + HA++
Sbjct  269   ------IHSSTSASSNMRVEVKILGAEAMIMVQSLNLNHPPARLMDALRDLNLQILHATM  322

Query  371   SSVNDIMLQDIVVKVPEGLRSEDG  300
             S++ ++MLQD+VVKVP  L ++D 
Sbjct  323   SNIKEMMLQDVVVKVPHDLMTQDA  346



>ref|XP_010456176.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Camelina 
sativa]
Length=333

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 190/366 (52%), Gaps = 80/366 (22%)
 Frame = -2

Query  1340  DAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVC  1161
             D E FY    A SF   DG   K  S  SLVWL+G   L+  N ERAKEA  HG+ T V 
Sbjct  6     DIELFY----ATSFYGDDGSRRKEISDESLVWLTGLDELRFSNYERAKEASFHGVHTFVS  61

Query  1160  IPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGA  981
              P   G++ELGS + IK+NW+ + +V S+F     +T+   D          Q G     
Sbjct  62    APIHNGIIELGSSDSIKQNWNFINRVTSMF--GSGQTLELTD----------QTG-----  104

Query  980   DDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPK-  804
                                           SYP+ E SD          I ++Q  + K 
Sbjct  105   ------------------------------SYPKPEESDYS-------EIGNQQITSEKI  127

Query  803   KRGRKPGAGRVTP--------VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  648
             +R +    G  T          +HVEAERQRREKLNHRFYALR+VVPNVS MDKASLLSD
Sbjct  128   RRTKLETTGVATAKENHPSPGFSHVEAERQRREKLNHRFYALRAVVPNVSGMDKASLLSD  187

Query  647   AVSYINELKGKVEELECQLQLRESKKVKVEAVGD------NQstssaassvaSP----VD  498
             AVSYI  LK ++ +LE +++   + K  + A  D      N+S S        P    ++
Sbjct  188   AVSYIQSLKTRINDLESEIK---NLKTILTAETDHNYNSSNRSPSFVDKVNQKPSKSNLE  244

Query  497   VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  318
             V+VK+VG +A++RVQ+EN N+P+  LM  L E++  V HA+ S +  IM+QD+VV VP+ 
Sbjct  245   VQVKVVGDEAVVRVQTENVNHPTCALMTTLMEMDCRVQHANASRLGQIMVQDVVVLVPDR  304

Query  317   LRSEDG  300
             LRSED 
Sbjct  305   LRSEDS  310



>ref|XP_010058363.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=406

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 199/366 (54%), Gaps = 31/366 (8%)
 Frame = -2

Query  1346  ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTL  1167
             ++D E +Y++S  RS+S  + + G A   G+ +WL G   L +Y CER +EA+  GI+++
Sbjct  41    VSDLERYYIVSATRSYSFEESILGWALCSGTHIWLCGEDELGIYECERVREARTTGIKSI  100

Query  1166  VCI--PTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGR  993
             VCI  P   GV+ELGS + + E+WSLV+  KSLF      T  F   G+        Q  
Sbjct  101   VCISTPCDTGVLELGSTKRLHEDWSLVRLAKSLF------TSHFLSTGITPHVHEEHQSN  154

Query  992   SAGADDLKVLQSRAAG--DaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQ  819
                 +    L        D           +         S++  S  + +     + + 
Sbjct  155   GVPKEACSALDGTGTSRSDTCPSETYGLLGSKRDLKRVGVSQNITSSNKSV----TIAKM  210

Query  818   QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  639
             +    +  R P   R+   NHVEAERQRREKL   FYALRSVVP V++MDKASLLSDAVS
Sbjct  211   ERDETEIARLPSPLRL---NHVEAERQRREKLKQGFYALRSVVPKVTKMDKASLLSDAVS  267

Query  638   YINELKGKVEELECQLQLRESK----KVKVEAVGDNQstssaassvaSP----------V  501
             YI EL+ +++ELE +L+    K    KV        +  S  +   +SP          +
Sbjct  268   YIKELRSRIDELEGELKFPPPKIGLSKVAGRFGDKTEPISPVSKIGSSPWLNVVKGLSKM  327

Query  500   DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  321
             +V VK+VG +A++ V+S N ++P+A+LM  L+EL+L VHHAS+SSV D+MLQD+V++ P 
Sbjct  328   EVGVKVVGDEAVVWVRSPNWDHPAARLMGALKELQLEVHHASMSSVKDMMLQDVVIRTPI  387

Query  320   GLRSED  303
             G  SE+
Sbjct  388   GWASEE  393



>ref|XP_002302637.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE81910.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=555

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 229/462 (50%), Gaps = 58/462 (13%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV--VQTSHSTQQSERKKVIS  1398
             SW YAIFWQ S    G   L WGDG  +  K G       +  ++    TQQ  RK+VI 
Sbjct  69    SWNYAIFWQISCSKSGDWVLGWGDGSCREPKEGEESEFTRILNIRLEDETQQRMRKRVIQ  128

Query  1397  GIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHR  1227
              +Q L G +         D +TD E F++ S+  SF  G+G PG  ++ G  VW+S A +
Sbjct  129   KLQTLFGESDEDNYALGLDRVTDTEMFFLASMYFSFPRGEGGPGNCYASGKHVWISDALK  188

Query  1226  LQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQ-------  1068
                  C R+  A+  G QT+V + T  GVVELGS+  + E+  +VQ ++S F        
Sbjct  189   SGPDYCVRSFLARSAGFQTIVLVATDVGVVELGSVRSVPESIEMVQSIRSWFSTRSSKLK  248

Query  1067  ------------FPEERT----ISFA-DIGLVSGHELLQQGRSAGADDLK-----VLQSR  954
                         FP  R      S+A   GL  G      G  A A++LK     V +  
Sbjct  249   ELRRFLNGSRLAFPGTRNRLHGSSWAQSFGLKQGTPGEVYGSQATANNLKELVNGVREEF  308

Query  953   AAGDaekqaqeasaaaaaaKNSYP---------ESEHSDSDCQFLKEPPIVDRQQNAPKK  801
                  + Q Q       +   S P         ESEHSD +    +E P     +   K+
Sbjct  309   RHNHYQGQKQVQVQIDFSGATSGPSGIGRPLGAESEHSDVEASCKEERPGAADDRRPRKR  368

Query  800   RGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELK  621
               +    GR  P+NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA+SYINEL+
Sbjct  369   GRKPAN-GREEPLNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAISYINELQ  427

Query  620   GKVEELECQLQ-----LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRV  456
              K++++E +       +R+S  + V   G++ + +          DV+++    + M+RV
Sbjct  428   AKLKKMEAERGKLEGVVRDSSTLDVNTNGESHNQAR---------DVDIQASHDEVMVRV  478

Query  455   QSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVK  330
                  ++P+++++  L+E ++ V  + +S+ ND +    V+K
Sbjct  479   SCPMDSHPASRVIQALKEAQVTVIESKLSAANDTVFHTFVIK  520



>emb|CBI34590.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 15/169 (9%)
 Frame = -2

Query  809  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
            PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+
Sbjct  142  PKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIH  201

Query  629  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQS  450
            ELK K+++LE +L+  E +K K  A G            A  ++V+VKI+G +AMIRVQ 
Sbjct  202  ELKTKIDDLETKLR-EEVRKPK--AYG------------AIRMEVDVKIIGSEAMIRVQC  246

Query  449  ENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+VV++PEGL SE+
Sbjct  247  PDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEE  295


 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  1358  NGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHG  1179
             +GD+ T  EW+Y++S+ +SF  GDGV G+ FS G+ VWL+    LQ Y+CER  EA+++G
Sbjct  2     DGDVAT-WEWYYMVSVTKSFVVGDGVLGRVFSSGAFVWLTD-RELQCYDCERVTEARMNG  59

Query  1178  IQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF  1071
             I+TL+C+ T  GV+ELGSL++IKE+W LV   KSLF
Sbjct  60    IRTLLCVSTSCGVLELGSLDMIKEDWGLVLLAKSLF  95



>ref|XP_006439218.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
 gb|ESR52458.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
Length=519

 Score =   206 bits (523),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  486
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  485  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  305  D  303
            +
Sbjct  507  E  507



>ref|XP_006476285.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
Length=519

 Score =   205 bits (522),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  486
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  485  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  305  D  303
            +
Sbjct  507  E  507


 Score =   189 bits (481),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 128/198 (65%), Gaps = 16/198 (8%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-------AG  1473
             Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K       AG
Sbjct  18    QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSKDFATRAAAG  77

Query  1472  RGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARS  1302
             + G               ERKKV   +Q   G   + +   +GD +TD EW+Y +S+ RS
Sbjct  78    KQGAG----NEPKFGFFLERKKVSKEVQVHFGEDMDLDRMVDGD-VTDGEWYYTVSVTRS  132

Query  1301  FSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
             F+ GDG V G+ FS G  VWL+G H LQ+Y CER KEA++HGIQTLVC+ T  GVVELGS
Sbjct  133   FAIGDGSVLGRVFSSGDYVWLTGDHELQLYECERVKEARMHGIQTLVCVSTACGVVELGS  192

Query  1124  LEIIKENWSLVQQVKSLF  1071
              ++IKE+WSLVQ  KSLF
Sbjct  193   SDLIKEDWSLVQLAKSLF  210



>gb|KDO76730.1| hypothetical protein CISIN_1g010053mg [Citrus sinensis]
Length=519

 Score =   205 bits (522),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  486
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  485  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  305  D  303
            +
Sbjct  507  E  507



>gb|ACF05947.1| MYC1 [Hevea brasiliensis]
Length=476

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 8/175 (5%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGRK   G + P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGELLPINHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  468
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQAV-SKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  467  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  464


 Score =   173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 125/209 (60%), Gaps = 7/209 (3%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             MDEL  TS SSSS   S  Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+
Sbjct  6     MDEL--TSPSSSSSFMSFCQDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLS  63

Query  1508  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITD  1338
             WGDG F+GT+           Q        ERK      Q L       +   + D I D
Sbjct  64    WGDGHFRGTEEFAAKACCKQNQLKFGFNL-ERKMTNKESQTLFSDDMEMDRLADVDAI-D  121

Query  1337  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  1158
              EWFY +S+ RSF+  DG+ GK F   + + L+G H LQMY CER KEA++HG+QTLVCI
Sbjct  122   YEWFYTVSVTRSFAVEDGILGKTFGSWAFIXLTGNHELQMYECERVKEARMHGVQTLVCI  181

Query  1157  PTGAGVVELGSLEIIKENWSLVQQVKSLF  1071
              T  GVVELGS   I ++WSLVQ  KSLF
Sbjct  182   STTCGVVELGSSNTIDKDWSLVQLCKSLF  210



>ref|XP_009101673.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=377

 Score =   200 bits (508),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 188/365 (52%), Gaps = 64/365 (18%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTS-NDDDGRLFLAWGDGFFQG---TKAGRGGG  1461
             P  +TL++RL  ++K   ++W YAIFW+ S +D  G   L WG G ++G   T   R   
Sbjct  22    PGETTLKERLHAVVKVTHEAWCYAIFWKPSYHDISGEPVLKWGYGVYKGEDETDKTRRR-  80

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGSTQ---NSENGDL-ITDAEWFYVMSLARSFSA  1293
                  + +++ ++ +R KV+  +   I         E+ D+ +TD EWFY++S+  SF +
Sbjct  81    -----RKTNAEEKLQRNKVLRELSLTISGVSFPVKDEDDDVELTDMEWFYLVSMTCSFRS  135

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+ GKAF+  + VW++G   +    C RA +    G+QT+VCIP+  GV+ELGS E I
Sbjct  136   GSGLAGKAFATYNPVWITGLDMINGSGCSRANQGGDLGLQTIVCIPSDNGVLELGSTEQI  195

Query  1112  KENWSLVQQVKSLFQF------------PEERTISFADIGLVSGHELLQQGRSAGADDLK  969
             +EN    ++++ LF F            P    I    I   +        RS+ A+D+K
Sbjct  196   RENTGFFRKIRFLFNFKGYGAMNSSKPRPVYPPIQNNIIFSTATSSTSTTVRSSFAEDIK  255

Query  968   VLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRK  789
             +                            ES+HS+           +D +    +KR +K
Sbjct  256   L---------------------------EESDHSN-----------IDVKAKLKRKRQKK  277

Query  788   PGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  609
             P  GR  P+NHVEAER RREKLN RFYALR+VVPN++ MDKASLL D V YINELK   E
Sbjct  278   PTHGREEPMNHVEAERLRREKLNQRFYALRAVVPNITGMDKASLLEDTVRYINELKLNAE  337

Query  608   ELECQ  594
               E +
Sbjct  338   NAESK  342



>gb|EYU32259.1| hypothetical protein MIMGU_mgv1a021930mg [Erythranthe guttata]
Length=500

 Score =   202 bits (513),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 221/451 (49%), Gaps = 36/451 (8%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTD---SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             N+  LQ +L  +++ Q     SW YAIFWQ S    G   L WGDG  +  +   G    
Sbjct  44    NNENLQNKLSDLVEHQHPTRISWNYAIFWQLSRSKSGEFVLGWGDGCCREPRENEGSEFT  103

Query  1454  VVVQT--SHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAG  1290
                ++     + Q  RK+V+  +  L G T         D +TD E F++ S+  SF  G
Sbjct  104   RNPKSRIEDESLQRMRKRVLQRMHTLFGGTDEDSYAFGLDKVTDTEMFFLASMYFSFPRG  163

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G PGK F     VWL+ A    +  C R+  A+  G+QT+V IPT  GVVELGS   I 
Sbjct  164   VGGPGKCFGSSKYVWLTNAMVTPVDYCVRSFLAKSAGMQTIVLIPTDVGVVELGSARYIA  223

Query  1109  ENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGAD-DLKVLQSRAAGDaek  933
             EN  ++  + S F            +  V G     + R A AD +   + +R       
Sbjct  224   ENSEVLNAIGSSFSSSSRNK----QVAAVDG-----RNRDADADVNGNRMPTRNGFHPSA  274

Query  932   qaqeasaaaaaaKN----SYP---ESEHSD---SDCQFLKEPPIVDRQQNAPKKRGRKPG  783
                     A  A +    S P   ESEHSD   + C+  +   ++  +   P+KRGRKP 
Sbjct  275   WTNSNYGNATGASSMSVISRPQSVESEHSDIEAASCKLEEPVGVLLLEDKKPRKRGRKPA  334

Query  782   AGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL  603
              GR  P+NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++YI EL+ KV+++
Sbjct  335   NGREEPLNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAIAYITELQRKVKDM  394

Query  602   ECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAK  423
             E +   R  +    EA   N        S      VEV+       +RV      +P+++
Sbjct  395   ESE---RGGEASASEASNKNVLEVQEWGSR-----VEVEAGRDKVTVRVSCPVGAHPASR  446

Query  422   LMNGLRELELAVHHASISSVNDIMLQDIVVK  330
             ++  +++    +  A +++ ++ +    VVK
Sbjct  447   VIRAIKDAGGNIVDAQMATGSERVFHTFVVK  477



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 147/217 (68%), Gaps = 27/217 (12%)
 Frame = -2

Query  881  ESEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            ESEHSD +    KE    +V+++   P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  75   ESEHSDVEAASFKEMEEAVVEKK---PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  131

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES--KKVKVEAVGDNQ--  540
            ALR+VVPNVS+MDKASLL DAVSYINEL+ KV+ELE + +  ES  +  K E +  +   
Sbjct  132  ALRAVVPNVSKMDKASLLGDAVSYINELRSKVQELETERKELESHVEATKKELLSSHSGF  191

Query  539  ------stssaassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMN  414
                       +SS   P            +D++V+++G +AM+R+QS   N+P+A+LM 
Sbjct  192  SGANFGFAKDLSSSSRVPDSKGFGTKQCPGLDLDVRVLGAEAMVRIQSGKKNHPAARLMT  251

Query  413  GLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
              +ELEL VHHAS+S+VN++MLQ+++V++P+ L +E+
Sbjct  252  AFQELELEVHHASVSTVNELMLQNVIVRLPKSLYTEE  288



>gb|ACF19982.1| MYC2 [Hevea brasiliensis]
Length=476

 Score =   197 bits (500),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGR    G+   +NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRTQLNGKELTLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  468
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQA-VSKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  467  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  464


 Score =   181 bits (458),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 117/189 (62%), Gaps = 3/189 (2%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK         
Sbjct  23    QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTKEFAAKACNK  82

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVP  1278
               Q        ERK +    Q L     + +   D+ + D EWFY +S+ RSF+  DG+ 
Sbjct  83    QNQPKFGFNL-ERKMINKESQTLFTDDMDMDRLADVDVIDYEWFYTVSVTRSFAIDDGIL  141

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+ F  G+ +WL+G + LQMY+CER KEA++HGIQTLVCI T   VVELGS   I ++WS
Sbjct  142   GRTFGSGAFIWLTGNNELQMYDCERVKEARMHGIQTLVCISTSCAVVELGSSNTIDKDWS  201

Query  1097  LVQQVKSLF  1071
             LVQ  KSLF
Sbjct  202   LVQLCKSLF  210



>ref|XP_006830285.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
 gb|ERM97701.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
Length=459

 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = -2

Query  809  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
            PKKRGRKPG GRV P+NHVEAERQRREKLN RFYALR+VVP+VS+MDKASLL+DAVSYIN
Sbjct  267  PKKRGRKPGNGRVVPLNHVEAERQRREKLNRRFYALRAVVPHVSKMDKASLLADAVSYIN  326

Query  629  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP----VDVEVKIVGPDAMI  462
            +LK KV+ LE  LQ   S +   +   D +     + S  +      ++EVKI+G DA+I
Sbjct  327  QLKAKVQHLESALQKLGSDEKTTQKDSDGKLMPDTSGSEGAEWNGIAELEVKIMGQDAII  386

Query  461  RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            RVQSE+  +P+AKLM  L EL L VHHAS+S+V  +M+QD+VV+VPEG    D
Sbjct  387  RVQSESTGHPAAKLMRALEELGLPVHHASVSNVKGLMVQDVVVRVPEGSPCSD  439


 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (63%), Gaps = 8/185 (4%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL-FLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             LQQ L  +L T+T+ W YAIFW+ S+D   +   L WG+GFF+G       G      T 
Sbjct  24    LQQSLHHLLNTRTEWWEYAIFWEASHDSLPQAPVLVWGEGFFRGPT----DGCNPSQMTK  79

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPGKAF  1266
                QQ ERKKV+  +QA++    + +   L   ++D EWFY++SL +SF   +G+P   F
Sbjct  80    SEAQQMERKKVLRDLQAMMEVDPDGDGFSLDSDVSDLEWFYMVSLTKSFMGAEGLPAHVF  139

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
               G  +WL+G+H +Q YNCER KEA +HGIQ++ CIP   GV+ELGS+++I E+WSL++ 
Sbjct  140   VAGRPIWLTGSHSIQSYNCERTKEAHLHGIQSMACIPIANGVLELGSMDLIPEDWSLLET  199

Query  1085  VKSLF  1071
               S+F
Sbjct  200   FTSIF  204



>ref|XP_004309579.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 131/175 (75%), Gaps = 7/175 (4%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            +KR +     R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YIN 
Sbjct  266  RKRRKSDKGERDSPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYINN  325

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDN-----QstssaassvaSPVDVEVKIVGPDAMI  462
            LK K+EELE ++   + KK K   + DN     Q T+S     A+  +V+VKIVG +AMI
Sbjct  326  LKTKIEELEAKIHA-QPKKHKSSVMSDNTLDYSQMTNSLTYRAAAATEVDVKIVGSEAMI  384

Query  461  RVQS-ENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  300
            RV+  ++ +YP+A+LMN L++LEL +HHASISSVND MLQD+V +VP+G  SE+ 
Sbjct  385  RVRCPDDEDYPNARLMNALKDLELHIHHASISSVNDFMLQDVVARVPDGFTSEEA  439


 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (63%), Gaps = 8/172 (5%)
 Frame = -2

Query  1619  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             +TLQQRLQ I++ + + W Y+IFWQ S D +G L L+W  G  +GT+      +    Q 
Sbjct  23    NTLQQRLQLIVQNRPELWVYSIFWQASKDRNGVLSLSWAGGHSRGTRDFSSKKLDNYYQP  82

Query  1439  SHSTQ-QSERKKVISGIQALIGSTQNSE-NGDLITDAEWFYV--MSLARSFSAGDG---V  1281
                 + Q+ +K +   +QAL     + + NGD +TD+EWFY   +SL +SF+AG G   +
Sbjct  83    KFGLELQTPKKGINRQVQALFQEDMDMDINGD-VTDSEWFYFYSLSLTQSFAAGHGNNNI  141

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  1125
              G+ F  G+ VWL+G H  Q+Y CER KEA+++GIQTLVCIPT  GV+EL S
Sbjct  142   VGRTFCSGAFVWLAGDHEFQLYECERVKEARMYGIQTLVCIPTPDGVIELNS  193



>gb|AEG74013.1| lMYC3 [Hevea brasiliensis]
Length=475

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKR +K   G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  285  KKRAKKLQNGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  344

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------VDVEVKIVGPDA  468
            LK KV+ELE +LQ   +KK K   V DNQST S    +  P       +++EVKIVG +A
Sbjct  345  LKAKVDELESKLQAV-TKKSKNTNVTDNQSTDSLIDQIRDPSIYKTKAMELEVKIVGSEA  403

Query  467  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  404  MIRFLSPDINYPAARLMDVLREIEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  458


 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 115/189 (61%), Gaps = 3/189 (2%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  1452
             Q     LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F GTK         
Sbjct  18    QETSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFCGTKEFAAKACNK  77

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVP  1278
             + Q        ERK +      L G   + +   D+ + D EWFY +S+ RSF+  DG+ 
Sbjct  78    LNQPKFGFNL-ERKMINKESPTLFGDDMDMDRLVDVEVIDYEWFYTVSVTRSFAVEDGIL  136

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+ F  G+ +WL+G H LQM+ CER KEA++HGIQTL CI T  GVVELGS   I ++WS
Sbjct  137   GRTFGSGAFIWLTGNHELQMFGCERVKEARMHGIQTLACISTTCGVVELGSSNTIDKDWS  196

Query  1097  LVQQVKSLF  1071
             LVQ  KSLF
Sbjct  197   LVQLCKSLF  205



>gb|KFK37416.1| hypothetical protein AALP_AA4G254100 [Arabis alpina]
Length=514

 Score =   193 bits (491),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 142/441 (32%), Positives = 217/441 (49%), Gaps = 55/441 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGF------FQGTKAGRGGGVPVVVQTSHSTQQSERK  1410
             SW YAIFWQ +    G+  L WGDG        + +K     G+           Q  RK
Sbjct  66    SWNYAIFWQQTMSRSGQQVLGWGDGCCREPNDLEESKMVSSFGL-----EEEERLQEMRK  120

Query  1409  KVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLS  1239
             +V+  +  L G +         + +T  E F++ S+   F+ G+G PG  ++    VWLS
Sbjct  121   RVLQKLHRLFGGSDEDNYALSLEKVTATEIFFLASMYFFFNHGEGGPGNCYASRKHVWLS  180

Query  1238  GAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPE  1059
              A       C R+  A+  GI+T+V +PT AGV+E+GS+  + EN  LV  V+ LF    
Sbjct  181   DAVNSDSDYCFRSFMAKSAGIRTIVMVPTDAGVLEVGSVWSLPENVELVNSVQGLFM---  237

Query  1058  ERTISFADIGLVSGHEL----LQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKN  891
              R+++         H+L    L     A    L+V +    G                 +
Sbjct  238   -RSVNVKPPLNGGIHKLFGQDLNNSDHAYPKKLEVDRFTPQGS----FGVKVQENVFVGS  292

Query  890   SYPESEHS---DSDCQFLKEPP-----------IVDRQQNAPKKRGRKPGAGRVTPVNHV  753
             S P S ++    SD    K P            IV+ ++  P+KRGRKP  GR  P+NHV
Sbjct  293   SVPASTNTQLEKSDSCTEKGPASLLALGGGAGTIVEEKR--PRKRGRKPANGREEPLNHV  350

Query  752   EAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK  573
             EAERQRREKLN RFYALR+VVPN+S+MDKASLL DA+SYI EL+ KV+ +E +       
Sbjct  351   EAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAISYIKELQEKVKIMEAER------  404

Query  572   KVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  393
                    G  +S+ S ++   +  ++ ++ +  + ++RV S    +P++++++ +R  E+
Sbjct  405   -------GRTESSLSESNQTTTSPEINIQTINEEVVVRVNSPLDTHPASRIIHAMRNSEV  457

Query  392   AVHHASISSVNDIMLQDIVVK  330
              V  + +S   D M    V+K
Sbjct  458   NVMESKLSLAEDTMFHTFVIK  478



>ref|XP_007209110.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
 gb|EMJ10309.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
Length=466

 Score =   190 bits (483),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 128/196 (65%), Gaps = 27/196 (14%)
 Frame = -2

Query  806  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  633
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  260  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  319

Query  632  NELKGKVEELECQLQ-------------LRESKKVKVEAVGDNQstssaassvaSP----  504
            N+LK KVEELE ++Q             L         ++ D+        +   P    
Sbjct  320  NKLKAKVEELEAKIQQPPQKPKLGILSNLEHQSNQSASSIVDHHRHHHHHQARPRPASSY  379

Query  503  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  348
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  380  TNSEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  439

Query  347  QDIVVKVPEGLRSEDG  300
            QD+V +VP G  SE+ 
Sbjct  440  QDVVARVPHGFTSEEA  455


 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 127/196 (65%), Gaps = 10/196 (5%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14    QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  1460  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  1290
             +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF A 
Sbjct  74    LVHNYQPKSGFISTERKKVVNREVEALFNEDMDLDGGD-VTDSEWFYFYTVSLTQSFGAC  132

Query  1289  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  1119
              G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133   HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192

Query  1118  IIKENWSLVQQVKSLF  1071
             +IKE+W LV+  KSLF
Sbjct  193   VIKEDWGLVELSKSLF  208



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   192 bits (488),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 139/193 (72%), Gaps = 13/193 (7%)
 Frame = -2

Query  878  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  699
            S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR
Sbjct  409  SDHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  464

Query  698  SVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDNQ  540
            +VVPNVS+MDKASLL DA+SYINELK K++       ++ECQL+  +S+     A   N+
Sbjct  465  AVVPNVSKMDKASLLGDAISYINELKSKLQRTESEKTQIECQLENLKSELAGRNANAGNR  524

Query  539  stssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  366
                ++S+V+ P+  ++EVKI+G DAMIR++S   N+P+A+LM+ L++LEL V+HAS+S 
Sbjct  525  DCGDSSSAVSKPIGMEIEVKIIGWDAMIRIESSKRNHPAARLMSALKDLELEVNHASMSV  584

Query  365  VNDIMLQDIVVKV  327
            VND+M+Q   VK+
Sbjct  585  VNDLMIQQATVKM  597


 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 124/205 (60%), Gaps = 10/205 (5%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVVVQT  1440
             +LQQRLQ +++   +SW YA+FWQ S D  G   L WGDG+++G +   R    P     
Sbjct  51    SLQQRLQALIEGAHESWTYAMFWQLSCDFSGAAVLGWGDGYYKGEEDKARAKQRPRSSMF  110

Query  1439  SHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKA  1269
             S   +Q  RKKV+  + +LI G    +E+   + +TD EWF+++S+ +SF +G G+ GKA
Sbjct  111   SSPAEQEHRKKVLRELNSLISGGAVTTEDAIDEEVTDMEWFFLVSMTQSFPSGSGLTGKA  170

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
             FS  + VW+ G+ +L    CERA++  + G+QT+ CIP   GVVELGS E+I+++  L+ 
Sbjct  171   FSTSNPVWVVGSDQLSGSGCERARQGGVFGLQTIACIPLANGVVELGSTEMIRQSSDLMN  230

Query  1088  QVKSLFQFPEERTISFADIGLVSGH  1014
             +V+ LF F        A  G +SGH
Sbjct  231   KVRILFSF------DGAAAGDLSGH  249



>ref|XP_008245836.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=492

 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 131/196 (67%), Gaps = 27/196 (14%)
 Frame = -2

Query  806  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  633
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  632  NELKGKVEELECQLQLRESKKVKV-------------EAVGDNQstssaassvaSP----  504
            N+LK +VEELE ++Q  +  K+ +              ++ D+        +   P    
Sbjct  346  NKLKARVEELEAKIQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASSY  405

Query  503  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  348
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  406  TNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  465

Query  347  QDIVVKVPEGLRSEDG  300
            QD+V +VP G  SE+ 
Sbjct  466  QDVVARVPHGFTSEEA  481


 Score =   177 bits (448),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 128/196 (65%), Gaps = 10/196 (5%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14    QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  1460  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  1290
             +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF+A 
Sbjct  74    LVHNYQPKSGFISTERKKVVNREVEALFHEDMDLDGGD-VTDSEWFYFYTVSLTQSFAAC  132

Query  1289  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  1119
              G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133   HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192

Query  1118  IIKENWSLVQQVKSLF  1071
             +IKE+W LV+  KSLF
Sbjct  193   VIKEDWGLVEVSKSLF  208



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   192 bits (488),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 140/205 (68%), Gaps = 13/205 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKE---PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            ES+HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  453  ESDHSDLEASVVKEVESSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  511

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQL--RESKKVKVE  558
            YALR+VVPNVS+MDKASLL DA++YINELK KV       EEL  QL+L  +E     + 
Sbjct  512  YALRAVVPNVSKMDKASLLGDAIAYINELKSKVQSVESDKEELRSQLELVKKELGTKDMR  571

Query  557  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
            +        + +S+V   +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHA
Sbjct  572  SAPPPAHDLNMSSNVKVDMDIDVKIIGWDAMIRVQCSKKNHPAAKLMLALRELDLDVHHA  631

Query  377  SISSVNDIMLQDIVVKVPEGLRSED  303
            S+S VND+M+Q   VK+     S+D
Sbjct  632  SVSVVNDLMIQQATVKMEGRFYSQD  656


 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 118/191 (62%), Gaps = 9/191 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TLQQRL  +++   +SW YAIFWQ+S  D  G   L WGDG+++G +          
Sbjct  92    NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEE-----NTGKR  146

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  1278
                S   +Q  RKKV+  + +LI   Q + +  +   +TD EWF+++S+ ++F  G G+P
Sbjct  147   KTASSPAEQEHRKKVLRELNSLISGPQATTDDAVDEEVTDTEWFFLISMTQNFVNGSGLP  206

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+A    S VW++G+ RL   +CERA++AQ  G+QTLVCIP+  GVVELGS E+I ++  
Sbjct  207   GQALYSSSPVWVTGSDRLAASHCERARQAQGFGLQTLVCIPSSNGVVELGSTELIFQSSD  266

Query  1097  LVQQVKSLFQF  1065
             L+ +V+ LF F
Sbjct  267   LMNKVRILFNF  277



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   191 bits (486),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 135/194 (70%), Gaps = 14/194 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  398  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  452

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK----VKVEAVG  549
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  453  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  512

Query  548  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  513  DLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  572

Query  368  SVNDIMLQDIVVKV  327
             VND+M+Q   VK+
Sbjct  573  VVNDLMIQQATVKM  586


 Score =   156 bits (394),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 119/194 (61%), Gaps = 10/194 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  1455
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  1454  VVVQTSHSTQQSERKKVISGIQALI----GSTQNSENGDLITDAEWFYVMSLARSFSAGD  1287
                 T     Q  RKKV+  + +LI    G T ++ + + +TD EWF+++S+ +SF+ G 
Sbjct  112   PPFSTP--ADQEYRKKVLRELNSLISGGCGPTDDAVD-EEVTDTEWFFLVSMTQSFACGS  168

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+ GKAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELGS E I++
Sbjct  169   GLAGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTEQIRQ  228

Query  1106  NWSLVQQVKSLFQF  1065
             +  L+ +V+ LF F
Sbjct  229   SSDLMNKVRVLFNF  242



>gb|ADK56287.1| LMYC1 [Hevea brasiliensis]
Length=476

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -2

Query  806  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  627
            KKRGRK   G   P+NHVEAERQRRE+LNHRFYALRS VPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGEELPINHVEAERQRRERLNHRFYALRSAVPNVSKMDKASLLADAVTYIKE  350

Query  626  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  468
            LK  V+EL+ +L+   SKK K   V DNQST        S++S  A  ++++V IVG +A
Sbjct  351  LKATVDELQSKLEAV-SKKSKSTNVTDNQSTDSMIDHMRSSSSYKAKGMELDVTIVGSEA  409

Query  467  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+VV+VP+GL  E+
Sbjct  410  MIRFLSPDVNYPAARLMDVLREVEFKVHHASMSSIKEMVLQDVVVRVPDGLTDEE  464


 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 126/209 (60%), Gaps = 7/209 (3%)
 Frame = -2

Query  1688  MDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  1509
             MDEL  TS SSSS   S  Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+
Sbjct  6     MDEL--TSPSSSSSFMSFCQDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLS  63

Query  1508  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITD  1338
             WGDG F+GT+           Q        ERK      Q L       +   + D I D
Sbjct  64    WGDGHFRGTEEFAAKACCKQNQLKFGFNL-ERKMTNKESQTLFSDDMEMDRLADVDAI-D  121

Query  1337  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  1158
              EWFY +S+ RSF+  DG+ GK F   + +WL+G H LQMY CER KEA++HG+QTLVCI
Sbjct  122   YEWFYTVSVTRSFAVEDGILGKTFGSWAFIWLTGNHELQMYECERVKEARMHGVQTLVCI  181

Query  1157  PTGAGVVELGSLEIIKENWSLVQQVKSLF  1071
              T  GVVELGS   I ++WSLVQ  KSLF
Sbjct  182   STTCGVVELGSSNTIDKDWSLVQLCKSLF  210



>ref|XP_010100202.1| hypothetical protein L484_015347 [Morus notabilis]
 gb|EXB81873.1| hypothetical protein L484_015347 [Morus notabilis]
Length=506

 Score =   189 bits (480),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 129/188 (69%), Gaps = 16/188 (9%)
 Frame = -2

Query  815  NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
            N  KKRGRKP  G   PVNHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLL+DAV Y
Sbjct  308  NRIKKRGRKPVIGNSLPVNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVVY  367

Query  635  INELKGKVEELECQLQLRESKK-VKVEAVGDNQstssaassvaSPV--------------  501
            INELK K+ ELE Q+ L +S + +K+     N +    + S  + V              
Sbjct  368  INELKSKINELETQVHLSQSNRPLKMGITMCNSTPKFESQSTYNIVEHKRKYSSYGSVGA  427

Query  500  -DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             +V+VKIVG +AMIRVQ  + NYP A+LMN LR+LE  + H S+SSV +++LQD+VV+VP
Sbjct  428  MEVDVKIVGTEAMIRVQCPDVNYPPARLMNALRDLEFQILHVSVSSVKELVLQDVVVRVP  487

Query  323  EGLRSEDG  300
            +   SE+ 
Sbjct  488  DRFPSEEA  495


 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (66%), Gaps = 8/190 (4%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSND----DDGRLFLAWGDGFFQGTK---AGRGGGV  1458
             T+QQRLQFIL+T+ + W Y+IFWQ   D      G + L+W  G+F+GTK   A +G  V
Sbjct  27    TIQQRLQFILQTRPEWWVYSIFWQAYKDVTIGSKGDVSLSWNGGYFRGTKNDVARKGNDV  86

Query  1457  PVVVQTSHSTQQSERKKVISGIQALIGSTQNSE-NGDLITDAEWFYVMSLARSFSAGDGV  1281
                V      +++     +  IQAL G+    E + D+++D EWFY +SL+R+F+A  G 
Sbjct  87    VETVFGFDLEKKASTTSRVGDIQALFGNDSGQEMDVDVLSDIEWFYTVSLSRTFAAESGA  146

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
              G++FS G+ VWL+G+  L +Y CER KEA++HGIQTLVCI T  GV+ELGS ++IKE+W
Sbjct  147   IGRSFSSGAYVWLTGSEELLLYECERVKEARMHGIQTLVCIATPNGVLELGSSDLIKEDW  206

Query  1100  SLVQQVKSLF  1071
             SLVQ  KSL 
Sbjct  207   SLVQLAKSLL  216



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   191 bits (485),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 135/194 (70%), Gaps = 14/194 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  403  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  457

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK----VKVEAVG  549
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  458  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  517

Query  548  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  518  DLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  577

Query  368  SVNDIMLQDIVVKV  327
             VND+M+Q   VK+
Sbjct  578  VVNDLMIQQATVKM  591


 Score =   154 bits (389),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 115/193 (60%), Gaps = 8/193 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  1455
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52    NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  1454  VVVQTSHSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG  1284
                 T     Q  RKKV+  + +LI   G   +    + +TD EWF+++S+ +SF+ G G
Sbjct  112   PPFSTP--ADQEYRKKVLRELNSLISGGGGPTDDAVDEEVTDTEWFFLVSMTQSFACGSG  169

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             + GKAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELG  E I+++
Sbjct  170   LAGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGPTEQIRQS  229

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  230   SDLMNKVRVLFNF  242



>ref|XP_008245834.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=493

 Score =   187 bits (476),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 129/197 (65%), Gaps = 28/197 (14%)
 Frame = -2

Query  806  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  633
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  632  NELKGKVEELECQLQLRESK--------------KVKVEAVGDNQstssaassvaSP---  504
            N+LK +VEELE ++Q +  K                   ++ D+        +   P   
Sbjct  346  NKLKARVEELEAKIQQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASS  405

Query  503  ---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIM  351
                     ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++M
Sbjct  406  YTNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMM  465

Query  350  LQDIVVKVPEGLRSEDG  300
            LQD+V +VP G  SE+ 
Sbjct  466  LQDVVARVPHGFTSEEA  482


 Score =   177 bits (448),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 128/196 (65%), Gaps = 10/196 (5%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  1461
             Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14    QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  1460  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  1290
             +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF+A 
Sbjct  74    LVHNYQPKSGFISTERKKVVNREVEALFHEDMDLDGGD-VTDSEWFYFYTVSLTQSFAAC  132

Query  1289  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  1119
              G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133   HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192

Query  1118  IIKENWSLVQQVKSLF  1071
             +IKE+W LV+  KSLF
Sbjct  193   VIKEDWGLVEVSKSLF  208



>ref|XP_010554450.1| PREDICTED: transcription factor bHLH3 [Tarenaya hassleriana]
Length=466

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/452 (31%), Positives = 223/452 (49%), Gaps = 51/452 (11%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             PN   LQQ L+ ++  +   W YAIFW  S+  + DG L L WGDG  +  K  RG    
Sbjct  43    PNDPNLQQGLRHVV--EGSDWDYAIFWLASSLSNSDGCL-LIWGDGHCRAPKGKRG----  95

Query  1454  VVVQTSHSTQQSERKKVISGIQALI----GSTQNSENGDL--ITDAEWFYVMSLARSF--  1299
               +      +Q E K++   +Q L     GS  ++    L  +TD E F++ S+  SF  
Sbjct  96    --ISNDVDPKQEEVKRL--ALQKLHMSFGGSDHDNSMAQLEGVTDLEMFFLASMYFSFRC  151

Query  1298  -SAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  1122
              SA  G P   ++ G  +W +       Y   R+  ++  G +T++ +P  +GVVELGS 
Sbjct  152   ESAKYG-PAGIYTTGKPLWAADLPSCLNYYRVRSFLSRSAGFETVLSVPVKSGVVELGSF  210

Query  1121  EIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGD  942
               I E+ S+++ VK++F   +   I       + G EL   G       +          
Sbjct  211   RTIPEDKSVIEMVKAVFGAAD--PIQTKAAPKIFGRELSLGGSKPQTMSINFSPKMEDDS  268

Query  941   aekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV  762
                     +   +     Y + ++ D  C       + D Q+  P+KRGRKP  GR   +
Sbjct  269   GFSLESYDAIGGSNQVYGYEQGKY-DVLC-------LTDEQK--PRKRGRKPANGREEAL  318

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +L+ K+   E + Q+ 
Sbjct  319   NHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDLQKKIRVFETEKQIM  378

Query  581   ESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
               +++       NQ           P +++ +    DA++R+      +P +K++   RE
Sbjct  379   NRREI-------NQ---------TPPAEIDFQQRQDDAVVRLSCPLETHPVSKVIQAFRE  422

Query  401   LELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
              ++  H +++++  D M+    V+  +G+ +E
Sbjct  423   NQVTAHDSNVTATEDCMVHTFSVRAQDGVTAE  454



>ref|XP_010440156.1| PREDICTED: transcription factor bHLH3-like isoform X1 [Camelina 
sativa]
Length=475

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 224/449 (50%), Gaps = 53/449 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             P+ S LQQ L+ ++  +   W YA+FW  SN    DG   L WGDG  +  K    G   
Sbjct  51    PSDSNLQQGLRHVV--EGSDWDYALFWLASNVNSSDG-CVLIWGDGHCRVKKGVSSG---  104

Query  1454  VVVQTSHSTQQSERKKVISGIQ-ALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGD  1287
                   +S Q   +++V+  +  + +GS ++   +++G L+TD + FY+ SL  SF    
Sbjct  105   ----EDYSQQDETKRRVLRKLHLSFVGSDEDHRLAKSGSLLTDLDMFYLASLYFSFRCDS  160

Query  1286  GV--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
                 P   +  G  +W +       Y   R+  A+  G QT++ +P   GVVELGSL  I
Sbjct  161   NKYGPAGTYVSGKPLWAADLPSCLSYYRVRSFLARSAGFQTVLSVPVNCGVVELGSLRNI  220

Query  1112  KENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
              E+ S+++ VKS+F   +   +   +   + G +L   G    +  +     +   D   
Sbjct  221   PEDKSVIEMVKSVFGGSD--FVQGKEAPKIFGRQLSLGGSKPRSMSIN-FSPKTEDDTGF  277

Query  932   qaqeasaaaaaaKNS-YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNH  756
               +     A    N  YP  +  D          + D Q+  P+KRGRKP  GR   +NH
Sbjct  278   SLESFEVQAIGGSNQVYPYEQGKDETLY------LTDEQK--PRKRGRKPANGREEALNH  329

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL---  585
             VEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +++ K+   E + Q+   
Sbjct  330   VEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDMQKKIRVYETEQQIMKR  389

Query  584   RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             RES ++                   +P +V+ +    DA++R+      +P +K++  LR
Sbjct  390   RESNQI-------------------TPAEVDYQQRHDDAVVRLSCPLETHPVSKVIQTLR  430

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEG  318
             E E+  H ++++   + ++    ++ P+G
Sbjct  431   ENEVTPHDSNVAVTEEGVVHTFTLR-PQG  458



>ref|XP_010440158.1| PREDICTED: transcription factor bHLH3-like isoform X2 [Camelina 
sativa]
Length=469

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 224/449 (50%), Gaps = 53/449 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             P+ S LQQ L+ ++  +   W YA+FW  SN    DG   L WGDG  +  K    G   
Sbjct  45    PSDSNLQQGLRHVV--EGSDWDYALFWLASNVNSSDG-CVLIWGDGHCRVKKGVSSG---  98

Query  1454  VVVQTSHSTQQSERKKVISGIQ-ALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGD  1287
                   +S Q   +++V+  +  + +GS ++   +++G L+TD + FY+ SL  SF    
Sbjct  99    ----EDYSQQDETKRRVLRKLHLSFVGSDEDHRLAKSGSLLTDLDMFYLASLYFSFRCDS  154

Query  1286  GV--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
                 P   +  G  +W +       Y   R+  A+  G QT++ +P   GVVELGSL  I
Sbjct  155   NKYGPAGTYVSGKPLWAADLPSCLSYYRVRSFLARSAGFQTVLSVPVNCGVVELGSLRNI  214

Query  1112  KENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
              E+ S+++ VKS+F   +   +   +   + G +L   G    +  +     +   D   
Sbjct  215   PEDKSVIEMVKSVFGGSD--FVQGKEAPKIFGRQLSLGGSKPRSMSIN-FSPKTEDDTGF  271

Query  932   qaqeasaaaaaaKNS-YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNH  756
               +     A    N  YP  +  D          + D Q+  P+KRGRKP  GR   +NH
Sbjct  272   SLESFEVQAIGGSNQVYPYEQGKDETLY------LTDEQK--PRKRGRKPANGREEALNH  323

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL---  585
             VEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +++ K+   E + Q+   
Sbjct  324   VEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDMQKKIRVYETEQQIMKR  383

Query  584   RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             RES ++                   +P +V+ +    DA++R+      +P +K++  LR
Sbjct  384   RESNQI-------------------TPAEVDYQQRHDDAVVRLSCPLETHPVSKVIQTLR  424

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEG  318
             E E+  H ++++   + ++    ++ P+G
Sbjct  425   ENEVTPHDSNVAVTEEGVVHTFTLR-PQG  452



>ref|XP_010679205.1| PREDICTED: transcription factor bHLH3-like [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 143/474 (30%), Positives = 226/474 (48%), Gaps = 55/474 (12%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGTKA------G  1473
             +P +S L ++        + +W YAI WQ  S+  DGR  L WGDG  +   A      G
Sbjct  40    KPTNSMLNRQQGLCQIVDSSNWNYAILWQIVSSKKDGRSVLIWGDGHCRHPNAVVAGERG  99

Query  1472  RGGGVPVVVQTSHSTQQSE-RKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLAR  1305
              GG   +V      +++ E +K+V+  + A  G ++        D ++D E  Y+ S+  
Sbjct  100   DGGEDELVEGNGEISKKDEAKKRVLEKLHACFGGSEGGNFAATLDKVSDIEMLYLTSMYY  159

Query  1304  SFSAGDGV-PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  1128
              F     + P K F+ G  +W+S       Y   RA+ A+    +T+V +P   GV+ELG
Sbjct  160   WFWLDSAMGPAKCFTSGRPIWVSDGEACLDYYQSRAQLARSANFRTVVFVPVQTGVLELG  219

Query  1127  SLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKV---LQS  957
             S+ ++ E  +LVQ VK +F  P  R++       + G EL   G    + +L     L+ 
Sbjct  220   SIRMVLEEPNLVQMVKHIFGEP--RSLQAKAFPKIFGCELSLSGSKPQSTNLNFTPKLED  277

Query  956   RAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFL---------------------KE  840
              AA  AE     ++        S      SD   + L                     KE
Sbjct  278   DAAFSAESHVGGSNVGGKHTFGSSSNGCCSDDSGKKLVSEINFGGLNPETQNPGLEQAKE  337

Query  839   PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKAS  660
               I+   Q  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPN+S+MDKAS
Sbjct  338   ELILQASQPKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNISKMDKAS  397

Query  659   LLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIV  480
             LL DA+SYI +L+ KV+ LE + ++      K  A+                 +++ +  
Sbjct  398   LLGDAISYITDLQMKVKMLEAEKEMANPNH-KHMAI----------------PEIDFQAR  440

Query  479   GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  318
               DA++ V      +P++ ++  LR+ ++    A++S+ ++ ++    ++   G
Sbjct  441   QDDALLHVSFPLDLHPASTVVRTLRDNQVMAPEANVSTTDNKIIHTFTIRTQSG  494



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   189 bits (479),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 139/196 (71%), Gaps = 18/196 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  536  ts----saassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
             S    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  589  MSVVNDLMIQQATVKM  604


 Score =   155 bits (392),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG--TKAG---RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E I+
Sbjct  180   AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIR  239

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  240   QSSDLINKVRILFNF  254



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   188 bits (478),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 139/196 (71%), Gaps = 18/196 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRRAS  528

Query  536  ts----saassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
             S    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  589  MSVVNDLMIQQATVKM  604


 Score =   155 bits (392),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG--TKAG---RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E I+
Sbjct  180   AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIR  239

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  240   QSSDLINKVRILFNF  254



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   189 bits (479),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 141/201 (70%), Gaps = 20/201 (10%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA+SYINELK KV     E+++ + QL E   VK+E  G   S
Sbjct  474  RAVVPNVSKMDKASLLGDAISYINELKSKVVKTESEKIQIKNQLEE---VKLELAGRKAS  530

Query  536  ts----saassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
             S    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  531  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  590

Query  374  ISSVNDIMLQDIVVKVPEGLR  312
            +S VND+M+Q   VK+  G R
Sbjct  591  MSVVNDLMIQQATVKM--GFR  609


 Score =   157 bits (397),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  66    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKLRQRSSS  125

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  126   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  181

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E I+
Sbjct  182   AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEPIR  241

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  242   QSSDLINKVRILFNF  256



>ref|XP_009360191.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=476

 Score =   186 bits (471),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 18/185 (10%)
 Frame = -2

Query  806  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
            KKRGR      GR  TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  283  KKRGRSSNRETGRSETPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVY  342

Query  635  INELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDV  495
            INELK +VE+LE ++Q +  K V    +G   ++S        P             +++
Sbjct  343  INELKARVEQLEAKIQAQHLKPVV--DIGGQTTSSIIDHHQTRPRLSSSYDNKAAGVMEI  400

Query  494  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  315
            +VKIVG +AMIRVQ  + +YP+A+LMN L++LEL V+HASISSV  +MLQD+V +VP+G 
Sbjct  401  DVKIVGSEAMIRVQCPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDVVARVPQGF  460

Query  314  RSEDG  300
             SE+ 
Sbjct  461  TSEEA  465



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   187 bits (476),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 21/198 (11%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E   VK E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEE---VKHELAGRKAS  527

Query  536  tssaassvaSP--------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                  + +SP        +++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+H
Sbjct  528  AGGGDLASSSPMMGIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMTALMDLELEVNH  587

Query  380  ASISSVNDIMLQDIVVKV  327
            AS+S VND+M+Q   VK+
Sbjct  588  ASMSVVNDLMIQQATVKM  605


 Score =   154 bits (389),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 117/188 (62%), Gaps = 4/188 (2%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVVVQT  1440
             TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +  G+          
Sbjct  63    TLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKGKPRQKSSSPPF  122

Query  1439  SHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKA  1269
             S    Q  RKKV+  + +LI G    +++   + +TD EWF+++S+ +SF+ G G+ GKA
Sbjct  123   STPADQEYRKKVLRELNSLISGGAGPADDAVDEEVTDTEWFFLVSMTQSFACGSGLAGKA  182

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
             FS  + VW+SG+ +L    CERAK+  I G+QT+ CIP+  GVVELGS E I+++  L+ 
Sbjct  183   FSTANAVWVSGSDQLSGSGCERAKQGGIFGMQTIACIPSANGVVELGSTEQIRQSSDLMN  242

Query  1088  QVKSLFQF  1065
             +V+ LF F
Sbjct  243   KVRVLFNF  250



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   187 bits (476),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 139/196 (71%), Gaps = 18/196 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  536  ts----saassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
             S    S++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  PSGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  589  MSVVNDLMIQQATVKM  604


 Score =   155 bits (392),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG--TKAG---RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E I+
Sbjct  180   AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIR  239

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  240   QSSDLINKVRILFNF  254



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   188 bits (477),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 137/209 (66%), Gaps = 16/209 (8%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  570
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELASKDSRR  576

Query  569  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  390
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  389  VHHASISSVNDIMLQDIVVKVPEGLRSED  303
            VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  637  VHHASVSVVNDLMIQQATVKMGSRLYTEE  665


 Score =   161 bits (407),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  86    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  146   ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  202

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  203   LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQS  262

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  263   CDLMNKVRVLFNF  275



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   187 bits (475),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 137/197 (70%), Gaps = 19/197 (10%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  474  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  530

Query  536  t-----ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
                  SS+  S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  531  AGCGDMSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  590

Query  377  SISSVNDIMLQDIVVKV  327
            S+S VND+M+Q   VK+
Sbjct  591  SMSVVNDLMIQQATVKM  607


 Score =   157 bits (396),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  68    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRSSS  127

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  128   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  183

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E I+
Sbjct  184   AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEQIR  243

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  244   QSSDLINKVRVLFNF  258



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   187 bits (476),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 136/208 (65%), Gaps = 16/208 (8%)
 Frame = -2

Query  878  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  705
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  460  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  519

Query  704  LRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKV  567
            LR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++ 
Sbjct  520  LRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRP  579

Query  566  KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                   +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L V
Sbjct  580  GPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDV  639

Query  386  HHASISSVNDIMLQDIVVKVPEGLRSED  303
            HHAS+S VND+M+Q   VK+   L +E+
Sbjct  640  HHASVSVVNDLMIQQATVKMGSRLYTEE  667


 Score =   161 bits (407),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  87    NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  147   ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  203

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  204   LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQS  263

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  264   SDLMNKVRVLFNF  276



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   187 bits (476),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 136/208 (65%), Gaps = 16/208 (8%)
 Frame = -2

Query  878  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  705
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  460  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  519

Query  704  LRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKV  567
            LR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++ 
Sbjct  520  LRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRP  579

Query  566  KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                   +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L V
Sbjct  580  GPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDV  639

Query  386  HHASISSVNDIMLQDIVVKVPEGLRSED  303
            HHAS+S VND+M+Q   VK+   L +E+
Sbjct  640  HHASVSVVNDLMIQQATVKMGSRLYTEE  667


 Score =   161 bits (407),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  87    NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  147   ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  203

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  204   LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQS  263

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  264   SDLMNKVRVLFNF  276



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score =   185 bits (469),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (71%), Gaps = 16/196 (8%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  320  ESDHSDLEAFIVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  374

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESK----KVKVEAVG  549
            R+VVPNVS+MDKASLL DA++YINELK KV     E++  + QL E K      K    G
Sbjct  375  RAVVPNVSKMDKASLLGDAIAYINELKLKVNKTESEKIHIKNQLEEVKIELAGRKSSTCG  434

Query  548  DNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
            D  S+SS+A+++  PV  ++EVK++G DAMIRV+S   N+P+A+LM+ L +LEL V HAS
Sbjct  435  DLSSSSSSATAMIKPVGMEIEVKVIGWDAMIRVESSKRNHPAARLMSALMDLELEVSHAS  494

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  495  MSVVNDLMIQQATVKM  510


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 96/188 (51%), Gaps = 35/188 (19%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  1449
             N  TLQQRLQ +++   + W YAIFWQ S D      L WGDG+++G +  G+     + 
Sbjct  45    NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSSASVLGWGDGYYKGEEDKGKPKQRSIP  104

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKA  1269
             +  S    Q  RKK                                  SF++G G+ GKA
Sbjct  105   LPFSTPADQEYRKK----------------------------------SFASGAGLAGKA  130

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQ  1089
              S  ++VW+SG+ +L   +CERAK+  + G+QT+ CIP+  GVVELGS E I  +  L+ 
Sbjct  131   LSTANVVWVSGSDQLSGSSCERAKQGGVFGMQTIACIPSANGVVELGSTEQIPPSSDLMS  190

Query  1088  QVKSLFQF  1065
             +V+ LF F
Sbjct  191   KVRILFNF  198



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   186 bits (473),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 137/197 (70%), Gaps = 19/197 (10%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  415  ESDHSDLEASVVKEVAMEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  527

Query  536  t-----ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
                  SS+  S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  528  AGCGDVSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  587

Query  377  SISSVNDIMLQDIVVKV  327
            S+S VND+M+Q   VK+
Sbjct  588  SMSVVNDLMIQQATVKM  604


 Score =   158 bits (399),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  65    NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRSSS  124

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  125   PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  180

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E I+
Sbjct  181   AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTEQIR  240

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  241   QSSDLINKVRVLFNF  255



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   187 bits (475),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 137/209 (66%), Gaps = 16/209 (8%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  570
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELVSKDSRR  576

Query  569  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  390
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  389  VHHASISSVNDIMLQDIVVKVPEGLRSED  303
            VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  637  VHHASVSVVNDLMIQQATVKMGSRLYTEE  665


 Score =   161 bits (407),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  86    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  146   ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  202

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  203   LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQS  262

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  263   CDLMNKVRVLFNF  275



>ref|XP_010523814.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
[Tarenaya hassleriana]
Length=557

 Score =   185 bits (470),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 227/502 (45%), Gaps = 93/502 (19%)
 Frame = -2

Query  1625  NHSTLQQRLQFIL---KTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             N  +LQ +L  ++    +   SW YAI WQ S    G L L WGDG  +           
Sbjct  42    NDESLQNKLSDLVDRPNSMNFSWNYAIVWQLSQSRSGHLVLGWGDGCCREPNEEEESK--  99

Query  1454  VVVQTSHSTQQSE------RKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARS  1302
               V+  +   + E      RK+V+  +    G +         D +TD E F+++S+  S
Sbjct  100   -RVRVRNRGLEEETWRNVIRKRVLQKLHGFSGGSDEDNYALGLDRVTDTEMFFLVSMYFS  158

Query  1301  FSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  1122
             F  G+G PG+ F+ G   W+S A       C R+  A+  GI+T+V +P   GVVELGS+
Sbjct  159   FPYGEGGPGRCFASGIHFWISDALNTDSDYCFRSFVAKSAGIRTIVMVPMDGGVVELGSV  218

Query  1121  EIIKENWSLVQQVKSLFQ---------FPE----ERTISFA-----DIGLVSGHEL----  1008
               + E+  LV  V+SLF          FP     +R  S A      +  + GHEL    
Sbjct  219   RSLPESMELVHSVRSLFSPRAHQTPTFFPHAGAVDRNTSVAGNKTGGVHKLFGHELSNSN  278

Query  1007  -------LQQGRSAGADDLKV------LQSRAAGDaekqaqeasaaaaaaKNSYPESEHS  867
                     ++   AG  D +          R  G            +A+ ++S  ++ H 
Sbjct  279   HVHANPPCKENVFAGKLDERFPPQAWEAHQRMNGSQPTDTNMQGHVSASKEDSRLDNNHQ  338

Query  866   DSDCQFLKEP--PIVDRQQNAPKKR---------------------GRKPGAGRVTPVNH  756
                 +    P   I + Q +  KKR                     GRKP  GR  P+NH
Sbjct  339   SELARVAATPANAISENQDSRAKKRAGVAAAAAGAAAVDEKRPRKRGRKPANGREEPLNH  398

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES  576
             VEAER RREKLN RFYALRSVVP +S+MDKASLL DA++YINEL+ KV+ ++ +      
Sbjct  399   VEAERMRREKLNQRFYALRSVVPKISKMDKASLLGDAIAYINELQEKVKAMKAE------  452

Query  575   KKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  396
              + +      N              DVE++ +  + +++V S   ++P ++++  +R  +
Sbjct  453   -RTRTGESNPNP-------------DVEIQTLNGEVVVQVSSPLDSHPVSRIIQAMRRSQ  498

Query  395   LAVHHASISSVNDIMLQDIVVK  330
             + V  + +S +++ +    V+K
Sbjct  499   VRVLESKLSPIDNTVFHTFVIK  520



>gb|ACU18071.1| unknown [Glycine max]
Length=245

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 124/209 (59%), Gaps = 43/209 (21%)
 Frame = -2

Query  1574  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  1395
             D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39    DWWVYAIFWQASHDDNGSLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  1394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--------------VPGKAFSMG  1257
                 +  T  ++N   I DAEWFYVMSL RSF+  +               +PGK+F++G
Sbjct  82    KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSSLPGKSFALG  138

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             S++W +  H LQ YNCER+ EA +HGI+TL+CIPT  G VE+GS + IK+NW+LVQ VKS
Sbjct  139   SVLWQNNRHELQFYNCERSNEAHMHGIETLICIPTQNGAVEMGSYDTIKQNWNLVQHVKS  198

Query  1076  LF---------QFPEERTISFADIGLVSG  1017
             LF         Q  ++  ISFADIG+V+G
Sbjct  199   LFHTSPDPVTVQILDDHIISFADIGIVAG  227



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   187 bits (475),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 15/200 (8%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  705
            +S+HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  704  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVG------  549
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E   +   +E   VK E  G      
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKELASVKKELAGGGKDSH  583

Query  548  ------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                  D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L V
Sbjct  584  SGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMEALKELDLEV  643

Query  386  HHASISSVNDIMLQDIVVKV  327
            +HAS+S VND+M+Q   VK+
Sbjct  644  NHASMSVVNDLMIQQATVKM  663


 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 122/196 (62%), Gaps = 12/196 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G       G    +
Sbjct  65    NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEK---GKSSKI  121

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSF-----SA  1293
             +TS + +Q  RKKV+  + +LI  + +S   D +    TD EWF+++S+ +SF       
Sbjct  122   KTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGG  181

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG+A+   S VW+SGA RL    C+RA++ Q+ G+QTLVCIP+  GVVELGS E+I
Sbjct  182   GGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVI  241

Query  1112  KENWSLVQQVKSLFQF  1065
              +N  L+ +V+ LF F
Sbjct  242   IQNSDLMNKVRFLFNF  257



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   187 bits (474),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 15/200 (8%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  705
            +S+HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  704  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVG------  549
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E   +   +E   VK E  G      
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKELASVKKELAGGGKDSH  583

Query  548  ------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                  D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L V
Sbjct  584  SGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLEV  643

Query  386  HHASISSVNDIMLQDIVVKV  327
            +HAS+S VND+M+Q   VK+
Sbjct  644  NHASMSVVNDLMIQQATVKM  663


 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 122/196 (62%), Gaps = 12/196 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G       G    +
Sbjct  65    NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEK---GKSSKI  121

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSF-----SA  1293
             +TS + +Q  RKKV+  + +LI  + +S   D +    TD EWF+++S+ +SF       
Sbjct  122   KTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGG  181

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG+A+   S VW+SGA RL    C+RA++ Q+ G+QTLVCIP+  GVVELGS E+I
Sbjct  182   GGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVI  241

Query  1112  KENWSLVQQVKSLFQF  1065
              +N  L+ +V+ LF F
Sbjct  242   IQNSDLMNKVRFLFNF  257



>ref|XP_008372342.1| PREDICTED: transcription factor bHLH3-like [Malus domestica]
Length=502

 Score =   184 bits (468),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/449 (30%), Positives = 216/449 (48%), Gaps = 52/449 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSER---KKVI  1401
             +W YAIFWQ  +   G   L WGDG  + TK G  G V     +S    Q ++   K V+
Sbjct  60    NWNYAIFWQAVSSKSGGPALIWGDGHCRDTKGGGAGDVNSNRDSSSEAMQKKKEVKKWVL  119

Query  1400  SGIQALIGSTQNSENG----DLITDAEWFYVMSLARSF---SAGDGVPGKAFSMGSLVWL  1242
               + A  G   N +N     D ++D E F++ S+  +F   S     PG+++  G L+W+
Sbjct  120   EKLHACFGGL-NGDNYARRLDGVSDMEMFHLSSMFYAFQLDSISHCGPGESYKSGKLIWV  178

Query  1241  SGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFP  1062
             S A     +   R+  A++ G QT+V +P  +GVVELGS++   E  S V  V+S F   
Sbjct  179   SDAGSCLHHYQSRSFLARLAGFQTVVFVPMKSGVVELGSVKSTPEEQSYVDTVRSAFG--  236

Query  1061  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNS--  888
             E   I      ++ G EL   G  + + ++     +   D     +     +    N   
Sbjct  237   ESXPIQAKAFPMIFGRELSLGGPKSQSVNIS-FTPKIEEDFAFPPESFELQSVGTSNGCR  295

Query  887   --------YPESEHSDSD----------CQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV  762
                     +P+      D           + LK+       +  P+KRGRKP  GR  P+
Sbjct  296   SEDXEVKLFPQMNQMMVDGFNVQTRVSSSELLKDESSAQIDERKPRKRGRKPANGREEPL  355

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++YI +L+ K   +E + Q+ 
Sbjct  356   NHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAITYITDLQXKXRXMETEKQMV  415

Query  581   ESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
              +K  ++                   +D + ++   DA++R+     ++P +++   LRE
Sbjct  416   NNKGKQLPV---------------PEIDFQERL--EDAVVRMNCPLDSHPVSEVFRTLRE  458

Query  401   LELAVHHASIS-SVNDIMLQDIVVKVPEG  318
              ++    +++S + ND ++    ++   G
Sbjct  459   HKIVAQESNVSITDNDKVIHTFSIQTQSG  487



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   186 bits (471),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 138/200 (69%), Gaps = 24/200 (12%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  404  DSDHSDLEASVVKEAVPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  459

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDN  543
            R+VVPNVS+MDKASLL DA++YINELK K++       ++ECQ++      +K E  G N
Sbjct  460  RAVVPNVSKMDKASLLGDAIAYINELKSKLQKVESEKTQVECQVE-----SLKGELAGQN  514

Query  542  Qst--------ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
             +         S ++ S  + V++EVKI+G DAMIR++S   NYP+A+LM+ LR+LEL V
Sbjct  515  ANAGVVGDVGDSYSSVSKRTGVEIEVKIIGWDAMIRIESSKRNYPAARLMSALRDLELEV  574

Query  386  HHASISSVNDIMLQDIVVKV  327
            +HAS+S VND+M+Q   VK+
Sbjct  575  NHASMSVVNDLMVQQATVKM  594


 Score =   155 bits (391),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 116/187 (62%), Gaps = 3/187 (2%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQQRL  +++   + W YAIFWQ S D  G   L WGDG+++G +             S
Sbjct  61    TLQQRLHALIEGAHEGWTYAIFWQLSYDFSGAAVLGWGDGYYKGEEDKACPRPRATTSFS  120

Query  1436  HSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKAF  1266
              S  Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF++G G+ GKAF
Sbjct  121   SSADQEHRKKVLRELNSLISGGALPSDDAVDEEVTDTEWFFLVSMTQSFASGSGLAGKAF  180

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
             S  + VW++G+ +L   +CERA +  + G+QT+ CIP+  GVVELGS EII+++  L+ +
Sbjct  181   STSNPVWVAGSDQLSGSDCERAGQGGVFGLQTIACIPSANGVVELGSTEIIRQSSDLMNK  240

Query  1085  VKSLFQF  1065
             V+ LF  
Sbjct  241   VRILFNL  247



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (68%), Gaps = 13/197 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  56   DSDHSDLEASVVRETESSRIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  114

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVE  558
            YALR+VVPNVS+MDKASLL DA+SYI ELK K+       EELE Q++   +E  K    
Sbjct  115  YALRAVVPNVSKMDKASLLGDAISYIKELKSKLQNTESDKEELEKQVESMKKEFSKKDTR  174

Query  557  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
            +           S+ +  +D++VKI+G D MIR+Q    N+P+A+LM  L+EL+L VHHA
Sbjct  175  SGTPPPDQELKMSNKSIEMDIDVKIIGWDVMIRIQCSKKNHPAARLMAALKELDLDVHHA  234

Query  377  SISSVNDIMLQDIVVKV  327
            S+S VND+M+Q   VK+
Sbjct  235  SVSVVNDLMIQQATVKM  251



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score =   186 bits (473),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 137/213 (64%), Gaps = 26/213 (12%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  478  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  534

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     RE+ + +VEA+  
Sbjct  535  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---RETLQAQVEALKK  591

Query  545  NQstssaassva------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
             +         A              V+++ KI+G +AMIRVQ    N+PSA+LM  LRE
Sbjct  592  ERDARPHPHPAAGLGGHDAGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRE  651

Query  401  LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            L+L V+HAS+S V D+M+Q + VK+   + S+D
Sbjct  652  LDLDVYHASVSVVKDLMIQQVAVKMASRMYSQD  684


 Score =   134 bits (337),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 112/194 (58%), Gaps = 12/194 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G    +    P +
Sbjct  51    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRRHRPPL  110

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENG--------DLITDAEWFYVMSLARSFSA  1293
                + + +Q  RK+V+  + +LI    ++           + +TD EWF+++S+ +SF  
Sbjct  111   TPAAQA-EQEHRKRVLRELNSLISGGASAAPAPAPDEAVEEEVTDTEWFFLVSMTQSFLN  169

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG+A   G   W++    L    C+RA++A   G++T+VC P G GV+ELGS +++
Sbjct  170   GSGLPGQALFAGHHTWIAAG--LSSAPCDRARQAYNFGLRTMVCFPVGTGVLELGSTDVV  227

Query  1112  KENWSLVQQVKSLF  1071
              +    + +++SLF
Sbjct  228   FQTAETMAKIRSLF  241



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   186 bits (473),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 134/200 (67%), Gaps = 18/200 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  510  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  567

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  543
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL   KK ++E   DN  
Sbjct  568  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKK-ELEKSSDNVS  626

Query  542  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  627  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  686

Query  386  HHASISSVNDIMLQDIVVKV  327
            HHAS+S VND+M+Q   VK+
Sbjct  687  HHASVSVVNDLMIQQATVKM  706


 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TLQ RLQ +++   +SW YAIFWQ S D  G   L WGDG+++G             
Sbjct  114   NQDTLQHRLQALIEGARESWTYAIFWQHSYDYSGSALLGWGDGYYKGDDDKAKAKA--KA  171

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPG  1275
             + + + +Q  RKKV+  + +LI  +  + + D+   +TD EWF+++S+ +SF  G G+PG
Sbjct  172   KATSAAEQDHRKKVLRELNSLISGSSAASSDDVDEEVTDTEWFFLVSMTQSFVNGAGLPG  231

Query  1274  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSL  1095
             +AF   + VW+ G  RL    CERA++ Q+ G+QTLVCIP+  GVVELGS E+I +N  L
Sbjct  232   QAFFNSNPVWVIGGDRLSTSPCERARQGQVFGLQTLVCIPSANGVVELGSTELIYQNPDL  291

Query  1094  VQQVKSLFQF  1065
             + +VK LF F
Sbjct  292   MNKVKVLFNF  301



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score =   185 bits (470),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 134/200 (67%), Gaps = 18/200 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  396  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  453

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  543
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL E  K ++E   DN  
Sbjct  454  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQL-EGVKKELEKSSDNVS  512

Query  542  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  513  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  572

Query  386  HHASISSVNDIMLQDIVVKV  327
            HHAS+S VND+M+Q   VK+
Sbjct  573  HHASVSVVNDLMIQQATVKM  592


 Score =   123 bits (309),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 105/187 (56%), Gaps = 6/187 (3%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  1437
             TLQ RLQ +++   +SW YAIFWQ S D  G   L WGDG+++G             + +
Sbjct  2     TLQHRLQALIEGARESWTYAIFWQHSYDYSGSALLGWGDGYYKGDDDKAKAK--AKAKAT  59

Query  1436  HSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPGKAF  1266
              + +Q  RKKV+  + +LI  +  + + D+   +TD EWF+++S+ +SF  G G+P +  
Sbjct  60    SAAEQDHRKKVLRELNSLISGSSAASSDDVDEEVTDTEWFFLVSMTQSFVNGAGLPRRPS  119

Query  1265  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQ  1086
             S  +         L +     +   Q+ G+QTLVCIP+  GVVELGS E+I +N  L+ +
Sbjct  120   STPTPSGSPERPPLHL-PLRESPPGQVFGLQTLVCIPSANGVVELGSTELIYQNPDLMNK  178

Query  1085  VKSLFQF  1065
             VK LF F
Sbjct  179   VKVLFNF  185



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   186 bits (472),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  552
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  551  GDNQstssaass--vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  377  SISSVNDIMLQDIVVKV  327
            S+S VND+M+Q   VK+
Sbjct  651  SVSVVNDLMIQQATVKM  667


 Score =   150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 121/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  90    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  1454  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  150   ---SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  206

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  207   LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQS  266

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  267   SDLMNKVRVLFNF  279



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   186 bits (471),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  552
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  551  GDNQstssaass--vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  377  SISSVNDIMLQDIVVKV  327
            S+S VND+M+Q   VK+
Sbjct  651  SVSVVNDLMIQQATVKM  667


 Score =   150 bits (379),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 121/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  90    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  1454  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  150   ---SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  206

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  207   LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQS  266

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  267   SDLMNKVRVLFNF  279



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   185 bits (469),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 139/194 (72%), Gaps = 13/194 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDVEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK--KVKVEAVGDNQst--  534
            R+VVPNVS+MDKASLL DA++YINELK KV + E +  + +++  +VK+E  G   S   
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKAKVVKTESEKVMIKNQLEEVKMELAGRKASAGC  531

Query  533  ---ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
               SS++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  532  GDMSSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  591

Query  368  SVNDIMLQDIVVKV  327
             VND+M+Q   VK+
Sbjct  592  VVNDLMIQQATVKM  605


 Score =   157 bits (396),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 117/195 (60%), Gaps = 12/195 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  1461
             N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  64    NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGDEDKAKPRQRSSS  123

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  1290
              P     S    Q  RKKV+  + +LI G    S+    + +TD EWF+++S+ +SF+ G
Sbjct  124   PPY----STPADQEYRKKVLRELNSLISGGVAPSDEAVDEEVTDTEWFFLVSMTQSFACG  179

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E I+
Sbjct  180   AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTERIR  239

Query  1109  ENWSLVQQVKSLFQF  1065
             +   LV +V+ LF F
Sbjct  240   QTSDLVNKVRVLFNF  254



>ref|XP_009354912.1| PREDICTED: transcription factor bHLH3-like [Pyrus x bretschneideri]
 ref|XP_009354914.1| PREDICTED: transcription factor bHLH3-like [Pyrus x bretschneideri]
Length=502

 Score =   183 bits (464),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 134/449 (30%), Positives = 216/449 (48%), Gaps = 52/449 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSE---RKKVI  1401
             +W YAIFWQ  +   G   L WGDG  + TK+G  G V      S    Q +   +K V+
Sbjct  60    NWNYAIFWQAVSKKSGGSALIWGDGHCRDTKSGGAGDVNSSRDGSLEAMQKKEEVKKWVL  119

Query  1400  SGIQALIGSTQNSENG----DLITDAEWFYVMSLARSF---SAGDGVPGKAFSMGSLVWL  1242
               + A  G   N +N     D ++D E F++ S+  +F   S     PG+++  G  +W+
Sbjct  120   EKLHACFGGL-NGDNYARRLDGVSDVEMFHLTSMCYAFQLDSISHCGPGESYKSGKSIWV  178

Query  1241  SGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFP  1062
             S A     +   R+  A++ G QT+V +P  +GVVELGS++   E  S V  V+S F   
Sbjct  179   SDAGSCLHHYQSRSFLARLAGFQTVVFVPMKSGVVELGSVKSTSEEQSYVDMVRSAFG--  236

Query  1061  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNS--  888
             E   I      ++ G EL   G  + + ++     +   D     +     +    N   
Sbjct  237   ESSPIQAKAFPMIFGRELSLGGPKSQSVNIS-FTPKVEEDFAFPPESFELQSVGTSNGCR  295

Query  887   --------YPESEHSDSD----------CQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV  762
                     +P+      D           + LK+       +  P+KRGRKP  GR  P+
Sbjct  296   SDDSEVKLFPQMNQMMVDGFNVQTRVSSSELLKDESSAQIDERKPRKRGRKPANGREEPL  355

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++YI +L+ K+  +E + Q+ 
Sbjct  356   NHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAITYITDLQMKIRVMETEKQMV  415

Query  581   ESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
              +K  ++                   +D + ++   DA++R+     ++P +++   LRE
Sbjct  416   NNKGKQLPV---------------PEIDFQERL--EDAVVRMNCPLDSHPVSEVFRTLRE  458

Query  401   LELAVHHASIS-SVNDIMLQDIVVKVPEG  318
              ++    +++S + ND ++    ++   G
Sbjct  459   HKIVAQESNVSITDNDKVIHTFSIQTQSG  487



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   186 bits (471),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 132/196 (67%), Gaps = 11/196 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  481  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  540

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVEA  555
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++   +ES++     
Sbjct  541  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  600

Query  554  VGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
               +   SS        VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHAS
Sbjct  601  PNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHAS  660

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  661  VSVVNDLMIQQATVKM  676


 Score =   150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 121/193 (63%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGT--KAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R     
Sbjct  98    NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRK---L  154

Query  1454  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  1284
              V   ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  155   AVSSPAYIAEQEHRKKVLRELNSLISGAPAGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  214

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  215   LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTELIVQS  274

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  275   SDLMNKVRVLFNF  287



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   184 bits (468),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -2

Query  893  NSYPESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  720
            N+  ES+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN
Sbjct  390  NNTIESDHSDLEASVVKEADSSRVVNPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  449

Query  719  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQ  540
             RFYALR+VVPNVS+MDKASLL DA++YINELK KV+  E       S+   ++      
Sbjct  450  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESDKDELRSELESLKRATPAP  509

Query  539  stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVN  360
            + + A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V 
Sbjct  510  APAPAPAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVK  569

Query  359  DIMLQDIVVKV  327
            D+M+Q   VK+
Sbjct  570  DLMIQQATVKM  580


 Score =   148 bits (374),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 117/194 (60%), Gaps = 15/194 (8%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRL  +++   +SW YAIFWQ+S  D  G   L WGDG+++G   K  R     
Sbjct  68    NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENKGKR-----  122

Query  1454  VVVQTSHS-TQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGD  1287
                QT+ S  +Q  RKKV+  + +LI     + +  +   +TD EWF+++S+ +SF  G 
Sbjct  123   ---QTASSPAEQDHRKKVLRELNSLISGPPTAVDDAVDEDVTDTEWFFLISMTQSFVNGS  179

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG+A    S VW++G  RL   +C+RA++A   G+QTLVC+P   GVVELGS E I +
Sbjct  180   GLPGQALYSSSPVWVTGTDRLAASHCDRARQAHGFGLQTLVCVPCSNGVVELGSTEPIFQ  239

Query  1106  NWSLVQQVKSLFQF  1065
             +  L+ +V+ LF F
Sbjct  240   SSDLMNKVRVLFNF  253



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score =   185 bits (469),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  444  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  500

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  561
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  501  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  560

Query  560  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  561  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  620

Query  380  ASISSVNDIMLQDIVVKVPEGLRSED  303
            AS+S V D+M+Q + VK+   + S+D
Sbjct  621  ASVSVVKDLMIQQVAVKMASRVYSQD  646


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 92/191 (48%), Gaps = 33/191 (17%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGT---KAGRGGGV  1458
             N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G    K  +    
Sbjct  54    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  113

Query  1457  PVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVP  1278
             P       + +Q  RK+V+  + +LI     + +                      + V 
Sbjct  114   PAA-----AAEQEHRKRVLRELNSLIAGAGAAPD----------------------EAVE  146

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
              +A       W+  A  L    C+RA++A   G++T+VC+P   GV+ELGS ++I +   
Sbjct  147   EEALFAAQPTWI--ATGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQTGD  204

Query  1097  LVQQVKSLFQF  1065
              + ++++LF  
Sbjct  205   SIPRIRALFNL  215



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score =   185 bits (469),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  468  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  524

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  561
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  525  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  584

Query  560  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  585  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  644

Query  380  ASISSVNDIMLQDIVVKVPEGLRSED  303
            AS+S V D+M+Q + VK+   + S+D
Sbjct  645  ASVSVVKDLMIQQVAVKMASRVYSQD  670


 Score =   134 bits (337),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 111/194 (57%), Gaps = 14/194 (7%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGT---KAGRGGGV  1458
             N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G    K  +    
Sbjct  53    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  112

Query  1457  PVVVQTSHSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGD  1287
             P       + +Q  RK+V+  + +LI   G+  +    + +TD EWF+++S+ +SF  G 
Sbjct  113   PAA-----AAEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFPNGL  167

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG+A       W+  A  L    C+RA++A   G++T+VC+P   GV+ELGS ++I +
Sbjct  168   GLPGQALFAAQPTWI--ATGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQ  225

Query  1106  NWSLVQQVKSLFQF  1065
                 + ++++LF  
Sbjct  226   TGDSIPRIRALFNL  239



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   185 bits (469),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 138/207 (67%), Gaps = 15/207 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  468  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  526

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  564
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  527  YALRAVVPNVSKMDKASLLGDAISYINELKXKLQTVETDKEELQKQLESMNKDLPSKDSR  586

Query  563  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
                   +     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  587  SSGSTVXEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  646

Query  383  HASISSVNDIMLQDIVVKVPEGLRSED  303
            HAS+S VND+M+Q   VK    + ++D
Sbjct  647  HASVSVVNDLMIQQATVKAGSRIYTQD  673


 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 115/192 (60%), Gaps = 8/192 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-LFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TL QRLQ +++   +SW YAIFWQ+S D  G    L WG+GF+   K  R       
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGAGAVLGWGEGFY---KDERDKVKAKA  134

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  1281
               T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+
Sbjct  135   KTTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGL  194

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+AF   + VW++G  RL    CERA++  + G+QT+VC+PT  GVVELGS E+I +  
Sbjct  195   PGQAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTELIYQTS  254

Query  1100  SLVQQVKSLFQF  1065
              L+ +V+ LF F
Sbjct  255   DLMNKVRVLFNF  266



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score =   185 bits (469),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  561
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  595

Query  560  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  596  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  655

Query  380  ASISSVNDIMLQDIVVKVPEGLRSED  303
            AS+S V D+M+Q + VK+   + S+D
Sbjct  656  ASVSVVKDLMIQQVAVKMASRVYSQD  681


 Score =   134 bits (336),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 111/194 (57%), Gaps = 14/194 (7%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGT---KAGRGGGV  1458
             N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G    K  +    
Sbjct  64    NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKGCDDDKRKQRSST  123

Query  1457  PVVVQTSHSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGD  1287
             P       + +Q  RK+V+  + +LI   G+  +    + +TD EWF+++S+ +SF  G 
Sbjct  124   PAA-----AAEQEHRKRVLRELNSLIAGAGAAPDEAVEEEVTDTEWFFLVSMTQSFPNGL  178

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
             G+PG+A       W+  A  L    C+RA++A   G++T+VC+P   GV+ELGS ++I +
Sbjct  179   GLPGQALFAAQPTWI--ATGLSSAPCDRARQAYTFGLRTMVCLPLATGVLELGSTDVIFQ  236

Query  1106  NWSLVQQVKSLFQF  1065
                 + ++++LF  
Sbjct  237   TGDSIPRIRALFNL  250



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score =   184 bits (467),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 140/202 (69%), Gaps = 10/202 (5%)
 Frame = -2

Query  881  ESEHSDSDCQFLKE---PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+ SD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  423  DSDQSDLEASVVKEVESSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  481

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLR---ESKKVKVEAVGDN  543
            YALR+VVPNVS+MDKASLL DA++YINELK K++ +E  + +LR   ES    ++   D 
Sbjct  482  YALRAVVPNVSKMDKASLLGDAIAYINELKSKLQNVELDKDELRRQLESSSSSMQKKKDK  541

Query  542  QstssaassvaSPVDVE--VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
            + +S+   S    VD+E  VKI+G DAMIRVQ    N+P+AK+M  LREL+L VHHAS+S
Sbjct  542  EYSSAKEESSKGIVDMEIDVKIIGWDAMIRVQCSKKNHPAAKMMVALRELDLDVHHASVS  601

Query  368  SVNDIMLQDIVVKVPEGLRSED  303
             VND+M+Q   VK+     S+D
Sbjct  602  VVNDLMIQQATVKMEGRFFSQD  623


 Score =   123 bits (308),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 104/195 (53%), Gaps = 39/195 (20%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-LFLAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRL  +++   +SW YAIFWQ+S  + G    L WGDG+++G   K  R     
Sbjct  73    NQETLQQRLLALIEGARESWTYAIFWQSSAAEYGAPAALTWGDGYYKGEDDKGNRKSA--  130

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----ITDAEWFYVMSLARSFSAG  1290
                  S   +Q  RKKV+  + +LI  TQ++   D      +TD EWF+++S+ +SF+ G
Sbjct  131   -----SSPAEQEHRKKVLRELNSLISGTQSTTAADEPVDEEVTDTEWFFLISMTQSFANG  185

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG+A    S VW                        T+VCIP+  GVVELGS E+I 
Sbjct  186   SGIPGQALYSSSPVW------------------------TIVCIPSSNGVVELGSTEVIF  221

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+++V+ LF F
Sbjct  222   QSSDLMKKVRVLFNF  236



>ref|XP_006282965.1| hypothetical protein CARUB_v10007725mg [Capsella rubella]
 gb|EOA15863.1| hypothetical protein CARUB_v10007725mg [Capsella rubella]
Length=467

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 138/453 (30%), Positives = 225/453 (50%), Gaps = 54/453 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             P+ S LQQ L+ ++  +   W YA+FW  SN    DG   L WGDG  +  K   G    
Sbjct  45    PSDSNLQQGLRHVV--EGSDWDYALFWLASNVNSSDG-CVLIWGDGHCRVNKGVSG----  97

Query  1454  VVVQTSHSTQQSERKKVISGIQ-ALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGD  1287
                   +S Q   +++V+  +  + +GS ++   +++G L TD + FY+ SL  SF    
Sbjct  98    ----EDYSQQDETKRRVLRKLHLSFVGSDEDPRLAKSGAL-TDLDMFYLASLYFSFRCDS  152

Query  1286  GV--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
                 P   +  G  +W +       Y   R+  A+  G QT++ +P   GVVELGSL  I
Sbjct  153   NKYGPAGTYVSGKPLWAADLPSCLSYYRVRSFLARSAGFQTVLSVPVNCGVVELGSLRNI  212

Query  1112  KENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
              E+ S+++ VKS+F   +   +   +   + G +L   G    +  +     +   D+  
Sbjct  213   PEDKSVIEMVKSVFGGSD--FVQAKEAPKIFGRQLSLGGAKPRSMSIN-FSPKTEDDSGF  269

Query  932   qaqeasaaaaaaKNS-YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNH  756
               +     A  + N  YP  +  D          + D Q+  P+KRGRKP  GR   +NH
Sbjct  270   SLESYEVQAIGSSNQVYPYEQGKDETLY------LTDEQK--PRKRGRKPANGREEALNH  321

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL---  585
             VEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +++ K+   E + Q+   
Sbjct  322   VEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDMQKKIRVYETEKQIMKR  381

Query  584   RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             RES ++                   +P +V+ +    DA++R+      +P +K++  LR
Sbjct  382   RESNQI-------------------TPAEVDYQQRQDDAVVRLSCPLETHPVSKVVQTLR  422

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  306
             E E+  H ++++   + ++    ++   G  +E
Sbjct  423   ENEVMPHDSNVAVTEEGVVHTFTIRPQGGCTTE  455



>ref|XP_009142636.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE [Brassica 
rapa]
Length=486

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 179/341 (52%), Gaps = 24/341 (7%)
 Frame = -2

Query  1604  RLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQ  1425
             RL     ++T SW YA+FWQ +    G+  LAWGDG  +  K        V        +
Sbjct  56    RLVDCPNSETFSWNYAVFWQQTVSRSGQQVLAWGDGCCREPKEEES---TVCYNLEEEMR  112

Query  1424  -QSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
              Q  RK+V+  +  + G +   +     + +T  E F++ S+   F+ G+G PG+ F+ G
Sbjct  113   WQYMRKRVLQKLHRMFGGSDEDDYALSLENVTATEMFFLASMYFFFNHGEGGPGRCFASG  172

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
               VWLS A  +    C R+   +  GI+T+V +PT AGV+ELGS+  + EN  LV+ V++
Sbjct  173   RHVWLSDA--VGSDYCFRSFMVKSAGIRTVVMVPTDAGVLELGSVWPLPENVELVRSVQA  230

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             LF     R +   ++     H+L  Q  ++ +D +             +         + 
Sbjct  231   LFM----RRVKPPNMSGGKIHKLFGQELNS-SDKVAHQVQENVNVVVVEDTNHKVMKTSC  285

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  717
                 P S         L  P +   ++  P+KRGRKP  GR   +NHVEAERQRREKLN 
Sbjct  286   NEKRPAS--------LL--PGVAVVEEKRPRKRGRKPANGREEALNHVEAERQRREKLNQ  335

Query  716   RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ  594
             RFYALR+VVPN+S+MDKASLL DA+SYI EL+ +V+ +E +
Sbjct  336   RFYALRAVVPNISKMDKASLLGDAISYIKELQERVKIIEAE  376



>gb|AEG74014.1| lMYC4 [Hevea brasiliensis]
Length=470

 Score =   181 bits (459),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 126/222 (57%), Gaps = 26/222 (12%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  1434
             LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK           Q  H
Sbjct  24    LQQRLQFILQSRPEWWVYAIFWQASKDSTGRLVLSWGDGHFRGTK--EFAAKVCNKQNQH  81

Query  1433  STQQS-ERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVPGKAFS  1263
                 + ERK      Q L     + +   D+ + D EWFY +S+ RSF+  DG+ G+ F 
Sbjct  82    KFGFNLERKLTDKESQILFTDDMDMDRLADVNVIDYEWFYTVSVTRSFTVEDGILGRTFG  141

Query  1262  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQV  1083
              G+ +WL+G H+LQMY CER KEA +HGIQTL C+ T  GVVELGS + I ++WSLVQ  
Sbjct  142   SGAFIWLTGNHQLQMYECERVKEASMHGIQTLTCVSTSCGVVELGSSDSIDKDWSLVQLC  201

Query  1082  KSLF------------------QFPEERTISFADIGLVSGHE  1011
             KSLF                  Q P     SF DIG+ S  +
Sbjct  202   KSLFGGDSACLVSREPSHESQLQIP---NTSFLDIGMFSASQ  240



>ref|XP_006414350.1| hypothetical protein EUTSA_v10025122mg [Eutrema salsugineum]
 gb|ESQ55803.1| hypothetical protein EUTSA_v10025122mg [Eutrema salsugineum]
Length=466

 Score =   181 bits (459),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 233/469 (50%), Gaps = 51/469 (11%)
 Frame = -2

Query  1694  ELMDELIVTssssssitaslSQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGR  1521
             E  D  I ++SS++++T  ++ P+   LQQ L+ ++  +   W YA+FW  SN    DG 
Sbjct  22    EACDFFISSASSNTALTKLVAPPSDPNLQQGLRHVV--EGSDWDYAVFWLASNVNSSDG-  78

Query  1520  LFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQA-LIGSTQNSE--NGD  1350
               L WGDG  +  K   G          +S Q   +++V+  + +  +GS ++       
Sbjct  79    CVLVWGDGHCRVQKGNSG--------EDYSQQDESKRRVLRKLHSSFVGSDEDHRLVKSG  130

Query  1349  LITDAEWFYVMSLARSFSAGDGV--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGI  1176
              +TD + FY+ SL  SF        P   +  G  +W S       Y   R+  A+  G 
Sbjct  131   ALTDLDMFYLASLYFSFRCDSNKYGPAGTYVSGKPLWASDLPSCLSYYRVRSFLARSAGF  190

Query  1175  QTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQG  996
             +T++ +P   GVVELGSL++I E+ S+++ VKS+F   +   +   +   + G +L   G
Sbjct  191   KTVLSVPVNCGVVELGSLQLIPEDKSVIEMVKSVFGGSD--FVQAKEAPKIFGRQLSLGG  248

Query  995   RSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQ  816
                 +  +     +   ++    +     A    N     E    +  +L +       +
Sbjct  249   SKPRSMSIN-FSPKMEDESGFSLESYEVQAVGGSNQVYGYEQGKDEALYLTD-------E  300

Query  815   NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
               P+KRGRKP  GR   +NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++Y
Sbjct  301   QKPRKRGRKPANGREEALNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITY  360

Query  635   INELKGKVEELECQLQL---RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAM  465
             I +++ K+   E + Q+   RES ++                   +P +V+ +    DA+
Sbjct  361   ITDMQKKIRVYETEKQIMKRRESNQI-------------------TPAEVDYQQRHDDAV  401

Query  464   IRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  318
             +R+      +P +K++  LRE E+  H ++++   + ++    ++ P+G
Sbjct  402   VRLSCPLETHPVSKVIQTLRENEVTPHDSNVAVTEEGVVHTFTLR-PQG  449



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  482  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  538

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  539  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  595

Query  545  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  396
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  596  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  655

Query  395  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            L V+HAS+S V D+M+Q + VK+   + ++D
Sbjct  656  LDVYHASVSVVKDLMIQQVAVKMASRVYTQD  686


 Score =   139 bits (350),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 111/189 (59%), Gaps = 8/189 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G    +    P+ 
Sbjct  56    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKGCDEDKRKQKPLT  115

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  1278
                S   +Q  RK+V+  + +LI     + +  +   +TD EWF+++S+ +SF  G G+P
Sbjct  116   --PSAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLP  173

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+A   G   W++    L    CERA++A   G++T+VC P G GV+ELGS +++ +   
Sbjct  174   GQALFAGQPTWIASG--LSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFKTAE  231

Query  1097  LVQQVKSLF  1071
              + +++SLF
Sbjct  232   SMAKIRSLF  240



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  592

Query  545  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  396
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  593  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  652

Query  395  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            L V+HAS+S V D+M+Q + VK+   + ++D
Sbjct  653  LDVYHASVSVVKDLMIQQVAVKMASRVYTQD  683


 Score =   139 bits (350),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 111/189 (59%), Gaps = 8/189 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G    +    P+ 
Sbjct  53    NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKGCDEDKRKQKPLT  112

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  1278
                S   +Q  RK+V+  + +LI     + +  +   +TD EWF+++S+ +SF  G G+P
Sbjct  113   --PSAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLP  170

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+A   G   W++    L    CERA++A   G++T+VC P G GV+ELGS +++ +   
Sbjct  171   GQALFAGQPTWIASG--LSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFKTAE  228

Query  1097  LVQQVKSLF  1071
              + +++SLF
Sbjct  229   SMAKIRSLF  237



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -2

Query  881  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  726
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  486  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  542

Query  725  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  546
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +++ + ++EA+  
Sbjct  543  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---KDTLQAQIEALKK  599

Query  545  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  396
             +     A +              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  600  ERDARPPAHAAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  659

Query  395  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  303
            L V+HAS+S V D+M+Q + VK+   + S+D
Sbjct  660  LDVYHASVSVVKDLMIQQVAVKMASRIYSQD  690


 Score =   137 bits (345),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 112/189 (59%), Gaps = 8/189 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TLQQRLQ +++  +++W YAIFWQ+S D   G   L WGDG+++G    +    P+ 
Sbjct  58    NQDTLQQRLQAMIEGSSETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRKQRPLT  117

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  1278
                +   +Q  RK+V+  + +LI     + +  +   +TD EWF+++S+ +SF  G G+P
Sbjct  118   --PAAQAEQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLP  175

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+A   G   W+  A  L    CERA++A   G++T+VC P G GV+ELGS +++ +   
Sbjct  176   GQALFAGQPTWI--ASGLSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFQTAE  233

Query  1097  LVQQVKSLF  1071
              + +++SLF
Sbjct  234   SMAKIRSLF  242



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 135/208 (65%), Gaps = 22/208 (11%)
 Frame = -2

Query  881  ESEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
            ES+HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  486  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  541

Query  722  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +++   ++EA+   
Sbjct  542  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KDTLHSQIEALKKE  598

Query  542  Qstssaassva--------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  387
            +     A              V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L V
Sbjct  599  RDARPVAPLSGVHDSGPRCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLDV  658

Query  386  HHASISSVNDIMLQDIVVKVPEGLRSED  303
            +HAS+S V DIM+Q + VK+P  + S+D
Sbjct  659  YHASVSVVKDIMIQQVAVKMPNRVYSQD  686


 Score =   138 bits (347),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 112/196 (57%), Gaps = 16/196 (8%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGT----KAGRGGG  1461
             N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G     K  R   
Sbjct  48    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTDAGAGASLLGWGDGYYKGCDDADKRARQQP  107

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIG----STQNSENGDLITDAEWFYVMSLARSFSA  1293
              P     + + +Q  RK+V+  + +LI     +  +    + +TD EWF+++S+ +SF  
Sbjct  108   TP-----ASAAEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPN  162

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG+A       W++    L    CERA++A   G++T+VCIP G GV+ELG+ E+I
Sbjct  163   GMGLPGQALYTRQPTWIASG--LASAPCERARQAYTFGLRTMVCIPVGTGVLELGATEVI  220

Query  1112  KENWSLVQQVKSLFQF  1065
              +    + +++SLF  
Sbjct  221   FQTADSLGRIRSLFNL  236



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 133/205 (65%), Gaps = 12/205 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S  SD +   +KE     I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  16   DSNRSDLEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  75

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD----  546
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD    
Sbjct  76   YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVK  135

Query  545  ----NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
                +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HA
Sbjct  136  SSVKDQKCLEQDSGVSIEVEIDVKIIGWDAMIRIQCGKKNHPGAKFMEALKELELEVNHA  195

Query  377  SISSVNDIMLQDIVVKVPEGLRSED  303
            S+S VN+ M+Q   VK+     ++D
Sbjct  196  SLSVVNEFMIQQATVKMGNQFFTQD  220



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  470  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  528

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  564
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  529  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNKDLPSKDSR  588

Query  563  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
                  ++     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  589  SSGSTMSEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  648

Query  383  HASISSVNDIMLQDIVVKVPEGLRSED  303
            HAS+S VND+M+Q   VK    + ++D
Sbjct  649  HASVSVVNDLMIQQATVKAGSRIYTQD  675


 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 115/192 (60%), Gaps = 8/192 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-LFLAWGDGFFQGTKAGRGGGVPVV  1449
             N  TL QRLQ +++   +SW YAIFWQ+S D  G    L WG+GF+   K  R       
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGAGAVLGWGEGFY---KDERDKVKAKA  134

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  1281
               T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+
Sbjct  135   KTTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGL  194

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+AF   + VW++G  RL    CERA++  + G+QT+VC+PT  GVVELGS E+I +  
Sbjct  195   PGQAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTELIYQTS  254

Query  1100  SLVQQVKSLFQF  1065
              L+ +V+ LF F
Sbjct  255   DLMNKVRVLFNF  266



>ref|XP_010434826.1| PREDICTED: transcription factor bHLH3 [Camelina sativa]
 ref|XP_010434827.1| PREDICTED: transcription factor bHLH3 [Camelina sativa]
Length=468

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 224/449 (50%), Gaps = 54/449 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             P+ S LQQ L+ ++  +   W YA+FW  SN    DG   L WGDG  +  K    G   
Sbjct  45    PSDSNLQQGLRHVV--EGSDWDYALFWLASNVNSSDG-CVLIWGDGHCRVKKGVSSG---  98

Query  1454  VVVQTSHSTQQSERKKVISGIQ-ALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGD  1287
                   +S Q   +++V+  +  + +GS ++   +++G L TD + FY+ SL  SF    
Sbjct  99    ----EDYSQQDETKRRVLRKLHLSFVGSDEDHRLAKSGAL-TDLDMFYLASLYFSFRCDS  153

Query  1286  GV--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
                 P   +  G  +W +       Y   R+  A+  G QT++ +P   GVVELGSL  I
Sbjct  154   NKYGPAGTYVSGKPLWAADLPSCLSYYRVRSFLARSAGFQTVLSVPVNCGVVELGSLRNI  213

Query  1112  KENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaek  933
              E+ S+++ VKS+F   +   +   +   + G +L   G    +  +     +   D+  
Sbjct  214   PEDKSVIEMVKSVFGGSD--FVQAKEAPKIFGRQLSLGGSKPRSMSIN-FSPKTEDDSGF  270

Query  932   qaqeasaaaaaaKNS-YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNH  756
               +     A    N  YP  +  D          + D Q+  P+KRGRKP  GR   +NH
Sbjct  271   SLESFEVQAIGGSNQVYPYEQGKDETLY------LTDEQK--PRKRGRKPANGREEALNH  322

Query  755   VEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL---  585
             VEAERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +++ K+   E + Q+   
Sbjct  323   VEAERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDMQKKIRVYETEQQIMKR  382

Query  584   RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
             RES ++                   +P +V+ +    DA++R+      +P +K++  LR
Sbjct  383   RESNQI-------------------TPAEVDYQQRHDDAVVRLSCPLETHPVSKVIQTLR  423

Query  404   ELELAVHHASISSVNDIMLQDIVVKVPEG  318
             E E+  H ++++   + ++    ++ P+G
Sbjct  424   ENEVTPHDSNVAVTEEGVVHTFTLR-PQG  451



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   183 bits (464),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 132/200 (66%), Gaps = 9/200 (5%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  419  DSDHSDLEASVVKE--AVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  476

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  543
            R+VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   +
Sbjct  477  RAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIECLRKELTNKGSSNYS  536

Query  542  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  363
             S           +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S V
Sbjct  537  ASPPLNQDVKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVV  596

Query  362  NDIMLQDIVVKVPEGLRSED  303
            ND+M+Q   VK+   L +++
Sbjct  597  NDLMIQQATVKMGSRLYAQE  616


 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 120/197 (61%), Gaps = 12/197 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG--TKAGRGGGVP  1455
             N  +LQQRLQ ++    +SWAYAIFWQ+S  D   +  L WGDG+++G   K  R G   
Sbjct  56    NQESLQQRLQALIDGARESWAYAIFWQSSVVDFASQTVLGWGDGYYKGEEDKNKRRGSSS  115

Query  1454  VVVQTSHSTQQSERKKV-------ISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFS  1296
                  +   +Q  RKKV       ISG+QA  G+  +    + +TD EWF+++S+ +SF 
Sbjct  116   SAA--NFVAEQEHRKKVLRELNSLISGVQASAGNGTDDAVDEEVTDTEWFFLISMTQSFV  173

Query  1295  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
              G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E+
Sbjct  174   NGNGLPGLAMYSSSPIWVTGTEKLAASQCERARQAQGFGLQTIVCIPSANGVVELGSTEL  233

Query  1115  IKENWSLVQQVKSLFQF  1065
             I ++  L+ +VK LF F
Sbjct  234   IFQSSDLMNKVKYLFNF  250



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score =   183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 139/206 (67%), Gaps = 14/206 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  458  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  516

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESK---KVKV  561
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ QL+        K   
Sbjct  517  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTESDKEDLQKQLESMNQDLGCKDSS  576

Query  560  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VHH
Sbjct  577  SLSDDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDLDVHH  636

Query  380  ASISSVNDIMLQDIVVKVPEGLRSED  303
            ASIS VND+M+Q   VK+   + ++D
Sbjct  637  ASISVVNDLMIQQATVKMGSRIYTQD  662


 Score =   146 bits (368),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 111/191 (58%), Gaps = 19/191 (10%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG       KA          
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGGTVLGWGKA-----KAK---------  123

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  1278
              T+ +  Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+P
Sbjct  124   TTTSAADQEYRKKVLRELNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVPGGGLP  183

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+AF   + VW++G  RL    CERA++ Q+ G+QT+VC+PT  GVVELGS E+I ++  
Sbjct  184   GQAFFHSTPVWVAG-DRLAASPCERARQGQLFGLQTMVCVPTANGVVELGSTELIYQSSD  242

Query  1097  LVQQVKSLFQF  1065
             L  +V+ LF F
Sbjct  243   LTNKVRVLFNF  253



>gb|AHN63211.1| transcription factor MYC2 [Salvia miltiorrhiza f. alba]
Length=592

 Score =   182 bits (463),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = -2

Query  893  NSYPESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  720
            N+  ES+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN
Sbjct  382  NNTIESDHSDLEASVVKEADSSRVVNPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  441

Query  719  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD-N  543
             RFYALR+VVPNVS+MDKASLL DA++YINELK KV+  E     ++  + ++E++    
Sbjct  442  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESD---KDELRSELESLKRAT  498

Query  542  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  363
             + + A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V
Sbjct  499  PAPAPAPAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVV  558

Query  362  NDIMLQDIVVKV  327
             D+M+Q   VK+
Sbjct  559  KDLMIQQATVKM  570


 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 115/195 (59%), Gaps = 16/195 (8%)
 Frame = -2

Query  1625  NHSTLQQRL-QFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG--TKAGRGGGV  1458
             N  TLQQRL   I     +SW YAIFWQ+S  D  G   L WGDG+++G   K  R    
Sbjct  59    NQETLQQRLLSLIEDAAHESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENKGKR----  114

Query  1457  PVVVQTSHS-TQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAG  1290
                 QT+ S  +Q  RKKV+  + +LI     + +  +   +TD EWF+++S+ +SF  G
Sbjct  115   ----QTASSPAEQDHRKKVLRELNSLISGPPTAVDDAVDEDVTDTEWFFLISMTQSFVNG  170

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG+A    S VW++G  RL   +C+RA++A   G+QTLVC+P   GVVELGS E I 
Sbjct  171   SGLPGQALYSSSPVWVTGTDRLAASHCDRARQAHGFGLQTLVCVPCSNGVVELGSTEPIF  230

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+ +V+ LF F
Sbjct  231   QSSDLMNKVRVLFNF  245



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 134/210 (64%), Gaps = 21/210 (10%)
 Frame = -2

Query  878  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  705
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  446  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  505

Query  704  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV---------  552
            LR+VVPNVS+MDKASLL DA+SYINELK K++  E     RE  K ++E +         
Sbjct  506  LRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETD---REDLKSQIEDLKKELASEDS  562

Query  551  -------GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  393
                     +   SS   S    VD++VKI+G DAM+R+Q    N+P+A+LM  L+EL+L
Sbjct  563  WRPGPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMVRIQCNKKNHPAARLMVALKELDL  622

Query  392  AVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  623  EVHHASVSVVNDLMIQQATVKMGSRLYTEE  652


 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 123/193 (64%), Gaps = 9/193 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQG--TKAGRGGGVP  1455
             N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KAGR   V 
Sbjct  78    NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPFVLGWGDGYYKGEEDKAGRKLAVS  137

Query  1454  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  1284
                  ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  138   ---SPAYIAEQEHRKKVLRELNSLISCTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  194

Query  1283  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKEN  1104
             +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E+I ++
Sbjct  195   LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTELIIQS  254

Query  1103  WSLVQQVKSLFQF  1065
               L+ +V+ LF F
Sbjct  255   SDLMNKVRVLFNF  267



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  240  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  298

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  564
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  299  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  358

Query  563  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  359  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  418

Query  383  HASISSVNDIMLQDIVVKVPEGLRSED  303
            HAS+S VND+M+Q   VK+   + ++D
Sbjct  419  HASVSVVNDLMIQQATVKMGSRIYTQD  445



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   182 bits (462),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 135/196 (69%), Gaps = 11/196 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  543
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  542  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  555  LSVVNDLMIQQATVKM  570


 Score =   145 bits (366),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 116/189 (61%), Gaps = 13/189 (7%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  48    NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  102

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  1290
                    +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  103   KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  162

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI T  GVVELGS E+I 
Sbjct  163   VGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVIS  222

Query  1109  ENWSLVQQV  1083
             ++  L+ +V
Sbjct  223   QSSDLMHKV  231



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   182 bits (462),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 135/196 (69%), Gaps = 11/196 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  543
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  542  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  375
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  374  ISSVNDIMLQDIVVKV  327
            +S VND+M+Q   VK+
Sbjct  555  LSVVNDLMIQQATVKM  570


 Score =   145 bits (366),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 116/189 (61%), Gaps = 13/189 (7%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  48    NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  102

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  1290
                    +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  103   KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  162

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI T  GVVELGS E+I 
Sbjct  163   VGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVIS  222

Query  1109  ENWSLVQQV  1083
             ++  L+ +V
Sbjct  223   QSSDLMHKV  231



>ref|NP_193376.1| transcription factor bHLH3 [Arabidopsis thaliana]
 sp|O23487.1|BH003_ARATH RecName: Full=Transcription factor bHLH3; AltName: Full=Basic 
helix-loop-helix protein 3; Short=AtbHLH3; Short=bHLH 3; AltName: 
Full=Transcription factor EN 34; AltName: Full=bHLH transcription 
factor bHLH003 [Arabidopsis thaliana]
 gb|AAL16298.1|AF428368_1 AT4g16430/dl4240w [Arabidopsis thaliana]
 gb|AAL55710.1|AF251688_1 putative transcription factor BHLH3 [Arabidopsis thaliana]
 emb|CAB10419.1| transcription factor like protein [Arabidopsis thaliana]
 emb|CAB78685.1| transcription factor like protein [Arabidopsis thaliana]
 gb|AAL15257.1| AT4g16430/dl4240w [Arabidopsis thaliana]
 gb|AAN73298.1| At4g16430/dl4240w [Arabidopsis thaliana]
 gb|AEE83747.1| transcription factor bHLH3 [Arabidopsis thaliana]
Length=467

 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 133/447 (30%), Positives = 218/447 (49%), Gaps = 51/447 (11%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLFLAWGDGFFQGTKAGRGGGVP  1455
             P+ S LQQ L+ ++  +   W YA+FW  SN    DG   L WGDG  +  K   G    
Sbjct  45    PSDSNLQQGLRHVV--EGSDWDYALFWLASNVNSSDG-CVLIWGDGHCRVKKGASG----  97

Query  1454  VVVQTSHSTQQSERKKVISGIQ-ALIGSTQNSE--NGDLITDAEWFYVMSLARSFSAGDG  1284
                   +S Q   +++V+  +  + +GS ++        +TD + FY+ SL  SF     
Sbjct  98    ----EDYSQQDEIKRRVLRKLHLSFVGSDEDHRLVKSGALTDLDMFYLASLYFSFRCDTN  153

Query  1283  V--PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
                P   +  G  +W +       Y   R+  A+  G QT++ +P  +GVVELGSL  I 
Sbjct  154   KYGPAGTYVSGKPLWAADLPSCLSYYRVRSFLARSAGFQTVLSVPVNSGVVELGSLRHIP  213

Query  1109  ENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekq  930
             E+ S+++ VKS+F   +   +   +   + G +L   G    +  +     +   D    
Sbjct  214   EDKSVIEMVKSVFGGSD--FVQAKEAPKIFGRQLSLGGAKPRSMSIN-FSPKTEDDTGFS  270

Query  929   aqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVE  750
              +     A    N     E    +  +L +       +  P+KRGRKP  GR   +NHVE
Sbjct  271   LESYEVQAIGGSNQVYGYEQGKDETLYLTD-------EQKPRKRGRKPANGREEALNHVE  323

Query  749   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL---RE  579
             AERQRREKLN RFYALR+VVPN+S+MDKASLL+DA++YI +++ K+   E + Q+   RE
Sbjct  324   AERQRREKLNQRFYALRAVVPNISKMDKASLLADAITYITDMQKKIRVYETEKQIMKRRE  383

Query  578   SKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  399
             S ++                   +P +V+ +    DA++R+      +P +K++  LRE 
Sbjct  384   SNQI-------------------TPAEVDYQQRHDDAVVRLSCPLETHPVSKVIQTLREN  424

Query  398   ELAVHHASISSVNDIMLQDIVVKVPEG  318
             E+  H ++++   + ++    ++ P+G
Sbjct  425   EVMPHDSNVAITEEGVVHTFTLR-PQG  450



>ref|XP_009367720.1| PREDICTED: transcription factor bHLH3-like [Pyrus x bretschneideri]
Length=502

 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 134/450 (30%), Positives = 217/450 (48%), Gaps = 54/450 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSE---RKKVI  1401
             +W YAIFWQ      G   L WGDG  + TK G  G       +S    Q++   +K+V+
Sbjct  60    NWNYAIFWQAVGSKSGGSALCWGDGHCRDTKDGGAGDANSSRDSSLEAVQNKEEVKKQVV  119

Query  1400  SGIQALIGSTQNSENG----DLITDAEWFYVMSLARSF---SAGDGVPGKAFSMGSLVWL  1242
               + A  G   N++N     D ++D E FY  S+  +F   S     P +A++    +W+
Sbjct  120   QKLHACFGGL-NADNYASRLDGVSDVEMFYHTSMCYAFQLDSISHCGPAEAYNSRKSIWV  178

Query  1241  SGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFP  1062
             S A     +   R+  A++ G QT+V +P  +GVVELGS++   E  S V  V+S F   
Sbjct  179   SDAGSCLHHYQSRSFLARLAGFQTVVFVPMKSGVVELGSVKSTPEEQSYVDIVRSAFG--  236

Query  1061  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  882
             E   I      ++ G EL   G  + + ++     +   D     +     +    N +P
Sbjct  237   ESSPIQPKAFPMIFGRELSLGGPKSQSVNIS-FTPKIEEDFAFPPESLELQSVGTSNGFP  295

Query  881   --------------------ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPV  762
                                  ++   S  + LK+       +  P+KRGRKP  GR  P+
Sbjct  296   SEGGEVKLFPQMNQMMVDGFNTQTRVSGSELLKDESSTQVDEQKPRKRGRKPSNGREEPL  355

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA+++I +L+ K+  +E + Q+ 
Sbjct  356   NHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAITHITDLQMKIRIIEAEKQMV  415

Query  581   ESKKVKVEAVGDNQstssaassvaSPV-DVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
              +K  ++                  PV +++ +    DA++R+     +YP + ++  LR
Sbjct  416   NNKGKQL------------------PVPEIDFQERHEDAVVRMNFPLDSYPVSDVIRTLR  457

Query  404   ELELAVHHASIS-SVNDIMLQDIVVKVPEG  318
             E ++    +++S + ND ++    ++   G
Sbjct  458   EHKIVPQESNVSITDNDKVIHTFSIQTQGG  487



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   182 bits (463),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 21/210 (10%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG------  549
            YALR+VVPNVS+MDKASLL DA+SYINELK K++ +E     +E  + ++E++       
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTVESD---KEDLQKQLESMNQDLGCK  581

Query  548  --------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  393
                    D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L
Sbjct  582  DSSSLSDQDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDL  641

Query  392  AVHHASISSVNDIMLQDIVVKVPEGLRSED  303
             VHHASIS VND+M+Q   VK+   + ++D
Sbjct  642  DVHHASISVVNDLMIQQATVKMGSRIYTQD  671


 Score =   164 bits (414),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 115/191 (60%), Gaps = 7/191 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF+   K  R  G     
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGGTVLGWGEGFY---KDERDKGKAKAK  134

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  1278
              T+ +  Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+P
Sbjct  135   TTTSAADQEYRKKVLRELNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVPGGGLP  194

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+AF   + VW++G  RL    CERA++ Q  G+QTLVC+PT  GVVELGS E+I ++  
Sbjct  195   GQAFFHSTPVWVAGPDRLAASPCERARQGQAFGLQTLVCVPTANGVVELGSTELIYQSSD  254

Query  1097  LVQQVKSLFQF  1065
             L  +V+ LF F
Sbjct  255   LTNKVRVLFNF  265



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   182 bits (462),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 131/200 (66%), Gaps = 10/200 (5%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            +S+HSD +    KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  428  DSDHSDVEASVYKEADSGRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  487

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKKVKVEAVGDN  543
            +LR++VPNVS+MDKASLL DA+SYINELK KV++      E Q QLRE +K      G +
Sbjct  488  SLRALVPNVSKMDKASLLGDAISYINELKSKVQKAEFDKGELQKQLRELRK---GVSGKD  544

Query  542  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  363
            Q   +  S  +   +++VKI+G D MIR+Q    N+P AK M  L+EL+L V+HAS+S V
Sbjct  545  QKGLNQDSGPSVETEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVV  604

Query  362  NDIMLQDIVVKVPEGLRSED  303
            ND M++   VK+     ++D
Sbjct  605  NDFMIEQATVKMGSRFFTQD  624


 Score =   159 bits (401),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 124/195 (64%), Gaps = 12/195 (6%)
 Frame = -2

Query  1622  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD---GRLFLAWGDGFFQGTKAGRGGGVPV  1452
             + TLQQRLQ +++   ++W YAIFWQ S D D   G   L WGDG+++G +    G   +
Sbjct  70    NETLQQRLQALIEGAPETWTYAIFWQLSYDFDAAGGTALLGWGDGYYKGEE--DKGKSNI  127

Query  1451  VVQTSHSTQQSERKKVISGIQALI------GSTQNSENGDLITDAEWFYVMSLARSFSAG  1290
                   + +Q  RK+VI  + ALI      G+++++ + + +TD EWF+++S+ +SF  G
Sbjct  128   RCSPESAAEQEHRKRVIRELNALISGGAVAGASEDAGD-EEVTDTEWFFLVSMTQSFLNG  186

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G PG+AF     +WLSG+  L    CERA++ QI+G+ TLVCIP+  GVVELGS E+I+
Sbjct  187   TGFPGQAFLNSRTIWLSGSDVLAGSGCERARQGQIYGLHTLVCIPSENGVVELGSTEVIQ  246

Query  1109  ENWSLVQQVKSLFQF  1065
             ++  L+++V +LF F
Sbjct  247   QSSDLMEKVNTLFNF  261



>gb|KHM99167.1| Transcription factor MYC4 [Glycine soja]
Length=218

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 121/180 (67%), Gaps = 19/180 (11%)
 Frame = -2

Query  809  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  630
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  16   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  75

Query  629  ELKGKV-----EELECQLQLRESKKVKVEAVGD--------------NQstssaassvaS  507
            ELK K+     E+ E + QL  +KK    A  +              N   +   ++  +
Sbjct  76   ELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPPPPPGLPPSNNEEAKKTTTKLA  135

Query  506  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  327
             +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+M+Q   V +
Sbjct  136  DLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLMIQQATVNM  195



>emb|CDX80023.1| BnaA05g01330D [Brassica napus]
Length=487

 Score =   179 bits (455),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 178/341 (52%), Gaps = 23/341 (7%)
 Frame = -2

Query  1604  RLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQ  1425
             RL     ++T SW YA+FWQ +    G+  LAWGDG  +  K        V        +
Sbjct  56    RLVDCPNSETFSWNYAVFWQQTVSRSGQQVLAWGDGCCREPKEEES---TVCYNLEEEMR  112

Query  1424  -QSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  1257
              Q  RK+V+  +  + G +   +     + +T  E F++ S+   F+ G+G PG+ F+ G
Sbjct  113   WQYMRKRVLQKLHRMFGGSDEDDYALSLENVTATEMFFLASMYFFFNHGEGGPGRCFASG  172

Query  1256  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
               VWLS A  +    C R+   +  GI+T+V +PT AGV+ELGS+  + EN  LV+ V++
Sbjct  173   RHVWLSDA--VGSDYCFRSFMVKSAGIRTVVMVPTDAGVLELGSVWSLPENVELVRSVQA  230

Query  1076  LFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaa  897
             LF     R +   ++     H+L  Q  ++ +D +             +         + 
Sbjct  231   LFM----RRVKPPNMSGGKIHKLFGQELNS-SDKVAHQVQENVNVVVVEDTNHKVMKTSC  285

Query  896   KNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  717
                 P S         L    +   ++  P+KRGRKP  GR   +NHVEAERQRREKLN 
Sbjct  286   NEKRPAS---------LLPGGVSVVEEKRPRKRGRKPANGREEALNHVEAERQRREKLNQ  336

Query  716   RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ  594
             RFYALR+VVPN+S+MDKASLL DA+SYI EL+ +V+ +E +
Sbjct  337   RFYALRAVVPNISKMDKASLLGDAISYIKELQERVKIIEAE  377



>ref|XP_004289915.1| PREDICTED: transcription factor bHLH3-like [Fragaria vesca subsp. 
vesca]
Length=504

 Score =   179 bits (455),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 211/455 (46%), Gaps = 56/455 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P    +QQ L  ++  Q  SW YA+FWQ      G   L WGDG  + TK   GGGV   
Sbjct  43    PGQLGVQQGLSQLV--QGSSWNYAVFWQVVGLKSGGAALIWGDGHCKDTK---GGGVGDE  97

Query  1448  VQTSHSTQQSERKK-------VISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSF  1299
               T     +  +KK       V+  + +  G +         D ++D E FY+ S+   F
Sbjct  98    SSTRDGNLEGVQKKNEEVRKWVLGKLHSCFGGSGEDNYARRLDRLSDVEMFYLTSMYFKF  157

Query  1298  SAGDGV-PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  1122
                    PG+++  G  +W+S       +   R+  A++ G QT+V +P  +GVVELGS+
Sbjct  158   QLDSPYGPGESYKSGKSIWVSNVASCLHHYQSRSFLARLAGFQTVVFVPMKSGVVELGSV  217

Query  1121  EIIKENWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRS----------------  990
             + I E  ++V  V+S+F  P   ++       + GHEL   G                  
Sbjct  218   KSILEEQNVVDMVRSVFGVPS--SVQAKIYPKIFGHELSLGGPKPQPINIAFCPKVETDS  275

Query  989   ---AGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQ  819
                + + DL+ + +      E    +     +        S    S  +  K+       
Sbjct  276   SFPSESFDLQAIGTSNGCRTEDSEVKLFPHLSQIMGGNFSSTAGVSSSELPKDESSAQID  335

Query  818   QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  639
             +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++
Sbjct  336   ERKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAIT  395

Query  638   YINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPV-DVEVKIVGPDAMI  462
             YIN+L+ K+  +E + Q+  S  ++                   P+ +++ +    DA++
Sbjct  396   YINDLQTKIRVMETEKQMGSSSHMQF------------------PIPEIDFQERQEDAVV  437

Query  461   RVQSENANYPSAKLMNGLRELELAVHHASISSVND  357
              +     ++P + ++  LRE  +     ++S   D
Sbjct  438   TMNCPLGSHPVSDVIRTLREHSIVAQDTNVSVTED  472



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   182 bits (461),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = -2

Query  875  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  696
            +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  437  DHSDLEASVVKEA-IVEPERK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  494

Query  695  VVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQs  537
            VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S
Sbjct  495  VVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSS  554

Query  536  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  357
              S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND
Sbjct  555  PPSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVND  614

Query  356  IMLQDIVVKVPEGLRSED  303
            +M+Q   VK+   L +++
Sbjct  615  LMIQQATVKMGSRLYAQE  632


 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 120/197 (61%), Gaps = 11/197 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL--FLAWGDGFFQGTKAGRGGGVPV  1452
             N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G +  +      
Sbjct  57    NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG-EENKNKRRAS  115

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENG--------DLITDAEWFYVMSLARSFS  1296
                T+   +Q  RKKV+  + +LI   Q +  G        + +TD EWF+++S+ +SF+
Sbjct  116   SSSTNFVAEQEHRKKVLRELNSLISGVQATGAGSGGDDAVDEEVTDTEWFFLISMTQSFA  175

Query  1295  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
              G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E+
Sbjct  176   NGNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTEL  235

Query  1115  IKENWSLVQQVKSLFQF  1065
             I E+  L+ +VK LF F
Sbjct  236   IFESSDLMNKVKYLFNF  252



>ref|XP_011083013.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH3-like, 
partial [Sesamum indicum]
Length=474

 Score =   179 bits (454),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 134/431 (31%), Positives = 206/431 (48%), Gaps = 60/431 (14%)
 Frame = -2

Query  1568  WAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGR---GGGVPVVVQTSHSTQQSERKKVIS  1398
             W YAI+W  S    G+  L WGDG  +  K G+   G       +   S +   RK+V+ 
Sbjct  60    WTYAIYWHVSKSKSGKSALIWGDGHCREPKKGQEVEGNSS----ENEKSMEGDSRKRVLE  115

Query  1397  GIQALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGD-GVPGKAFSMGSLVWLSGAH  1230
              + A  G  ++   +   D ++D E FY+ S+   F      +P ++F+ G  +W+S   
Sbjct  116   KVHACFGGLEDDNVASKLDRVSDLEMFYLTSMYFVFPFDKPSIPSQSFNSGRCIWVSDMK  175

Query  1229  R-LQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEER  1053
             R L+ Y   R+  A+   ++T+V +PT +G+VE GS++ I E+ S VQ  KS+      +
Sbjct  176   RCLECYES-RSYLAKSAHLETVVFVPTKSGIVEFGSIKSIPEDRSTVQSAKSIVVKLNSK  234

Query  1052  TISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESE  873
                   +  + G EL   G  +G   +   Q +   D+   A+     +      Y  S 
Sbjct  235   KAR--AVPKIFGQELSIGGSRSGPISISFSQ-KVEDDSVFSAESYELPSTGNTQVYGNSS  291

Query  872   H----SDSDCQFL-------------------KEPPIVDRQQNAPKKRGRKPGAGRVTPV  762
             +    SDS+ +                     KE   +   +  P+KRGRKP  GR  P+
Sbjct  292   NRHLNSDSEVKLYPHRNQAAAGGSNSQGIEQAKEDAFLLSDERKPRKRGRKPANGREEPL  351

Query  761   NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR  582
             NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++YI +L+ K+  LE      
Sbjct  352   NHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAIAYITDLQTKIRMLE------  405

Query  581   ESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
                    E    NQ T+          D+E      DA++RV     ++P + ++   RE
Sbjct  406   ------TEDGNQNQCTTP---------DIEFHDRQEDAVLRVSCPLDSHPVSGIIKAFRE  450

Query  401   LELAVHHASIS  369
              ++    ++IS
Sbjct  451   HQVMAQESTIS  461



>gb|KHN18804.1| Transcription factor MYC4 [Glycine soja]
Length=280

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 24/206 (12%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  55   DSDHSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  111

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGD---  546
            R+VVPNVS+MDKASLL DA+ YINELK K+     E+ E + QL  +KK    A  +   
Sbjct  112  RAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPP  171

Query  545  -------------NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  405
                         N       +S  + +++EVKI+G DAM+R+Q    N+P+A+LM  L+
Sbjct  172  PPPPPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALK  231

Query  404  ELELAVHHASISSVNDIMLQDIVVKV  327
            +L+L VHHAS+S VND+M+Q   V +
Sbjct  232  DLDLEVHHASVSVVNDLMIQQATVNM  257



>ref|XP_008235723.1| PREDICTED: transcription factor bHLH3 [Prunus mume]
Length=499

 Score =   179 bits (455),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 135/450 (30%), Positives = 216/450 (48%), Gaps = 56/450 (12%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P    +QQ L  ++K    +W YAIFWQ      G   L WGDG  + TK G   G    
Sbjct  43    PGKLGVQQGLSQLVKG--SNWNYAIFWQVVGSKSGGSALIWGDGHCRDTKDGGVAGENSS  100

Query  1448  VQTSHSTQQSE---RKKVISGIQALIGSTQN--SENGDLITDAEWFYVMSLARSFSA-GD  1287
             +  S    Q +   +K V+  + A  G      +   D ++D E FY+ S+  +F     
Sbjct  101   LDGSFEGVQKKEEVKKWVLEKLHACFGGLDEGYARRLDGVSDVEMFYLTSMYFAFQLDSH  160

Query  1286  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKE  1107
               PG+++  G  +W+S       +   R+  A++ G QT+V +P  +GVVELGS++   E
Sbjct  161   SGPGESYKSGKSIWVSDVGGCLHHYQSRSYLARLAGFQTVVFVPMKSGVVELGSVKANPE  220

Query  1106  NWSLVQQVKSLFQFPEERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqa  927
               +LV  V++LF   E  ++      ++ G EL   G  +   ++     +   D+    
Sbjct  221   EQNLVNMVRNLFG--ESSSVQAKAFPMIFGRELSLGGPKSQPINI-AFSPKIEEDSTFPP  277

Query  926   qeasaaaaaaKNSYPESEHSDSDCQFLKE-----------PPIVDRQQ------------  816
             +     +    N     +  DS+ +   +           P IV   +            
Sbjct  278   ESFELQSVGTSNG---CQSEDSEVKLFPQLNQMMVGGFSAPTIVSSSELPKDESSAQIDE  334

Query  815   NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  636
               P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA++Y
Sbjct  335   RKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAITY  394

Query  635   INELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPV-DVEVKIVGPDAMIR  459
             I +L+ K+  +E + Q+           G+N            PV +++ +    DA++R
Sbjct  395   ITDLQMKIRVMETENQM-----------GNNN-------QKQFPVPEIDFQERHEDAVVR  436

Query  458   VQSENANYPSAKLMNGLRELELAVHHASIS  369
             +     ++P ++++N LRE ++    +++S
Sbjct  437   MNCPLDSHPVSEVINTLREHKIVAQESNVS  466



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 133/197 (68%), Gaps = 9/197 (5%)
 Frame = -2

Query  872  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  693
            HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+V
Sbjct  442  HSDLEASVVKEA-IVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  499

Query  692  VPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQst  534
            VPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S 
Sbjct  500  VPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSSP  559

Query  533  ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  354
             S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+
Sbjct  560  PSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL  619

Query  353  MLQDIVVKVPEGLRSED  303
            M+Q   VK+   L +++
Sbjct  620  MIQQATVKMGSRLYAQE  636


 Score =   154 bits (390),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 119/197 (60%), Gaps = 11/197 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL--FLAWGDGFFQGTKAGRGGGVPV  1452
             N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G +  +      
Sbjct  57    NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG-EENKNKRRAS  115

Query  1451  VVQTSHSTQQSERKKVISGIQALIGSTQNSENG--------DLITDAEWFYVMSLARSFS  1296
                 +   +Q  RKKV+  + +LI   Q +  G        + +TD EWF+++S+ +SF+
Sbjct  116   SSSANFVAEQEHRKKVLRELNSLISGVQAAGAGSGGDDAVDEEVTDTEWFFLISMTQSFA  175

Query  1295  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
              G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E+
Sbjct  176   NGNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTEL  235

Query  1115  IKENWSLVQQVKSLFQF  1065
             I E+  L+ +VK LF F
Sbjct  236   IFESSDLMNKVKYLFNF  252



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  353  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  411

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  412  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  471

Query  536  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  357
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  472  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  531

Query  356  IMLQDIVVKV  327
            +M+Q   VK+
Sbjct  532  LMIQQATVKM  541


 Score =   143 bits (360),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 115/190 (61%), Gaps = 11/190 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  64    NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRGEEDKEK--  121

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS----TQNSENGDLITDAEWFYVMSLARSFSA  1293
                   +S+  +Q  RK+VI  + +LI        +  N + +TD EWF+++S+ +SF  
Sbjct  122   KKKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVN  181

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E+I
Sbjct  182   GVGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVI  241

Query  1112  KENWSLVQQV  1083
              ++  L+ +V
Sbjct  242   SQSSDLMDKV  251



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  352  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  410

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  537
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  411  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  470

Query  536  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  357
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  471  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  530

Query  356  IMLQDIVVKV  327
            +M+Q   VK+
Sbjct  531  LMIQQATVKM  540


 Score =   143 bits (360),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 115/190 (61%), Gaps = 11/190 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  63    NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRGEEDKEK--  120

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS----TQNSENGDLITDAEWFYVMSLARSFSA  1293
                   +S+  +Q  RK+VI  + +LI        +  N + +TD EWF+++S+ +SF  
Sbjct  121   KKKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVN  180

Query  1292  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEII  1113
             G G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E+I
Sbjct  181   GVGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVI  240

Query  1112  KENWSLVQQV  1083
              ++  L+ +V
Sbjct  241   SQSSDLMDKV  250



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 23/201 (11%)
 Frame = -2

Query  881  ESEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
            ES+HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  722  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  542  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  390
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  389  VHHASISSVNDIMLQDIVVKV  327
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656


 Score =   140 bits (352),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 114/192 (59%), Gaps = 11/192 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  1449
             N  TLQQRLQ I++   ++W YAIFWQ+S D  G   L WGDG+++G   A +    P  
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTDA-GASLLGWGDGYYKGCDDADKRRQQPT-  99

Query  1448  VQTSHSTQQSERKKVISGIQALIG----STQNSENGDLITDAEWFYVMSLARSFSAGDGV  1281
                + + +Q  RK+V+  + +LI     +  +    + +TD EWF+++S+ +SF  G G+
Sbjct  100   --PASAAEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGL  157

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+A   G  +W+  A  L    CERA++A   G++T+VCIP G GV+ELG+ E+I +  
Sbjct  158   PGQALFAGQPIWI--ATGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTT  215

Query  1100  SLVQQVKSLFQF  1065
               + +++SLF  
Sbjct  216   DSLGRIRSLFSL  227



>gb|EYU32289.1| hypothetical protein MIMGU_mgv1a007575mg [Erythranthe guttata]
Length=403

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 14/169 (8%)
 Frame = -2

Query  806  KKRGRKPGAGR----VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  639
            KKRGRKP   R    +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  222  KKRGRKPAGPRGPDALPTMNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  281

Query  638  YINELKGKVEELECQ----LQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPD  471
            YI ELK ++++L+      L    S  VK E   D++   S++S       VEVK+VG D
Sbjct  282  YIKELKSRLDDLQTNNVNKLLSSSSSVVKTETDDDDEPIISSSSL------VEVKMVGVD  335

Query  470  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  324
             MIRVQSE +NYPSA+LM+ +R+L+L + HAS+S VN+IM+QD+VV +P
Sbjct  336  GMIRVQSEKSNYPSARLMDAIRDLKLEIQHASMSCVNNIMIQDVVVTLP  384


 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 101/188 (54%), Gaps = 50/188 (27%)
 Frame = -2

Query  1628  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  1449
             P  S LQ++L+ +L+TQTD W+YAIFWQ+ +     + L WGDG+FQGT           
Sbjct  30    PTISVLQKKLKHLLQTQTDFWSYAIFWQSCSSSTSNV-LNWGDGYFQGT-----------  77

Query  1448  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKA  1269
                                     +  N     L  D               G GV GKA
Sbjct  78    -----------------------ANYSNETTKKLAVDEH-------------GGGVVGKA  101

Query  1268  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA--GVVELGSLEIIKENWSL  1095
             F+ GSLVWL+G ++L++YNCERAK+A+ HG+QT+VCIPT    GVVEL S  II ENW+L
Sbjct  102   FNSGSLVWLTGGNQLKLYNCERAKQAEAHGMQTMVCIPTATPRGVVELASHLIIHENWTL  161

Query  1094  VQQVKSLF  1071
             +QQV+  F
Sbjct  162   LQQVQHTF  169



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 23/201 (11%)
 Frame = -2

Query  881  ESEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
            ES+HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  722  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  542  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  390
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  389  VHHASISSVNDIMLQDIVVKV  327
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656


 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 114/192 (59%), Gaps = 11/192 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  1449
             N  TLQQRLQ I++   ++W YAIFWQ+S D  G   L WGDG+++G   A +    P  
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTDA-GASLLGWGDGYYKGCDDADKRRQQPT-  99

Query  1448  VQTSHSTQQSERKKVISGIQALIG----STQNSENGDLITDAEWFYVMSLARSFSAGDGV  1281
                + + +Q  RK+V+  + +LI     +  +    + +TD EWF+++S+ +SF  G G+
Sbjct  100   --PASAAEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGL  157

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+A   G  +W+  A  L    CERA++A   G++T+VCIP G GV+ELG+ E+I +  
Sbjct  158   PGQALFAGKPIWI--ATGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTT  215

Query  1100  SLVQQVKSLFQF  1065
               + +++SLF  
Sbjct  216   DSLGRIRSLFSL  227



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   181 bits (458),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 136/198 (69%), Gaps = 15/198 (8%)
 Frame = -2

Query  887  YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  708
            + +S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  391  FGDSDHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  446

Query  707  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQ--LRESKKVKVEA  555
            ALR+VVPNVS+MDKASLL DA+SYINELK K++       + +CQL+   RE       A
Sbjct  447  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQRAESDKTQFQCQLENLKRELAGRHANA  506

Query  554  VGDNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  381
                   S ++S+V+ P+  ++EVKI+  DAMIR++S   N+P+A+LM  L+ELEL V+H
Sbjct  507  NAGILDASDSSSAVSKPIGMEIEVKIIEWDAMIRIESSKRNHPAARLMTALKELELEVNH  566

Query  380  ASISSVNDIMLQDIVVKV  327
            AS+S VND+M+Q   VK+
Sbjct  567  ASVSVVNDLMIQQATVKL  584


 Score =   160 bits (406),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 124/192 (65%), Gaps = 6/192 (3%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT--KAGRGGGVPV  1452
             N  TLQQRLQ +++    SW YAIFWQ S D  G   L WGDG+++G   KA      P 
Sbjct  51    NQETLQQRLQALIEGAPKSWTYAIFWQLSYDFSGAAVLGWGDGYYKGEEDKAQPSRRSPR  110

Query  1451  VVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGV  1281
                +S + +Q  RK+++S + +LI G    S++   + +TD EWF+++S+ +SF +G G+
Sbjct  111   TFFSSPA-EQEHRKRILSELNSLISGGAVPSDDAVNEEVTDTEWFFLVSMTQSFPSGSGL  169

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
              GKA+S  + VW+ G+ +L    CERA++  + G+QT+ CIP+  GVVELGS EII+++ 
Sbjct  170   AGKAYSTSNPVWVIGSDQLSSSGCERARQGGVFGLQTIACIPSANGVVELGSTEIIRQSS  229

Query  1100  SLVQQVKSLFQF  1065
              LV +V++LF+F
Sbjct  230   GLVNKVRTLFKF  241



>ref|XP_009367780.1| PREDICTED: transcription factor bHLH3-like [Pyrus x bretschneideri]
Length=481

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/449 (29%), Positives = 213/449 (47%), Gaps = 52/449 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSE---RKKVI  1401
             +W YAIFWQ      G   L WGDG  + TK G  G       +S    Q++   +K+V+
Sbjct  27    NWNYAIFWQAVRSKSGGSALGWGDGHCRDTKDGGAGDANSSRDSSLEAVQNKEEVKKRVV  86

Query  1400  SGIQALIGSTQNSENG---DLITDAEWFYVMSLARSF---SAGDGVPGKAFSMGSLVWLS  1239
               + A  G           D ++D E FY+ S+  +F   S     P ++++    +W+S
Sbjct  87    EKLHACFGGLHADNYARRLDGVSDVEMFYLTSMCYAFQLDSISHCGPAESYNSRKSIWVS  146

Query  1238  GAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPE  1059
              A     +   R+  A++ G QT+V +P  +GVVELGS++   E  S V  V+S F   E
Sbjct  147   DAGSCLHHYQSRSFLARLAGFQTVVFVPMKSGVVELGSVKSTSEEQSYVDMVRSAFG--E  204

Query  1058  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP-  882
                I      ++ G EL   G  + + ++     +   D     +     +    N +P 
Sbjct  205   SSPIQPKASPMIFGRELSLGGPKSQSVNIS-FTPKVEEDFACHPESFELQSVGTSNGFPS  263

Query  881   -------------------ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVN  759
                                 ++   S  + LK+       +  P+KRGRKP  GR  P+N
Sbjct  264   EGGEVKLFPQMNQLMVDGFNTQTRVSSSELLKDESSTQVDEQKPRKRGRKPSNGREEPLN  323

Query  758   HVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRE  579
             HVEAERQRREKLN RFYALR+VVPN+S+MDKASLL DA+++I +L+ K+  +E + Q+  
Sbjct  324   HVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDAITHITDLQMKIRVIEIEKQMVN  383

Query  578   SKKVKVEAVGDNQstssaassvaSPV-DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  402
             +K  ++                  PV +++      DA++R+     ++P + ++  LRE
Sbjct  384   NKGKQL------------------PVPEIDFLERHEDAVVRMNCPLDSHPVSDVIRTLRE  425

Query  401   LELAVHHASIS-SVNDIMLQDIVVKVPEG  318
              ++    +++S + ND ++    ++   G
Sbjct  426   HKIVPQESNVSITDNDKVIHTFSIQTQGG  454



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = -2

Query  875  EHSDSDCQFLK--EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +HSD +   +K  +   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  355  DHSDLEASIVKGADSSRVFDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  414

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGK-------VEELECQLQLRESKKVKVEAVGDN  543
            R+VVPNVS+MDKASLL DA+SYINELK K       V+EL  QL   ES K +       
Sbjct  415  RAVVPNVSKMDKASLLGDAISYINELKSKLQNSEMDVDELRSQL---ESLKKEHNDSDPP  471

Query  542  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  363
               ++A+++    VD+EVKI+G DAMI+VQ    N+P+A+LM   REL+L VHHAS+S V
Sbjct  472  TGYTTASATNNVSVDIEVKIIGRDAMIQVQCGKRNHPAAQLMTAFRELDLDVHHASVSVV  531

Query  362  NDIMLQDIVVKV  327
            N++M+Q   VK+
Sbjct  532  NELMIQQATVKM  543


 Score =   149 bits (375),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 113/192 (59%), Gaps = 14/192 (7%)
 Frame = -2

Query  1613  LQQRLQFILKTQTDSWAYAIFWQTSNDDDG--RLFLAWGDGFFQGTKAGRGGGVPVVVQT  1440
             LQQRL  ++    + W YAIFWQ S  D G     L+WGDG+++G +             
Sbjct  4     LQQRLSALIDGARECWTYAIFWQNSAADFGLPPSALSWGDGYYKGEEDKEKRKT-----A  58

Query  1439  SHSTQQSERKKVISGIQALIGSTQNSENGD-------LITDAEWFYVMSLARSFSAGDGV  1281
             S   +Q  RKKV+  + +L+   Q S   D        +TD EWF+++S+ ++F  G G+
Sbjct  59    SSYAEQEHRKKVLRELNSLVSGQQASSPDDDGAAVDEEVTDTEWFFLISMTQTFENGSGI  118

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+A    S VW++G  RL   NC+RA++A  +G++TLVCIP+  GVVELGS  +I ++ 
Sbjct  119   PGQAMFASSPVWVAGPERLAEANCDRARQALGYGLRTLVCIPSSNGVVELGSTSVIFQSS  178

Query  1100  SLVQQVKSLFQF  1065
              LV++VKSLF F
Sbjct  179   DLVRKVKSLFNF  190



>ref|XP_006414178.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
 gb|ESQ55631.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
Length=621

 Score =   180 bits (457),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S HSD D   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  407  DSNHSDLDASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  466

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  552
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+ +  ++  K    
Sbjct  467  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIDVMSNENGKCS--  524

Query  551  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  372
            G ++   +  S V+  ++++VKI+G DAMIR+Q    N+P AK M  L++L+L V+HAS+
Sbjct  525  GGDRKYLNQDSGVSIEMEIDVKIIGWDAMIRIQCSKRNHPGAKFMEALKDLDLEVNHASL  584

Query  371  SSVNDIMLQDIVVKVPEGLRSED  303
            S VND M+Q   VK+     ++D
Sbjct  585  SVVNDFMIQQATVKMGNQFFTQD  607


 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 115/207 (56%), Gaps = 25/207 (12%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND------------DDGRLFLAWGDGFFQ  1488
             Q    TLQQRLQ +++   +SW YA+FWQ S D                  L W DG+++
Sbjct  59    QAGEDTLQQRLQALIEGARESWTYAVFWQLSYDFAGEDDGGGGGGSINTPLLGWSDGYYK  118

Query  1487  GTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ----------NSENGDL-IT  1341
             G +  +          + +  Q  RK+VI  + +LI              + E GD  +T
Sbjct  119   GEEEKKS--RKKKPNPASAADQEHRKRVIQELNSLISGGGGGGTVNGGGNSDEAGDEEVT  176

Query  1340  DAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVC  1161
             D EWF+++S+ +SF  G G+PG+AFS    +WLSG++ L   +CERA++ QI+G++T+VC
Sbjct  177   DTEWFFLVSMTQSFINGSGLPGQAFSDSQTIWLSGSNALAGSSCERARQGQIYGLETMVC  236

Query  1160  IPTGAGVVELGSLEIIKENWSLVQQVK  1080
             IP   GVVELGS EII ++  L+ +V+
Sbjct  237   IPAENGVVELGSSEIIHQSSDLIGKVR  263



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   181 bits (458),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  564
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  584

Query  563  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  585  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  644

Query  383  HASISSVNDIMLQDIVVKVPEGLRSED  303
            HAS+S VND+M+Q   VK+   + ++D
Sbjct  645  HASVSVVNDLMIQQATVKMGSRIYTQD  671


 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 116/191 (61%), Gaps = 7/191 (4%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  1446
             N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF+   K  R        
Sbjct  78    NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGSAILGWGEGFY---KDERDKVKAKAK  134

Query  1445  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  1278
              T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+P
Sbjct  135   TTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLISMTQSFVNGGGLP  194

Query  1277  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWS  1098
             G+AF   + VW++G  RL    CERA++ ++ G+QT+VC+PT  GVVELGS E+I ++  
Sbjct  195   GQAFFHSTPVWVAGPDRLAASPCERARQGKVFGLQTMVCVPTANGVVELGSTELIYQSSD  254

Query  1097  LVQQVKSLFQF  1065
             L+ + + LF F
Sbjct  255   LMNKARVLFDF  265



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   180 bits (456),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 10/203 (5%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  398  DSNHSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  457

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  552
            Y+LR+VVPN+S+MDKASLL DA+SYINELK K+       EEL+ Q++    +    ++ 
Sbjct  458  YSLRAVVPNISKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIEGMSKEAANEKSY  517

Query  551  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  372
               +  ++  S V   ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+
Sbjct  518  VKERKCANQESGVTIEMEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASL  577

Query  371  SSVNDIMLQDIVVKVPEGLRSED  303
            S VND+M+Q   VK+ +   ++D
Sbjct  578  SVVNDLMIQQATVKMGKEFFTQD  600


 Score =   161 bits (407),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 125/208 (60%), Gaps = 22/208 (11%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND----DDG------RLFLAWGDGFFQGT  1482
             Q N  TLQQRLQ +++   +SW YA+FWQ+S D    DDG         L WGDG+++G 
Sbjct  60    QFNEDTLQQRLQALIEGANESWTYAVFWQSSYDFAGEDDGGGESRNTAVLGWGDGYYKGE  119

Query  1481  KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ--------NSENGDL-ITDAEW  1329
             +             + + +Q  R++VI  + ALI            + E GD  +TD EW
Sbjct  120   EEN---SRKKKSNPASAAEQEHRRRVIRELNALISGGGGVVNNGGGSDEAGDEEVTDTEW  176

Query  1328  FYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  1149
             F+++S+ +SF +G G+PG+AFS  + +WLSG++ L   +CERA++ QI+G+QT+VC+P  
Sbjct  177   FFLVSMTQSFVSGTGLPGQAFSNSNTIWLSGSNALAGSSCERARQGQIYGLQTMVCVPCE  236

Query  1148  AGVVELGSLEIIKENWSLVQQVKSLFQF  1065
              GVVELGS EII ++  LV +V + F F
Sbjct  237   NGVVELGSSEIIHQSSDLVDKVDTFFNF  264



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   180 bits (456),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 130/196 (66%), Gaps = 11/196 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  411  DSNHSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  470

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQsts  531
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+ + E     +E  + +++ +  NQ   
Sbjct  471  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLLKAESD---KEELQKQIDGMKRNQEPG  527

Query  530  saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIM  351
             +       ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+S VND+M
Sbjct  528  VSVE-----MEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLM  582

Query  350  LQDIVVKVPEGLRSED  303
            +Q   VK+     ++D
Sbjct  583  IQQATVKMGNEFFTQD  598


 Score =   148 bits (373),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 124/215 (58%), Gaps = 35/215 (16%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-------------------DDGRLFLA  1509
             Q N  TLQQRLQ +++   +SWAYA+FWQ S D                   ++    L 
Sbjct  61    QVNEDTLQQRLQALIEGANESWAYAVFWQLSYDFAGEDVEGGGVGGVGLTNNNNNTALLG  120

Query  1508  WGDGFFQGT--KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ--------NSE  1359
             WGDG+++G   K+ +    P     + + +Q  RK+V+  + ALI            + E
Sbjct  121   WGDGYYKGEEEKSRKKKTNP-----ASAAEQEHRKRVVRELNALISGGGGEVVNNGGSDE  175

Query  1358  NGDL-ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIH  1182
              GD  +TD EWF+++S+ +SF  G G+PG+AFS  + +WLSG++ L   +CERA++ QI+
Sbjct  176   AGDEEVTDTEWFFLVSMTQSFVYGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIY  235

Query  1181  GIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKS  1077
             G+QT+VC+P   GVVELGS E+I ++  LV +V +
Sbjct  236   GLQTMVCVPCENGVVELGSSEVIHQSSDLVDKVDT  270



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 128/185 (69%), Gaps = 11/185 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  350  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  408

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  522
            R+VVPNVS+MDKASLL DA+SYINELK K       LQ  E+ K +V+   D  S     
Sbjct  409  RAVVPNVSKMDKASLLGDAISYINELKTK-------LQQAETDKEEVQKQLDGMSKEGGG  461

Query  521  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  342
            S     ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND+M+Q 
Sbjct  462  SVE---MEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQ  518

Query  341  IVVKV  327
              VK+
Sbjct  519  ATVKM  523


 Score =   142 bits (359),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 115/189 (61%), Gaps = 10/189 (5%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-----RLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  62    NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGESTVILGWGDGYYRGEEDKEK--  119

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  1290
                   +S+  +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  120   KKKQSSSSNPAEQEHRKRVIRELNSLIAGGAGVSDEANDEEVTDTEWFFLVSMTQSFVNG  179

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E+I 
Sbjct  180   VGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSEVIS  239

Query  1109  ENWSLVQQV  1083
             ++  L+ +V
Sbjct  240   QSSDLMDKV  248



>emb|CDY56874.1| BnaC04g52120D [Brassica napus]
Length=491

 Score =   177 bits (450),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 174/330 (53%), Gaps = 11/330 (3%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGI  1392
             SW YA+FWQ +    G+  LAWGDG  +  K        +         Q  RK+V+  +
Sbjct  67    SWNYAVFWQQTVSRSGQQVLAWGDGCCREPKEEESMAYNL---EEEMRWQYMRKRVLQKL  123

Query  1391  QALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQ  1221
               + G +   +   N + +T  E F++ S+   F+ G+G PG+ F+ G  VWLS A  + 
Sbjct  124   HRMFGGSDEDDYALNLENVTATEMFFLASMYFFFNHGEGGPGRCFASGRHVWLSDA--VG  181

Query  1220  MYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF-QFPEERTIS  1044
                C R+   +  GI+T+V +PT AGV+ELGS+  + EN  LV+ V+ LF +  +   +S
Sbjct  182   SDYCFRSFMVKSAGIRTVVMVPTDAGVLELGSVWSLPENVELVRSVQGLFARRVKPPNMS  241

Query  1043  FADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEHSD  864
                I  + G EL     +     +         D + Q            +   ++  ++
Sbjct  242   GGKIHKLFGQELNSSHHNNNGSTIGYTSQEI--DVKVQENVNVVVVDDKNHKVMKTSCNE  299

Query  863   SDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPN  684
                  L    +   ++  P+KRGRKP  GR   +NHVEAERQRREKLN RFYALR+VVPN
Sbjct  300   KRPASLLPEGVSVVEEKRPRKRGRKPANGREEALNHVEAERQRREKLNQRFYALRAVVPN  359

Query  683   VSRMDKASLLSDAVSYINELKGKVEELECQ  594
             +S+MDKASLL DA+SYI EL+ +V+ +E +
Sbjct  360   ISKMDKASLLGDAISYIKELQERVKIIEAE  389



>gb|EYU46482.1| hypothetical protein MIMGU_mgv1a005352mg [Erythranthe guttata]
Length=487

 Score =   177 bits (450),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 132/415 (32%), Positives = 202/415 (49%), Gaps = 36/415 (9%)
 Frame = -2

Query  1568  WAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQ  1389
             W YAI+W  S    G+  L WGDG  +  K G               +   RK+V+  I 
Sbjct  61    WTYAIYWHVSRSKSGKSALIWGDGHCREPKEGEYDTGNFSEDGKKPVEGDCRKRVLQKIH  120

Query  1388  ALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGD-GVPGKAFSMGSLVWLSGAHRLQ  1221
             A  G +++       D ++  E FY+ S+  +F      +P ++F+ G  +W+S      
Sbjct  121   ACFGGSEDDNVAAKLDQVSHVEMFYLTSMYFAFPFDKPSIPSQSFNSGRTIWVSDMKSCL  180

Query  1220  MYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLFQFPEERTISF  1041
                  R+  A++ G +TLV IP+ +GV+E+GS + I EN S++Q  KS+       T + 
Sbjct  181   ERYQSRSYLAKLAGFETLVYIPSKSGVIEIGSRKSIPENQSIIQSAKSII-VKVNSTHAK  239

Query  1040  ADIGLVSGHELLQQGR---------SAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNS  888
               +  V G EL   G          S   +D  VL S +  D +     ++       ++
Sbjct  240   PFLPKVFGQELNLGGSKSSTISISFSPKVEDDSVLSSESY-DLQVYGNSSNGHRTDDIDA  298

Query  887   --YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  714
               YP   H + D   + E   V      P+KRGRKP  GR   +NHVEAERQRREKLN R
Sbjct  299   KIYP---HLNMDQ--IAENSFVLSDDQRPRKRGRKPANGREEALNHVEAERQRREKLNQR  353

Query  713   FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  534
             FYALR+VVPN+S+MDKASLL DA++YI +L+ KV  +E +              G   + 
Sbjct  354   FYALRAVVPNISKMDKASLLGDAIAYITDLQTKVRVMEAEK-------------GVVNNN  400

Query  533   ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
             ++       P D++      D+++RV     ++P + ++  LRE ++A H + IS
Sbjct  401   NNKQHESNIP-DIDFLERHEDSVLRVSCPLESHPVSGVVRALRENQVAAHESVIS  454



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   179 bits (455),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 136/199 (68%), Gaps = 17/199 (9%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  393  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  452

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---------  549
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  + K++ +          
Sbjct  453  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESD---KEEIQKKLDGMSKEGNNGKGG  509

Query  548  -----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  384
                 + +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+
Sbjct  510  GSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVN  569

Query  383  HASISSVNDIMLQDIVVKV  327
            HAS+S VND+M+Q   VK+
Sbjct  570  HASLSVVNDLMIQQATVKM  588


 Score =   138 bits (347),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 117/191 (61%), Gaps = 13/191 (7%)
 Frame = -2

Query  1631  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRG  1467
             Q N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +    
Sbjct  50    QFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED---  106

Query  1466  GGVPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFS  1296
                      +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF 
Sbjct  107   --KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFV  164

Query  1295  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEI  1116
              G G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI T  GVVELGS E+
Sbjct  165   NGVGLPGESFLNSRVIWLSGSGSLTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEV  224

Query  1115  IKENWSLVQQV  1083
             I ++  L+ +V
Sbjct  225   ISQSSDLMDKV  235



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   179 bits (454),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 12/205 (6%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  711
            +S  SD +   +KE     IV   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  372  DSNRSDLEASVVKEAESGRIVAETEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  431

Query  710  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVE  558
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+    +E     V+
Sbjct  432  YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVK  491

Query  557  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  378
            ++  +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HA
Sbjct  492  SLVKDQKCLDQDSGVSIEVEIDVKIIGWDAMIRIQCAKKNHPGAKFMEALKELELEVNHA  551

Query  377  SISSVNDIMLQDIVVKVPEGLRSED  303
            S+S VN+ M+Q   VK+     ++D
Sbjct  552  SLSVVNEFMIQQATVKMGNQFFTQD  576


 Score =   154 bits (388),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 121/197 (61%), Gaps = 24/197 (12%)
 Frame = -2

Query  1616  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQGT---KAGRGG  1464
             TLQQRLQ +++   +SW YA+FWQ S+D  G         L WGDG+++G    K+ +  
Sbjct  61    TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLTWGDGYYKGEEERKSRKRK  120

Query  1463  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQN---------SENGDL-ITDAEWFYVMS  1314
               PV      + +Q  RK+VI  + +LI               E GD  ++D EWF+++S
Sbjct  121   PNPV-----SAAEQEHRKRVIRELNSLISGGGGTVSSSGGSSDEAGDEDVSDTEWFFLVS  175

Query  1313  LARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVE  1134
             + +SF  G G+PG+AFS    +WLSG++ L   +CERA++ Q++G++T+VCIPT  GVVE
Sbjct  176   MTQSFVNGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVE  235

Query  1133  LGSLEIIKENWSLVQQV  1083
             LGSLEII ++  LV++V
Sbjct  236   LGSLEIIHQSSDLVEKV  252



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   179 bits (455),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 131/194 (68%), Gaps = 9/194 (5%)
 Frame = -2

Query  881  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  702
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  387  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  446

Query  701  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  522
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + +   V   G+ +  S A 
Sbjct  447  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGNGKGGSRAK  506

Query  521  ssvaS---------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  369
               +S          ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S
Sbjct  507  ERKSSNQDSSGSSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLS  566

Query  368  SVNDIMLQDIVVKV  327
             VND+M+Q   VK+
Sbjct  567  VVNDLMIQQATVKM  580


 Score =   141 bits (356),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 114/189 (60%), Gaps = 13/189 (7%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQGTKAGRGGG  1461
             N  TLQQRLQ ++++  ++W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  50    NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGENTVILGWGDGYYKGEED-----  104

Query  1460  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  1290
                    +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  105   KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  164

Query  1289  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIK  1110
              G+PG++F    ++WLSG   L    CERA + QI+G++T+VCI    GVVELGS E+I 
Sbjct  165   VGLPGESFLNSRVIWLSGPGALTGSGCERAGQGQIYGLKTMVCIAAQNGVVELGSSEVIS  224

Query  1109  ENWSLVQQV  1083
             ++  L+ +V
Sbjct  225   QSSDLMDKV  233



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   180 bits (456),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 132/201 (66%), Gaps = 23/201 (11%)
 Frame = -2

Query  881  ESEHSDSDCQFLK-------EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  723
            ES+HSD +    +        PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  722  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  543
            N RFY LR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  542  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  390
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  389  VHHASISSVNDIMLQDIVVKV  327
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656


 Score =   140 bits (352),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 114/192 (59%), Gaps = 11/192 (6%)
 Frame = -2

Query  1625  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  1449
             N  TLQQRLQ I++   ++W YAIFWQ+S D  G   L WGDG+++G   A +    P  
Sbjct  42    NQDTLQQRLQAIIEGSRETWTYAIFWQSSTDA-GASLLGWGDGYYKGCDDADKRRQQPT-  99

Query  1448  VQTSHSTQQSERKKVISGIQALIG----STQNSENGDLITDAEWFYVMSLARSFSAGDGV  1281
                + + +Q  RK+V+  + +LI     +  +    + +TD EWF+++S+ +SF  G G+
Sbjct  100   --PASAAEQEHRKRVLRELNSLIAGGGAAAPDEAVEEEVTDTEWFFLVSMTQSFPNGMGL  157

Query  1280  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENW  1101
             PG+A   G  +W+  A  L    CERA++A   G++T+VCIP G GV+ELG+ E+I +  
Sbjct  158   PGQALFAGQPIWI--ATGLASAPCERARQAYTFGLRTMVCIPLGTGVLELGATEVIFQTT  215

Query  1100  SLVQQVKSLFQF  1065
               + +++SLF  
Sbjct  216   DSLGRIRSLFSL  227



>ref|XP_010679204.1| PREDICTED: transcription factor bHLH3-like [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   177 bits (450),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 134/448 (30%), Positives = 214/448 (48%), Gaps = 55/448 (12%)
 Frame = -2

Query  1571  SWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA-----GRGGGVPVVVQTSHSTQQSERKK  1407
             SW YAIFWQ ++  +G+  L WGDG  +  KA     G  GG     +     +   +K+
Sbjct  60    SWNYAIFWQIASSKNGKAVLIWGDGHCRDPKAVVAREGLDGGNGKFGEV----KNEGKKR  115

Query  1406  VISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGV-PGKAFSMGSLVWLS  1239
             V+  +    G ++        D ++D E  Y+ S+   F     + P K+F+ G  +W+S
Sbjct  116   VLEKLHGCFGGSEEDNFAATLDKVSDVEMLYLTSMYYWFRLDSSLGPAKSFTSGRSIWVS  175

Query  1238  GAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLEIIKENWSLVQQVKSLF----  1071
                    +   RA  A+    QT+V +P   GV+ELGS+  + E  SLVQ VK +F    
Sbjct  176   DVRSCLDHYQSRAHLAKSAMFQTVVFVPVKTGVLELGSVRTVMEEHSLVQMVKKIFGESQ  235

Query  1070  QFPEERT--ISFADIGLVSGHEL---------------LQQGRSAGADDL---KVLQSRA  951
              FP + +  +   D+ LV+                          GA D+    +  S +
Sbjct  236   SFPAKVSPKVFGRDLSLVTSRPRSMNISFAPKTEDDASFSAESRVGASDIGAKHIYGSSS  295

Query  950   AGDaekqaqeasaaaaaaKNSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRV  771
              G   +Q+ +   +      S PES+    D +  +E  +   +  A K+  R+P +GR 
Sbjct  296   NGKHSEQSDKRVFSEINFGGSNPESDFPALD-EASEELLLQAAELRARKRPSRRPASGRE  354

Query  770   TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL  591
               ++HV AERQRREKLN RFYALR+VVPN+S+MDKASLL DA+SYIN+L+ K+ ELE + 
Sbjct  355   EAMSHVLAERQRREKLNQRFYALRAVVPNISKMDKASLLLDAISYINDLQTKIGELEAEK  414

Query  590   QLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  411
             ++   K    E                   +++ +    DA++ V      +P +K++  
Sbjct  415   EVANPKDESFEI-----------------PEIDFQARQDDALVHVSFPLDAHPVSKVVKT  457

Query  410   LRELELAVHHASISSVNDIMLQDIVVKV  327
             LRE +L    A++S+ +D M+    ++ 
Sbjct  458   LREHQLVALEANVSTKDDKMVHTFTIRA  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5380304293438