BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25322_g4_i2 len=1737 path=[1:0-192 194:193-222 224:223-556
558:557-613 615:614-1188 22481:1189-1191 3533:1192-1228
3570:1229-1300 3642:1301-1319 22597:1320-1326 13330:1327-1392
13396:1393-1736]

Length=1737
                                                                      Score     E

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          887   0.0     
dbj|BAG80542.1|  glycosyltransferase                                    745   0.0     Lycium barbarum [goji berry]
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    739   0.0     
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    736   0.0     
dbj|BAD93690.1|  glycosyltransferase                                    733   0.0     Nicotiana tabacum [American tobacco]
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       732   0.0     
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    731   0.0     
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    731   0.0     
emb|CDP01076.1|  unnamed protein product                                726   0.0     
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    726   0.0     
gb|ADG65641.1|  glycosyltransferase                                     726   0.0     
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    722   0.0     
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       721   0.0     
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    721   0.0     
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    720   0.0     
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    717   0.0     
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    717   0.0     
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       717   0.0     
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    716   0.0     
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    713   0.0     
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         710   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             709   0.0     
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         707   0.0     
dbj|BAG80547.1|  glycosyltransferase                                    706   0.0     Lycium barbarum [goji berry]
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         704   0.0     
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    701   0.0     
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       699   0.0     
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    696   0.0     
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      696   0.0     
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       693   0.0     
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    691   0.0     
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    688   0.0     
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                688   0.0     
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                687   0.0     
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             686   0.0     
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    686   0.0     
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    684   0.0     
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       683   0.0     
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          682   0.0     
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    682   0.0     Vitis vinifera
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    681   0.0     Vitis vinifera
gb|AIL51400.1|  glycosyltransferase                                     681   0.0     
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    680   0.0     
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       680   0.0     
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       679   0.0     
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      681   0.0     
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       679   0.0     
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    679   0.0     
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    679   0.0     
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       677   0.0     
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     677   0.0     
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    676   0.0     
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    676   0.0     
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  676   0.0     
gb|ABW96222.1|  glucosyltransferase                                     676   0.0     Linum usitatissimum
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  674   0.0     
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              674   0.0     Ricinus communis
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    673   0.0     Vitis vinifera
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    673   0.0     Vitis vinifera
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       673   0.0     
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    673   0.0     Vitis vinifera
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             673   0.0     
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    673   0.0     
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            672   0.0     
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       672   0.0     
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     671   0.0     
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    671   0.0     
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       670   0.0     
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             669   0.0     
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            668   0.0     
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    669   0.0     
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    668   0.0     
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       668   0.0     
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    667   0.0     
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             667   0.0     
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       665   0.0     
gb|AFK33787.1|  unknown                                                 665   0.0     
gb|ACJ84649.1|  unknown                                                 665   0.0     Medicago truncatula
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               665   0.0     
gb|AFK34769.1|  unknown                                                 664   0.0     
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       664   0.0     
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             664   0.0     
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    663   0.0     
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       662   0.0     
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       662   0.0     
gb|AFK37311.1|  unknown                                                 662   0.0     
emb|CDO97426.1|  unnamed protein product                                662   0.0     
emb|CDP01078.1|  unnamed protein product                                662   0.0     
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             661   0.0     
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    661   0.0     
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       660   0.0     
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       659   0.0     
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    659   0.0     
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       659   0.0     
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  658   0.0     
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             657   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            653   0.0     
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             653   0.0     
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             653   0.0     
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    652   0.0     
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    652   0.0     
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    651   0.0     Vitis vinifera
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    650   0.0     Vitis vinifera
gb|ADV71371.1|  glycosyltransferase GT14M03                             650   0.0     
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       650   0.0     
emb|CDP01087.1|  unnamed protein product                                649   0.0     
emb|CAN65645.1|  hypothetical protein VITISV_012510                     653   0.0     Vitis vinifera
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  649   0.0     
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             649   0.0     
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             649   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    648   0.0     
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                647   0.0     
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    647   0.0     
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       647   0.0     
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    648   0.0     
emb|CDP01079.1|  unnamed protein product                                647   0.0     
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            647   0.0     
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              647   0.0     Ricinus communis
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    646   0.0     
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    646   0.0     
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             646   0.0     
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              646   0.0     Ricinus communis
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       645   0.0     
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             645   0.0     
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            645   0.0     
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             645   0.0     Prunus dulcis [sweet almond]
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       642   0.0     
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       642   0.0     
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    642   0.0     
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       642   0.0     
emb|CDP01082.1|  unnamed protein product                                648   0.0     
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    641   0.0     
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             640   0.0     
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       640   0.0     
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    639   0.0     
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       639   0.0     
dbj|BAB86928.1|  glucosyltransferase-10                                 639   0.0     Vigna angularis [azuki bean]
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    639   0.0     
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    638   0.0     
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           637   0.0     
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    638   0.0     
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       637   0.0     
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    637   0.0     
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       637   0.0     
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       637   0.0     
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    637   0.0     
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             634   0.0     
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    634   0.0     
emb|CDP21827.1|  unnamed protein product                                631   0.0     
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    634   0.0     
ref|XP_002893221.1|  UDP-glycosyltransferase                            632   0.0     
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       632   0.0     
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    632   0.0     
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         631   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         631   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       632   0.0     
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       631   0.0     
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    630   0.0     
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       629   0.0     
gb|AHL38933.1|  glycosyltransferase                                     629   0.0     
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    628   0.0     
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       627   0.0     
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    627   0.0     
emb|CDY38225.1|  BnaC05g17420D                                          626   0.0     
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    627   0.0     
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     625   0.0     
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             629   0.0     
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    626   0.0     
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       625   0.0     
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    626   0.0     
emb|CDY46643.1|  BnaA07g10530D                                          625   0.0     
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       625   0.0     
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                      624   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    624   0.0     
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    624   0.0     
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             624   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             624   0.0     Populus trichocarpa [western balsam poplar]
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          623   0.0     
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       624   0.0     
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             623   0.0     
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       622   0.0     
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    623   0.0     
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       624   0.0     
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    623   0.0     
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             622   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       622   0.0     
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              621   0.0     Ricinus communis
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             621   0.0     
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             620   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    619   0.0     
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       620   0.0     
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    619   0.0     
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    620   0.0     
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    619   0.0     
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             619   0.0     
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       619   0.0     
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      619   0.0     
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          619   0.0     
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    619   0.0     
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       619   0.0     
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     618   0.0     
emb|CDO97432.1|  unnamed protein product                                618   0.0     
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       619   0.0     
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    618   0.0     
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    632   0.0     
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       617   0.0     
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             617   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             617   0.0     Populus trichocarpa [western balsam poplar]
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          617   0.0     
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    617   0.0     
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             617   0.0     
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    617   0.0     
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       616   0.0     
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             615   0.0     
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       615   0.0     
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             614   0.0     
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    614   0.0     
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             614   0.0     
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         614   0.0     
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         614   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    613   0.0     
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      613   0.0     
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    613   0.0     
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             623   0.0     
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       613   0.0     
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       613   0.0     
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             612   0.0     
ref|XP_004299645.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       612   0.0     
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     612   0.0     
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          612   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             612   0.0     
emb|CDP01073.1|  unnamed protein product                                612   0.0     
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    612   0.0     
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    611   0.0     
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      611   0.0     
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    611   0.0     
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    614   0.0     
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       611   0.0     
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       610   0.0     
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    610   0.0     
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       611   0.0     
emb|CDY62992.1|  BnaC07g48400D                                          610   0.0     
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             610   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    609   0.0     
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       610   0.0     
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             609   0.0     
gb|KDP40911.1|  hypothetical protein JCGZ_24910                         609   0.0     
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       608   0.0     
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            609   0.0     
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            608   0.0     Stevia rebaudiana
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            608   0.0     
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       608   0.0     
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       608   0.0     
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       608   0.0     
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             609   0.0     
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             608   0.0     
emb|CDY21359.1|  BnaA09g30680D                                          605   0.0     
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       608   0.0     
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            607   0.0     
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    607   0.0     
ref|XP_004303932.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       607   0.0     
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          607   0.0     
ref|XP_004300654.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       607   0.0     
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     605   0.0     
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            605   0.0     
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       606   0.0     
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              605   0.0     Ricinus communis
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     605   0.0     
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    606   0.0     
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    605   0.0     
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             605   0.0     
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    605   0.0     
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     603   0.0     
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            604   0.0     
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       604   0.0     
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       620   0.0     
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       604   0.0     
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       601   0.0     
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    604   0.0     
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    604   0.0     
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    605   0.0     
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    603   0.0     
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             602   0.0     
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    603   0.0     
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    602   0.0     
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     602   0.0     
emb|CDY62991.1|  BnaC07g48390D                                          602   0.0     
ref|XP_008375649.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       602   0.0     
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       602   0.0     
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             602   0.0     
emb|CDY41486.1|  BnaA08g20880D                                          602   0.0     
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       602   0.0     
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       603   0.0     
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    602   0.0     
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         601   0.0     
ref|NP_001052946.1|  Os04g0451200                                       602   0.0     
gb|EAY94339.1|  hypothetical protein OsI_16107                          602   0.0     
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       601   0.0     
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       601   0.0     
ref|XP_004305887.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       601   0.0     
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    600   0.0     
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       600   0.0     
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             600   0.0     
gb|KHN42558.1|  UDP-glycosyltransferase 85A2                            599   0.0     
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         600   0.0     
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       600   0.0     
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    600   0.0     
emb|CDY46645.1|  BnaA07g10510D                                          598   0.0     
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    599   0.0     
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       599   0.0     
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       599   0.0     
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    598   0.0     
dbj|BAH56949.1|  AT1G22360                                              597   0.0     
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    598   0.0     
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    597   0.0     
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    597   0.0     
emb|CAH67108.1|  H0818E04.25                                            597   0.0     
ref|XP_008229793.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       597   0.0     
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       597   0.0     
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             597   0.0     
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    597   0.0     
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    597   0.0     
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       597   0.0     
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    596   0.0     
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                595   0.0     
ref|XP_002891115.1|  predicted protein                                  595   0.0     
gb|AAV32497.1|  UDP-glucuronosyltransferase                             595   0.0     
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    595   0.0     
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       595   0.0     
gb|KCW66553.1|  hypothetical protein EUGRSUZ_F00351                     593   0.0     
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    594   0.0     
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               594   0.0     
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             594   0.0     
emb|CDY21360.1|  BnaA09g30670D                                          594   0.0     
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    593   0.0     
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               594   0.0     
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    593   0.0     
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          593   0.0     
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          593   0.0     
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    593   0.0     
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       593   0.0     
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             592   0.0     
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       592   0.0     
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       592   0.0     
ref|XP_004155440.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    592   0.0     
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    592   0.0     
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       592   0.0     
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  591   0.0     
emb|CDX91674.1|  BnaC08g05930D                                          590   0.0     
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        591   0.0     
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       590   0.0     
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    590   0.0     
ref|XP_010030928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    590   0.0     
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 590   0.0     
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                589   0.0     
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      589   0.0     
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    589   0.0     
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    588   0.0     
gb|KCW73114.1|  hypothetical protein EUGRSUZ_E01567                     585   0.0     
ref|XP_004305884.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       588   0.0     
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       588   0.0     
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       588   0.0     
ref|XP_009377945.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    588   0.0     
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       588   0.0     
ref|XP_004303931.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       588   0.0     
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     587   0.0     
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    587   0.0     
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    587   0.0     
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       587   0.0     
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              587   0.0     
emb|CAN60444.1|  hypothetical protein VITISV_032467                     586   0.0     
gb|KGN43734.1|  hypothetical protein Csa_7G063980                       587   0.0     
ref|XP_004953967.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       587   0.0     
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       587   0.0     
ref|XP_002323189.1|  hypothetical protein POPTR_0016s02190g             586   0.0     
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    586   0.0     
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          585   0.0     
ref|XP_002452530.1|  hypothetical protein SORBIDRAFT_04g027470          585   0.0     
ref|XP_004306404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       585   0.0     
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    584   0.0     
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       584   0.0     
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       584   0.0     
ref|XP_011008540.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    584   0.0     
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    584   0.0     
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    584   0.0     
gb|AFJ52994.1|  UDP-glycosyltransferase 1                               582   0.0     
ref|XP_009377949.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    583   0.0     
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    583   0.0     
ref|XP_009377946.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    582   0.0     
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     581   0.0     
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       582   0.0     
ref|XP_010087621.1|  UDP-glycosyltransferase 85A1                       582   0.0     
ref|XP_004305878.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       582   0.0     
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                581   0.0     
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       581   0.0     
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       582   0.0     
ref|XP_004137056.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       590   0.0     
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       581   0.0     
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          580   0.0     
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    580   0.0     
ref|XP_003579871.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    583   0.0     
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     580   0.0     
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    579   0.0     
ref|XP_002323188.2|  hypothetical protein POPTR_0016s02200g             581   0.0     
ref|XP_004137057.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       579   0.0     
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    580   0.0     
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         579   0.0     
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             578   0.0     
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             578   0.0     
ref|XP_011008538.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             578   0.0     
gb|KDP33196.1|  hypothetical protein JCGZ_12718                         578   0.0     
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       578   0.0     
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       578   0.0     
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    577   0.0     
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             577   0.0     
ref|XP_010025432.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    577   0.0     
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    577   0.0     
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          577   0.0     
ref|XP_008224049.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    576   0.0     
gb|EYU18463.1|  hypothetical protein MIMGU_mgv1a005662mg                576   0.0     
ref|XP_008375675.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       577   0.0     
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    577   0.0     
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    576   0.0     
gb|KDP45150.1|  hypothetical protein JCGZ_19350                         576   0.0     
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    577   0.0     
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    576   0.0     
dbj|BAJ85429.1|  predicted protein                                      576   0.0     
gb|ABK95289.1|  unknown                                                 576   0.0     
gb|ACU24374.1|  unknown                                                 576   0.0     
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    576   0.0     
ref|XP_002529831.1|  UDP-glucuronosyltransferase, putative              576   0.0     
dbj|BAJ88498.1|  predicted protein                                      576   0.0     
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            576   0.0     
ref|XP_008224047.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    575   0.0     
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         575   0.0     
ref|XP_003570607.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    575   0.0     
gb|AFW64425.1|  cytokinin-O-glucosyltransferase 2                       575   0.0     
ref|XP_011014887.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    575   0.0     
ref|XP_008347720.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       575   0.0     
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      574   0.0     
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    573   0.0     
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       573   0.0     
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          574   0.0     
ref|XP_004953966.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       573   0.0     
gb|EAY87581.1|  hypothetical protein OsI_08991                          573   0.0     
gb|ACB88211.1|  UFGT2                                                   572   0.0     
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             572   0.0     
gb|KDP33206.1|  hypothetical protein JCGZ_12728                         572   0.0     
ref|NP_001048165.1|  Os02g0755900                                       572   0.0     
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       572   0.0     
ref|XP_004155441.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    572   0.0     
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       572   0.0     
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          572   0.0     
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             571   0.0     
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             571   0.0     
gb|AFW64426.1|  hypothetical protein ZEAMMB73_179381                    571   0.0     
ref|XP_008347719.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       571   0.0     
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    570   0.0     
dbj|BAJ90289.1|  predicted protein                                      571   0.0     
ref|XP_008679293.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       570   0.0     
emb|CAN68409.1|  hypothetical protein VITISV_022913                     569   0.0     
ref|XP_008362352.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       569   0.0     
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         570   0.0     
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative              569   0.0     
ref|XP_006852717.1|  hypothetical protein AMTR_s00033p00056330          569   0.0     
gb|EAY87578.1|  hypothetical protein OsI_08989                          569   0.0     
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       569   0.0     
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       569   0.0     
dbj|BAF49299.1|  putative glycosyltransferase                           568   0.0     
ref|XP_008357979.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       568   0.0     
ref|XP_008342456.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       568   0.0     
ref|XP_006603934.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       568   0.0     
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       568   0.0     
gb|AEO45782.1|  cyanohydrin UDP-glucosyltransferase UGT85K5             567   0.0     
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    567   0.0     
ref|NP_001048163.1|  Os02g0755500                                       567   0.0     
ref|XP_009364608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    567   0.0     
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       567   0.0     
ref|XP_009377938.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    567   0.0     
ref|XP_011023081.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    567   0.0     
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             566   0.0     
ref|XP_002513010.1|  UDP-glucuronosyltransferase, putative              566   0.0     
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         566   0.0     
ref|XP_004308659.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       566   0.0     
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     565   0.0     
ref|XP_004303933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       565   0.0     
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             565   0.0     
ref|XP_008353653.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       565   0.0     
ref|XP_009348490.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    565   0.0     



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 460/482 (95%), Gaps = 2/482 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL SE DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL+R+ GPE
Sbjct  1     MGSLSSELDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLERTRGPE  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SLRGLPSFRFETIPDGLP+S+AD TQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP
Sbjct  61    SLRGLPSFRFETIPDGLPVSDADVTQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFTVDAAEELGIPEV+FWTTSACGFLGYMH++QLLDKGYTPLKDESYLTN
Sbjct  121   VSCIVSDGVMSFTVDAAEELGIPEVLFWTTSACGFLGYMHFTQLLDKGYTPLKDESYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLETELDWVKGMKGIRLRD+PSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE
Sbjct  181   GYLETELDWVKGMKGIRLRDIPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HEALMALQSMLPPVYAVGPLQFLQ QVKD NVRALAS+LWKEDTSCLEWLDTK PNSVVY
Sbjct  241   HEALMALQSMLPPVYAVGPLQFLQTQVKDSNVRALASNLWKEDTSCLEWLDTKEPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMTPDQL EFAWGLANSKKPFLWI+RPDLVTGEAAI+PPEF+EETKDRGMLSS
Sbjct  301   VNYGSITVMTPDQLLEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HPA+GGFLTHNGWNSTLESIC+GVPMLCWPFFAEQQTNC Y+C+KWGIG E
Sbjct  361   WCSQEQVLNHPAIGGFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKE  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN-H  1460
             ID+NV RDEVEK+VRELME EKG EMK+KAME KKLA EAA T  IGSSH+NI+K IN H
Sbjct  421   IDSNVKRDEVEKLVRELMEGEKGGEMKKKAMEWKKLAEEAA-TSSIGSSHINIDKLINLH  479

Query  1461  LL  1466
             LL
Sbjct  480   LL  481



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/485 (74%), Positives = 420/485 (87%), Gaps = 3/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIP+PAQGHINPMLKLAKILHHKGFHITFVNTE+NHRRL +S GP 
Sbjct  1     MGSISAELKKPHAVCIPFPAQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGPN  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GL SFR+ETIPDGLP  +ADATQDIPSLCEST+ TCLGPFKDLLA+LN+T     PP
Sbjct  61    ALNGLSSFRYETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKDLLAKLNNTL--EVPP  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT  AA+ELG+PEV+FWTTSACGFLGYMHYS +++KGYTPLKD SYLTN
Sbjct  119   VSCIVSDGVMSFTFAAAQELGVPEVLFWTTSACGFLGYMHYSTIIEKGYTPLKDASYLTN  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD + GM+ IRLRDLPSFLRTTNPDE+M+KF+LQET +AR+ASAI+LNTF+ LE
Sbjct  179   GYLETTLDCIPGMENIRLRDLPSFLRTTNPDEFMVKFVLQETEKARKASAIVLNTFETLE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +L+++LPPVY +GPL  L K V D N++ L SSLWKE+  C++WLDTK PNSVVY
Sbjct  239   SEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECIQWLDTKEPNSVVY  298

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP+QL EFAWGLANS++ FLWIIRPD+V+G+ AILPPEFVEETK RGML+S
Sbjct  299   VNFGSITVMTPNQLIEFAWGLANSQQDFLWIIRPDIVSGDEAILPPEFVEETKKRGMLAS  358

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKWG+GME
Sbjct  359   WCSQEEVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWGVGME  418

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +VRELM  EKG++MK+K +E K LA E+A     GSS+VNIEK +N +
Sbjct  419   IDNNVKRDEVESLVRELMVGEKGKQMKKKTIEWKNLAQESAKQ-STGSSYVNIEKVVNDI  477

Query  1464  LLSHR  1478
             LLS +
Sbjct  478   LLSSK  482



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/484 (74%), Positives = 417/484 (86%), Gaps = 2/484 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHINPMLKLAKIL++KGFHITFVN E+NHRRL +S GP+
Sbjct  1     MGSI-GNHNKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GLPSF+FETIPDGLP  +AD+TQDIP+LCEST+ TCLGPFK+LLA+LNDT  SN PP
Sbjct  60    SLKGLPSFQFETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDG MSFT+ AA+ELGIPEV FWT SACGFLGYMHY +L  KGY PLKD S LTN
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGFLGYMHYHELAKKGYFPLKDASDLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LDW+ GMK IRLRDLPSFLR+TNPD+++  +++QET R++  SAI++NTFD LE
Sbjct  180   GYLETALDWIPGMKDIRLRDLPSFLRSTNPDDFLFNYLIQETNRSKSVSAIVVNTFDPLE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +LQ++LPPVYA+GPL FL K ++D N+  L S+LWKED   +EWLD+K PNSVVY
Sbjct  240   KEVLESLQTLLPPVYAIGPLHFLVKHIEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT +QL EFAWGLANS+  FLWIIRPD+V+GE AILPPEFVEETK+RGML+S
Sbjct  300   VNFGSITVMTANQLIEFAWGLANSEMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH+GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +VRELM  EKG++MK+KAME KKLA EAA   P GSS+VNI+K IN +
Sbjct  420   IDNNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKLAEEAAAK-PAGSSYVNIDKLINEI  478

Query  1464  LLSH  1475
             LL H
Sbjct  479   LLKH  482



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/485 (75%), Positives = 425/485 (88%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIGAELTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP  EADATQDIPSLCEST+ TCL PF+DLLA+LNDT  SN PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCEADATQDIPSLCESTTNTCLAPFRDLLAKLNDTNTSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+ AA+ELG+PEV+FWTTSACGFLGYMHY ++++KGY PLKD S LTN
Sbjct  121   VSCIVSDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYCKVIEKGYAPLKDASDLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD++ GMK +RLRDLPSFLRTTNPDE+M+KF+LQET RAR+ASAIILNTF+ LE
Sbjct  181   GYLETTLDFIPGMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTFETLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +L+++LPPVY +GPL FL K V D N++ L SSLWKE+  C++WLDTK PNSVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP+QL EFAWGLANS++ FLWIIRPD+V+G+A+ILPPEFVEETK+RGML+S
Sbjct  301   VNFGSITVMTPNQLIEFAWGLANSQQTFLWIIRPDIVSGDASILPPEFVEETKNRGMLAS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+ GFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GME
Sbjct  361   WCSQEEVLSHPAIVGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDEVE +VRELM   KG++MK+KAME K+LA EA+     GSS+VNIEK +N +
Sbjct  421   IDSDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELA-EASAKEHSGSSYVNIEKLVNDI  479

Query  1464  LLSHR  1478
             LLS +
Sbjct  480   LLSSK  484



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/485 (74%), Positives = 424/485 (87%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIGAEFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP  +ADATQDIPSLCEST+ TCLGPF+DLLA+LNDT  SN PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDGVMSFT+ AA+ELG+PEV+FWTTSACGFLGYMHY ++++KGY PLKD S LTN
Sbjct  121   VSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD++  MK +RLRDLPSFLRTTNPDE+M+KF+LQET RAR+ASAIILNT++ LE
Sbjct  181   GYLETTLDFIPCMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTYETLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +L+++LPPVY +GPL FL K V D N++ L SSLWKE+  C++WLDTK PNSVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP+QL EFAWGLANS++ FLWIIRPD+V+G+A+ILPPEFVEETK RGML+S
Sbjct  301   VNFGSITVMTPNQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLAS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID +V RDEVE +VRELM   KG++MK+KAME K+LA EA+     GSS+VNIEK +N +
Sbjct  421   IDCDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELA-EASAKEHSGSSYVNIEKVVNDI  479

Query  1464  LLSHR  1478
             LLS +
Sbjct  480   LLSSK  484



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/484 (73%), Positives = 413/484 (85%), Gaps = 2/484 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHINPMLKLAKIL+HKGFHITFVN E+NHRRL +S GP+
Sbjct  1     MGSI-GNHNKPHAVCIPYPAQGHINPMLKLAKILNHKGFHITFVNNEYNHRRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GLPSF+FETIPDGLP  +AD+TQDI +LCEST+ TCLGPFK+LLA+LNDT  SN PP
Sbjct  60    SLKGLPSFQFETIPDGLPPCDADSTQDIAALCESTTKTCLGPFKELLAKLNDTCSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDG MSFT+ AA+ELGIPEV FWT SACG LGYMHY +L  KGY PLKD S LTN
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGLLGYMHYHELAKKGYFPLKDASDLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LDW+ GMK IRLRDLPSFLR+TNPD+++  +++QET R++  SAI++NTFD LE
Sbjct  180   GYLETALDWIPGMKDIRLRDLPSFLRSTNPDDFLFNYLIQETNRSKSVSAIVINTFDPLE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +LQ++LPPVY +GPL FL K ++D N+  L S+LWKED   +EWLD+K PNSVVY
Sbjct  240   KEVLESLQTLLPPVYTIGPLHFLVKHIEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT +QL EFAWGLANS+  FLWIIRPD+V+GE AILPPEFVEETK+RGML+S
Sbjct  300   VNFGSITVMTANQLVEFAWGLANSQIQFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH+GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +VREL+  EKG++MK+KAME KKL  EAA   P GSS+VNI+K IN +
Sbjct  420   IDNNVKRDEVESLVRELIVGEKGKDMKKKAMEWKKLTEEAAAK-PTGSSYVNIDKLINEI  478

Query  1464  LLSH  1475
             LL H
Sbjct  479   LLKH  482



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/484 (74%), Positives = 412/484 (85%), Gaps = 2/484 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS     DKPHAVCIPYPAQGHINPMLKLAKIL++KGFHITFVN E+NHRRL +S GP+
Sbjct  1     MGS-TGNHDKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GLPSFRFETIPDGLP  +AD+TQDIP+LCEST+ TCLGPFK+LLA+LNDT  SN P 
Sbjct  60    SLKGLPSFRFETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPT  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDG MSFT+ AA+ELGIPEV FWT SACG LGY+HY +L  KGY PLKD + LTN
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGSLGYLHYHELAKKGYFPLKDVTDLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LDW+ GMKGIRLRDLPSFLR+TN D++M  F++QET R++ ASAI++NTFD LE
Sbjct  180   GYLETALDWIPGMKGIRLRDLPSFLRSTNSDDFMFNFLIQETDRSKLASAIVINTFDPLE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +LQ +LPPVYA+GPL FL K ++D N+  L S+LWKED   +EWLD+K PNSVVY
Sbjct  240   KEVLESLQPLLPPVYAIGPLHFLVKHIEDKNLEHLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT +QL EFAWGLANS+  FLWIIRPD+V+GE AILPPEFVEETK+RGML+S
Sbjct  300   VNFGSITVMTANQLIEFAWGLANSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH+GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +VRELM  EKG++MK+KAME KK A EAA   P GSS+VNI+K IN +
Sbjct  420   IDNNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAK-PTGSSYVNIDKLINEI  478

Query  1464  LLSH  1475
             L  H
Sbjct  479   LFKH  482



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/485 (74%), Positives = 422/485 (87%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIGAEFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP  +ADATQDIPSLCEST+ TCLGPF+DLLA+LNDT  SN PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDGVMSFT+ AA+ELG+PEV+FWTTSACGFLGYMHY ++++KGY PLKD S LTN
Sbjct  121   VSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD++  MK +RLRDLPSFLRTTNPDE+M+KF+LQET RAR+ASAIILNT++ LE
Sbjct  181   GYLETTLDFIPCMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTYETLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +L+++LPPVY +GPL FL K V D N++ L SSLWKE+  C++WLDTK PNSVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP QL EFAWGLANS++ FLWIIRPD+V+G+A+ILPPEFVEETK RGML+S
Sbjct  301   VNFGSITVMTPSQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLAS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID +V RDEVE +VRELM   KG++MK+K ME K+LA EA+     GSS+VNIEK +N +
Sbjct  421   IDCDVKRDEVESLVRELMVGGKGKKMKKKTMEWKELA-EASAKEHSGSSYVNIEKVVNDI  479

Query  1464  LLSHR  1478
             LLS +
Sbjct  480   LLSSK  484



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/481 (72%), Positives = 414/481 (86%), Gaps = 2/481 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTEFNH+RL +S GP+
Sbjct  1     MGSM-SLPEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP F+F+ IPDGLP S+ DATQD+PSLCEST+  CLGPF+DLLA LNDT+ S  PP
Sbjct  60    ALNGLPDFQFKAIPDGLPPSDVDATQDVPSLCESTTTHCLGPFRDLLAELNDTSSSQVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT++AA ELG+PE++FWT SACGFLGYMHY++L++KG TPLKD S L+N
Sbjct  120   VSCIVSDGVMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLTPLKDASCLSN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLE  +DW+ GMK IRLRDLPSFLRTTNPD+YM+KF+LQET R+++A AIILNTF+ LE
Sbjct  180   GYLEQAIDWIPGMKDIRLRDLPSFLRTTNPDDYMIKFVLQETERSKKALAIILNTFEELE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              + + AL ++LPP+YA+GPLQFL+K+VKD  +  L S+LWKE+  CLEWLD+K PNSVVY
Sbjct  240   DDVINALSAILPPIYAIGPLQFLEKEVKDERLSVLGSNLWKEEPECLEWLDSKDPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT DQL EFAWGL NSK+ FLWIIRPDLV+G++AILPPEF+EE KDRG+L+S
Sbjct  300   VNFGSITVMTADQLVEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRGLLAS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCW+ CTKWG G+E
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWGNGLE  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV R+ VE +V ELM   KG++MK+KA+E K  A EAA +   GSS+ N+EK +  L
Sbjct  420   IDNNVKREGVESLVTELMVRGKGKDMKKKALEWKNKAEEAAKSSG-GSSYANLEKVVQVL  478

Query  1464  L  1466
             L
Sbjct  479   L  479



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/481 (73%), Positives = 414/481 (86%), Gaps = 2/481 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +K HAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNH+RL +S GP+
Sbjct  1     MGSI-SLPEKHHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP F+F+TIPDGLP S+ DATQDIPSLCEST+  CL PF++LLA LN  + S  PP
Sbjct  60    ALNGLPDFQFKTIPDGLPPSDVDATQDIPSLCESTTTRCLDPFRNLLAELNGPSSSQVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT++AA ELG+PE++FWTTSACGFLGYMHY++L++KG TPLKD SYL+N
Sbjct  120   VSCIVSDGVMSFTLEAAAELGVPEILFWTTSACGFLGYMHYAKLIEKGLTPLKDASYLSN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLE  LDW+ GMK IRL+DLPSFLRTTNPD+YM+KF+LQET RA++ASAIILNTF  LE
Sbjct  180   GYLEQSLDWIPGMKDIRLKDLPSFLRTTNPDDYMVKFVLQETERAKKASAIILNTFQELE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              + + AL ++LPP+Y +GPLQFLQK+VKD  +  L S+LWKE+  CL+WLD+K PNSVVY
Sbjct  240   DDVINALSAILPPIYTIGPLQFLQKEVKDERLSVLGSNLWKEEPECLDWLDSKDPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP QL EFAWGLANSK+ FLWIIRPDLV+G++AILPPEF+EETKDRG+L+S
Sbjct  300   VNFGSITVMTPGQLVEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLAS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCW+ CTKW  G+E
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLE  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +V ELM  EKG +MK+KA+E K  A EAA +   GSS+ N+EK +  L
Sbjct  420   IDNNVKRDEVESLVTELMVGEKGMDMKKKALEWKNKAEEAAKSSG-GSSYSNLEKVVQVL  478

Query  1464  L  1466
             L
Sbjct  479   L  479



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/485 (75%), Positives = 421/485 (87%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIPYPAQGHINPML+LAKILH KGFHITFVNTEFNHRRL +S GP 
Sbjct  1     MGSISAESQKPHAVCIPYPAQGHINPMLELAKILHQKGFHITFVNTEFNHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GL SFRFETIPDGLP S+ADATQDIPSLCEST+ TCLGPF+DLLA+LN+T  SN PP
Sbjct  61    ALDGLSSFRFETIPDGLPPSDADATQDIPSLCESTTKTCLGPFRDLLAKLNNTYTSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+ AA+ELG+PEV+FWTTSACGFLGYMHYS + +KGY PLKD SYL+N
Sbjct  121   VSCIVSDGVMTFTLAAAQELGVPEVLFWTTSACGFLGYMHYSTVTEKGYVPLKDASYLSN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD + GMKG+RLRDLPSFLRTTNPDEYM+KF+LQET RAR+ASAIILNTF+ LE
Sbjct  181   GYLETTLDCIPGMKGVRLRDLPSFLRTTNPDEYMIKFVLQETERARKASAIILNTFETLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             +E L +L+++L PVY++GPL  L K V D N++ L SSLWKE+  C++WLDTK P SVVY
Sbjct  241   NEVLESLRTLLQPVYSIGPLNLLVKDVDDENLKGLGSSLWKEEPECIQWLDTKEPKSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTPDQL EFAWGLANS++ FLWIIRPD+V+G  +ILPP+FVEETK+RGML+ 
Sbjct  301   VNFGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPDFVEETKNRGMLAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+GGFLTHNGWNSTLESIC+GVPM+CWPFFAEQQTNCWY+ TKW IGME
Sbjct  361   WCSQEEVLNHPAIGGFLTHNGWNSTLESICSGVPMICWPFFAEQQTNCWYTVTKWDIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +VRELM  EKG+EMK+KAM+ K LA E +     GSS+VNIEK +N +
Sbjct  421   IDNNVKRDEVECLVRELMVGEKGKEMKKKAMKWKTLA-EISAQKSEGSSYVNIEKVVNDI  479

Query  1464  LLSHR  1478
             LLS +
Sbjct  480   LLSSK  484



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/485 (74%), Positives = 426/485 (88%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIGAEFSKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP  +ADATQDIPSLCEST+ TCLGPF+DLLA+LN+T  SN PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNNTNTSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+ AA+ELG+PE++FWTTSACGFLGYMHY ++++KGY PLKD + LTN
Sbjct  121   VSCIVSDGVMSFTLAAAQELGVPEILFWTTSACGFLGYMHYYKVIEKGYAPLKDAADLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LD++ GMK +RLRDLPSFLRTTNPDE+M+KF+LQET RAR+ASAIILNTF+ LE
Sbjct  181   GYLETTLDFIPGMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTFETLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +L+++LPPVY +GPL FL K   D N++ L SSLWKE+  C++WLDTK PNSVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHADDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP+QL EFAWGLANS++ FLWIIRPD+V G+A+ILPPEFVEETK+RGML+S
Sbjct  301   VNFGSITVMTPNQLVEFAWGLANSQQTFLWIIRPDIVLGDASILPPEFVEETKNRGMLAS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HPA+GGFLTH+GWNSTLESI +G+PM+CWPFFAEQQTNCW+S TKW +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGLPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDEVE +VRELM  EKG++MK+KAMELK+LA EA+     GSS+ NIEK +N +
Sbjct  421   IDSDVKRDEVESLVRELMVGEKGKKMKKKAMELKELA-EASAIEHSGSSYENIEKVVNDI  479

Query  1464  LLSHR  1478
             LLS +
Sbjct  480   LLSSK  484



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/486 (74%), Positives = 422/486 (87%), Gaps = 2/486 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS   E +KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP 
Sbjct  1     MGSNNVELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA-VSNAP  380
             SL GL SFRFETIPDGLP  +ADATQDIPSLC+ST+ TCL PF+DLLA+LN+T+  SN P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNETSNTSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG+MSFT+ AA+E+G+PEV+FWTTSACGFLGYMHY+ L++KG+TPLKD SYLT
Sbjct  121   PVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGFTPLKDPSYLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LD + GMK +RLRDLPSFLRTTNPD++M+KF+LQET RAR+ASAI+LNTF+ L
Sbjct  181   NGYLETTLDCIPGMKDVRLRDLPSFLRTTNPDDFMVKFVLQETERARKASAIVLNTFETL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +L+++LPPVY +GPL  L K V D N++ L SSLWKE+  C++WLD K PNSVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLESSLWKEEPECIQWLDNKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVNYGSITVMTPDQL EFAWGLANS++ FLWIIRPD+V+G  +ILPPEFVEETK+RGML+
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL HPA+GGFLTH+GWNSTLESI +GVPMLCWPFFAEQQTNCW+S TKWG+GM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGVGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +VRELM  EKG+EMK+KAME K+LA E +     GSS+VNIEK IN 
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKELA-EISAKKSTGSSYVNIEKVIND  479

Query  1461  LLLSHR  1478
             +LL+ +
Sbjct  480   VLLASK  485



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/486 (75%), Positives = 420/486 (86%), Gaps = 2/486 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E +KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP 
Sbjct  1     MGSISTEINKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA-VSNAP  380
             SL GL SFRFETIPDGLP  +ADATQDIPSLC+ST+ TCL PF+DLLA+LN T+  SN P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTSNTSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDGVMSFT+ AA+E+G+PEV+FWTTSACGFLGYMHYS +++KGY PLKDESY T
Sbjct  121   PVTCIVSDGVMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYSTVIEKGYAPLKDESYFT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NG++E  LD++ GMK +RLRDLPSFLRTTNP+EYM+KF+LQET RA+ ASAIILNTF+ L
Sbjct  181   NGHVEKPLDFIPGMKDVRLRDLPSFLRTTNPEEYMIKFVLQETERAKNASAIILNTFETL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +LQ++LPPVY +GPL  L K V D N++ L SSLWKE+  CL+WLD+K PNSVV
Sbjct  241   ESEVLESLQTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECLQWLDSKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVNYGSITVMTPDQL EFAWGLANS+  FLWIIRPD+V+G  +ILPPEFVEETK+RGML+
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSQHEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL HPA+GGFLTH+GWNSTLESI +GVPMLCWPFFAEQQTNCW+S TKWGIGM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +VRELM  EKG+EMK+KAME KKLA E +     GSS+ NI+K IN 
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLA-EISAQKSTGSSYGNIDKVIND  479

Query  1461  LLLSHR  1478
             +LLS +
Sbjct  480   VLLSSK  485



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/485 (70%), Positives = 414/485 (85%), Gaps = 3/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL +  + PHAVCIPYPAQGHINPMLKLAK+LHH+GFHITFVNTE+NH+R+ RS GP 
Sbjct  1     MGSL-AFLENPHAVCIPYPAQGHINPMLKLAKLLHHRGFHITFVNTEYNHKRILRSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+F+ IPDGLP +  D TQDIPSLCESTS TCL PFK+L+  LNDT+ SN PP
Sbjct  60    SLDGLPSFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDGVMSFT++AA+ELGIPEV+FWTTSACGFL Y HY QL++KG TPLKDESYL+N
Sbjct  120   VTCIVSDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHYHQLIEKGLTPLKDESYLSN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL++ +DW+ GMKGIRLRD+PSF+RTT+P+++MLKF+  ET RA++ASAI+LNT+DALE
Sbjct  180   GYLDSVIDWIPGMKGIRLRDIPSFVRTTDPEDFMLKFVKAETERAKKASAIVLNTYDALE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L++L SMLPPVY++GPL  L  QV D +++ + S+LW E++ CLEWLD+K PNSVVY
Sbjct  240   HEGLVSLASMLPPVYSIGPLHLLLNQVTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT DQL+EFAWGLANS + FLW+IRPDLV G++A+LPPEFV  TK+RG+ SS
Sbjct  300   VNFGSITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HP++GGFLTH+GWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WGIGME
Sbjct  360   WCSQEQVLSHPSIGGFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGME  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I+++V R EVE +VRELM  +KGREMK+K  ELKK+A EA  +   GSS +N++  IN +
Sbjct  420   INSDVKRGEVESLVRELMGGDKGREMKKKTRELKKMAEEAITS--TGSSCMNLDDMINKV  477

Query  1464  LLSHR  1478
             LLS R
Sbjct  478   LLSPR  482



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/487 (72%), Positives = 413/487 (85%), Gaps = 6/487 (1%)
 Frame = +3

Query  24    MGSLRSE-QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             M S+ +E  DKPHAVC+PYPAQGHI+PMLKLAKIL+ KGFHITFVNTE NH+RL +S GP
Sbjct  1     MCSINAEISDKPHAVCLPYPAQGHISPMLKLAKILNRKGFHITFVNTEHNHKRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +SL GLPSFRFE IPDGLP  + DATQDI SLC+ST+ TCLGPFK+LLA+L +T   N P
Sbjct  61    DSLNGLPSFRFEAIPDGLPPCDPDATQDISSLCKSTTTTCLGPFKELLAKLKNT---NVP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              VSCIVSDG MSFT+ AA++LGIP+V+FWT SACG L YM+Y  L++KGYTPLKDESYLT
Sbjct  118   RVSCIVSDGSMSFTLSAAQDLGIPQVLFWTPSACGLLCYMYYRDLVEKGYTPLKDESYLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LDW+ GMKGIRLRDLPSFLRTTNP+EYM++FI+QET R++ A+AII+NTF+ L
Sbjct  178   NGYLETSLDWIPGMKGIRLRDLPSFLRTTNPEEYMIEFIIQETERSKNATAIIINTFETL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQ-VKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             E E + +LQ +LPP+YAVGPL  L +  V D N+  L S+LWKE+T CL+WLD+K  NSV
Sbjct  238   EREVVESLQKLLPPIYAVGPLNLLMEHFVVDKNLEGLGSNLWKEETKCLDWLDSKKANSV  297

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL+EFAWGL NS+  FLWIIRPD+V+GE AILPPEFVEETK+RGML
Sbjct  298   VYVNFGSITVMTANQLTEFAWGLVNSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGML  357

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQEQ+L HPA+GGFLTH+GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CTKWGIG
Sbjct  358   TSWCPQEQILSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTKWGIG  417

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEIDNNV R EVE +VRELM  EKG++MK+KAME KK A EAA     GSS+VNI+K IN
Sbjct  418   MEIDNNVKRAEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKT-TGSSYVNIDKLIN  476

Query  1458  HLLLSHR  1478
              +LLS +
Sbjct  477   EILLSSK  483



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/485 (75%), Positives = 415/485 (86%), Gaps = 2/485 (0%)
 Frame = +3

Query  24    MGSLRSE-QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             M S+R   QDKPHAVCIPYP QGHINPMLKLAKILHHKGFHITFVNTE+NHRRL +S GP
Sbjct  1     MDSIRIHGQDKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +SL G PSFRFETIPDGLP  +ADATQDIPSLCEST+ TCLGPFK+LLA+LN T+ SN P
Sbjct  61    DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKELLAKLNTTSSSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              VSCIVSDG MSFT+DAA++LGIPEV+FWT SACG LGYMHY  L +KGY PLKD S LT
Sbjct  121   RVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGSLGYMHYRDLSEKGYFPLKDASDLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LDW+  MKGIRLRDLPSFLR+TNPDEYM KF++QET R++ ASAI++NTF+ L
Sbjct  181   NGYLETALDWIPSMKGIRLRDLPSFLRSTNPDEYMFKFLVQETDRSKFASAIVINTFERL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +L+++LPP+YA+GPL FL K ++D N+  L S+LWKED  CL+WLD+K PNSVV
Sbjct  241   EKEVLESLRTLLPPIYAIGPLHFLVKHIEDKNLECLGSNLWKEDVQCLDWLDSKKPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMTP+QL EFAWGLANS+  FLWIIRPD+V+GE AILPPEFV ETK+RGML+
Sbjct  301   YVNFGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVSGEQAILPPEFVGETKERGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+  T+WGIGM
Sbjct  361   SWCPQEQVLSHPAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +VRELM  EKG+EMK+KAME KKLA EA    P GSS V I+K IN 
Sbjct  421   EIDNNVKRDEVESLVRELMAGEKGKEMKKKAMEWKKLAEEATQK-PEGSSFVAIDKLINE  479

Query  1461  LLLSH  1475
             +LL H
Sbjct  480   ILLKH  484



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/486 (72%), Positives = 410/486 (84%), Gaps = 3/486 (1%)
 Frame = +3

Query  24    MGSLRS--EQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLG  197
             M S+RS  E DKPHAVCIPYPAQGHINPMLKLAKI +HKGFHITFVNTE+NHRRL +S G
Sbjct  1     MDSIRSMHELDKPHAVCIPYPAQGHINPMLKLAKIFNHKGFHITFVNTEYNHRRLLKSRG  60

Query  198   PESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
             P+SL+GLPSFRFETIPDGLP S+AD+TQDI SL +ST+ TCLGPFK+LLA+LN+T  SN 
Sbjct  61    PDSLKGLPSFRFETIPDGLPPSDADSTQDIVSLGKSTTNTCLGPFKELLAKLNNTCSSNV  120

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSCIVSDG MSFT+ AA+ELGIPE+ FWT SACG LGYMHY  L +KGY PLKD S L
Sbjct  121   PPVSCIVSDGCMSFTLAAAQELGIPEIFFWTPSACGLLGYMHYRDLAEKGYFPLKDASDL  180

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYLET LDW+ GMKGIRLRDLP+ LR+TNPD+++  +++QET R++ ASAI++NTFD 
Sbjct  181   TNGYLETALDWIPGMKGIRLRDLPTLLRSTNPDDFLFNYLIQETDRSKLASAIVINTFDP  240

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LE E L  LQ +LPPVY +GPL FL K ++D N+  L S+LWKE+   +EWLD+K PNSV
Sbjct  241   LEKEVLETLQVLLPPVYTIGPLHFLLKHIEDRNLECLGSNLWKEEPKTVEWLDSKKPNSV  300

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL+EFAWGLANS+  FLWIIRPD V+GE A LP EF+EETK+RGML
Sbjct  301   VYVNFGSITVMTANQLTEFAWGLANSQMDFLWIIRPDTVSGEKATLPSEFMEETKERGML  360

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWC QEQVL HPA+GGFLTH+GWNSTLESI NGVPM+CWPFF EQQTNCW+ CT+W IG
Sbjct  361   TSWCAQEQVLSHPAIGGFLTHSGWNSTLESISNGVPMICWPFFTEQQTNCWFKCTQWRIG  420

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEIDNNV RDEVE++VR+LM  EKG++MK+KAME KKLA EAA     GSS+VNI+K IN
Sbjct  421   MEIDNNVKRDEVERLVRDLMVGEKGKDMKKKAMEWKKLAEEAAAK-STGSSYVNIDKLIN  479

Query  1458  HLLLSH  1475
              +LL H
Sbjct  480   EILLKH  485



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/486 (74%), Positives = 415/486 (85%), Gaps = 2/486 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS   E +KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL +S GP 
Sbjct  1     MGSNNVELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA-VSNAP  380
             SL GL SFRFETIPDGLP  +ADATQDIPSLC+ST+ TCL PF+DLLA+LN T   SN P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTNNTSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG+MSFT+ AA+E+G+PEV+FWTTSACGFLGYMHY+ L++KGY PLKD SYLT
Sbjct  121   PVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGYIPLKDVSYLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LD + GMK +RLRDLP+FLRTTNPD++M KF+LQET RAR ASAIILNTFD L
Sbjct  181   NGYLETTLDCIPGMKDVRLRDLPTFLRTTNPDDFMFKFVLQETERARNASAIILNTFDTL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +L+++LPPVY +GPL  L K V D N++ L SSLWKE+  C++WLDTK PNSVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECIQWLDTKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVNYGSITVMTPDQL EFAWGLANSK  FLWIIRPD+V+G  +ILPPEFVEETK+RGML+
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSKLEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL HPA+GGFLTH+GWNSTLESI +GVPMLCWPFFAEQQTNCWYS TKW +GM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWDVGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +VRELM  EKG+EMK+KAME KKLA E +     GSS+ NI+K +N 
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLA-EISAQKSTGSSYGNIDKVVND  479

Query  1461  LLLSHR  1478
             +LL+ +
Sbjct  480   VLLASK  485



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/485 (74%), Positives = 414/485 (85%), Gaps = 2/485 (0%)
 Frame = +3

Query  24    MGSLRSE-QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS+++  Q KPHAVCIPYP QGHINPMLKLAKILHHKGFHITFVNTE+NHRRL +S GP
Sbjct  1     MGSIKTHGQAKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +SL G PSFRFETIPDGLP  +ADATQDIPSLCEST+ TCL PFK+LLA+LN  + SN P
Sbjct  61    DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLRPFKELLAKLNTISSSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              VSCIVSDG MSFT+DAA++LGIPEV+FWT SACG LGYMHY  L DKGY PLKD S LT
Sbjct  121   RVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGLLGYMHYRDLSDKGYFPLKDASNLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LDW+ GMKGIRLRDLPSFLR+TNPDEYM KF+++ET R++ ASAI++NTF+ L
Sbjct  181   NGYLETALDWIPGMKGIRLRDLPSFLRSTNPDEYMFKFLVEETERSKFASAIVINTFEPL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +L+++LPP+YA+GPL FL K ++D N+  L S+LWKED  CLEWLD+K PNSVV
Sbjct  241   EKEVLESLRTLLPPIYAIGPLHFLVKHIEDKNLECLGSNLWKEDLQCLEWLDSKKPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMTP+QL EFAWGLANS+  FLWIIRPD+VTGE AILP EFVE+TK+RGML+
Sbjct  301   YVNFGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVTGEQAILPSEFVEQTKERGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL H A+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+  T+WGIGM
Sbjct  361   SWCPQEQVLSHSAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEV+ +VRELM  EKG+EMK+K+ME KKLA EA    P GSS V I+K IN 
Sbjct  421   EIDNNVKRDEVKSLVRELMAGEKGKEMKKKSMEWKKLAEEATQK-PEGSSFVAIDKLINE  479

Query  1461  LLLSH  1475
             +LL H
Sbjct  480   ILLKH  484



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/485 (69%), Positives = 410/485 (85%), Gaps = 3/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +  + PHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTE+NH+R+ RS G  
Sbjct  1     MGSM-AFLENPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRILRSRGLN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+F+ IPDGLP +  D TQDIPSLCESTS TC+ PFKDL+  LNDT+ SN PP
Sbjct  60    SLDGLPSFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCMVPFKDLITNLNDTSSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDGVMSFT++AA+ELGIPEV+FWTTSACGFL Y H  QL++KG TPLKDESYL+N
Sbjct  120   VTCIVSDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHCRQLIEKGLTPLKDESYLSN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL++ +DW+ GMKGIRLRD+PSF+RTT+P+++MLKFI  E+ RA++ASAI+LNT+DALE
Sbjct  180   GYLDSVIDWIPGMKGIRLRDIPSFVRTTDPEDFMLKFIKAESERAKKASAIVLNTYDALE  239

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L++L SMLPPVY++GPL  L  QV D +++ + S+LW E++ CLEWLD+K PNSVVY
Sbjct  240   HEGLVSLASMLPPVYSIGPLHLLLNQVTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVY  299

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT DQL+EFAWGLANS + FLW+IRPDLV G++A+LPPEFV  TK+RG+ +S
Sbjct  300   VNFGSITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFAS  359

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HP++GGFLTHNGWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WGIGME
Sbjct  360   WCSQEQVLSHPSIGGFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGME  419

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I+++V R EVE +VRELM  EKG EMK+K  E KK+A EA  +   GSS +N++  IN +
Sbjct  420   INSDVKRGEVESLVRELMGGEKGSEMKKKTREWKKMAEEAITS--TGSSCMNLDDMINKV  477

Query  1464  LLSHR  1478
             LLS R
Sbjct  478   LLSPR  482



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/485 (73%), Positives = 420/485 (87%), Gaps = 4/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +  + PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNH+RL +S GP+
Sbjct  1     MGSVAAAIEMPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSFRFETIPDGLP ++ DATQDIPSLC ST+ TCL PFK+LL +LND + SN PP
Sbjct  61    SLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLNDPS-SNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDGVMSFTVDAAEELG+PEV+FWTTSACGFL Y+H+ QL+DKGYTPLKDESY TN
Sbjct  120   VTCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLKDESYFTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL T +DW+ GMKGIRL D+PSF+RTTNPD+ ML F++ ET R++RASAIILNT+  LE
Sbjct  180   GYLNTVIDWIPGMKGIRLSDIPSFIRTTNPDDIMLNFVISETERSKRASAIILNTYRELE  239

Query  744   HEALMALQSML-PPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
              EAL AL S+L PPVY++G LQF   Q+ ++ ++  + S+LWKE+T C++WLDTK PNSV
Sbjct  240   QEALDALTSLLLPPVYSIGHLQFQLNQIPENDSIMRIGSNLWKEETECIDWLDTKEPNSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL EFAWGLANSK+ F+W+IRPDLV G++AILPPEFV ETK+R +L
Sbjct  300   VYVNFGSITVMTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQEQVL HPA+GGFLTH+GWNSTLESIC GVP++CWPFFAEQQTNC YSC +WGIG
Sbjct  360   ASWCPQEQVLNHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID+NV R+EVE +VR+LM  EKG+EMK KA+ELKK A EAA T P+GSS+VN+EK I 
Sbjct  420   MEIDSNVKREEVEVLVRDLMVGEKGQEMKLKALELKKKAKEAA-TGPVGSSYVNLEKLIT  478

Query  1458  HLLLS  1472
             H+LLS
Sbjct  479   HVLLS  483



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/484 (70%), Positives = 409/484 (85%), Gaps = 3/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFV+TE+NH+RL RS G +
Sbjct  1     MGSI-SILEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S+ GLPSF+F TIPDGLP +++D TQDIPSLC+STS  CL PFK+LL+ LNDT+ SN PP
Sbjct  60    SVIGLPSFQFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFTVDAA+EL IP V+FWTTSACGF+GY+ Y QL+++G +PLKDESYLTN
Sbjct  120   VSCIVSDGVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IRLRD+PSF+RTT+P + M+ F+L ET R ++A+A+ILNTFD LE
Sbjct  180   GYLDTVIDWIPGMKNIRLRDIPSFIRTTDPKDGMIDFVLSETARLQKATAVILNTFDLLE  239

Query  744   HEALMAL-QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             H+ L AL  S+LPPVY++G LQ L   +KD N++++ S+LWKED  CL+WLD+K PNSVV
Sbjct  240   HDVLAALSSSLLPPVYSIGSLQLLLNNIKDENLKSIESNLWKEDADCLQWLDSKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT  QL EFAWGLANS K FLW+IRPDLV G+ A+LPPEFV  TK+RG L+
Sbjct  300   YVNFGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL H ++GGFLTH+GWNSTLE IC GVPM+CWPFFAEQQTNC YSC +WGIGM
Sbjct  360   SWCPQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++V RDEVE +VRELM   KG+EMK+KAME KK+A EA  T P GSS  N++KFINH
Sbjct  420   EINSDVKRDEVEILVRELMVGVKGQEMKKKAMEWKKMAEEAI-TCPNGSSFQNLDKFINH  478

Query  1461  LLLS  1472
              LLS
Sbjct  479   HLLS  482



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/486 (72%), Positives = 414/486 (85%), Gaps = 2/486 (0%)
 Frame = +3

Query  24    MGSLRSEQ-DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             M S+ +E  DKPHAVCIPYPAQGHI+PMLKLAKILHH GFHITFVNTE NH+RL +S GP
Sbjct  1     MYSISAEDLDKPHAVCIPYPAQGHISPMLKLAKILHHNGFHITFVNTEHNHKRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +S++GLPSF+FETIPDGLP  + D TQDI SL EST+ +C GPFK+LL +LN+T++SN P
Sbjct  61    DSVKGLPSFQFETIPDGLPPCDPDTTQDIFSLSESTTNSCSGPFKELLTKLNNTSLSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+ AA++LGIP+V FWT SACG L YMHY  L++KGYTPLKDESYLT
Sbjct  121   PVSCIVSDGAMSFTLAAAQDLGIPQVFFWTPSACGLLSYMHYRDLVEKGYTPLKDESYLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET LDW+ GMKG+RLRDLPSF+RTTNP+EYM+KF++QET R++ ASAI+LNTF+ L
Sbjct  181   NGYLETTLDWIPGMKGVRLRDLPSFIRTTNPEEYMIKFLIQETERSKMASAIVLNTFEPL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +LQ++LPPVYA+GPL  L + V D N+  L S+LWKED  CLEWLD+K PNSVV
Sbjct  241   EREVLKSLQALLPPVYAIGPLHLLMEHVDDKNLEKLGSNLWKEDPKCLEWLDSKKPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSIT MTP+QL EFAWGLANS+  FLWIIRPD+V+G  A+LPPEF+EETK+RGML+
Sbjct  301   YVNFGSITPMTPNQLIEFAWGLANSQVDFLWIIRPDIVSGNKAVLPPEFLEETKERGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC Q+QVL H AVGGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNCW+ CT+W IGM
Sbjct  361   SWCQQQQVLSHVAVGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFCCTQWEIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEV+ +VREL+  EKG EMK+KA+E KKLA EAA   P GSS+VNI+K IN 
Sbjct  421   EIDNNVKRDEVKSLVRELLTWEKGNEMKKKALEWKKLAKEAA-KKPGGSSYVNIDKLINE  479

Query  1461  LLLSHR  1478
             +LLS +
Sbjct  480   ILLSSK  485



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/484 (70%), Positives = 407/484 (84%), Gaps = 3/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +KPHAVCI YPAQGHINPMLKLAK+LHHKGFHITFV+TE+NH+RL RS G +
Sbjct  1     MGSV-SILEKPHAVCISYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S+ GLPSF+F TIPDGLP +++D TQDIPSLC+STS  CL PFK+LL+ LNDT+ SN PP
Sbjct  60    SVIGLPSFQFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFTVDAA+EL IP V+FWTTSACGF+GY+ Y QL+++G +PLKDESYLTN
Sbjct  120   VSCIVSDGVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T  DW+ GMK IRLRD+PSF+RTT+P + M+ F+L ET R ++A+A+ILNTFD LE
Sbjct  180   GYLDTVKDWIPGMKNIRLRDIPSFIRTTDPKDGMIDFVLSETARLQKATAVILNTFDLLE  239

Query  744   HEALMAL-QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             H+ L AL  S+LPPVY++G LQ L   +KD N++++ S+LWKED  CL+WLD+K PNSVV
Sbjct  240   HDVLAALSSSLLPPVYSIGSLQLLLNNIKDENLKSIESNLWKEDADCLQWLDSKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT  QL EFAWGLANS K FLW+IRPDLV G+ A+LPPEFV  TK+RG L+
Sbjct  300   YVNFGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL H ++GGFLTH+GWNSTLE IC GVPM+CWPFFAEQQTNC YSC +WGIGM
Sbjct  360   SWCPQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++V  DEVE +VRELME  KG+EMK+KAME KK+A EA  T P GSS  N++KFIN 
Sbjct  420   EINSDVKGDEVEILVRELMEGVKGKEMKKKAMEWKKMAEEAI-TCPKGSSFQNLDKFINL  478

Query  1461  LLLS  1472
             LLLS
Sbjct  479   LLLS  482



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/479 (71%), Positives = 408/479 (85%), Gaps = 5/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LHH GFHITFVNTE+NH+RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHHNGFHITFVNTEYNHQRLLKSRGPSSLEGLPSF  67

Query  228   RFETIPDGLPLSEA-DATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             RFETIPDGLP S+A DATQDIPSLC+ST+ TCL PF+DLLA+LNDT  SN PPVSCIVSD
Sbjct  68    RFETIPDGLPPSDAADATQDIPSLCQSTTTTCLAPFRDLLAKLNDTGSSNVPPVSCIVSD  127

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             GVMSFTV+AAEELGIPE+ FWT SACGF  Y  Y +L++KGY+PL D S+LTNGYL+T +
Sbjct  128   GVMSFTVEAAEELGIPEIFFWTPSACGFFAYTQYEKLIEKGYSPLPDASFLTNGYLDTII  187

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             D +  MKGIRLRD+PSF+RTTNPDE+M+KF++ ET RARRASAI+LNTF+ LE + L AL
Sbjct  188   DEIPSMKGIRLRDIPSFIRTTNPDEFMVKFVVDETRRARRASAIVLNTFEDLERDVLDAL  247

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
              S+LPP+YA+GPL  L+ QV D  +  L S+LWK++  CLEWLD+K  NSVVYVN+GSIT
Sbjct  248   SSILPPIYAIGPLHLLENQVDDKALEQLGSNLWKDEPQCLEWLDSKEANSVVYVNFGSIT  307

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT DQL EFAWGLANS  PFLWIIRPDLV+G+ A+LPPEF+E TK+RG+L++WCPQE+V
Sbjct  308   VMTSDQLLEFAWGLANSNLPFLWIIRPDLVSGDKAVLPPEFLEATKERGLLANWCPQERV  367

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP+VGGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKW IGMEID+NV R
Sbjct  368   LRHPSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWNIGMEIDSNVKR  427

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             DEVE +VR+LM  E+G+EMKR+AME KKLA+ +A +    SS  N+EK I+ +LL+  K
Sbjct  428   DEVEILVRKLMIGEEGQEMKRRAMEWKKLAVASAQS----SSSENLEKVISRVLLAPSK  482



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/482 (69%), Positives = 404/482 (84%), Gaps = 5/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL +  +KPHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL ++ GP+
Sbjct  1     MGSLGTINNKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL SFRFETIPDGLP ++ DATQDIPSLCE+T  TC   FK+LL ++N+   S+APP
Sbjct  61    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINN---SDAPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAAEELG+PEV+FWTTSACGF+ Y+ Y QL++KG TPLKD SY+TN
Sbjct  118   VSCIVSDGVMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K IRL+DLPSF+RTTNPDE+ML FI  E GR RRASAIILNTFDALE
Sbjct  178   GYLETTIDWIPGIKEIRLKDLPSFIRTTNPDEFMLDFIQWECGRTRRASAIILNTFDALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  S+LPPVY++GPL  L K V D ++ A+ S+LWKE++ C+EWLDTK PNSVVY
Sbjct  238   HDVLEAFSSILPPVYSIGPLNLLVKHVDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVY  297

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI VMT +QL EFAWGLANS K FLW+IRPDLV GE A+LP EFV++T+ RG+LSS
Sbjct  298   VNFGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSS  357

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNCW+ C +WGIG+E
Sbjct  358   WCSQEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLE  417

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V RD++E +VRELM+ EKG+EMK KA++ K+LA  AA   P+GSS  N++  +  +
Sbjct  418   I-EDVERDKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFG-PVGSSFANLDNMVRDV  475

Query  1464  LL  1469
             LL
Sbjct  476   LL  477



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/487 (70%), Positives = 404/487 (83%), Gaps = 3/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S  +E DKPHAVC+PYPAQGHINPMLKLAKIL+HKGFHITFVNTE+NHRRL +S GP 
Sbjct  1     MASTGAELDKPHAVCVPYPAQGHINPMLKLAKILNHKGFHITFVNTEYNHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
               + LPSFRFE IPDGLP  +ADATQDI +LC+ST  TCLGPF++LLA+LN+T  S  PP
Sbjct  61    GFKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG  S+T+ AA+ELGIP+V FWT +ACG L YMHY  L+DKGY PLKDESYLTN
Sbjct  121   VSCIVSDGSNSYTLTAAQELGIPQVHFWTFAACGTLSYMHYCNLVDKGYIPLKDESYLTN  180

Query  564   GYLE-TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARR-ASAIILNTFDA  737
             GYLE T LDW+ GMK +RLRDLPSFL+T NPD++ML FI+ +T R+++ ASAI++N+F+A
Sbjct  181   GYLEKTTLDWIPGMKDVRLRDLPSFLKTANPDDFMLNFIICKTERSKKYASAIVVNSFEA  240

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LE E L +LQ+++PPVY +GPL  L K V D ++  L S+LWKE+  CLEWLD+K PNSV
Sbjct  241   LEKEVLESLQTLVPPVYVIGPLNLLVKHVDDKDLADLGSNLWKEEPKCLEWLDSKKPNSV  300

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT + L EFAWGLANS+  FLWIIRPD+V GE AILPPEF+EETK+RGML
Sbjct  301   VYVNFGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEEAILPPEFLEETKERGML  360

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWC QE+VL HPA+GGFLTH+GWNSTLESI NGVPM+CWPFFAEQ TNCW+ CTK GIG
Sbjct  361   ASWCQQEKVLNHPAIGGFLTHSGWNSTLESISNGVPMICWPFFAEQPTNCWFCCTKLGIG  420

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEI+NNV RDEVE +VRELM  EKG+EMK KA E KKLA EAA   P GSS+VNI+K IN
Sbjct  421   MEINNNVKRDEVEALVRELMTGEKGKEMKNKATEWKKLAEEAAAK-PAGSSYVNIDKLIN  479

Query  1458  HLLLSHR  1478
              +LL+ +
Sbjct  480   EILLAPK  486



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/486 (71%), Positives = 414/486 (85%), Gaps = 3/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL    DKPHAVCIPYPAQGHINPMLKLAKILHH+GFHITFVNTEFNH+RL ++ GP+
Sbjct  1     MGSL-GFADKPHAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLPSFRFETIPDGLP ++ DATQDIPSLCEST  TCL  FK LL +LND++ +N PP
Sbjct  60    ALNGLPSFRFETIPDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSANVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAAEELG+PEV+FWTTSACGFLGY+HY QL++KGYTPLKDESYLTN
Sbjct  120   VSCIVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTN  179

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+  M+GIRLRDLP+F+RTT+P+  ML F+  ET RA +ASAIILNTFD LE
Sbjct  180   GYLDTVIDWIPAMEGIRLRDLPTFIRTTDPNFIMLDFVFVETERALKASAIILNTFDDLE  239

Query  744   HEALMALQSMLPPVYAVGPLQF-LQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE L AL  MLPP+Y+VGPL   L   V D +++ L S+LWKE+  C++WLD+K PNSVV
Sbjct  240   HEMLGALSPMLPPIYSVGPLHLALNHHVHDNDLKQLGSNLWKEEPECIQWLDSKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSI VMT DQL+EFAWGLANS + FLW+IRPDLV GE+A++P EFV ETKDRG+++
Sbjct  300   YVNFGSIAVMTADQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPAEFVAETKDRGLMA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             +WCPQEQVL HP+VGGFLTH+GWNST+ESI  GVPM+CWPFFAEQQTNC YSCTKWGIGM
Sbjct  360   TWCPQEQVLSHPSVGGFLTHSGWNSTIESISGGVPMICWPFFAEQQTNCRYSCTKWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++V RDEVE +VRELME EKG+EMK+KA+E K+ A EA  +   GSS+ N+++ IN 
Sbjct  420   EINSDVKRDEVEGLVRELMEGEKGKEMKKKALEWKRKAEEATGSSK-GSSYKNLDQMINQ  478

Query  1461  LLLSHR  1478
             +LLS R
Sbjct  479   VLLSPR  484



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/484 (68%), Positives = 410/484 (85%), Gaps = 5/484 (1%)
 Frame = +3

Query  33    LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLR  212
             + S  +KPHAVCIP+PAQGHINPMLKLAK+LHHKGFHITFVNTE+NH+RL +S GP SL 
Sbjct  1     MDSIAEKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLD  60

Query  213   GLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSC  392
             GLPSF FETIPDGLP ++A+ATQDI SLC ST   CL  F+DLL++LN +  SN PPVSC
Sbjct  61    GLPSFTFETIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLNSS--SNIPPVSC  118

Query  393   IVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYL  572
             IVSDGVMSFTV+AA+ELGIPEV+FWTTSACGF+GYM Y  L+D+G  PLKD S LTNGYL
Sbjct  119   IVSDGVMSFTVEAAQELGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLKDASCLTNGYL  178

Query  573   ETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEA  752
             ETE+DW+ GM+GIRLRDLP+F+RTT+P++ M+K +L ET RA+RASAIILNT D LEHE 
Sbjct  179   ETEIDWLPGMRGIRLRDLPAFIRTTDPEDGMMKTMLIETERAKRASAIILNTIDDLEHEV  238

Query  753   LMALQSMLPPVYAVGPL--QFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYV  926
             L AL+++LPP+Y++GPL  Q  Q Q +  +++++ S+LWK++  CLEWLD++APNSVVYV
Sbjct  239   LDALKNLLPPIYSIGPLHLQLDQVQSEGTDLKSIQSNLWKDEPECLEWLDSRAPNSVVYV  298

Query  927   NYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSW  1106
             N+GSITVMT +QL EFAWGLANS K FLW+IRPDLV GE+A++PPEFVEETK+R +L++W
Sbjct  299   NFGSITVMTSEQLIEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTW  358

Query  1107  CPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEI  1286
             CPQEQVL HPA+GGFLTH+GWNSTLES+C GVPMLCWPFFAEQQTNC Y C +WGIGMEI
Sbjct  359   CPQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEI  418

Query  1287  dnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             + +V R  +E++V +LME E+G+EM++KAME KKLA EAA T P G S ++++K +N +L
Sbjct  419   EGDVHRSNIEELVTKLMEGEEGKEMRKKAMEWKKLAKEAA-TGPNGLSFLDLDKMVNEVL  477

Query  1467  LSHR  1478
             LS +
Sbjct  478   LSKK  481



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/482 (71%), Positives = 407/482 (84%), Gaps = 3/482 (1%)
 Frame = +3

Query  24    MGSLRSEQ--DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLG  197
             MGSL S     KPHAVCIPYPAQGHINPMLKLAK+LH+KGFHITFVNTEFNH+RL +S G
Sbjct  1     MGSLSSSDYSKKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRG  60

Query  198   PESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
              +SL+GL SF+F+TIPDGLP S+ DATQDIPSLCEST+  CL PFK LL +LNDT+ S  
Sbjct  61    SDSLKGLHSFQFKTIPDGLPPSDVDATQDIPSLCESTTTHCLVPFKQLLQKLNDTSSSEV  120

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSD VMSFT+ AA+EL IPEV+FWT SACG LGYMHY+QL+DKG TPLKD SY 
Sbjct  121   PPVSCVVSDAVMSFTISAAQELDIPEVLFWTPSACGVLGYMHYAQLIDKGLTPLKDASYF  180

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             +NG+L+  LDW+ GM+GIRLRDLP+FLRTTNPDEYM+KFILQET R+++ASAI+LNTF  
Sbjct  181   SNGFLDQVLDWIPGMEGIRLRDLPTFLRTTNPDEYMIKFILQETERSKKASAIVLNTFQE  240

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LE E + +L ++LPP+Y +GPLQ LQ QV D +++ L S+LWKE+  CLEWLDTK PNSV
Sbjct  241   LESEVIDSLSTLLPPIYPIGPLQILQNQVDDESLKVLGSNLWKEEPECLEWLDTKDPNSV  300

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT DQL EFAWGLANSK+ FLWIIRPDL++GE++IL  EFVEETK+RG++
Sbjct  301   VYVNFGSITVMTNDQLIEFAWGLANSKQNFLWIIRPDLISGESSILGEEFVEETKERGLI  360

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWC QEQV+ HPA+GGFLTHNGWNST+ESI +GVPM+CWPFFAEQQTNC + C KWGIG
Sbjct  361   ASWCHQEQVINHPAIGGFLTHNGWNSTIESISSGVPMICWPFFAEQQTNCRFCCNKWGIG  420

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEI+++V RDEVE +V+ELM  EKG+EMK+KA+E K +A E   T P GSS+ N+EK I 
Sbjct  421   MEINSDVKRDEVESLVKELMVGEKGKEMKKKALEWKNIA-EVTTTKPDGSSYSNLEKLIK  479

Query  1458  HL  1463
              L
Sbjct  480   VL  481



>ref|XP_004252532.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=484

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/486 (72%), Positives = 411/486 (85%), Gaps = 4/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S   E +KPHAVC+PYPAQGHINPMLKLAKILHHKGFHITFVNTEF HRRL +S GP 
Sbjct  1     MSSNNVEINKPHAVCVPYPAQGHINPMLKLAKILHHKGFHITFVNTEFIHRRLLKSRGPH  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA-VSNAP  380
             SL  L SFRFETIPDGLP  +ADATQDIPS+C+ST+ TCL PF+DLLA+LN T+  SN P
Sbjct  61    SLECLSSFRFETIPDGLPTCDADATQDIPSVCKSTTETCLAPFRDLLAKLNGTSNTSNVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG+MSFT+ AA+EL +PEV  WTTSACGFLGYMHY+ L++KGY PLKD SYLT
Sbjct  121   PVTCIVSDGIMSFTLAAAQELAVPEVQLWTTSACGFLGYMHYTTLIEKGYIPLKDVSYLT  180

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             +GYLET LD + GMK +RLRDLP+FLRTTN D++M KF+LQET RAR ASAII+NTF+ L
Sbjct  181   DGYLETTLDCIPGMKDVRLRDLPTFLRTTNSDDFMFKFVLQETVRARNASAIIMNTFETL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E E L +L+++LPPVY +GPL  L K V D N++ L SSLWKE++ C++WLDTK PNSVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEESECIQWLDTKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVNYG+ TVMTPDQL EFAWGLANS++ FLWIIRPD+V+G  +ILPPEFVEETK++GML+
Sbjct  301   YVNYGTTTVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSG--SILPPEFVEETKNKGMLA  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC Q++VL HPA+GGFLTH+GWNSTLESI +GVPMLCWPFFAEQQTNCWYS TKW IGM
Sbjct  359   SWCSQKEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWSIGM  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +VRELM  EKG++MK+KAME KKLA E +   P GSS++NIEK +N 
Sbjct  419   EIDNNVKRDEVESLVRELMVGEKGKKMKKKAMEWKKLA-EISAQKPTGSSYMNIEKVVND  477

Query  1461  LLLSHR  1478
             +LL  +
Sbjct  478   VLLVSK  483



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/488 (68%), Positives = 406/488 (83%), Gaps = 9/488 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   KPHAVCIP+PAQGHINPMLKLAK+LH+ GFHITFVNTE+NH RL +S GP+
Sbjct  1     MGSVGNSVHKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLP---LSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSN  374
             SL GLPSFRFETIPDGLP     +ADATQDIPSLCEST+ TCL PF+DLLA+LNDTA S 
Sbjct  61    SLTGLPSFRFETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSE  120

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              P VSC+VSDGVMSFT DAAEELGIPEV+FWTTSACGF  Y  Y  +++KGY  L D S 
Sbjct  121   VPHVSCVVSDGVMSFTADAAEELGIPEVLFWTTSACGFYCYTQYGNVIEKGYASLADTSC  180

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDE-YMLKFILQETGRARRASAIILNTF  731
             LTNGYLET ++ +  M+G+R+RD+PSF+RTTN D+ YM+KF+LQET RA+RASAI+LNTF
Sbjct  181   LTNGYLETVIEGIPNMEGMRIRDIPSFIRTTNEDDIYMVKFVLQETKRAKRASAIVLNTF  240

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAP  908
             + LE E + AL S+LPP+Y +GPL  ++K V ++  +  L S+LWKED  CL+WLDTK P
Sbjct  241   EELERETIDALSSILPPIYPIGPLNLIEKNVIENKGLNLLGSNLWKEDQECLKWLDTKEP  300

Query  909   NSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDR  1088
             NSVVYVN+GSITVMTPDQL+EFAWGLANS +PFLWIIRP+LV+GE A+LP  F++ TK+R
Sbjct  301   NSVVYVNFGSITVMTPDQLNEFAWGLANSMQPFLWIIRPNLVSGEKAVLPDGFLDATKER  360

Query  1089  GMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKW  1268
             GML++WCPQE+VL H +VGGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKW
Sbjct  361   GMLANWCPQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKW  420

Query  1269  GIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEK  1448
             G+GMEID++V R+ VE +V +LM  E+GR+M+ KA+E K LA ++A+    GSS+ N++K
Sbjct  421   GVGMEIDSDVKRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDSAE----GSSYRNLKK  476

Query  1449  FINHLLLS  1472
              I+ +LLS
Sbjct  477   LIDQVLLS  484



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/477 (68%), Positives = 396/477 (83%), Gaps = 8/477 (2%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQGHINPMLKLAK+LH+ GFHITFVNTE+NH RL +S GP+SL GLPSFR
Sbjct  8     KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  67

Query  231   FETIPDGLP---LSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVS  401
             FETIPDGLP     +ADATQDIPSLCEST+ TCL PF+DLLA+LNDTA S  PPVSCIVS
Sbjct  68    FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSEVPPVSCIVS  127

Query  402   DGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETE  581
             DGVMSFT DAAEELGIPE++FWTTSACGF  Y  Y  +  KGY PL D S  TNGYLET 
Sbjct  128   DGVMSFTADAAEELGIPEILFWTTSACGFYAYTQYEYVFQKGYAPLADTSCFTNGYLETV  187

Query  582   LDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMA  761
             ++ +  M+GIR++D+PSF+RTTN D++M++FI  ET RA+R SAI+LNTF+ LE + + A
Sbjct  188   IEGIPSMEGIRMKDMPSFVRTTNEDDFMIQFIFAETKRAKRVSAIVLNTFEELERDTIDA  247

Query  762   LQSMLPPVYAVGPLQFLQK-QVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             L S LPP+Y +GPL  ++K  +KD  ++ L S+LWKED  CLEWLDTK PNSVVYVN+GS
Sbjct  248   LSSFLPPIYPIGPLNLIEKYHIKDEGLKELGSNLWKEDQECLEWLDTKEPNSVVYVNFGS  307

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITVMTPDQL+EFAWGLANSK+PFLWIIRP+LV+GE A+LP  F++ TK+RGML++WCPQE
Sbjct  308   ITVMTPDQLNEFAWGLANSKQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWCPQE  367

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL H +VGGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKWG+GMEID++V
Sbjct  368   KVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDV  427

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              R+ VE +V +LM  E+GR+M+ KA+E K LA ++A+    GSS+ N++  I+ +LL
Sbjct  428   KRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDSAE----GSSYRNLKNLIDQVLL  480



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/479 (68%), Positives = 404/479 (84%), Gaps = 5/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLPL++A+ATQDIPSLCEST    L  F+DLL++LN +  +  PPVSCIVSDG
Sbjct  68    RFETIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSS--TGCPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA ELGIPEV+FWTTSACGFL Y+HY +L++ G TPLKD SYLTNGYLET++D
Sbjct  126   VMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKDASYLTNGYLETQID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+ D+ ML F++ ET R R+ASA++LNTF  LEHEAL AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDRDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVEETK+R +L+ WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +WGIGMEI+N+V R
Sbjct  366   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIENDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + VE +VR+LME E+G++M++KA+E KKLAMEA  T P GSS V ++K IN +LLS R 
Sbjct  426   NYVEGLVRKLMEGEEGKDMRKKALEWKKLAMEA--TSPNGSSFVALDKMINQVLLSPRN  482



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 395/484 (82%), Gaps = 1/484 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S  ++ D PHA+C+P P QGHINPMLKLAK LH +GFHITFVNTE+NHRRL +S GP+
Sbjct  1     MASNYAQLDVPHAICVPAPTQGHINPMLKLAKFLHFRGFHITFVNTEYNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP S+AD+TQDI SL +S + T L PFK+LLA+LN T+ SN PP
Sbjct  61    SLKGLHSFRFETIPDGLPPSDADSTQDIASLSKSLTTTGLVPFKELLAKLNHTSSSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
              SCI+SDGVMSFT+ AA++LGIP V FWT  ACG LGYMHY  L++K YTPLKDESYLTN
Sbjct  121   ASCIISDGVMSFTLAAAQDLGIPLVFFWTLCACGLLGYMHYCNLIEKDYTPLKDESYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLE  LDW+ GMK IRLRDLPSF+RT NPD+YM+KF++QET R++ ASAI++NTF+ LE
Sbjct  181   GYLEKTLDWIPGMKDIRLRDLPSFIRTANPDDYMIKFLIQETERSKNASAIVVNTFEPLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L +LQ++LPPVYA+GPL  + K V D N+  L  +LWKED  CLEWLD+K  NSVVY
Sbjct  241   KEVLESLQTLLPPVYAIGPLHLILKHVDDNNLEELELNLWKEDEKCLEWLDSKKLNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI V+T +QL EFAWGLANS+  FLWIIRPD+V GE AILPPEFVEETKDR ML+S
Sbjct  301   VNFGSIAVVTSNQLIEFAWGLANSRMEFLWIIRPDIVLGEQAILPPEFVEETKDRAMLAS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTH  WNS LESI  GVPM+CWPFFAEQ TNCW+ CTK GIGME
Sbjct  361   WCPQEQVLSHPAIGGFLTHGEWNSILESISCGVPMICWPFFAEQPTNCWFCCTKLGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID+NV RDEV  +VRELM  +KG+EMK+KA+E KKLA EAA   P GSS+VNI+K IN +
Sbjct  421   IDSNVKRDEVASLVRELMAGDKGKEMKKKALEWKKLAEEAAKK-PTGSSYVNIDKIINEI  479

Query  1464  LLSH  1475
              L H
Sbjct  480   SLKH  483



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/488 (68%), Positives = 403/488 (83%), Gaps = 5/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIP PAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEA-DATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNA  377
             SL GLPSFRF TIPDGLP S+A D TQDIP+LC+STS  CL  F+DLL RLN+ +A S +
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDG+M+FT+DAAE +G+PEV+FWT SACGF+GY+ Y  L+DKG TPLKD SYL
Sbjct  120   PPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYL  179

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYL+T +DW+ GM+ IRLRDLPSFLRTT+ D+ M+ F L+ET RA+RASAI+ NTFD 
Sbjct  180   TNGYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDR  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LEHE L AL+++ PP+Y +GPL  L KQ+ D + +++ S+LWKED  CLEWLD+K P+SV
Sbjct  240   LEHEVLDALKAIFPPIYTLGPLHLLTKQLPDNDTKSIGSNLWKEDLGCLEWLDSKPPSSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVM+P QL EFAWGLA+S + FLW+IRPDLV G+ AILPPEF   T++R +L
Sbjct  300   VYVNFGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL H AVGGFLTH+GWNST+ESI  GVPM+CWPFF EQQTNC YSC +WGIG
Sbjct  360   ASWCPQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID+NV RDEV + VRELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+
Sbjct  420   MEIDSNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVID  477

Query  1458  HLLLSHRK  1481
              +LLS R+
Sbjct  478   KVLLSPRR  485



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/479 (68%), Positives = 403/479 (84%), Gaps = 5/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLCEST    L  F+DLL++LN +  +  PPVSCIVSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSS--TGCPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA ELGIPEV+FWTTSACGFL Y+HY +L++KG TPLKD +YLTNGYLET++D
Sbjct  126   VMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDANYLTNGYLETQID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA++LNTF  LEHEAL AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVEETK+R +L+ WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R
Sbjct  366   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + VE +VR+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  426   NYVEGLVRKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/482 (68%), Positives = 391/482 (81%), Gaps = 9/482 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHINPMLKLAK+LH +GF ITFVNTEFNH RL ++ GP 
Sbjct  1     MGSM----EKPHAVCIPYPAQGHINPMLKLAKLLHFRGFRITFVNTEFNHTRLLKAQGPN  56

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP+F+FETIPDGLP S  DATQDIPSLC ST   CL PF+ LLA+LND      PP
Sbjct  57    SLNGLPTFQFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLND----RGPP  112

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI SD VMSFT+DAA+ELGIP+++ WT SACGF+ Y+ Y  L+DKG+TPLKDESYLTN
Sbjct  113   VTCIFSDAVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTN  172

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMKGIRL+DLPSF+RTT+PD+ ML F + E  RAR+ASAII NTFDALE
Sbjct  173   GYLDTVVDWIPGMKGIRLKDLPSFIRTTDPDDIMLDFAMGELERARKASAIIFNTFDALE  232

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L A+  M PP+Y +GPLQ L  Q+ D  ++ + S+LWKE+  CL+WLD+K PNSVVY
Sbjct  233   QEVLDAIAPMYPPIYTIGPLQLLPDQIHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVY  292

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMTP QL EFAWGLANS + FLWI+RPDLV+GE+AILPPEFV ET+DRG+L+ 
Sbjct  293   VNYGSITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAG  352

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL H A+GGFLTHNGWNST+E +C GVPM+CWPFFAEQQTNC Y CT+WG+GME
Sbjct  353   WCPQEQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGME  412

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDEV K+VRELM  EKG+ MK+K ME K  A E A T P GSS++N+EK    +
Sbjct  413   IDSDVKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRA-EVATTGPDGSSYLNLEKIFEQV  471

Query  1464  LL  1469
             LL
Sbjct  472   LL  473



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 390/480 (81%), Gaps = 5/480 (1%)
 Frame = +3

Query  30    SLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESL  209
             S +   +KPHAVCIPYPAQGHINPMLKLAK+LH +GF ITFVNTEFNH RL  + GP  L
Sbjct  18    SAKMGSEKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCL  77

Query  210   RGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVS  389
              GLP+F+FETIPDGLP S+ DATQDIPSLC ST   CL PF+ LLA+LN     + PPV+
Sbjct  78    SGLPTFQFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLN----HDGPPVT  133

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
             CI SD +MSFT+DAA+ELGIP+++ WT SACGF+ Y+ Y  L+DKG+TPLKDESYLTNGY
Sbjct  134   CIFSDAIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGY  193

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             L+T +DW+ GMKGIRL+DLPSF+RTT+PD+ ML F + E  RAR+ASAII NTFDALEHE
Sbjct  194   LDTVVDWIPGMKGIRLKDLPSFIRTTDPDDVMLDFAMGELERARKASAIIFNTFDALEHE  253

Query  750   ALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVN  929
              L A+  M PP+Y + PLQ L  Q+ D  ++ + S+LWKED  CL+WLD+K PN+VVYVN
Sbjct  254   VLDAIAPMYPPIYTIAPLQLLLDQIHDSELQLIGSNLWKEDEECLQWLDSKGPNTVVYVN  313

Query  930   YGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWC  1109
             +GSITVM P+ L EFAWGL+NSK+ FLWIIRPDLV+G +AILPPEF+ ETKDRG+L+SWC
Sbjct  314   FGSITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWC  373

Query  1110  PQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEId  1289
              QEQVLGHPAVGGFLTHNGWNS LES+C GV M+CWPFFAEQQTNC Y CT+WGIGMEID
Sbjct  374   SQEQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEID  433

Query  1290  nnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              +V RD+VE++VRELME EKG EMK+K ME KK+A EA  T P GSS  N+++ I  LLL
Sbjct  434   GDVKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEAT-TAPSGSSFFNLDRMIKQLLL  492



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/482 (68%), Positives = 391/482 (81%), Gaps = 9/482 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHINPMLK+AK+LH +GF ITFVNTEFNH RL ++ GP 
Sbjct  1     MGSM----EKPHAVCIPYPAQGHINPMLKVAKLLHFRGFRITFVNTEFNHTRLLKAQGPN  56

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP+F+FETIPDGLP S  DATQDIPSLC ST   CL PF+ LLA+LND      PP
Sbjct  57    SLNGLPTFQFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLND----RGPP  112

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI SD VMSFT+DAA+ELGIP+++ WT SACGF+ Y+ Y  L+DKG+TPLKDESYLTN
Sbjct  113   VTCIFSDAVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTN  172

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMKGIRL+DLPSF+RTT+PD+ ML F + E  RAR+ASAII NTFDALE
Sbjct  173   GYLDTVVDWIPGMKGIRLKDLPSFIRTTDPDDIMLDFAMGELERARKASAIIFNTFDALE  232

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L A+  M PP+Y +GPLQ L  Q+ D  ++ + S+LWKE+  CL+WLD+K PNSVVY
Sbjct  233   QEVLDAIAPMYPPIYTIGPLQLLPDQIHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVY  292

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMTP QL EFAWGLANS + FLWI+RPDLV+GE+AILPPEFV ET+DRG+L+ 
Sbjct  293   VNYGSITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAG  352

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL H A+GGFLTHNGWNST+E +C GVPM+CWPFFAEQQTNC Y CT+WG+GME
Sbjct  353   WCPQEQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGME  412

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDEV K+VRELM  EKG+ MK+K ME K  A E A T P GSS++N+EK    +
Sbjct  413   IDSDVKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRA-EVATTGPDGSSYLNLEKIFEQV  471

Query  1464  LL  1469
             LL
Sbjct  472   LL  473



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/477 (68%), Positives = 395/477 (83%), Gaps = 1/477 (0%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVC+PYPAQGHI PMLKLAK+LH KGFH+TFVNTEFNH+RL +S GP+SL GL SF
Sbjct  8     EKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPDSLTGLSSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP S+ DATQ IPSLCEST   CLGPF+ LL +LN+T  S  PPVSC+VSDG
Sbjct  68    RFETIPDGLPESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNTVSSGVPPVSCVVSDG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSF++DAAEELGIP+V+FWTTS CGF+ Y+HY  L++KGYTPLKD SY+TNGYL+T +D
Sbjct  128   VMSFSLDAAEELGIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPLKDVSYVTNGYLDTVID  187

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+DLPSFLRTT+P++ ML F+L ET    R+SAII NTFD LEH+ L  L 
Sbjct  188   WIPGMEGIRLKDLPSFLRTTDPNDIMLDFVLSETKNTHRSSAIIFNTFDKLEHQVLEPLA  247

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             SM PP+Y +GPL  L  Q+K+ +++ + S+LWKE+  C+EWL++K P SVVYVN+GSITV
Sbjct  248   SMFPPIYTIGPLNLLMNQIKEESLKMIGSNLWKEEPMCIEWLNSKEPKSVVYVNFGSITV  307

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MTP+QL EFAWGLANS + FLWIIRPDLV GE+A+LPPEFV  TK+RGML+SW PQE+VL
Sbjct  308   MTPNQLVEFAWGLANSNQSFLWIIRPDLVVGESAVLPPEFVAVTKERGMLASWAPQEEVL  367

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H +VGGFLTH GWNSTLESI +GV ++CWPFFAEQQTNCWY C + GIGMEID++V R+
Sbjct  368   AHSSVGGFLTHCGWNSTLESISSGVAVVCWPFFAEQQTNCWYCCGELGIGMEIDSDVKRE  427

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             EVE++VRELM  EKG+EMK +AM  K+LA EA  +   GSS +N++K ++ +LLS R
Sbjct  428   EVERLVRELMVGEKGKEMKERAMGWKRLAEEATQS-SSGSSFLNLDKLVHQVLLSPR  483



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/488 (68%), Positives = 402/488 (82%), Gaps = 5/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDMIQ-KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNA  377
             SL GLPSFRF TIPDGLP S+ ADATQDIP+LC+STS  CL  F+DLL RLN+ +  S +
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDG MSFT+DAAE +G+PEV+FWTTSACGF+GY+ Y  L+DKG TPLKD SYL
Sbjct  120   PPVSCVVSDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLVDKGLTPLKDASYL  179

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYL+T +DW+ GM+ IRLRDLPSF++TTNPD+ M+ F+L+ET RA+RASAI+ NTFD 
Sbjct  180   TNGYLDTIIDWIPGMRNIRLRDLPSFIQTTNPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LEHE L AL++  P +  +GPL  L +Q+ D + +++ S+LWKED  CLEWLD+K P SV
Sbjct  240   LEHEVLDALKATFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVM+P QL EFAWGLANS + FLW+IRPDLV G+ AILP EF   T++R +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSGQMFLWVIRPDLVVGDTAILPSEFSATTRERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPAVGGFLTH+GWNST+ESI  GVPMLCWPFFAEQQTNC YSC +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPMLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID +V RD+VEK VRELME E G+EMKRKAME +++A EA  T P GSS +N+++ ++
Sbjct  420   MEIDGDVKRDKVEKQVRELMEGETGKEMKRKAMEWQEMAREA--TRPSGSSCLNLDEVMD  477

Query  1458  HLLLSHRK  1481
              +LLS R+
Sbjct  478   KVLLSPRR  485



>ref|XP_004299648.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/491 (67%), Positives = 406/491 (83%), Gaps = 8/491 (2%)
 Frame = +3

Query  24    MGS--LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLG  197
             MGS  L  E +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFH+TFVN+E+NHRRL  S G
Sbjct  1     MGSNALMVETNKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHVTFVNSEYNHRRLLNSRG  60

Query  198   PESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
             P +L GLPSF+F+TIPDGLP ++ +ATQDIPSLCEST   CL  F+ LL  +N     N+
Sbjct  61    PNALDGLPSFQFKTIPDGLPPTDTNATQDIPSLCESTRKYCLPHFRKLLEEVNSE--ENS  118

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDGVMSFT+DAAEELG+PEV+FWTTSACGF+ Y+HY  L++KGYTPLKD SYL
Sbjct  119   PPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFMAYVHYKHLIEKGYTPLKDASYL  178

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRA-RRASAIILNTFD  734
             TNGYL+T +DW+ GMKGIRL+D+P+F+RTT+ +  M+ F+L ET RA ++ASAIILNTFD
Sbjct  179   TNGYLDTVIDWIPGMKGIRLKDIPTFIRTTDTNALMVDFVLHETERAAKKASAIILNTFD  238

Query  735   ALEHEALMALQSMLPP-VYAVGPLQFLQKQVK-DINVRALASSLWKEDTSCLEWLDTKAP  908
              LEH+ L A  ++LPP VY++GPL     Q+     ++ L S+LWKE++ CLEWLD+K P
Sbjct  239   DLEHDVLEAFAALLPPAVYSIGPLSLQLNQIPPGSELQTLKSNLWKEESECLEWLDSKDP  298

Query  909   NSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDR  1088
             +SVVYVN+GSITVMT  QL EFAWGLANSKK FLW+IRPDLV G +A++P EFVEET++R
Sbjct  299   DSVVYVNFGSITVMTETQLIEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRER  358

Query  1089  GMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKW  1268
              ML++WCPQE+VL HPAVGGFLTH+GWNSTLESIC GVPM+CWPFFAEQQTNC + C +W
Sbjct  359   SMLATWCPQEEVLRHPAVGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEW  418

Query  1269  GIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEK  1448
             GIGMEI+ +  RD VE +VR+LME E+G+EMK+KA+E K+LAMEAA T P GSS VN++K
Sbjct  419   GIGMEIEGDPKRDYVEGLVRKLMEGEEGKEMKKKALEWKRLAMEAA-TGPKGSSFVNLDK  477

Query  1449  FINHLLLSHRK  1481
              +N +LL+ RK
Sbjct  478   MVNQVLLAPRK  488



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/476 (68%), Positives = 403/476 (85%), Gaps = 5/476 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPML+LAK+LH+KGFHITFVNTEFNH+RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLCEST    L  F+DLL++LN +  +  PPVSCIVSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSS--TGCPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA ELGIPEV+FWTTSACGFL Y+HY +L++KG TPLKD SYLTNGYLETE+D
Sbjct  126   VMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA+ILNTF   EHE L AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVILNTFHDFEHEVLDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHVQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVE+TK+R +L++WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C+GVPM+CWPFFAEQQTNC YS  +WGIGMEI+++V R
Sbjct  366   LKHPAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             + VE +VR+LME ++G+EM++KA+E KKLA EA  T P GSS + ++K +N +LLS
Sbjct  426   NYVEGLVRKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFLCLDKMVNQVLLS  479



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/485 (67%), Positives = 405/485 (84%), Gaps = 6/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL + ++KPHAVC+PYPAQGH+NPMLK+AK+LH KGFHITFVNTE+NH+RL +S GP 
Sbjct  1     MGSL-TARNKPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L G+P FRFETIPDGLP  + DATQDIP+LC+STS  CL PF+ LLA+LN + V   PP
Sbjct  60    ALDGVPDFRFETIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSGV---PP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDGVMSFT+ AAEELGIPEV+FWTTSACGFLGYMHY +L+++G+TPLKDE+YLTN
Sbjct  117   VTCIVSDGVMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IR+RDLPSF+RTT+ ++ ML F+  E+ RA +ASA+I+NTFD  E
Sbjct  177   GYLDTVIDWIPGMKNIRIRDLPSFVRTTDRNDIMLNFLAVESERAAKASAVIVNTFDEFE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ + AL SMLP +Y +GPLQ L  Q+    + ++ S+LWKE+  CL+WL++K P SVVY
Sbjct  237   HDVVKALSSMLPRIYTIGPLQLLLNQIPQTPLESIGSNLWKEEPECLQWLNSKEPKSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT  QL EFAWGLANSK  FLWIIRPDLV G+++ILPPEF+EET++RG+++S
Sbjct  297   VNFGSITVMTAQQLVEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERGLMAS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+ GFLTH+GWNST+ESI  GVPM+ WPFFAEQQTNC ++CT+WG+GME
Sbjct  357   WCPQEQVLNHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV R+EVE++VRELME EKG+ M+ KAME KK A +AA   P GSS +N+EK I  +
Sbjct  417   IDNNVKREEVERLVRELMEGEKGKGMRNKAMEWKKKAEQAAS--PNGSSFLNLEKLIKDV  474

Query  1464  LLSHR  1478
             LL H+
Sbjct  475   LLKHQ  479



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/479 (67%), Positives = 402/479 (84%), Gaps = 5/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH+KGF+ITFVNTEFNH+RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLCEST    L  F+DLL++LN +  +  PPVSCIVSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSS--TGCPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA ELGIPEV+FWTTSACG L Y+HY +L++KG TPLKD SYLTNGYLETE+D
Sbjct  126   VMSFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKDASYLTNGYLETEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA++LNTF  LEHEAL AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVLLNTFHDLEHEALDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLA+S + F W+IRPDLV G++A++PPEFVEETK+R +L+ WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R
Sbjct  366   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + +E +VR+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  426   NYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/487 (67%), Positives = 400/487 (82%), Gaps = 4/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS    Q  PHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSTDMTQ-MPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAP  380
             SL GLPSFRF TIPDGLP S+ADATQD+P+LC+ST  +CL  F+DLL +LN+ +A+S +P
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGSP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSC+VSDGVMSFT+DAAE + +PEV+FWTTS CGF+GY+ Y  L+D+G  PLKD SYLT
Sbjct  120   PVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYLT  179

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYL+T +DW+ GM  IRLRDLPSF+RTT+PD+ M+ F L ET RA+RASAI+ NTFD L
Sbjct  180   NGYLDTAVDWIPGMTNIRLRDLPSFIRTTDPDDPMVDFCLVETERAKRASAIVFNTFDQL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EHE L AL++MLPP+Y +GPL  L +Q+   + R++ S+LWKED  CLEWLD K+P+SVV
Sbjct  240   EHEVLDALKAMLPPIYTLGPLHLLTEQLPSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+TVM+P QL EFAWGLANS + FLW+IRPDLV G+ AILPPEF   T++R +L+
Sbjct  300   YVNFGSVTVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQ QVL H A+GGFLTH+GWNST+ESI  GVP++CWPFFAEQQ NC YSC +WGIGM
Sbjct  360   SWCPQVQVLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EID +V RDEVE+ VRELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ 
Sbjct  420   EIDGDVKRDEVERQVRELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVIDK  477

Query  1461  LLLSHRK  1481
             +LLS R+
Sbjct  478   VLLSPRR  484



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 405/488 (83%), Gaps = 5/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDKIQ-KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS-NA  377
             SL GLPSFRF TIPDGLP S+ ADATQDIP+LC+STS  CL  F+DLL RLN+ + +  +
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDGVMSFT+DAAE +G+PEV+FWTTSACGF+GY+ Y  L+DKG TPLKD SYL
Sbjct  120   PPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYL  179

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYL+T +DW+ GM+ I+LRDLPSF++TT+PD+ M+ F+L+ET RA+RASAI+ NTFD 
Sbjct  180   TNGYLDTIIDWIPGMRNIQLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LEHE L AL++M P +  +GPL  L +Q+ D + +++ S+LWKED  CLEWLD+K P SV
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVM+P QL EFAWGLANS + FLW+IRPDLV G+ AILP EF   T++R +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPAVGGFLTH+GWNST+ESI  GVP+LCWPFFAEQQTNC YSC +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID +V RD+VE+ VRELME E+G+EMKRKAME +++A EA  T P GSS++N+++ ++
Sbjct  420   MEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMAREA--TRPSGSSYLNLDEVMD  477

Query  1458  HLLLSHRK  1481
              +LL  R+
Sbjct  478   KVLLLPRR  485



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/486 (67%), Positives = 404/486 (83%), Gaps = 7/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ + Q +PHAVCIPYPAQGHINPMLKLAK+LH  GFHITFVNT+FNHRRL +S GP 
Sbjct  1     MGSISTSQQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPT  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L G+ SF+FE+IPDGLP ++ DATQDIPSLC+ST   CL PFK+L+++LN     N P 
Sbjct  61    ALDGISSFQFESIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLN--CDPNVPQ  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFTVDAAEELG+P V+FWTTSACGFL Y+HY QL+++GYTP KDESYL+N
Sbjct  119   VSCIVSDGVMSFTVDAAEELGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFKDESYLSN  178

Query  564   -GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               YL+T++DW+ GMK +RLRD+P+F+RTT+P++ M+ FI+ ET RA+RA+AI+LNT  +L
Sbjct  179   EQYLDTKIDWIPGMKDVRLRDIPTFIRTTDPEDGMIDFIISETKRAKRANAIVLNTVASL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDIN---VRALASSLWKEDTSCLEWLDTKAPN  911
             E EAL A+ S+LPPV+++GPLQ L +QV   +   ++ L S+LWKEDTSCL+WLD K+PN
Sbjct  239   EQEALNAMSSLLPPVFSIGPLQLLLQQVASHDSDHLKFLGSNLWKEDTSCLQWLDQKSPN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SVVYVN+GSITVMT DQL EFAWGLANS + FLWIIRPDLV G+ A+LPPEF++ TK+RG
Sbjct  299   SVVYVNFGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERG  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             ML++WCPQE+VL HPA+GGFLTHNGWNST ESI  GVPM+CWPFFAEQQTNC Y CT+WG
Sbjct  359   MLTNWCPQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWG  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IGME+D++V R+E+EK V+ELME EKG+EM+ +A E KKL  +AA T   GSS  N+   
Sbjct  419   IGMEVDSDVKREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAA-TPHSGSSSRNLNDL  477

Query  1452  INHLLL  1469
             ++ +LL
Sbjct  478   VHKVLL  483



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/480 (68%), Positives = 397/480 (83%), Gaps = 5/480 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIP PAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEA-DATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNA  377
             SL GLPSFRF TIPDGLP S+A D TQDIP+LC+STS  CL  F+DLL RLN+ +A S +
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDG+M+FT+DAAE +G+PEV+FWT SACGF+GY+ Y  L+DKG TPLKD SYL
Sbjct  120   PPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYL  179

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYL+T +DW+ GM+ IRLRDLPSFLRTT+ D+ M+ F L+ET RA+RASAI+ NTFD 
Sbjct  180   TNGYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDR  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LEHE L AL+++ PP+Y +GPL  L KQ+ D + +++ S+LWKED  CLEWLD+K P+SV
Sbjct  240   LEHEVLDALKAIFPPIYTLGPLHLLTKQLPDNDTKSIGSNLWKEDLGCLEWLDSKPPSSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVM+P QL EFAWGLA+S + FLW+IRPDLV G+ AILPPEF   T++R +L
Sbjct  300   VYVNFGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL H AVGGFLTH+GWNST+ESI  GVPM+CWPFF EQQTNC YSC +WGIG
Sbjct  360   ASWCPQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID+NV RDEV + VRELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+
Sbjct  420   MEIDSNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVID  477



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/476 (67%), Positives = 399/476 (84%), Gaps = 4/476 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VCIPYPAQGHINPMLKLAK+LH+KGFH+TFVNTE+NHRRL +S GP+S++GLP FR
Sbjct  9     KPHVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPGFR  68

Query  231   FETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             FETIPDGLP S+  +ATQ IPSLC+ST  TCL PF++LL++LND++ S+ PPVSCIVSDG
Sbjct  69    FETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLNDSSSSDTPPVSCIVSDG  128

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+ AA+E GIPEV+FWTTSACGF+ Y+HY  L+ +G TPLKD +YLTNGYL+T +D
Sbjct  129   VMSFTLTAAQECGIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLKDINYLTNGYLDTTID  188

Query  588   WVKGM-KGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             W+ G+ K IRLRDLPSFLRTT+PD+ ML F+  E  RA++A AIILNTFDALEH+ L  L
Sbjct  189   WIPGLVKDIRLRDLPSFLRTTDPDDIMLDFVKGEVQRAKKAEAIILNTFDALEHDVLNVL  248

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
               M P VY++GPLQ L  Q+ +  ++++ S+LW+E   CL+WLD++ PNSVVYVN+GSIT
Sbjct  249   SFMFPRVYSIGPLQLLHNQIPENGLKSIGSNLWQEQPGCLDWLDSQKPNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMTP+QL EFAWGLANS   FLW+IRPDLV G++A+LPP+F+ +T++RG+L+SWCPQEQV
Sbjct  309   VMTPEQLVEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLASWCPQEQV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP++G FLTHNGWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WG+GMEID+NV R
Sbjct  369   LNHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEIDSNVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             DEVE +V+++ME EKG+EMK++ +E KK A EA  T   GSS+ N++K I  +LLS
Sbjct  429   DEVESLVKQIMEGEKGKEMKKRTLEWKKKAEEA--TYQDGSSYSNLDKMIKEVLLS  482



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/488 (67%), Positives = 403/488 (83%), Gaps = 5/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHA+CIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDMIQ-KPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNA  377
             SL GLPSFRF TIPDGLP S+ ADATQDIP+LC+STS  CL  F+DLL RLN+ +  S +
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDGVMSFT+DAAE +G+PEV+FWTTSACGF+GY+ Y  L+DKG TPLKD SYL
Sbjct  120   PPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYL  179

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TN YL+T +DW+ GM+ IRLRDLPSF++TT+PD+ M+ F+L+ET RA+RASAI+ NTFD 
Sbjct  180   TNAYLDTIIDWIPGMRNIRLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LEHE L AL++M P +  +GPL  L +Q+ D + +++ S+LWKED  CLEWLD+K P SV
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVM+P QL EFAWGLANS + FLW+IRPDLV G+ AILP EF   T++R +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPAVGGFLTH+GWNST+ESI  GVP+LCWPFFAEQQTNC YSC +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEID +V RD+VE+ VRELME E+G+EMKRKAME +++A EA    P GSS++N+++ ++
Sbjct  420   MEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMAREAMR--PSGSSYLNLDEVMD  477

Query  1458  HLLLSHRK  1481
              +LL  R+
Sbjct  478   KVLLLPRR  485



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/478 (69%), Positives = 400/478 (84%), Gaps = 1/478 (0%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             +E+ +PHAVC+P+PAQGHINPM+KLAK+LHHKGFHITFVNTEFNH+RL +S GP SLRGL
Sbjct  4     AEKPRPHAVCVPFPAQGHINPMMKLAKLLHHKGFHITFVNTEFNHQRLLKSRGPNSLRGL  63

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSF+FETI DGLP S+ DATQD+PSLC ST   CL PF+DLLA+LNDT+ S  PPV+CIV
Sbjct  64    PSFQFETIADGLPPSDIDATQDVPSLCASTHNDCLAPFRDLLAKLNDTSSSKVPPVTCIV  123

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             SDG+MSFT+ AAEELGIPEV FWTTSACGF+GY+ Y  L+D+G+ PLKDES LTNG+L+T
Sbjct  124   SDGIMSFTLKAAEELGIPEVFFWTTSACGFMGYVQYRHLIDRGFFPLKDESCLTNGHLDT  183

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
              +DW+  MKG+RLRDLPSF+RTTNPD+ ++ F + E  RA  ASAI+LNTFD LEHE L 
Sbjct  184   VVDWIPAMKGVRLRDLPSFIRTTNPDDIVVNFAMGEVERANDASAILLNTFDELEHEVLQ  243

Query  759   ALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             AL +M PP+Y +GPLQ L  Q+ D +++++ S+LWKE+  CLEWLD K P SVVYVN+GS
Sbjct  244   ALSTMFPPIYTIGPLQLLLNQMPDNDLKSIESNLWKEEPGCLEWLDAKEPESVVYVNFGS  303

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             +TVMTP QL EFAWGLAN+   FLWIIRPDLV G+AAILP +FV +TK+R +L+SWCPQE
Sbjct  304   VTVMTPQQLVEFAWGLANANLKFLWIIRPDLVAGDAAILPADFVAQTKERSLLASWCPQE  363

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL HPA+GGFLTH+GWNST+E +C GVPM+CWPFFAEQ TNC Y CT+WG+GMEI N+V
Sbjct  364   RVLTHPAIGGFLTHSGWNSTIEGLCGGVPMICWPFFAEQMTNCRYCCTEWGVGMEIGNDV  423

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              RDEVE +VR LME EKG+EMK+KAME K++A EAA T P GSS+ N++K IN +LLS
Sbjct  424   TRDEVESLVRGLMEGEKGKEMKKKAMEWKRMA-EAATTTPAGSSYSNLDKMINQVLLS  480



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/494 (66%), Positives = 405/494 (82%), Gaps = 12/494 (2%)
 Frame = +3

Query  24    MGSL-RSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS+  SE+ KPHAVCIPYPAQGHI PMLKLAK+LHH+GFH+TFVNTE+NH RL++S   
Sbjct  1     MGSMGHSEKPKPHAVCIPYPAQGHITPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV--SN  374
             +++  LPSFRF TIPDGLP +++D TQDIPSLCEST  TCL  FK+LLA+LND A     
Sbjct  58    QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPVSC+VSDGVMSFT+DAAEELG+PEV+FWTTSACGFLGYMHY  L+D+G  PLKDESY
Sbjct  118   VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRAR--RASAIILNT  728
             LTNGYL+T +DW+  M  I+L+DLP+FLRTTNPDE+M++F+L ET R+R  + +AIILNT
Sbjct  178   LTNGYLDTVIDWIPAMSNIKLKDLPTFLRTTNPDEFMVEFVLGETERSRSPKPAAIILNT  237

Query  729   FDALEHEALMALQSMLP-PVYAVGPLQFL--QKQVKDINVRALASSLWKEDTSCLEWLDT  899
             FDALEH+ L +L +ML  PVY++GPLQ L   + + D +V+ ++SSLWKE++ CL+WL+T
Sbjct  238   FDALEHDVLASLSNMLAKPVYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLET  297

Query  900   KAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEET  1079
             K  NSVVYVN+GSITVMT DQL EFAWGLANSKK FLW+IRPDLV GE A+LPPEFV +T
Sbjct  298   KPKNSVVYVNFGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKT  357

Query  1080  KDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSC  1259
             +DRG+L+SWCPQEQVL H +V GFLTHNGWNSTLES+  GVPM+CWPFFAEQQTNCW++C
Sbjct  358   RDRGLLASWCPQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFAC  417

Query  1260  TKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVN  1439
              +WG+GMEI+++V RDEVE  VREL++  KG EM++KA E K++A EA  T   GSS   
Sbjct  418   NEWGVGMEINSDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAV-TGGGGSSFAG  476

Query  1440  IEKFINHLLLSHRK  1481
             ++  I  +LLS  +
Sbjct  477   LDSLIERVLLSSSR  490



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/485 (67%), Positives = 400/485 (82%), Gaps = 7/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL  +++KPH VC+P+PAQGHINPMLKLAK+LH K  FH+TFVNTE+NH+RL ++ GP
Sbjct  1     MGSLGKKENKPHVVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              SL GLPSFRFETIPDGLP S+ D+TQDIPSLCESTS TCL  FK L+++LN+    + P
Sbjct  61    NSLNGLPSFRFETIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNNAI--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CI+ DGVMSFT+DAAEEL IP V+FWTTSACGF+ YM + QL++KG TPLKD SYLT
Sbjct  119   PVTCIIGDGVMSFTIDAAEELNIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLKDSSYLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRLRD+P+F+RTT+P++ +L F L E  RA +ASAIILNTFDAL
Sbjct  179   NGYLETTIDWVPGIKEIRLRDIPTFIRTTDPNDIVLNFALGECQRALKASAIILNTFDAL  238

Query  741   EHEALMALQSM--LPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH  L A  S+  LPPVY++GP+ FL K V D  + ++ S+LWK++T CLEWL +K PNS
Sbjct  239   EHNVLEAFSSIDNLPPVYSIGPINFLLKNVTDEELNSIGSNLWKDETDCLEWLASKEPNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMT DQL EFAWGLANSKK FLW+IRPDLV+G+ A+LP EF+EETK+RG+
Sbjct  299   VVYVNFGSITVMTNDQLVEFAWGLANSKKTFLWVIRPDLVSGKNAVLPQEFLEETKNRGL  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             LSSWCPQE+VLGH ++GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGI
Sbjct  359   LSSWCPQEEVLGHSSIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGI  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             G+EI  +  RD++E +V+ELME EKG+EMK KA+ LK+LA + A     GSS VN++  I
Sbjct  419   GLEI-EDAKRDKIEILVKELMEGEKGKEMKEKALRLKELAHDNAYG-AFGSSLVNLDNMI  476

Query  1455  NHLLL  1469
             +H+LL
Sbjct  477   HHVLL  481



>ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/477 (69%), Positives = 399/477 (84%), Gaps = 3/477 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +K HAVCIPYPAQGHINPMLKLAK L+HKGFHITFVN+E+NHRRL +S GP+SL GL SF
Sbjct  8     EKSHAVCIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLDGLSSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++ DATQDIPSLC ST   CL  FK++L++LNDT  S+ PPVSCI+SDG
Sbjct  68    RFETIPDGLPPTDTDATQDIPSLCVSTKNACLPHFKNVLSKLNDTP-SSVPPVSCIISDG  126

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA+ELGIPEV+FWTTSACGFL Y+HY QL+ KGYTPLKDES LTNGYL+T +D
Sbjct  127   VMSFTLDAAQELGIPEVLFWTTSACGFLAYLHYHQLIKKGYTPLKDESSLTNGYLDTVID  186

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ G K IRL+D+PSF+RTTNP++ ML F++ ET RA++ASAIILNTFDALEH+ L A  
Sbjct  187   WIPGTKDIRLKDIPSFVRTTNPEDIMLNFLVSETERAQKASAIILNTFDALEHDVLAAFP  246

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             S++PPVY+VG LQ L   +KD +++ + S+LWKE+T CLEWLD+K PNSVVYVN+G ITV
Sbjct  247   SLIPPVYSVGSLQLLLNNIKDNDLKLIGSNLWKEETGCLEWLDSKEPNSVVYVNFGCITV  306

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT  QL EFAWGLANS K FLW+IRPDLV G  A LPPEFV  T++RG+L SWCPQEQVL
Sbjct  307   MTSAQLGEFAWGLANSDKTFLWVIRPDLVDGNTAALPPEFVSMTRERGLLPSWCPQEQVL  366

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HP++GGFLTH+GWNSTLESIC GVPM+CWPFFAEQQTNC Y+C +WGIGMEI+++V R+
Sbjct  367   NHPSIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCKYTCNEWGIGMEINSDVKRN  426

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             EVE +V ELM+ +KG+ MK+KAME K++A EA  T   GSS+ N++  I  +LLS +
Sbjct  427   EVESLVIELMDGDKGKAMKKKAMEWKRIAEEAVST--KGSSYQNLDNMIKQVLLSFK  481



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/482 (69%), Positives = 402/482 (83%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL S + KPHAVCIPYPAQGHINPMLKLAK LH +GFHITFVNTE+NH RL +S GP+
Sbjct  1     MGSLASAE-KPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+G+PSF+F+TIPDGLP S  DATQD P+LC ST+  CL PF+DLL+ LN     + PP
Sbjct  60    SLKGIPSFQFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLN----HDGPP  115

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG MSFT+DAA+ELG+PEV+FWTTSACGF+GY+ Y  L+DKG  PLKDESYLTN
Sbjct  116   VTCIVSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTN  175

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMKGIRLRD+PSF+RTT+P++ ML+F L+E  RAR+ASA+I NTFDALE
Sbjct  176   GYLDTVIDWIPGMKGIRLRDIPSFIRTTDPNDIMLEFPLREAERARKASALIFNTFDALE  235

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L AL  M PP+Y +GPL  L  Q++D +++ + S+LWKE+  CLEWLD+K PNSVVY
Sbjct  236   HEVLDALSQMFPPIYTIGPLHKLMSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVY  295

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+TVMT  QL+EFAWGL NS + FLWIIRPDLV+G+AAILPPEFV ETK+RG+L+ 
Sbjct  296   VNFGSVTVMTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAG  355

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPAVGGFLTHNGWNST+ES+  GVPM+CWPFFAEQQTNC Y CT+WGIGME
Sbjct  356   WCPQEQVLSHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGME  415

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDE+E++V+ELME EKG+E+K+KA+E K LA EA    P GSS  N++K I   
Sbjct  416   IDSDVKRDEIERLVKELMEGEKGKELKKKALEWKALAEEATRG-PNGSSFSNLDKMITQA  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/482 (67%), Positives = 394/482 (82%), Gaps = 8/482 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + KPHAVCIP+PAQGHI PML LAK+LH +GFHITFVNTEFNHRRL ++ GP 
Sbjct  1     MGSV---EKKPHAVCIPFPAQGHIKPMLNLAKLLHFRGFHITFVNTEFNHRRLLKARGPN  57

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGL  S+ +ATQDIPSLC ST    L PF+ LL++LN     N PP
Sbjct  58    SLDGLPSFQFETIPDGLQPSDVNATQDIPSLCVSTKNNLLPPFRCLLSKLN----HNGPP  113

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSD  ++ T+DAA+ELGIP ++FWT SACGF+GY HY  L++KG+ PLKD SYLTN
Sbjct  114   VTCIVSDSSLTSTLDAAQELGIPGLLFWTASACGFMGYAHYRTLVNKGFIPLKDASYLTN  173

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMKGIRL+D+PSF+RTT+PD+ ML F + E  RAR+ASAII NTFDALE
Sbjct  174   GYLDTVIDWIPGMKGIRLKDMPSFVRTTDPDDVMLGFAMGEIERARKASAIIFNTFDALE  233

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L A+ +M PP+Y +GP+  L  Q++D +++++ S+LWKED  CL+WLD+K PN+VVY
Sbjct  234   HEVLDAISTMYPPIYTIGPISLLMNQIQDKDLKSIGSNLWKEDEECLQWLDSKGPNTVVY  293

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVM P+ L EFAWGL+NSK+ FLWIIRPDLV+G +AILPPEF+ ETKDRG+L+S
Sbjct  294   VNFGSITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLAS  353

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVLGHPAVGGFLTHNGWNS LES+C GV M+CWPFFAEQQTNC Y CT+WGIGME
Sbjct  354   WCSQEQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGME  413

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID +V RD+VE++VRELME EKG EMK+K ME KK+A EA  T P GSS  N+++ I  L
Sbjct  414   IDGDVKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEAT-TAPSGSSFFNLDRMIKQL  472

Query  1464  LL  1469
             LL
Sbjct  473   LL  474



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 403/487 (83%), Gaps = 6/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +KPHAVCIP+PAQGHINPML +AK+LH KGFHITFVNT+FNH+RL +S G  
Sbjct  1     MGSI-SLAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTQFNHKRLLKSRGSN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP + A+ TQDIPSLC ST  TCL  F++LL++LN +   ++P 
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLNSS--RDSPS  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAA+ELGIPEV+FWTTSACGFL YM + +L++KG TPLKD SYLTN
Sbjct  118   VSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGLTPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IRL+D+PSF+RTT PD+ ML FIL ET RA++ASAIILNTF   E
Sbjct  178   GYLDTVVDWIPGMKDIRLKDIPSFIRTTEPDDQMLDFILVETERAKKASAIILNTFHDFE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              E L AL ++LPPVYA+GPL     Q+  D  ++++ S+LW E+  CLEWLD+K PNSVV
Sbjct  238   REVLDALSTLLPPVYAIGPLNLQISQIPADNELKSIGSNLWTEEPECLEWLDSKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLAN KK FLW+IRPDLV G++A++PP+F+EETKDR +L+
Sbjct  298   YVNFGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPKFLEETKDRSLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC  SC +WGIG+
Sbjct  358   SWCPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRVSCKEWGIGL  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V R  VE +VR+LM+ E+G+EM++KA+E KK A EA  + PIG S+V+++K +N 
Sbjct  418   EIEGDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKSAKEA--SCPIGLSYVDLDKMVNQ  475

Query  1461  LLLSHRK  1481
             +LL+ RK
Sbjct  476   VLLTPRK  482



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/482 (69%), Positives = 401/482 (83%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL S + KPHAVCIPYPAQGHINPMLKLAK LH +GFHITFVNTE+NH RL +S GP+
Sbjct  1     MGSLASAE-KPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+G+PSF+F+TIPDGL  S  DATQDIP+LC ST   CL PF+DLL+ LN     + PP
Sbjct  60    SLKGIPSFQFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLN----HDGPP  115

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG MSFT+DAA+ELG+PEV+FWTTSACGF+GY+ Y  L+DKG  PLKDESYLTN
Sbjct  116   VTCIVSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTN  175

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMKGIRLRD+PSF+RTT+P+E ML+F L+E  RAR+ASA+I NTFDALE
Sbjct  176   GYLDTVIDWIPGMKGIRLRDIPSFIRTTDPNEIMLEFPLREAERARKASALIFNTFDALE  235

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L AL  M PP+Y +GPL  L  Q++D +++ + S+LWKE+  CLEWLD+K PNSVVY
Sbjct  236   HEVLDALSQMFPPIYTIGPLHQLMSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVY  295

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT  QL+EFAWGL NS + FLWIIRPDLV+G+AAILPPEFV ETK+RG+L+ 
Sbjct  296   VNFGSITVMTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAG  355

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPAVGGFLTHNGWNST+ES+  GVPM+CWPFFAEQQTNC Y CT+WGIGME
Sbjct  356   WCPQEQVLSHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGME  415

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V RDE+E++V+ELME EKG+E+K+KA+E K LA EA    P GSS  N++K I   
Sbjct  416   IDSDVKRDEIERLVKELMEGEKGKELKKKALEWKTLAEEATRG-PKGSSFSNLDKMITQA  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/476 (66%), Positives = 397/476 (83%), Gaps = 5/476 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP SL G PSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLC+ST    L  F+DLL++LN +   + PPVSC+VSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLNSSP--DCPPVSCVVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+DAA+ELG+PEV+FWTTSACGFL Y+HY +L++KG TPLKD SYLTNGYLETE+D
Sbjct  126   AMGFTLDAAQELGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA+I NTF   EHE L AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLNALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVEETK+R +L++WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +W IGMEI+++V R
Sbjct  366   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             + VE +VR+LME ++G+EM++KA+E KKLA EA    P GSS V ++K +N +LLS
Sbjct  426   NYVEGLVRKLMEGDEGKEMRKKALEWKKLATEAIS--PNGSSFVGLDKMVNQVLLS  479



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/487 (67%), Positives = 405/487 (83%), Gaps = 8/487 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS++  + KPHAVCIPYPAQGHINPMLKLAK+LH+KGFH+TFV+TE+N RR+ +S GP+
Sbjct  1     MGSIKVVE-KPHAVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVHTEYNLRRMVKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS-NAP  380
             S++GLP FRFETIPDGLP S+ DATQDIPSLC+ST  TCL PF  LL+RLND++ S N P
Sbjct  60    SIKGLPGFRFETIPDGLPPSDVDATQDIPSLCDSTRNTCLVPFXSLLSRLNDSSNSDNIP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              V+CIVSDGVMSFT+DAA+ELGIPEV+ W TSAC F+ ++HYS L+++G TPL+DESYLT
Sbjct  120   LVTCIVSDGVMSFTLDAAQELGIPEVLLWPTSACSFMSFLHYSHLIERGLTPLRDESYLT  179

Query  561   NGYLETELDWVKGM-KGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             NGYL+T +DW+ G+ K IRLRDLPSF+RTT+P + ML F+  E  R++RA AIILNTFDA
Sbjct  180   NGYLDTTIDWIPGLIKDIRLRDLPSFIRTTDPHDIMLNFLKGEAXRSKRAQAIILNTFDA  239

Query  738   LEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             LE + L AL SM P VY++GPL  L  Q+ D  + ++ S+LW+E+  CLEWLD++ PNSV
Sbjct  240   LEQDVLDALSSMFPRVYSIGPLPLLHDQISDNGLESIGSNLWQEELGCLEWLDSQKPNSV  299

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL EFAWGLANS + FLW+IRPDLV G++A+LPPEF+ +TK+R +L
Sbjct  300   VYVNFGSITVMTREQLVEFAWGLANSNQTFLWVIRPDLVVGDSALLPPEFIRDTKERSLL  359

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQ+QVL HP+VGGFLTHNGWNST+ESIC+GVPM+CWPFFA+QQT C Y+CT+WG+G
Sbjct  360   ASWCPQKQVLNHPSVGGFLTHNGWNSTVESICSGVPMICWPFFADQQTICRYACTEWGVG  419

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAA--DTIPIGSSHVNIEKF  1451
             MEID+NV RDEVE ++RELME EKG+EMK KAME K+ A EAA     P   SH N++K 
Sbjct  420   MEIDSNVKRDEVESLIRELMEGEKGKEMKYKAMEWKRRAEEAAYQGGXP---SHTNLDKM  476

Query  1452  INHLLLS  1472
             IN +LLS
Sbjct  477   INEVLLS  483



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/487 (67%), Positives = 405/487 (83%), Gaps = 8/487 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + +PHAVCIPYPAQGHINPMLKLAK+LH  GFHITFVNT+FNHRRL +S GP+
Sbjct  1     MGSISISEQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPK  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GL SFRFE+IPDGLP ++ DATQDIPSLC+ST   CL PFK+L+++LN     N P 
Sbjct  61    ALDGLSSFRFESIPDGLPPTDVDATQDIPSLCQSTRQFCLQPFKELVSKLN--CDPNVPQ  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAA+ELG+P V+FWTTSACGFLGY+HY QL+++GYTP KDESYL+N
Sbjct  119   VSCIVSDGVMSFTIDAADELGVPVVLFWTTSACGFLGYLHYQQLVERGYTPFKDESYLSN  178

Query  564   G-YLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               YL+T++DW+ GMK +R+RD+P+F+RTT+P + M+ FIL ET RA+RA+AI+LNT D+L
Sbjct  179   KQYLDTKIDWIPGMKDVRIRDIPTFIRTTDPKDVMVDFILGETKRAKRANAIVLNTVDSL  238

Query  741   EHEALMALQSMLPP-VYAVGPLQFLQKQVKDIN---VRALASSLWKEDTSCLEWLDTKAP  908
             E EAL A+ S+LPP V+++GPLQ L KQV   +   +++L S+LWKEDTSCL+WLD  + 
Sbjct  239   EQEALNAMPSLLPPPVFSIGPLQLLLKQVASHDSDSLKSLGSNLWKEDTSCLQWLDQMSA  298

Query  909   NSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDR  1088
             NSVVYVN+GSITVMT DQL EFAWGLANS + FLWIIRPDLV G+ A+LPPEF++ TK+R
Sbjct  299   NSVVYVNFGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDMTKER  358

Query  1089  GMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKW  1268
             GML++WCPQE+VL HPA+GGFLTHNGWNST ESI  GVPM+CWPFFAEQQTNC Y CT+W
Sbjct  359   GMLTNWCPQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEW  418

Query  1269  GIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEK  1448
             GIGMEID++V R+E+EK VRELME +KG+EM+++A E KKL  +AA+    GSS  N+  
Sbjct  419   GIGMEIDSDVKREEIEKQVRELMEGDKGKEMRKRAQEWKKLMADAAEPHS-GSSFRNLNH  477

Query  1449  FINHLLL  1469
              ++ +LL
Sbjct  478   LVHKVLL  484



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/488 (70%), Positives = 407/488 (83%), Gaps = 4/488 (1%)
 Frame = +3

Query  24    MGSLRSEQ-DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             M S+ +E  DKPHAVC+PYPAQGHI+PMLKLAKIL+HKGFHITFVNTE N +RL +S GP
Sbjct  1     MCSINAENSDKPHAVCLPYPAQGHISPMLKLAKILNHKGFHITFVNTEHNQKRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             + L+ LPSFRFE IPDGLP  +ADATQDI +LC+ST  TCLGPF++LLA+LN+T  S  P
Sbjct  61    DGLKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVP  120

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG +SFT+ AA+ELGIP+V FWT +ACG L YMHY  L+DKGY PLKDESYLT
Sbjct  121   PVSCIVSDGSISFTLTAAQELGIPQVFFWTFAACGTLSYMHYCNLVDKGYIPLKDESYLT  180

Query  561   NGYLE-TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARR-ASAIILNTFD  734
             NGYLE T LDW+ GMK +RL+DLPSFLRT NPD++ML FI++ET R+++ ASAI++N+F+
Sbjct  181   NGYLEKTTLDWIPGMKDVRLKDLPSFLRTANPDDFMLNFIIRETERSKKYASAIVVNSFE  240

Query  735   ALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             ALE E L +LQ+++PPVY +GPL  L K V D N+  L S+LWKE+  CLEWLD+K PNS
Sbjct  241   ALEKEVLESLQTLVPPVYVIGPLNLLVKHVDDKNLADLGSNLWKEEPKCLEWLDSKKPNS  300

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMT + L EFAWGLANS+  FLWIIRPD+V GE AILPPEFVEETK+RGM
Sbjct  301   VVYVNFGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEQAILPPEFVEETKERGM  360

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWC QE+VL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQ TNCW+ CTK GI
Sbjct  361   LASWCQQEKVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQPTNCWFCCTKLGI  420

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEI+NNV R EVE +VRELM  EKG+EMK+KAME K LA EAA   P GSS+VNI+K I
Sbjct  421   GMEINNNVKRGEVEALVRELMTGEKGKEMKKKAMEWKILAEEAAAK-PAGSSYVNIDKLI  479

Query  1455  NHLLLSHR  1478
             N +LLS +
Sbjct  480   NEILLSPK  487



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/479 (67%), Positives = 394/479 (82%), Gaps = 4/479 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS    Q  PHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSTDMTQ-MPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAP  380
             SL GLPSFRF TIPDGLP S+ADATQD+P+LC+ST  +CL  F+DLL +LN+ +A+S +P
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGSP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSC+VSDGVMSFT+DAAE + +PEV+FWTTS CGF+GY+ Y  L+D+G  PLKD SYLT
Sbjct  120   PVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYLT  179

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYL+T +DW+ GM  IRLRDLPSF+RTT+PD+ M+ F L ET RA+RASAI+ NTFD L
Sbjct  180   NGYLDTAVDWIPGMTNIRLRDLPSFIRTTDPDDPMVDFCLVETERAKRASAIVFNTFDQL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EHE L AL++MLPP+Y +GPL  L +Q+   + R++ S+LWKED  CLEWLD K+P+SVV
Sbjct  240   EHEVLDALKAMLPPIYTLGPLHLLTEQLPSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+TVM+P QL EFAWGLANS + FLW+IRPDLV G+ AILPPEF   T++R +L+
Sbjct  300   YVNFGSVTVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQ QVL H A+GGFLTH+GWNST+ESI  GVP++CWPFFAEQQ NC YSC +WGIGM
Sbjct  360   SWCPQVQVLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             EID +V RDEVE+ VRELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+
Sbjct  420   EIDGDVKRDEVERQVRELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVID  476



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 392/479 (82%), Gaps = 5/479 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSF+
Sbjct  9     KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFQ  68

Query  231   FETIPDGLPLSEA--DATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVS  401
             F TIPDGLP S+A  D TQD  +LC+STS  CL  F+DLL RLN+ +A S +PPVSC+VS
Sbjct  69    FRTIPDGLPPSDAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESATSGSPPVSCVVS  128

Query  402   DGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETE  581
             DG M+FT+DAAE +G+PEV+ WT SAC F+GY+ Y  L+DKG  PLKD SYLTNGYL+T 
Sbjct  129   DGAMTFTLDAAEAIGVPEVLLWTASACSFMGYVQYRSLIDKGLAPLKDASYLTNGYLDTT  188

Query  582   LDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMA  761
             +DW+ GM+ IRLRDLPSF++TT+P++ M+ F L+E  RA+RASAI+ NTFD LEHE L A
Sbjct  189   IDWIPGMRNIRLRDLPSFIQTTDPNDLMIPFCLREIERAKRASAIVFNTFDRLEHEVLDA  248

Query  762   LQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
             L++M PP+Y VGPL  L KQ+ D N +   S+LWKE+  C+EWLD+K P SV+YVN+GSI
Sbjct  249   LKAMFPPIYTVGPLHLLTKQLSDNNTKPFGSNLWKEEPGCIEWLDSKQPGSVMYVNFGSI  308

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TVM+P QL EFAWGLANS + FLW+IRPDLV G+AA+LPP+F+  T++R +L SWCPQE+
Sbjct  309   TVMSPVQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQER  368

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL H AVGGFLTHNGWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEIDNNV 
Sbjct  369   VLSHSAVGGFLTHNGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDNNVK  428

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             R+EVE+ V+ELME EKG++MKRKAME K++A EA  T P GSS +N+++ IN +LLS R
Sbjct  429   RNEVERQVKELMEGEKGKQMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSTR  485



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/479 (66%), Positives = 396/479 (83%), Gaps = 5/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINP+LKLAK+LH+KGFHITFVNTEFNH+RL +S GP SL G PSF
Sbjct  8     EKPHAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLC+ST    L  F+DLL++LN +   + PPVSC+VSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSP--DCPPVSCVVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+DAA+E G+PEV+FWTTSACGFL Y+HY + ++KG TPLKD SYLTNGYLETE+D
Sbjct  126   AMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA+I NTF   EHE L AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLA+S + F W+IRPDLV G++A++PPEFVEETK+R +L+ WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R
Sbjct  366   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + +E +VR+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  426   NYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/482 (67%), Positives = 395/482 (82%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL + + KPHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVN+E+N +RL +S G  
Sbjct  1     MGSLGTTK-KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL  L SFRFETIPDGLP S+ DATQDIPSLCEST  TCL  F+ LLA+LN+   S+ PP
Sbjct  60    SLHALSSFRFETIPDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNN---SDGPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+DAA+ELG+PEV+FWTTSACGF+ Y+ Y QL  KG TPLKD S +T+
Sbjct  117   VSCIVSDGVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSLVTS  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G++ IRL+D+PSF+RTT+ D+ ML F+  E  RARRASAIILNTFD LE
Sbjct  177   GYLETTIDWIPGIEKIRLKDIPSFIRTTDSDDIMLDFVQWECKRARRASAIILNTFDTLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  S+LPPVY++GPL  L K V +  + A+ S+LWKE++ C+EWL+TK PNSVVY
Sbjct  237   HDVLKAFSSILPPVYSIGPLNLLVKNVDNKALNAIESNLWKEESECMEWLNTKEPNSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT +QL EFAWGL NS K FLW+IRPDLV GE AILPPEFV++TK+RG+LSS
Sbjct  297   VNFGSITVMTSEQLVEFAWGLGNSNKSFLWVIRPDLVAGENAILPPEFVKQTKNRGLLSS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGME
Sbjct  357   WCSQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V RD++E +V+ELM+ EKG++MK KA++ KKLA  AA   P G+S +N++  ++ +
Sbjct  417   I-EDVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKTAASG-PYGTSFLNLDNMVHEV  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/482 (68%), Positives = 404/482 (84%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL +  +KPHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL ++ GP+
Sbjct  1     MGSLGT-INKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL SFRFETIPDGLP ++ DATQDIPSLCE+T  TC   FK+LLA++ND   S+APP
Sbjct  60    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKIND---SDAPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+DAAEELG+PEV+FWTTSACGF+ Y+ Y QL++K  TPLKD SY+TN
Sbjct  117   VSCIVSDGVMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K IRL+D+PSF+RTTNPDE+ML FI  E GRARRASAIILNTFDALE
Sbjct  177   GYLETTIDWIPGIKEIRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  S+LPPVY++GPL    K V D  + A+ S+LWKE++ C+EWLDTK P+SVVY
Sbjct  237   HDVLEAFSSILPPVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI VMT +QLSEFAWGLANS K FLW+IR DLV GE A+LPPEFV++T++RG+LSS
Sbjct  297   VNFGSIAVMTSEQLSEFAWGLANSNKNFLWVIRADLVAGENAVLPPEFVKQTENRGLLSS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HP+VGGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C  WGIG+E
Sbjct  357   WCSQEQVLAHPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLE  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V R+++E +VRELM+ EKG+EMK+KA++ K+LA E+A    +GSS  N++  +  +
Sbjct  417   I-EDVEREKIESLVRELMDGEKGKEMKKKALQWKELA-ESAAFRSVGSSFANLDNMVRDV  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/481 (66%), Positives = 393/481 (82%), Gaps = 6/481 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSF+
Sbjct  9     KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFQ  68

Query  231   FETIPDGLPLSEA--DATQDIPSLCESTSATCLGPFKDLLARLNDTAV--SNAPPVSCIV  398
             F TIPDGLP S+A  DATQD  +LC+STS  CL  F+DLL RLN+ +   S +PPVSC+V
Sbjct  69    FRTIPDGLPPSDAASDATQDTLALCQSTSKFCLPYFRDLLQRLNEESATTSGSPPVSCVV  128

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             SDG M+FT+DAAE + +PEV+ WT SAC F+GY+ Y  L+DKG TPLKD SYLTNGYL+T
Sbjct  129   SDGAMTFTLDAAEAINVPEVLLWTASACSFMGYVQYRSLIDKGLTPLKDASYLTNGYLDT  188

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
              +DW+ GM+ IRLRDLPSF++TT+P++ M+ F L+E  RA+RASAI+ NTFD LEHE L 
Sbjct  189   TIDWIPGMRNIRLRDLPSFIQTTDPNDLMIPFCLREIERAKRASAIVFNTFDRLEHEVLD  248

Query  759   ALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             AL++M PP+Y +GPL  L KQ+ D N R   S+LWKE+  C+EWLD+K P+SVVYVN+GS
Sbjct  249   ALKAMFPPIYTLGPLHLLTKQLSDNNTRPFGSNLWKEEPGCIEWLDSKQPSSVVYVNFGS  308

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITVM+P QL EFAWGLANS + FLW+IRPDLV G+AA+LPP+F+  T++R +L SWCPQE
Sbjct  309   ITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQE  368

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VLGH AVGGFLTH+GWNST+ESI  GVP++CWPFF +QQTNCWYSC +W IGMEID++V
Sbjct  369   RVLGHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWRIGMEIDSDV  428

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              R+EVE+ V+ELME EKG++MKRKAME K++A EA  T P G S +N+++ IN +LLS R
Sbjct  429   KRNEVERQVKELMEGEKGKQMKRKAMEWKEMAREA--TRPFGPSFLNLDEVINKVLLSPR  486

Query  1479  K  1481
             +
Sbjct  487   R  487



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 395/483 (82%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL   ++  H VCIP+PAQGHINPMLKLAK+LH KG FH+TFVNTE+NH+RL ++ GP
Sbjct  1     MGSLDITKNLSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              SL GLPSFRFETIPDGLP S+ D TQDIPSLCEST ATC   FK LL++LN+    + P
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAI--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG MSFT+DAA+EL IPEV+FWTTSACGF+ YM Y +L+++G TPLKD SY+T
Sbjct  119   PVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYIT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRL+D+PSF+RTTNP++ ML F+  E  RA++ASAII NTFD L
Sbjct  179   NGYLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+LPPVY++GPL  L K V +  + ++ S+LWKE+  CLEWL++K PNSVV
Sbjct  239   EHDVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +Q+ EFAWGL+NSK PFLW+IRPDLV GE A+LP EF+EETK+RG+LS
Sbjct  299   YVNFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLS  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VLGH ++GGFLTHNGWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+
Sbjct  359   SWCPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD++E +V+ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ 
Sbjct  419   EI-EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHD  476

Query  1461  LLL  1469
             +LL
Sbjct  477   VLL  479



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/477 (67%), Positives = 385/477 (81%), Gaps = 4/477 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+PYPAQGHINPMLK+AK+LH +GFH+TFVNTEFNHRRL RS GP +L  LPSFR
Sbjct  11    KPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTEFNHRRLLRSRGPHALDKLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP +E DATQDIP+LC+ST   CL PFK+LL R+N  A    PPVSC+VSDG 
Sbjct  71    FETIPDGLPETEVDATQDIPALCDSTRKNCLAPFKELLRRIN-LAGGEIPPVSCVVSDGC  129

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWTTSACGF  Y+HY QL++KG  PLKDESYLTNGYL+TE+DW
Sbjct  130   MSFTLDAAEELGVPEVLFWTTSACGFWAYLHYYQLVEKGLVPLKDESYLTNGYLDTEIDW  189

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             V  +K  RL+D P+F+RTTN D+ ML+F+++ET RA+RASAIILNTF  LEH+ + ++QS
Sbjct  190   VPSLKNFRLKDFPTFVRTTNTDDVMLRFVIRETHRAKRASAIILNTFHDLEHDVIRSMQS  249

Query  771   MLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPV+ VGPL  L  +   KD  +  L S+LWKEDT CL WLD KAPNSVVYVN+GSIT
Sbjct  250   ILPPVHPVGPLHLLVNREIDKDSEIGRLGSNLWKEDTECLAWLDAKAPNSVVYVNFGSIT  309

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VM+  QL EFAWGLA S+K FLW+IRPDLV G+AA++PPEF+ ET DRGML++WCPQE+V
Sbjct  310   VMSEKQLVEFAWGLAGSRKEFLWVIRPDLVGGDAAVVPPEFMAETADRGMLANWCPQEEV  369

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTHNGWNST+ESI  GVPM+CWPFFAEQQ NC + C +WG G EI  +V R
Sbjct  370   LSHPAVGGFLTHNGWNSTIESISGGVPMICWPFFAEQQMNCKFCCDEWGTGKEIGGDVKR  429

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  1475
              EVE VVRELM+ E G++M+ KA E ++ A EA+   P GSS VN E  ++ +LL H
Sbjct  430   GEVEAVVRELMDGEMGKKMRNKAEEWRRSA-EASVAAPSGSSFVNFEAVVDRVLLGH  485



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 401/487 (82%), Gaps = 5/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S  +KPHAVCIP+PAQGHINPML +AK+LH KGFHITFVNTEFNH+RL +S G  
Sbjct  1     MGSI-SFAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP + A+ TQDIPSLC ST  TCL  F++LL++LN +   ++PP
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSP--DSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAA+ELGIPEV+FWTTSACG L YM + +L++KG TP KD SYLTN
Sbjct  118   VSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGLLAYMQFYRLIEKGLTPHKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IRL+D+PSF+RTT PD+ ML FIL ET RA++ASAIILNTF   E
Sbjct  178   GYLDTVIDWLPGMKDIRLKDIPSFIRTTEPDDQMLDFILVETERAKKASAIILNTFHDFE  237

Query  744   HEALMALQSMLPPVYAVGPLQF-LQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              E L AL ++LPPVY++GPL   + +   D  ++++ S+LW E+  CLEWLDTK PNSVV
Sbjct  238   REVLNALSTLLPPVYSIGPLNLQIGQNPVDKELKSIGSNLWTEEPECLEWLDTKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLAN KK FLW+IRPDLV G++A++PPEFVEETKDR +L+
Sbjct  298   YVNFGSITVMTNEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPEFVEETKDRSLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +WGIG+
Sbjct  358   SWCPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCKEWGIGL  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V R  VE +VR+LM+ E+G+EM++K++E KK A EA+   P G S V+++K +N 
Sbjct  418   EIEGDVKRKYVEGLVRKLMDGEEGKEMRKKSLEWKKSAKEASSG-PNGLSFVDLDKMVNQ  476

Query  1461  LLLSHRK  1481
             +LL+ RK
Sbjct  477   VLLTPRK  483



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/487 (66%), Positives = 403/487 (83%), Gaps = 5/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHI PML+LAK+LH+KGFHITFV+TEFNHRRL +S GP 
Sbjct  1     MGSI-DLTEKPHAVCIPYPAQGHITPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP ++ +ATQDI +LC STS  CL PF+DLL+++N  +V ++PP
Sbjct  60    SLDGLPSFQFETIPDGLPPTDPNATQDITALCLSTSKNCLAPFRDLLSKVN--SVPDSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG M+FT+DAA+ELGIPEV+F T SACG + Y+ Y  L++KG  P KD SYLTN
Sbjct  118   VTCIVSDGGMTFTLDAAQELGIPEVIFETLSACGLMCYLQYRPLIEKGLMPPKDPSYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+TE+DW+ GM+GIRLRD+PSF+RTT+P+++ML ++L E  RA+RASAIILNTFDAL+
Sbjct  178   GYLDTEIDWIPGMRGIRLRDIPSFIRTTDPNDFMLDYLLVEIARAKRASAIILNTFDALD  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE L  L ++LPPVY+VGPL     Q+  D  ++++ S+LW E+  CLEWLD+K PNSVV
Sbjct  238   HEVLHGLSTLLPPVYSVGPLHLQLNQIPADNKLKSIGSNLWTEEPECLEWLDSKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EF+WGLANS + F W+IRPDLV GEAA++PPEF++ETK+RG+L+
Sbjct  298   YVNFGSITVMTAEQLIEFSWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQ  NC + C +WGIGM
Sbjct  358   SWCPQEQVLSHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V R+ VE++VR+LME E+G+EM+RKA+E KKLA EA  T P G S V +EK +N 
Sbjct  418   EIEGDVKRNYVEELVRKLMEGEEGKEMRRKALEWKKLAKEAT-TGPNGLSFVGLEKLVNQ  476

Query  1461  LLLSHRK  1481
             +LLS R 
Sbjct  477   VLLSPRN  483



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/482 (68%), Positives = 403/482 (84%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL +  +KPHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL ++ GP+
Sbjct  1     MGSLGT-INKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL SFRFETIPDGLP ++ DATQDIPSLCE+T  TC   FK+LLA++ND   S+APP
Sbjct  60    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKIND---SDAPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+DAAEELG+PEV+FWTTSACGF+ Y+ Y QL++K  TPLKD SY+TN
Sbjct  117   VSCIVSDGVMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K IRL+D+PSF+RTTNPDE+ML FI  E GRARRASAIILNTFDALE
Sbjct  177   GYLETTIDWIPGIKEIRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  S+LPPVY++GPL    K V D  + A+ S+LWKE++ C+EWLDTK P+SVVY
Sbjct  237   HDVLEAFSSILPPVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI VMT +QL EFAWGLANS K FLW+IR DLV GE A+LPPEFV++T++RG+LSS
Sbjct  297   VNFGSIAVMTSEQLIEFAWGLANSNKNFLWVIRADLVAGENAVLPPEFVKQTENRGLLSS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HP+VGGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C  WGIG+E
Sbjct  357   WCSQEQVLAHPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLE  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V R+++E +VRELM+ EKG+EMK+KA++ K+LA E+A    +GSS  N++  +  +
Sbjct  417   I-EDVEREKIESLVRELMDGEKGKEMKKKALQWKELA-ESAAFRSVGSSFANLDNMVRDV  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/483 (66%), Positives = 394/483 (82%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL   ++  H VCIP+PAQGHINPMLKLAK+LH KG FH+TFVNTE+NH+RL ++ GP
Sbjct  1     MGSLDITKNLSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              SL GLPSFRFETIPDGLP S+ D TQDIPSLCEST ATC   FK LL++LN+    + P
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAI--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG MSFT+DAA+EL IPEV+FWTTSACGF+ YM Y +L+++G TPLKD SY+T
Sbjct  119   PVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYIT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRL+D+PSF+RTTNP++ ML F+  E  RA++ASAII NTFD L
Sbjct  179   NGYLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+LPPVY++GPL  L K V +  + ++ S+LWKE+  CLEWL++K PNSVV
Sbjct  239   EHDVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +Q+ EFAWGL+NSK PFLW+IRPDLV GE A+LP EF+EETK+RG+LS
Sbjct  299   YVNFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLS  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VLGH ++GGFLTHN WNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+
Sbjct  359   SWCPQEEVLGHSSIGGFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD++E +V+ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ 
Sbjct  419   EI-EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHD  476

Query  1461  LLL  1469
             +LL
Sbjct  477   VLL  479



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/483 (66%), Positives = 394/483 (82%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL   ++  H VCIP+PAQGHINPMLKLAK+LH KG FH+TFVNTE+NH+RL ++ GP
Sbjct  1     MGSLDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              SL GLPSFRFETIPDGLP S+ D TQDIPSLCEST ATC   FK LL++LN+    + P
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAI--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG MSFT+DAA+EL IPEV+FWTTSACGF+ YM Y +L+++G TPLKD SY+T
Sbjct  119   PVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYIT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRL+D+PSF+RTTNP++ ML F+  E  RA++ASAII NTFD L
Sbjct  179   NGYLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+LPPVY++GPL  L K V +  + ++ S+LWKE+  CLEWL++K PNSVV
Sbjct  239   EHDVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +Q+ EFAWGL+NSK PFLW+IRPDLV GE A+LP EF+EET++RG+LS
Sbjct  299   YVNFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLS  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VLGH ++GGFLTHNGWNSTLES+C GVPM+CWPFF EQQTNC + C +WGIG+
Sbjct  359   SWCPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD++E +V+ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ 
Sbjct  419   EI-EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHD  476

Query  1461  LLL  1469
             +LL
Sbjct  477   VLL  479



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/494 (66%), Positives = 400/494 (81%), Gaps = 12/494 (2%)
 Frame = +3

Query  24    MGSL-RSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS+  SE+ KPHAVCIPYPAQGH  PMLKLAK+LHH+GFH+TFVNTE+NH RL++S   
Sbjct  1     MGSMGHSEKPKPHAVCIPYPAQGHKTPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV--SN  374
             +++  LPSFRF TIPDGLP +++D TQDIPSLCEST  TCL  FK+LLA+LND A     
Sbjct  58    QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPVSC+VSDGVMSFT+DAAEELG+PEV+FWTTSACGFLGYMHY  L+D+G  PLKDESY
Sbjct  118   VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRAR--RASAIILNT  728
             LTNGYL+T +DW+  M  I+L+DLP+FLRTTNP E+M +F+  ET R+R    +AIILNT
Sbjct  178   LTNGYLDTVIDWIPAMSNIKLKDLPTFLRTTNPAEFMAEFVPGETERSRSQNPAAIILNT  237

Query  729   FDALEHEALMALQSMLP-PVYAVGPLQFL--QKQVKDINVRALASSLWKEDTSCLEWLDT  899
             FDALEH+ L +L +ML  PVY++GPLQ L   + + D +V+ ++SSLWKE++ CL+WL+T
Sbjct  238   FDALEHDVLASLSNMLAKPVYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLET  297

Query  900   KAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEET  1079
             K  NSVVYVN+GSITVMT DQL EFAWGLANSKK FLW+IRPDLV GE A+LPPEFV +T
Sbjct  298   KPKNSVVYVNFGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKT  357

Query  1080  KDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSC  1259
             +DRG+L+SWCPQEQVL H +V GFLTHNGWNSTLES+  GVPM+CWPFFAEQQTNCW++C
Sbjct  358   RDRGLLASWCPQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFAC  417

Query  1260  TKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVN  1439
              +WG+GMEI+++V RDEVE  VREL++  KG EM++KA E K++A EA  T   GSS   
Sbjct  418   NEWGVGMEINSDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAV-TGGGGSSFAG  476

Query  1440  IEKFINHLLLSHRK  1481
             ++  I  +LLS  +
Sbjct  477   LDSLIERVLLSSSR  490



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/483 (67%), Positives = 387/483 (80%), Gaps = 4/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL +   KPH VCIPYPAQGHINPMLKLAK+LH KG FH+TFVNTE+NH+RL +S GP
Sbjct  1     MGSLGTAAKKPHVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +SL GLPSFRFETIPDGLP ++ D TQDIPSLC ST  TCL  FK LL++LND + S+ P
Sbjct  61    DSLNGLPSFRFETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVS-SDVP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG MSFT+DAA EL IPEV+FWTTSACGF+GY+ Y +L++KG  PLKD S +T
Sbjct  120   PVTCIVSDGCMSFTLDAAIELNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLKDSSDIT  179

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET ++W+ GMK IRL+DLPSFLRTT+P++ ML F+  E  RA +ASAIILNTFDAL
Sbjct  180   NGYLETTIEWLPGMKNIRLKDLPSFLRTTDPNDKMLDFLTGECQRALKASAIILNTFDAL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+LPPVY++GPL  L K V D N+ +L S+LWKED+ CL+WLDTK PNSVV
Sbjct  240   EHDVLEAFSSILPPVYSIGPLHLLIKDVTDKNLNSLGSNLWKEDSECLKWLDTKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSI VMT +Q+ EFAWGLANS K FLW+IRPDLV G+ A+LP EFV  T DRG LS
Sbjct  300   YVNFGSIAVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGKHAVLPEEFVAATNDRGRLS  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SW PQE VL HPA+GGFLTH+GWNSTLESIC GVPM+CWPFFAEQQTNC Y C +WGIG+
Sbjct  360   SWTPQEDVLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGL  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD VE +VRELM+ EKG+ MK  A++ KKLA ++A   P GSS VN+E     
Sbjct  420   EI-EDAKRDRVESLVRELMDGEKGKLMKENALKWKKLAHDSA-VGPKGSSFVNLENMFRG  477

Query  1461  LLL  1469
             +LL
Sbjct  478   VLL  480



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/476 (66%), Positives = 394/476 (83%), Gaps = 5/476 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHI+PMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP SL G PSF
Sbjct  8     EKPHAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A ATQDIPSLC+ST    L  F++LL++LN +   + PPVSC+VSDG
Sbjct  68    RFETIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSKLNSSP--DCPPVSCVVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+DAA+E G+PEV+FWTTSACGFL Y+HY + ++KG TPLKD SYLTNGYLETE+D
Sbjct  126   AMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F++ ET R R+ASA+ILNTF   EHE L AL 
Sbjct  186   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFLVHETERTRKASAVILNTFHDFEHEVLDALS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVEETK+R +L++WCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L H AVGGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTN  YS  +WGIGMEI+ +V R
Sbjct  366   LSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIERDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             + +E +VR+LME ++G+EM++KA+E KKLA EA  T P GSS V ++K +N +LLS
Sbjct  426   NYIEGLVRKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFVGLDKMVNQVLLS  479



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/478 (66%), Positives = 394/478 (82%), Gaps = 4/478 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIPYPAQGHI PML+L K+LH+KGFHITFVNTEFNHRRL +S GP SL GLPSFR
Sbjct  9     KPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP ++ +ATQD+ +LC STS  CL PF+DLL++LN  ++ ++PPV+CIVSDG 
Sbjct  69    FETIPDGLPPTDINATQDVTALCVSTSKNCLAPFRDLLSKLN--SLPDSPPVTCIVSDGG  126

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             M+FT+DAA+ELGIPEV+  T SACGF+ Y+    L++KG  PL+D SYLTNGYL+TE+DW
Sbjct  127   MTFTLDAAQELGIPEVILQTLSACGFMCYLQCRPLIEKGLIPLRDASYLTNGYLDTEIDW  186

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GM+GIRLRD+PSF+R T+P+++ML FIL E  RA+RASAIILNTFDALEHE L  L +
Sbjct  187   IPGMRGIRLRDIPSFIRITDPNDFMLDFILVEIARAKRASAIILNTFDALEHEVLDGLST  246

Query  771   MLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +LPPVY+VGPL      +  D  ++++ S+LW E+  CL+WLD+K PNSVVYVN+GSITV
Sbjct  247   LLPPVYSVGPLHLQLNHIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYVNFGSITV  306

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT +QL EFAWGLANS + F W++RPDLV GEAA++PPEF+EETK+RG+L+SWCPQEQVL
Sbjct  307   MTAEQLIEFAWGLANSNQTFFWVVRPDLVGGEAAVVPPEFMEETKERGLLASWCPQEQVL  366

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H AVGGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGMEI+ +V R+
Sbjct  367   SHAAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCREWGIGMEIEGDVKRN  426

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
              VE +VR+LM  E+G+EM++KA+E KKLA EA  T P G S V ++K +N +LLS R 
Sbjct  427   YVEGLVRKLMAGEEGKEMRKKALEWKKLAKEAT-TGPNGFSFVGLDKLVNQMLLSTRN  483



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/479 (65%), Positives = 393/479 (82%), Gaps = 4/479 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSF+
Sbjct  9     KPHVVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSLDGLPSFQ  68

Query  231   FETIPDGLPLSEA-DATQDIPSLCESTSATCLGPFKDLLARLNDTAVS-NAPPVSCIVSD  404
             F TIPDGLP S+A DATQDIP+LC+STS  CL  F+DLL RLN+ + +  +P VSC+VSD
Sbjct  69    FRTIPDGLPPSDATDATQDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPLVSCVVSD  128

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G M+FT+DAAE +G+PEV+ WT SAC F+GY+ Y  L+DKG TPLKD +Y TNG L+T +
Sbjct  129   GGMTFTLDAAEAIGVPEVLIWTASACSFMGYVQYRSLIDKGLTPLKDANYFTNGCLDTTI  188

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+ GM+ IRLRDLP+F++TT+PD+ M+ F L+E  RA+RASAI+ NTFD LEHE L AL
Sbjct  189   DWIPGMRNIRLRDLPTFIQTTDPDDLMIPFCLREVERAKRASAIVFNTFDRLEHEVLDAL  248

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++M PP+Y +GPL  L KQ+ D N R   S+LWKE+  C+EWLD+K P+SVVYVN+GSIT
Sbjct  249   KAMFPPIYTLGPLHLLTKQLSDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VM+P QL EFAWGLANS + FLW+IRPDLV G+AA+LPP+F+  T++R +L+SWCPQE+V
Sbjct  309   VMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L H AVGGFLTH+GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID++V R
Sbjct  369   LSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             +EVE+ V+ELME EKG+ MKRKAME K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  429   NEVERQVKELMEGEKGKHMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  485



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/479 (66%), Positives = 397/479 (83%), Gaps = 4/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGH+ PML+LAK+LH+KGFHITFV+TEFNHRRL +S GP SL GLP F
Sbjct  8     EKPHAVCIPYPAQGHVTPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPNSLDGLPFF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDI +LC STS  CL PF+DLL+++N  +V ++PPV+ IVSDG
Sbjct  68    RFETIPDGLPPTDANATQDITALCLSTSKNCLAPFRDLLSKVN--SVPDSPPVTSIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M+FT+DAA+ELGIPEV+  T SACG + Y+ Y  L++KG  PLKD SYLTNGYL+TE+D
Sbjct  126   GMTFTLDAAQELGIPEVILETLSACGLMCYLQYRPLIEKGLMPLKDPSYLTNGYLDTEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRLRD+PSF+RTT+P+++ML ++L E  RA+RASAIILNTFDAL+HE L  L 
Sbjct  186   WIPGMRGIRLRDIPSFIRTTDPNDFMLDYLLVEIARAKRASAIILNTFDALDHEVLHGLS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPPVY+VGPL     Q+  D  ++++ S+LW E+  CLEWLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPVYSVGPLHLQLNQIPADDKLKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV GEAA++PPEF++ETK+RG+L+SWCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNSTLES+C GVPM+CWPFFAEQ  NC + C +WGIGMEI+ +V R
Sbjct  366   LSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIEGDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + VE +VR+LME E+G+EM++KA+E KKLA EA  T P G S V ++K +N +LLS R 
Sbjct  426   NYVEGLVRKLMEGEEGKEMRKKALEWKKLAKEAT-TGPNGLSFVCLDKLVNQVLLSPRN  483



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/479 (65%), Positives = 393/479 (82%), Gaps = 4/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHI PML+L K+LH+KGFHITFVNTEFNHRRL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++ +ATQD+ +LC ST   CL PF+DLL++LN  ++ ++PPV+CIVSDG
Sbjct  68    RFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLN--SLPDSPPVTCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+DAA+ELGIPEV+F T SACG + Y+    L+++G  PL+D SYLTNGYL+TE+D
Sbjct  126   GMIFTLDAAQELGIPEVIFQTPSACGLMCYLQCRPLIERGLIPLRDASYLTNGYLDTEID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRLRD+PSF+RTT+P ++ML F+L    RA+RASAI+LNTFDALEHE L  L 
Sbjct  186   WIPGMRGIRLRDIPSFIRTTDPHDFMLDFLLVAMARAKRASAIVLNTFDALEHEVLEGLS  245

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPPVY+VGPL     Q+  D  ++++ S+LW E+  CL+WLD+K PNSVVYVN+GSIT
Sbjct  246   TLLPPVYSVGPLHIQLNQIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV GEAA++PPEF++ET +RG+L+SWCPQEQV
Sbjct  306   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNSTLES+C GVPM+CWPFFAEQQ NC + C +WGIGMEI+ +V R
Sbjct  366   LSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             + +E +VR+LME E+G+EM++KA+E KKLA EA    P GSS V ++K +N +LLS R 
Sbjct  426   NYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATSG-PNGSSFVGLDKLVNQMLLSRRN  483



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 392/483 (81%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL   ++  H VCIP+PAQGHINPMLKLAK+LH KG FH+TFVNTE+NH+RL ++ GP
Sbjct  1     MGSLDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              SL GLPSFRFETIPDGLP S+ D TQDIPSLCEST ATC   FK LL++LN+    + P
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAI--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDG MSFT+DAA+EL IPEV+FWTTSACGF+ YM Y +L+++G TPLKD SY+T
Sbjct  119   PVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYIT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRL+D+PSF+RTTNP++ ML F+  E  RA++ASAII NTFD L
Sbjct  179   NGYLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+LPPVY++GPL  L K V +  + ++ S+LWKE+  CLEWL++K PNSVV
Sbjct  239   EHDVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +Q+ EFAWGL+NSK PFLW+IRPDLV GE A+LP EF+EET++RG+LS
Sbjct  299   YVNFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLS  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VLGH ++GGFLTHNGWNSTLES+C GVPM+CWPFF EQQTNC + C +WGIG+
Sbjct  359   SWCPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD++E  V+ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ 
Sbjct  419   EI-EDAKRDKIEIFVKELMEGEKGKEMKEKALQWKKLAHNAAFG-PHGSSFMNLENLIHD  476

Query  1461  LLL  1469
             + L
Sbjct  477   VFL  479



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/487 (66%), Positives = 391/487 (80%), Gaps = 4/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   KPHAVC+PYPAQGHINPMLKLAK+LHHKGFHITFVNTE+NH RL +S GP 
Sbjct  1     MGSVAANDLKPHAVCVPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHNRLLKSRGPN  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP FRFETIPDGLP ++AD+TQDIPSLC+STS TCL PF  LL+RLN+ A  + PP
Sbjct  61    SLDGLPDFRFETIPDGLPPNDADSTQDIPSLCDSTSKTCLAPFSSLLSRLNN-AAPDVPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG MSFTV+AA + G+PE +FWT SACG LGY  YS L+++GYTPLKD SY+TN
Sbjct  120   VTCIVSDGCMSFTVEAAHQFGLPEALFWTPSACGLLGYTQYSHLVERGYTPLKDMSYVTN  179

Query  564   GYLETELDWVKGMKG-IRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             GYLET+LDW+ GM+  IRLRDLPSF+RTT  D+ ML F+L E     + +A++LN+F  L
Sbjct  180   GYLETKLDWIPGMRNDIRLRDLPSFIRTTAADDIMLNFVLHEVNNIPKGTAVVLNSFYEL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+A  AL +M P V+++GPLQ +  Q++D  ++++ S+LWKED  C+EWLD K PNSVV
Sbjct  240   EHDAFDALSAMYPRVFSIGPLQLMLNQIQDEGLKSIGSNLWKEDPVCIEWLDDKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT  QL+EFAWGLANSKK FLWIIRPD+V G+ A+LPPEFV ETK+RG L+
Sbjct  300   YVNFGSITVMTAHQLTEFAWGLANSKKSFLWIIRPDIVAGDTAMLPPEFVTETKERGKLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VL HPA+GG LTH+GWNSTLES+C GVP++CWPFFAEQQTNC YSC +W +GM
Sbjct  360   SWCPQEEVLKHPAIGGSLTHSGWNSTLESVCGGVPVICWPFFAEQQTNCRYSCVEWEMGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDN+V RDEVE +VRELM+ EKG +M+ KA+E K  A  AA   P G    N+++ IN 
Sbjct  420   EIDNDVKRDEVELLVRELMDGEKGEKMRNKALEWKSKAEAAAG--PDGPCFQNLDQLIND  477

Query  1461  LLLSHRK  1481
             LLL   K
Sbjct  478   LLLPKIK  484



>emb|CDP01078.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 397/481 (83%), Gaps = 2/481 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + KPHAVCIP+PAQGHINPML+LAK+LHHKGFHITFVN+EFNH+RL +S GP+
Sbjct  1     MGSISLLEKKPHAVCIPFPAQGHINPMLELAKLLHHKGFHITFVNSEFNHKRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP F+F+TIPDGLP S+ DATQDI SLCEST    LGPF++LLARLNDT+ SN PP
Sbjct  61    SLNGLPDFQFQTIPDGLPPSDVDATQDIASLCESTDKHGLGPFRELLARLNDTSSSNVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SD  MSFT+ AAEELGIPE+  WT SAC +L   H+SQL+DKG TPLKD SYLTN
Sbjct  121   VSCIISDAAMSFTLAAAEELGIPEIYLWTASACSYLAIFHFSQLIDKGITPLKDASYLTN  180

Query  564   GYLETELDWV-KGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             GYL+T L+W+  GM+GIRLRDLPSFLRTTNPD+++LKFILQ T  A+RASAIILNTF+ L
Sbjct  181   GYLDTVLEWIIPGMEGIRLRDLPSFLRTTNPDDFILKFILQITESAQRASAIILNTFEEL  240

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ + +L + LPP+Y +GPL  L+ QV D ++  L S+LWKE+  CLEWLD+K PNSVV
Sbjct  241   DHDVISSLPAYLPPIYPIGPLHVLENQVDDKSLEVLGSNLWKEEPECLEWLDSKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMTP+QL EFAWGLANSK+ FLWIIRPDLV G+ AILP EFVEETK RG+ +
Sbjct  301   YVNFGSITVMTPEQLVEFAWGLANSKQTFLWIIRPDLVKGDLAILPDEFVEETKHRGLFA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC Q  VL H +VGGFLTH+GWNST+ES+ +G+PM+CWPFFA+QQTNCW  CTKWGIGM
Sbjct  361   SWCNQGTVLSHSSVGGFLTHSGWNSTIESMSSGLPMICWPFFADQQTNCWICCTKWGIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEVE +V ELM  +KG+EMK+KAME KKLA +AA     GSS VN E  I+ 
Sbjct  421   EIDNNVKRDEVESLVIELMSGKKGKEMKKKAMEWKKLAEDAASCS-SGSSSVNFENLISQ  479

Query  1461  L  1463
             L
Sbjct  480   L  480



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/488 (65%), Positives = 402/488 (82%), Gaps = 6/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   KPHAVCIPYPAQGHI PMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP 
Sbjct  1     MGSV-ALTKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP S+ +ATQDIPSLC STS  CL PF+DLL++LN  ++ ++PP
Sbjct  60    SLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFRDLLSKLN--SLPHSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+C+VSDG M+F++DAA+E GIP V+F TTSACG LGY+ Y  L++KG  PLKD SYLTN
Sbjct  118   VTCLVSDGGMTFSLDAAQEFGIPCVLFETTSACGSLGYLQYLPLMEKGLIPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+ IRLRDLP+F+RTT+P++ MLK+++ E  RA++ASAII NTFDALE
Sbjct  178   GYLDTVIDWIPGMRHIRLRDLPTFVRTTDPNDIMLKYLVSEYERAQKASAIIFNTFDALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDI--NVRALASSLWKEDTSCLEWLDTKAPNSV  917
              E L AL ++LPP+Y +GPLQ    Q+     N++++ S+LW+E+T CLEWLD+K PNSV
Sbjct  238   LEVLDALSTLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSV  297

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL EF WGLANS K FLW+IRPDLV GE+A++PPEF+EET++RG+ 
Sbjct  298   VYVNFGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVLGESAVVPPEFLEETEERGLF  357

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             SSWCPQEQVL HPAVGGFLTH+GWNS+LES+C GVPM+CWPFFAEQQTNC + C +WG+G
Sbjct  358   SSWCPQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCKEWGVG  417

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI+ +V R+ +E +VR LME EKG+EM++KA E KKLA EAA T P G S + ++  IN
Sbjct  418   IEIEGDVKRNYIEDLVRTLMEGEKGKEMRKKATEWKKLAEEAA-TGPNGLSFLALDNMIN  476

Query  1458  HLLLSHRK  1481
              +LLS R 
Sbjct  477   RVLLSPRN  484



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/473 (67%), Positives = 388/473 (82%), Gaps = 5/473 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL +S G  SL GLP F
Sbjct  8     NKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGSSSLDGLPDF  67

Query  228   RFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
              F+TIPDGLP S+ ADATQDIPSLC+STS TCL PF+DL+A+LN +++   P V+CI+SD
Sbjct  68    EFKTIPDGLPPSDIADATQDIPSLCDSTSTTCLAPFRDLIAKLNSSSI--VPQVTCIISD  125

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
               MSFT+DAAEE GIPE +FWT SACG LGY  Y  L+++G TPLKDE+ LTNGYLET +
Sbjct  126   ACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDETDLTNGYLETSI  185

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+ GMK IRLRDLPSF+RTT+ +++ML F+++E  R  RASA+I+NTFD+ E + L AL
Sbjct  186   DWIPGMKNIRLRDLPSFVRTTDINDFMLHFLIREIDRTSRASAVIINTFDSFEQDVLDAL  245

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
               M PP+Y +GPLQ L  Q+ + N++ + S+LWK+   C+EWLD+K PNSVVYVN+GSIT
Sbjct  246   SPMFPPIYTLGPLQLLVDQIPNDNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+T  Q+ EFAWGLANS KPFLWIIRPDL+ GEAA+LPPEF+  TKDR +L SWCPQEQ+
Sbjct  306   VITAQQMIEFAWGLANSNKPFLWIIRPDLIGGEAAMLPPEFLSATKDRSLLVSWCPQEQI  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP++GGFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI+NNV R
Sbjct  366   LKHPSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             DEVEK+VRELME EKG++MKRKAME K  A EAA T    +S+ N+++ +  L
Sbjct  426   DEVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWT--GDASYRNLDRLVKVL  476



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/485 (66%), Positives = 393/485 (81%), Gaps = 9/485 (2%)
 Frame = +3

Query  27    GSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPES  206
              SL  + + PH VCIPYPAQGH+NPM  LAK+LHHKGF++TFV TEFN++RL RS GP S
Sbjct  3     NSLTVKTNPPHVVCIPYPAQGHVNPMTNLAKLLHHKGFYVTFVYTEFNYKRLLRSRGPNS  62

Query  207   LRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPV  386
             L GLPSFRFE+IPDGLP S+ADATQDIPSLCESTS  CL PF+ LL++LN +   + PPV
Sbjct  63    LDGLPSFRFESIPDGLPESDADATQDIPSLCESTSKNCLAPFRQLLSKLNSSP--DIPPV  120

Query  387   SCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNG  566
             S IVSDG M+FT++AA ELG+PEV+ WTTSACGFL Y++Y QL++KG TPLKD SY+TNG
Sbjct  121   SSIVSDGAMTFTLEAARELGVPEVVLWTTSACGFLAYLNYRQLIEKGVTPLKDASYMTNG  180

Query  567   YLE-TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             YLE T ++ + GMK +RLRD PSF+RTT+PD+ ML F+  E+ RA++ASA++LNTFD LE
Sbjct  181   YLENTVINSIPGMKDMRLRDFPSFVRTTDPDDIMLNFLDVESQRAKQASAVVLNTFDDLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              + L +L S+LPPVY VGPL  L  Q+ D NVR++ S+LWKED  CLEWL++K P+SVVY
Sbjct  241   KDVLDSLSSILPPVYTVGPLALLVNQIPDKNVRSIGSNLWKEDPYCLEWLNSKKPSSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT +QL EFAWGLANS+K FLWIIRPDLV G+AAI+PPEFV ETKDRG++ S
Sbjct  301   VNFGSITVMTSEQLVEFAWGLANSQKTFLWIIRPDLVVGDAAIVPPEFVSETKDRGLMPS  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVLGHPA+GGFLTH GWNST+ESI  GVP++CWPFFAEQQTNC Y C  WGIGME
Sbjct  361   WCPQEQVLGHPAIGGFLTHCGWNSTIESISCGVPVICWPFFAEQQTNCRYCCRAWGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  NV R  +E++VR+LM+ EKG+EMK++AME KK   ++     I SS +N++K I  +
Sbjct  421   I-ENVERGNIERLVRKLMDGEKGKEMKKRAMEWKKSTEDS-----IASSQLNLDKMIEQV  474

Query  1464  LLSHR  1478
             LL+ R
Sbjct  475   LLAPR  479



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 401/488 (82%), Gaps = 6/488 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   KPHAVCIPYPAQGHI PMLKLAK+LH+KGFHITFVNTEFNH+RL +S GP 
Sbjct  1     MGSV-ALTKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP S+ +ATQDIPSLC STS  CL PF DLL++LN  ++ ++PP
Sbjct  60    SLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFGDLLSKLN--SLPHSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+C+VSDG M+F++DAA+E GIP V+F T SACG LGY+ Y  L++KG  PLKD SY+TN
Sbjct  118   VTCLVSDGGMTFSLDAAQEFGIPCVLFETMSACGSLGYLQYLPLMEKGLIPLKDASYMTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+ IRLRDLP+F+RTT+P++ MLK+++ E  RA++ASAII NTFDALE
Sbjct  178   GYLDTVIDWIPGMRHIRLRDLPTFVRTTDPNDIMLKYLVSEFERAQKASAIIFNTFDALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDI--NVRALASSLWKEDTSCLEWLDTKAPNSV  917
              E L AL ++LPP+Y +GPLQ    Q+     N++++ S+LW+E+T CLEWLD+K PNSV
Sbjct  238   LEVLDALSTLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSV  297

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL EF WGLANS K FLW+IRPDLV GE+A++PPEF+EETK+RG+ 
Sbjct  298   VYVNFGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVCGESAVVPPEFLEETKERGLF  357

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQEQVL HPAVGGFLTH+GWNS+LES+C GVPM+CWPFFAEQQTNC + C +WG+G
Sbjct  358   ASWCPQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCREWGVG  417

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI+ +V R+ +E +VR LME EKG+EM++KAME KKLA EAA T P G S + ++  IN
Sbjct  418   IEIEGDVKRNYIEDLVRTLMEGEKGKEMRKKAMEWKKLAEEAA-TGPNGLSFLALDNMIN  476

Query  1458  HLLLSHRK  1481
              +LLS R 
Sbjct  477   RVLLSPRN  484



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/487 (65%), Positives = 397/487 (82%), Gaps = 5/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  S  +KPHAVCIP+PAQGHINPML +AK+L+ KGFHITFVNTEFNH+RL +S G  
Sbjct  1     MGSF-SLAEKPHAVCIPFPAQGHINPMLNVAKLLYLKGFHITFVNTEFNHKRLLKSRGSN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSF+FETIPDGLP + A+ TQDIPSLC ST+ TCL  F +LL++LN +   ++PP
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTTKTCLPHFSELLSKLNSSP--DSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG+MSFT+DAA++LGIPEV+ WTTSACGFL Y+ +  L++ G TPLKD SYLTN
Sbjct  118   VSCIVSDGIMSFTLDAAQKLGIPEVLLWTTSACGFLAYVQFHHLIENGLTPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IRL+D+PSF+RTT PD+ ML FIL ET RA+RASAII+NTF   E
Sbjct  178   GYLDTVIDWIPGMKDIRLKDIPSFMRTTEPDDQMLDFILVETERAKRASAIIVNTFHDFE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              E L AL ++ PPVY++GPL     Q+  D  + ++ S+LW E+  CLEWLD+K PNSVV
Sbjct  238   REVLDALSTLFPPVYSIGPLNLQIGQIPADNELNSIGSNLWTEEPECLEWLDSKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLAN KK FLW+IRPDLV G++A++PPEF+EETKDR +L+
Sbjct  298   YVNFGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVIPPEFLEETKDRSLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL +PA+GGFLTH+GWNSTLES+C GVP++CWPFFAEQQTNC +SC +WGIG+
Sbjct  358   SWCPQEQVLNNPAIGGFLTHSGWNSTLESVCGGVPIICWPFFAEQQTNCRFSCKEWGIGL  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V R  VE +VR+LM+ E+G+EM++KA+E KKLA EA+   P G S V+ +K +N 
Sbjct  418   EIEGDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKLAKEASGG-PNGLSFVDFDKMVNQ  476

Query  1461  LLLSHRK  1481
             +LLS +K
Sbjct  477   VLLSQKK  483



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 397/487 (82%), Gaps = 5/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIP+PAQGHINPMLK+AK+LH KGFHITFVNTEFNH+RL +S GP 
Sbjct  1     MGSI-GLAEKPHAVCIPFPAQGHINPMLKVAKLLHCKGFHITFVNTEFNHKRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S  GLPSFRFE IPDGLP + A  TQDIPSLC ST   CL  F++LL++LN +  S  PP
Sbjct  60    SHDGLPSFRFENIPDGLPPTNASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSPAS--PP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELGIPEV+FWTTSACGF+ Y+ Y +L++KG TPLKD SYLTN
Sbjct  118   VSCIVSDGAMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDVSYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ GMK IRLRD+PSF+RTT+P++ +L FIL ET RAR+ASAIILNTF  LE
Sbjct  178   GYLETVIDWIPGMKDIRLRDIPSFMRTTDPNDPILDFILHETTRARKASAIILNTFYDLE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +E + AL ++L P++ +GPL  L  Q+  D  ++++ S+LW E+  CLEWLDTK PNSVV
Sbjct  238   YEIIDALSTLLSPIHCIGPLHLLLNQIPADNELKSIGSNLWTEEPECLEWLDTKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLANS   FLW IRPDLV GE+A++P EFV+ETK+R +L+
Sbjct  298   YVNFGSITVMTSEQLIEFAWGLANSMHTFLWAIRPDLVGGESAVVPKEFVDETKERSLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             +WCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +WGIG+
Sbjct  358   NWCPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCREWGIGL  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EID +V RD VE +VR+LME E+G+EM++K +E KKLA EA  T P G S V+ EK ++ 
Sbjct  418   EIDPDVKRDYVEGLVRKLMEGEEGKEMRKKTLEWKKLAKEAT-TGPSGLSFVDFEKVVSQ  476

Query  1461  LLLSHRK  1481
             ++L+ RK
Sbjct  477   VILAQRK  483



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/482 (69%), Positives = 397/482 (82%), Gaps = 4/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +  DKPH V IPYPAQGH+NPMLKLAK+LH+KGF ++FVNTE+NH+RL RS GP 
Sbjct  1     MGSV-TASDKPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL  FRFETIPDGLP S+ADATQDIPSLC ST+  CL PF  L+ +LND + S  PP
Sbjct  60    SLDGLSDFRFETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPGPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAAE+ G+PEV+FWTTSACGFLGY HY  L+ +G  PL+DES L+N
Sbjct  120   VSCIVSDGVMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQDESCLSN  179

Query  564   GYLETELDWVKGMKG-IRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             GYL+T +D+V G K  IRLRD P+FLRTT+ ++ ML F+  E  RA RASA+ILNTFDAL
Sbjct  180   GYLDTVVDFVPGKKKTIRLRDFPTFLRTTDLNDIMLNFVRVEAERASRASAVILNTFDAL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L AL + LPPVY++GPLQ L  Q+ D  ++++ S+LWKE T CL+WLD+K PNSVV
Sbjct  240   EKDVLDALSATLPPVYSIGPLQHLVDQISDDRLKSMGSNLWKEQTDCLQWLDSKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT  QL+EFAWGLANS KPFLWIIRPDLV G++A+LPPEFV ETKDRGML+
Sbjct  300   YVNFGSITVMTSQQLTEFAWGLANSNKPFLWIIRPDLVVGDSALLPPEFVTETKDRGMLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH+GWNST ESIC GVP++CWPFFAEQQTNC YSC++WGIGM
Sbjct  360   SWCPQEQVLKHPAIGGFLTHSGWNSTSESICGGVPLICWPFFAEQQTNCRYSCSEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV R EVEK+VRELM+ EKG+EMK+K ME KKLA EA  T P GSS+ N  K + +
Sbjct  420   EIDNNVKRVEVEKLVRELMDGEKGKEMKKKVMEWKKLAEEA--TRPGGSSYDNFNKLLRN  477

Query  1461  LL  1466
             +L
Sbjct  478   VL  479



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/473 (67%), Positives = 385/473 (81%), Gaps = 5/473 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LH KGFHITFVNTE+NHRRL +S G  SL GLP F
Sbjct  8     NKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGLPEF  67

Query  228   RFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             +F+TIPDGLP S+ ADATQDIPSLC+ TS TCL PF+DL+A+LN +++   P V+CI+SD
Sbjct  68    QFKTIPDGLPPSDIADATQDIPSLCDCTSTTCLAPFRDLIAKLNSSSI--VPQVTCIISD  125

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
               MSFT+DAAEE GIPE +FWT SACG LGY  Y  L+++G TPLKD + LTNGYLET +
Sbjct  126   ACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDATDLTNGYLETSI  185

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+ GMK IRLRDLPSF+RTT+ +++ML F ++E  R  RASA+I+NTFD+ E + L AL
Sbjct  186   DWIPGMKNIRLRDLPSFVRTTDINDFMLHFQIREIDRTSRASAVIINTFDSFEQDVLDAL  245

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
               M PP+Y +GPLQ L  Q+ + N++ + S+LWK+   C+EWLD+K PNSVVYVN+GSIT
Sbjct  246   SPMFPPIYTLGPLQLLVDQIPNGNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+T  Q+ EF+WGLANS KPFLWIIRPDL+ GEAA+LPPEF+  TKDR +L SWCPQEQV
Sbjct  306   VITAQQMIEFSWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP++GGF+ H GWNSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI+NNV R
Sbjct  366   LKHPSIGGFVNHMGWNSTLESICGGVPMICWPFFGEQQTNCWFACTKWGIGMEIENNVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             DEVEK+VRELME EKG++MKRKAME K  A EAA T    +SH N+++ +  L
Sbjct  426   DEVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWT--GDASHRNLDRLVKVL  476



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/456 (69%), Positives = 381/456 (84%), Gaps = 5/456 (1%)
 Frame = +3

Query  102   MLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFRFETIPDGLPLSEADATQ  281
             MLKLAK+LH KGFHITFVNTE+NH+RL ++ GP+SL GL SFRFETIPDGLP ++ DATQ
Sbjct  1     MLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETIPDGLPETDLDATQ  60

Query  282   DIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGVMSFTVDAAEELGIPEVM  461
             DIPSLCE+T  TC   FK+LL ++N+   S+APPVSCIVSDGVMSFT+DAAEELG+PEV+
Sbjct  61    DIPSLCEATRRTCSPHFKNLLTKINN---SDAPPVSCIVSDGVMSFTLDAAEELGLPEVL  117

Query  462   FWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDWVKGMKGIRLRDLPSFLR  641
             FWTTSACGF+ Y+ Y QL++KG TPLKD SY+TNGYLET +DW+ G+K IRL+DLPSF+R
Sbjct  118   FWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLETTIDWIPGIKEIRLKDLPSFIR  177

Query  642   TTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQSMLPPVYAVGPLQFLQKQ  821
             TTNPDE+ML FI  E GR RRASAIILNTFDALEH+ L A  S+LPPVY++GPL  L K 
Sbjct  178   TTNPDEFMLDFIQWECGRTRRASAIILNTFDALEHDVLEAFSSILPPVYSIGPLNLLVKH  237

Query  822   VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKK  1001
             V D ++ A+ S+LWKE++ C+EWLDTK PNSVVYVN+GSI VMT +QL EFAWGLANS K
Sbjct  238   VDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNK  297

Query  1002  PFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTL  1181
              FLW+IRPDLV GE A+LP EFV++T+ RG+LSSWC QEQVL HPA+GGFLTH+GWNSTL
Sbjct  298   TFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSGWNSTL  357

Query  1182  ESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGREM  1361
             ES+C GVPM+CWPFFAEQQTNCW+ C +WGIG+EI  +V RD++E +VRELM+ EKG+EM
Sbjct  358   ESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-EDVERDKIESLVRELMDGEKGKEM  416

Query  1362  KRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             K KA++ K+LA  AA   P+GSS  N++  +  +LL
Sbjct  417   KEKALQWKELAKSAAFG-PVGSSFANLDNMVRDVLL  451



>ref|XP_007227225.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
 gb|EMJ28424.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
Length=483

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/487 (67%), Positives = 402/487 (83%), Gaps = 5/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGHINPMLK+AK+LH+KGFHITFVNTEFNH+RL +S GP 
Sbjct  1     MGSI-GLAEKPHAVCIPYPAQGHINPMLKVAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSFRFE IPDGLP ++A  TQDIPSLC ST   CL  F++LL++LN +   ++PP
Sbjct  60    SLDGLPSFRFENIPDGLPPTDASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSP--DSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAAEELGIPEV+FWTTSACGF+ Y+ Y +L++KG TPLKD SYLTN
Sbjct  118   VSCIVSDGVMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ GMK IRLRD+P+F+RTT+P++ +L FI+ ET RAR+ASAIILNTF  LE
Sbjct  178   GYLETVIDWIPGMKDIRLRDIPTFMRTTDPNDPILDFIVHETTRARKASAIILNTFYELE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE + AL ++L P++ +GPL     Q+  D  ++++ S+LW E+  CLEWLDT+ PNSVV
Sbjct  238   HEVIDALSTLLSPIHCIGPLHLQLSQIPADNELKSIGSNLWTEEPECLEWLDTEEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLANSK  FLW+IRPDLV GE+A++P EFVEETK+R +L+
Sbjct  298   YVNFGSITVMTSEQLIEFAWGLANSKHTFLWVIRPDLVGGESAMVPAEFVEETKERSLLA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             +WCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +WGIG+
Sbjct  358   NWCPQEQVLNHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFSCKEWGIGL  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EID +V RD VE +VR+LME E+G EM++K +E KKLA EA  T P G S V+ +K +N 
Sbjct  418   EIDPDVKRDYVEGLVRKLMEGEEGEEMRKKTLEWKKLAKEAT-TGPSGLSFVDFDKVVNQ  476

Query  1461  LLLSHRK  1481
             ++L+ RK
Sbjct  477   VILAQRK  483



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/473 (66%), Positives = 385/473 (81%), Gaps = 5/473 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+P QGHINPMLKLAK+LH KGFHITFVNTE+ H+RL +S GP+SL+GL SFR
Sbjct  18    KPHAVCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSFR  77

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP    DATQDIPSLC+ST  TCL    +LL ++N    S+ PPV+C+V+DGV
Sbjct  78    FETIPDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKINS---SDVPPVTCLVADGV  134

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+P  +FWT SACGF+ Y+   QL+ KG  PLKD S +TNGYLET++D 
Sbjct  135   MSFTLDAAEELGVPLALFWTPSACGFMCYVQLEQLIQKGLIPLKDSSSVTNGYLETKIDS  194

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + G+K IRLRD PSF+RTT+ D++M++F+  E GRAR ASAIILNTFDA+EH+ L AL S
Sbjct  195   IPGIKEIRLRDFPSFVRTTDSDDFMIEFLQWECGRAREASAIILNTFDAMEHDVLEALSS  254

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
             +LPPVY++GPL  L K + D ++  + S+LWKE+  C+EWLDTK PNSV+YVN+GSITVM
Sbjct  255   ILPPVYSIGPLNLLVKDIDDEDLNVIRSNLWKEEFECVEWLDTKEPNSVIYVNFGSITVM  314

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             T +QL+EFAWGLANS K FLW+IRPD+V GE  +LPPEFVE+TKDRG LSSWCPQEQVL 
Sbjct  315   TSEQLNEFAWGLANSNKSFLWVIRPDVVGGENVVLPPEFVEQTKDRGFLSSWCPQEQVLA  374

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +V RD+
Sbjct  375   HPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEI-EDVKRDK  433

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +E++VRELM+ EKG+EMK KA++ K LA+ A    P GSS +N+E  I  +L+
Sbjct  434   IERLVRELMDGEKGKEMKEKAIQWKDLAVSATYG-PHGSSFLNLENMIREVLV  485



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 389/478 (81%), Gaps = 3/478 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHI PML LAK+LHH+GFHITFVNTE+NH+RL RS GP +L GLPSFR
Sbjct  9     KPHAVCVPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVSDG  407
             F TIPDGLP S+ADATQDIP+LC S+   CL  F+DLL  L++ +A S +PPVSC+VSDG
Sbjct  69    FRTIPDGLPPSDADATQDIPTLCRSSRDLCLPYFRDLLRTLDEESATSGSPPVSCVVSDG  128

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAAE  G+P V+FWTTSACGF+GY+ Y  L+DKG +PL+D SYLTNGYL+T +D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ I LRDLPSF+RTT+PD++M+ F+  ET RA+RASAI+LNTFD LEHE + AL+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVDFLSVETERAKRASAIVLNTFDRLEHEVVDALK  248

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GPL     Q+ D    ++ S+LWKE+  CL+WLD+K P SVVYVN+GSITV
Sbjct  249   AMFPPIYTLGPLHLFTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSITV  308

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+P QL EFAWGLANS + FLWIIRPDLV G+ A+LPPEF   T +R +L+SWCPQE+VL
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQERVL  368

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
             GH AVGGFLTH+GWNST+ESI  GVP++CWPFFAEQ TNC YS  +WG+GMEID++V RD
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGMGMEIDSDVKRD  428

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             EVE+ VRELME ++G+EMKRKAME K++A EAA   P G S +N+++ IN +L   R+
Sbjct  429   EVERQVRELMEGKRGKEMKRKAMEWKEMAREAA--CPSGPSFLNLDELINSVLRLPRR  484



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/473 (66%), Positives = 386/473 (82%), Gaps = 3/473 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHI PML LAK+LHH+GFHITFVNTE+NH+RL RS GP +L GLPSFR
Sbjct  9     KPHAVCMPFPAQGHIKPMLSLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVSDG  407
             F TIPDGLP S+ADATQD+P+LC S+   CL  F+DLL  L++ +A S +PPVSC+VSDG
Sbjct  69    FRTIPDGLPPSDADATQDVPTLCRSSRDLCLPYFRDLLRTLDEESATSGSPPVSCVVSDG  128

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAAE  G+P V+FWTTSACGF+GY+ Y  L+DKG +PL+D SYLTNGYL+T +D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ I LRDLPSF+RTT+PD++M+ F   ET RA+RASAI+LNTFD LE+E + AL+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVDFASVETERAKRASAIVLNTFDRLEYEVVDALK  248

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GPL  L  Q+ D    ++ S+LWKE+  CL+WLD+K P SVVYVN+GS+TV
Sbjct  249   AMFPPIYTLGPLHLLTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSVTV  308

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+P QL EFAWGLANS + FLWIIRPDLV G+ A+LPPEF   T++R +L+SWCPQEQVL
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQEQVL  368

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
             GH AVGGFLTH+GWNST+ESI  GVP++CWPFFAEQ  NC YS  +WGIGMEID++V RD
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRD  428

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             EVE+ VRELME E+G+EMKRK ME K++A EA  T P G S +N+++ IN +L
Sbjct  429   EVERQVRELMEGERGKEMKRKVMEWKEMAREA--TCPSGPSFLNLDELINSVL  479



>ref|XP_002271368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/486 (66%), Positives = 388/486 (80%), Gaps = 4/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S+R+  DKPHAVCIPYP+QGH+NP+L++AK+LH +GF ITFVNTE NH+RL RS GP 
Sbjct  1     MASIRA-SDKPHAVCIPYPSQGHVNPLLQMAKLLHSRGFFITFVNTEHNHKRLLRSKGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
              L G P FRFETIPDGLP S+AD TQ   S+CESTS   L PF +L+++LND + S  PP
Sbjct  60    YLDGFPDFRFETIPDGLPPSDADITQPTASVCESTSKNSLAPFCNLISKLNDPSSSAGPP  119

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDGVMSFT+DAAE+ G+PEV+FWTTSACGFLGY HY  LL +G  PLKDES LTN
Sbjct  120   VTCIVSDGVMSFTLDAAEKFGVPEVLFWTTSACGFLGYRHYRDLLQRGLIPLKDESCLTN  179

Query  564   GYLETELDWVKGM-KGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             GYL+T +D + GM K IRLRD P+F +TT+P++ ML F++ E  RA +ASAIILNTFDAL
Sbjct  180   GYLDTIVDSIPGMMKTIRLRDFPAFFKTTDPNDIMLNFLIAEAERANKASAIILNTFDAL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L AL++ LPPVY +GPLQ L  Q+ D  ++   SSLWKE   CL+WLD+K PNSVV
Sbjct  240   EKDVLDALRATLPPVYTIGPLQHLVHQISDDKLKFFGSSLWKEQPECLQWLDSKEPNSVV  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+ VMTP QL+E AWGLANS KPFLWIIRPDLV G++A LPPEFV ET+DRG+L+
Sbjct  300   YVNFGSVIVMTPQQLTELAWGLANSNKPFLWIIRPDLVPGDSAPLPPEFVTETRDRGLLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPAVGGF+TH+GWNST E IC GVP++C PF AEQ TNC Y C++WGIGM
Sbjct  360   SWCPQEQVLKHPAVGGFVTHSGWNSTSEGICGGVPLICMPFRAEQPTNCRYCCSEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EID NV RD+VEK+VRELM+ E G++MK+KAME KKLA EA   +P GSS+ N  K ++ 
Sbjct  420   EIDGNVKRDKVEKLVRELMDGENGKKMKKKAMEWKKLAEEA--IMPGGSSYNNFNKLLSD  477

Query  1461  LLLSHR  1478
             +LLS +
Sbjct  478   VLLSKK  483



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/474 (67%), Positives = 382/474 (81%), Gaps = 5/474 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             DKPH VCIP+PAQGHI PMLKLAK+LH++GFHITFVNTEFNH+RL RS GP +L G+P F
Sbjct  3     DKPHVVCIPFPAQGHIKPMLKLAKLLHYRGFHITFVNTEFNHKRLLRSRGPHALDGMPGF  62

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
              FE+IPDGLP  +ADATQ IPSLCEST  +CL PF+ L+A+LND   SN PPV+CIVSDG
Sbjct  63    CFESIPDGLPPVDADATQHIPSLCESTPKSCLIPFQQLIAKLNDAPSSNVPPVTCIVSDG  122

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+ A+EELGIP V+FWTTSACGF+ Y  +  L+D    PLKD SYLTNGYLET +D
Sbjct  123   SMCFTLKASEELGIPNVLFWTTSACGFMAYKQFRPLIDGVLVPLKDLSYLTNGYLETIID  182

Query  588   WVKGMKGIRLRDLPSFLRTTNP-DEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             WV GMK +RLRD PSF+RT +P D +ML FI+  T  A +AS +ILNTF ALEH+ L  L
Sbjct  183   WVPGMKNMRLRDFPSFIRTRDPSDHFMLDFIIDTTDSASKASGLILNTFHALEHDVLNPL  242

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
              SM P +  VGPL  L  Q+ D N  ++ S+LW+E+T CL+WL++K PNSVVYVN+GSIT
Sbjct  243   SSMFPTICTVGPLPLLLNQIPDDN--SIESNLWREETECLQWLNSKQPNSVVYVNFGSIT  300

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMTP+QL EFAWGLANS KPFLWIIRPDLV G++ ILPPEFV ET  RG+++ WCPQE+V
Sbjct  301   VMTPEQLVEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWCPQEKV  360

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP+VGGFLTH+GWNST+ESIC GVPM+CWPFFAEQQTNC Y+CT+WG+GMEIDNNV R
Sbjct  361   LNHPSVGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEIDNNVER  420

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             DEVEK+V+ELME EKG+ MK+ AME +  A EA  T P GSS++N++K ++ LL
Sbjct  421   DEVEKLVKELMEGEKGKSMKKAAMEWRTKAEEA--TAPCGSSYLNLDKLVDILL  472



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 397/483 (82%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL +   KPHAVC+P+PAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL +S GP+
Sbjct  1     MGSLEA-ISKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL+GL SFRFETIPDGLP  + + TQ +PSLC+ T  TCL  F+++L++L D+   + PP
Sbjct  60    SLKGLSSFRFETIPDGLPEPDVEVTQHVPSLCDYTRRTCLPHFRNVLSKLRDSP--SVPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG+MSFT+DAA+E G+P V+FWTTSACGF+ Y+ Y QL+++G TPLKD SYLTN
Sbjct  118   VSCIVSDGIMSFTLDAAQEFGVPNVLFWTTSACGFMCYVQYQQLIERGLTPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K I+L+D+P+F+RTT+PD+ ML F   E  RA++ASAIILNTFDALE
Sbjct  178   GYLETAIDWIPGIKEIQLKDIPTFIRTTDPDDIMLNFGRGECIRAQKASAIILNTFDALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  S+LPPVY++GPL FL   V D ++ A+ S+LWKE+  CLEWLDTK  N+VVY
Sbjct  238   HDILEAFSSILPPVYSIGPLNFLLNDVTDKDLNAIGSNLWKEEPGCLEWLDTKEANTVVY  297

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+TVMT DQL EFAWGLANS K F+W+IRPDLV GE A+LPPEFV ETK+RG+LSS
Sbjct  298   VNFGSVTVMTNDQLIEFAWGLANSNKTFVWVIRPDLVVGENAVLPPEFVTETKNRGLLSS  357

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTHNGWNSTLES+C GVPM+CWPFFAEQ TNC + C +WGIG+E
Sbjct  358   WCPQEQVLAHPAIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQHTNCRFCCKEWGIGLE  417

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V RD++E +VRELM+ EKG+EMK+KA+E K LA +AA   P GSS V+ EK I  +
Sbjct  418   I-GDVERDKIESLVRELMDGEKGKEMKKKALEWKTLAQKAASG-PNGSSFVHFEKMIREV  475

Query  1464  LLS  1472
             L+S
Sbjct  476   LMS  478



>ref|XP_004299646.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/489 (63%), Positives = 401/489 (82%), Gaps = 8/489 (2%)
 Frame = +3

Query  21    EMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             E   L SE  KPHAVCIP+PAQGHINPMLK+AK+LH+KGF+ITFVNTEF H+RL +S GP
Sbjct  2     ECNGLTSE--KPHAVCIPFPAQGHINPMLKVAKLLHYKGFYITFVNTEFIHKRLLKSRGP  59

Query  201   ESLRGLPSFRFETIPDGLPLSEAD-ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
              SL G PSFRFETIPDGLP ++A+ ATQ +PSLCEST   CL PF+DLL +LN +   N+
Sbjct  60    NSLDGFPSFRFETIPDGLPPTDANVATQHMPSLCESTRKNCLAPFRDLLLKLNSSP--NS  117

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPV+CIV+DG+M+FT+DAA+ELG+PEV+FWTTSACGF+GY+ Y  L++KG  PLKD+SYL
Sbjct  118   PPVTCIVADGIMNFTLDAAQELGLPEVIFWTTSACGFMGYLQYYNLIEKGLVPLKDDSYL  177

Query  558   TNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
             TNGYL+T +DW+ GMKGI+L+D+P+F+RTT+P++ +L  IL +T + +RASAIILNTFDA
Sbjct  178   TNGYLDTVIDWIPGMKGIQLKDIPTFMRTTDPNDPILHLILHDTEQVQRASAIILNTFDA  237

Query  738   LEHEALMALQSMLPPVYAVGPL--QFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             LEHE L A+  +LPP+Y++GPL  Q  Q   +D N + + ++LW+E+  C EWLD+K P+
Sbjct  238   LEHEVLEAISHLLPPIYSIGPLYLQLNQIPAEDSNFKLIGANLWREEPDCFEWLDSKEPS  297

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SV+YVN+GS TVMT +QL EFAWGLA+S K F W+IRPDLV GE+ +LPPEF+E+TK+RG
Sbjct  298   SVIYVNFGSSTVMTDEQLIEFAWGLADSSKTFFWVIRPDLVGGESPVLPPEFIEQTKERG  357

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             +L+SWC QEQVL HPA+GGFLTH+GWNST+ES+C GVPM+CWPF  EQQTNC Y C +WG
Sbjct  358   LLASWCCQEQVLSHPAIGGFLTHSGWNSTIESVCGGVPMICWPFNGEQQTNCRYCCKEWG  417

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IG+E++ +V R+ +E VVR+LME E+G+EM++K+ME KKLA E A T P GSS ++++  
Sbjct  418   IGIEMEGDVKRNYIESVVRKLMEGEEGKEMRKKSMEWKKLA-EKATTGPHGSSFLDLDNM  476

Query  1452  INHLLLSHR  1478
             +N +LLS R
Sbjct  477   VNQVLLSPR  485



>emb|CDP01087.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 393/483 (81%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + KPHAVCIP  AQGHINPMLKLAK+LHH GFHITFVNTEFNHRR  +S GP+
Sbjct  1     MGSIALLEKKPHAVCIPAAAQGHINPMLKLAKLLHHNGFHITFVNTEFNHRRWLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP F+F+ IPDGLP S+ADATQD  +LCES   TCLGPF++LLA LNDT+ S  PP
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDADATQDPAALCESVDRTCLGPFRELLAELNDTSSSKVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSD + +FT+ AAEEL IPEV+FWT SAC +LGY  Y++L++KG  PLKD SYLTN
Sbjct  121   VSCIVSDAITAFTLAAAEELCIPEVLFWTASACSYLGYFQYAKLMEKGIIPLKDASYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+  LDW+ G++GIRL+DLPSFLRTTNPD++M+KF +QET RAR+ASAII+NT+  LE
Sbjct  181   GYLDAVLDWIPGLEGIRLKDLPSFLRTTNPDDFMVKFGMQETQRARKASAIIINTYQQLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H  L AL S LPP+Y +GPL FL+  V D ++  + S+LWKE+  CLEWLD+K PNSVVY
Sbjct  241   HGVLDALSSYLPPIYTIGPLHFLENHVHDNSLTDVQSNLWKEEPKCLEWLDSKDPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI VMTP+QL EFAWGLANSK+ FLWI+RPDLV+G +AILP EF+EETK+R M + 
Sbjct  301   VNFGSIAVMTPEQLVEFAWGLANSKQNFLWILRPDLVSGSSAILPSEFLEETKERSMFAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QE+VL HP+VGGFLTH+GWNST+ESI  GVPM+CWP FA+QQTNCW+ CTKWGIGME
Sbjct  361   WCAQEKVLSHPSVGGFLTHSGWNSTIESISYGVPMICWPCFADQQTNCWFCCTKWGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE++V ELM  EKG+EMK+KAM+ KKLA  A     +  S +N+E  I+ +
Sbjct  421   IDNNVKRDEVERLVSELMAGEKGKEMKKKAMDWKKLAETA-----VTDSKLNLENLIHQV  475

Query  1464  LLS  1472
             LL+
Sbjct  476   LLN  478



>emb|CAN65645.1| hypothetical protein VITISV_012510 [Vitis vinifera]
Length=582

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/471 (69%), Positives = 385/471 (82%), Gaps = 5/471 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHINPMLKLAK+LH +GF ITFVNTEFNH RL  + GP  L GLP+F
Sbjct  4     EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTF  63

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             +FETIPDGLP S+ DATQDIPSLC ST   CL PF+ LLA+LN     + PPV+CI SD 
Sbjct  64    QFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLN----HDGPPVTCIFSDA  119

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             +MSFT+DAA+ELGIP+++ WT SACGF+ Y+ Y  L+DKG+TPLKDESYLTNGYL+T +D
Sbjct  120   IMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVVD  179

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GMKGIRL+DLPSF+RTT+PD+ ML F + E  RAR+ASAII NTFDALEHE L A+ 
Sbjct  180   WIPGMKGIRLKDLPSFIRTTDPDDVMLDFAMGELERARKASAIIFNTFDALEHEVLDAIA  239

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
              M PP+Y + PLQ L  Q+ D  ++ + S+LWKE+  CL+WLD+K PNSVVYVNYGSITV
Sbjct  240   PMYPPIYTIAPLQLLLDQIHDSELQLIESNLWKEEPECLKWLDSKEPNSVVYVNYGSITV  299

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MTP QL EFAWGLANS + FLWI+RPDLV+GE+AILPPEFV ET+DRG+L+ WC QEQVL
Sbjct  300   MTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCLQEQVL  359

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H A+GGFLTHNGWNS +E +C GVPM+CWPFFAEQQTNC Y CT+WG+GMEID++V RD
Sbjct  360   THQAIGGFLTHNGWNSIIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRD  419

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EV K+VRELME EKG+EMK+K ME K  A EAA T P GSS++N+EK   H
Sbjct  420   EVAKLVRELMEGEKGKEMKKKTMEWKHTA-EAATTGPDGSSYLNLEKMFEH  469



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 393/483 (81%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             M SL + ++ PH VC+PYPAQGHINPML +AK+LH KG FH+TFVNTE+NH+R  ++ GP
Sbjct  1     MCSLGTTKNVPHVVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             +SL GLP+FRFETIPDGLP S  D+TQDIPSLCEST  TCL  FK+LL++LND    + P
Sbjct  61    DSLNGLPTFRFETIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLNDAL--DTP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIVSDGVMSFT+DAA+EL IP+V+FWTTSACGF+ Y  Y QL++KG TPLKD S +T
Sbjct  119   PVTCIVSDGVMSFTLDAAQELNIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLKDWSDMT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DWV G+K IRL+DLPSF+RTT+P++ M++F+ +E  RA++ASAIILNTFDAL
Sbjct  179   NGYLETPIDWVPGIKEIRLKDLPSFIRTTDPNDPMIEFMSRECQRAQKASAIILNTFDAL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EH+ L A  S+ PP+Y++GPL  L K V +  + ++ S+LWKED+ CL+WL+ K PN+VV
Sbjct  239   EHDVLEAFSSIFPPIYSIGPLNLLLKDVTNEELNSIGSNLWKEDSKCLKWLNNKEPNTVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+TVMT +Q+ EFAWGL+NSKKPFLW+IRPDLV GE A+LP EF+EETKDRG+LS
Sbjct  299   YVNFGSVTVMTKEQMIEFAWGLSNSKKPFLWVIRPDLVAGENAVLPLEFLEETKDRGLLS  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC Q +VL H A+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +W IG+
Sbjct  359   SWCLQGEVLAHSAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI  +  RD++E +V+EL++ EKG+EMK KA++ KKLA  AA   P GSS +N+E     
Sbjct  419   EI-EDAKRDKIESLVKELLDGEKGKEMKAKALQWKKLAHNAASG-PHGSSFMNLENLFRD  476

Query  1461  LLL  1469
             +LL
Sbjct  477   VLL  479



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 391/476 (82%), Gaps = 11/476 (2%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHINPMLKLAK+LH+KGFHIT+VN+EFN +RL +S GP SL GLPSF
Sbjct  8     EKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITYVNSEFNLKRLLKSRGPNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP ++A+ATQDIPSLC+ST    L  F+DLL++LN +   + PPVSCIVSDG
Sbjct  68    RFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSP--DCPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+DAA+E G+PEV+FWTTSACGFL Y+HY +L++K      D SYLTNGYLETE+D
Sbjct  126   AMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRLIEK------DASYLTNGYLETEID  179

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GIRL+D+PSF+RTT+PD+ ML F + ET R R+ASA+I NTF   EHE L AL 
Sbjct  180   WIPGMRGIRLKDIPSFIRTTDPDDIMLDFWVHETERTRKASAVIFNTFHDFEHEVLDALS  239

Query  768   SMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPP+Y++GPL     Q+  D  ++ + S+LW E+  CLEWL++K PNSVVYVN+GSIT
Sbjct  240   TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLNSKEPNSVVYVNFGSIT  299

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL EFAWGLANS + F W+IRPDLV G++A++PPEFVEETK+R +L++WCPQEQV
Sbjct  300   VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  359

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH+GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +WGI MEI+++V R
Sbjct  360   LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIDMEIESDVKR  419

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             + VE +VR+LME ++G+EM++KA+E KKLA EA  T P GSS V ++K +N +LLS
Sbjct  420   NHVEGLVRKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFVGLDKMVNEVLLS  473



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/485 (65%), Positives = 391/485 (81%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M SL +E+  PHAVC+P+PAQGHINPMLKLAKILH K FHITFVNTEFNHRRL +S G  
Sbjct  1     MVSLATEEFPPHAVCLPFPAQGHINPMLKLAKILHRKDFHITFVNTEFNHRRLLKSRGLG  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP+FRFETIPDGLP S+AD+TQ +PSLC+ST   CL PF+DLL+RLN+T+ S  PP
Sbjct  61    SLDGLPTFRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSD +MSFT+ AA+ELGIP V+FWT S CGF+ Y+ Y  L++KG+ PLKDESYLTN
Sbjct  121   VTCIVSDCIMSFTLKAAQELGIPNVLFWTASVCGFMSYLQYRPLIEKGFVPLKDESYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+GI L+ LPSFLRTT+  + ML F + E   AR ASA+I NTFD LE
Sbjct  181   GYLDTVIDWIPGMEGISLKYLPSFLRTTDSGDIMLNFAIGEVESARNASAVIFNTFDDLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L  L S LP +Y +GPLQ L+ Q ++  + ++AS+LWKE+  C+EWLD K P+SV+Y
Sbjct  241   SEVLKPLTSTLPHLYTIGPLQLLENQDQENALNSIASNLWKEEPGCIEWLDFKEPDSVIY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+TVMTP QL EFAWGLANSK  FLW+IRPDLV G++AI+PPEFV ETK+RG+L+ 
Sbjct  301   VNFGSVTVMTPQQLIEFAWGLANSKCTFLWVIRPDLVVGDSAIVPPEFVAETKERGLLAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HP++GGFLTH+GWNSTL+S+C GVPM+CWPFFAEQQTNCW+ C K GIGME
Sbjct  361   WCPQEQVLQHPSIGGFLTHSGWNSTLDSLCGGVPMICWPFFAEQQTNCWFCCNKLGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V R+E+E +VRELME ++G+ MK KA + K+   EA  + P GSS +N+EK IN +
Sbjct  421   IDSDVKRNEIESLVRELMEGDQGQVMKYKAKKWKRKVEEATAS-PTGSSCLNLEKMINKV  479

Query  1464  LLSHR  1478
             LL+ R
Sbjct  480   LLAPR  484



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/473 (66%), Positives = 385/473 (81%), Gaps = 3/473 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQGHI PML LAK+LHH+GFHITFVNTE+NH+RL RS GP +L GLPSFR
Sbjct  9     KPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVSDG  407
             F TIPDGLP  +AD TQDIP+LC S+   CL  F+DLL  L++ +A S +PPVSC+VSDG
Sbjct  69    FRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGSPPVSCVVSDG  128

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAAE  G+P V+FWTTSACGF+GY+ Y  L+DKG +PL+D SYLTNGYL+T +D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ I LRDLPSF+RTT+PD++M+ F   ET RA+RASAI+LNTFD LE+E + AL+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVHFASVETERAKRASAIVLNTFDRLEYEVVDALK  248

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GPL  L  Q+ D    ++ S+LWKE+  CL+WLD+K P SVVYVN+GSITV
Sbjct  249   AMFPPIYTLGPLHLLTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSITV  308

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+P QL EFAWGLANS + FLWIIRPDLV G+ A+LPPEF   T++R +L+SWCPQE+VL
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQERVL  368

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
             GH AVGGFLTH+GWNST+ESI  GVP++CWPFFAEQ  NC YS  +WGIGMEID++V RD
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRD  428

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             EVE+ VRELME E+G+EMKRKAME K++A EAA   P G S +N+++ IN +L
Sbjct  429   EVERQVRELMEGERGKEMKRKAMEWKEMAREAA--CPSGPSFLNLDELINSVL  479



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/479 (66%), Positives = 387/479 (81%), Gaps = 21/479 (4%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQGHINPMLKLAK+LH+ GFHITFVNTE+NH RL +S GP+SL GLPSFR
Sbjct  9     KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  68

Query  231   FETIPDGLP-----LSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCI  395
             FETIPDGLP      ++ADATQDIPSLCEST+ TCL PF++LLA+LNDTA S  PPVSCI
Sbjct  69    FETIPDGLPPPSEDDADADATQDIPSLCESTTTTCLAPFRNLLAKLNDTASSEVPPVSCI  128

Query  396   VSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLE  575
             VSDGVMSFT DAAEEL IPEV+FWTTSACGF  Y  Y  +  K Y PL D S  TNGYLE
Sbjct  129   VSDGVMSFTADAAEELAIPEVLFWTTSACGFYAYTQYEYVFQKEYAPLADASCFTNGYLE  188

Query  576   TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEAL  755
             T ++ +  M+GIR+RD+PSF+RTTN D++M++FI  E  RA+RASAI+LNTF+ LE + +
Sbjct  189   TVIEGIPSMEGIRMRDMPSFVRTTNEDDFMVQFIFAEMKRAKRASAIVLNTFEELERDTI  248

Query  756   MALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
              AL S+LPP+Y +GPL  ++  V +D  ++ L S+LWKED  CL+WLDT+ PNSVVYVN+
Sbjct  249   DALSSILPPIYPIGPLNLIENLVIEDEGLKELGSNLWKEDQECLKWLDTREPNSVVYVNF  308

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSITVMTPDQL+EFAWGLANSK+PFLW+           +LP  F+EETK+RGML++WCP
Sbjct  309   GSITVMTPDQLNEFAWGLANSKQPFLWV-----------VLPRGFLEETKERGMLANWCP  357

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL H +VGGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKWG+GMEID+
Sbjct  358   QEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDS  417

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +V R+ VE +V +LM  E+GR+M+ KA+E K LA ++A+    GSS+ N++K I+ +LL
Sbjct  418   DVKRNGVETLVTKLMIGEEGRQMRNKAVEWKNLARDSAE----GSSYRNLKKLIDQVLL  472



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/479 (66%), Positives = 395/479 (82%), Gaps = 4/479 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPML +AK+LH KGFHITFVNTEFNH+RL +S G  SL GLPSF
Sbjct  8     EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             +FETIPDGLP ++A+ TQDIPSLC ST  TCL  F++LL++LN +   ++PPVSCIVSDG
Sbjct  68    QFETIPDGLPPTKANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSP--DSPPVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA+ELGIPEV+FWTTSACGFL YM + +L++KG+TPLKD SYLTNGYL+T +D
Sbjct  126   VMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGHTPLKDASYLTNGYLDTVID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GMK IRL+D+PSF+RTT PD+ ML FIL ET RA++ASAIILNTF   E E L  L 
Sbjct  186   WIPGMKDIRLKDIPSFMRTTEPDDQMLDFILVETERAKKASAIILNTFHDFEREVLDTLL  245

Query  768   SMLPPVYAVGPLQFLQKQVK-DINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++LPPVY++GPL     Q+  D  ++++ S+LW E+  CLEWL TK PNSVVYVN+GSIT
Sbjct  246   TLLPPVYSIGPLNLQIGQIPVDKELKSIRSNLWIEEPECLEWLHTKEPNSVVYVNFGSIT  305

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +QL+EFAWGLAN KK FLW+IRPDLV G++A++P EFVEETKDR +++SWCPQEQV
Sbjct  306   VMTNEQLTEFAWGLANCKKTFLWVIRPDLVGGDSAVVPQEFVEETKDRSLMASWCPQEQV  365

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC + GIG+EI+ +V R
Sbjct  366   LSHPAIGGFLTHCGWNSTLESVCGGVPMVCWPFFAEQQTNCRFSCKELGIGLEIEGDVKR  425

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
               VE +VR+LM+ ++G+EM++KA+E KKLA EA+   P G S V+ +  +N +LLS +K
Sbjct  426   KYVEGLVRKLMDGKEGKEMRKKALEWKKLAKEASSG-PNGLSFVDFDTMVNQVLLSQKK  483



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/475 (67%), Positives = 377/475 (79%), Gaps = 4/475 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHI PMLKLAK+LH KGFHITFVNTEFNH+RL +S G +SL G PSF
Sbjct  10    EKPHAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGADSLNGFPSF  69

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP S+ DATQD P+LCES   TCL PF++LLA+LN +   + PPVSCIVSDG
Sbjct  70    RFETIPDGLPESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNHS--RHVPPVSCIVSDG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+ A+EELGIPEV FWT SACG L Y+H  QL+ KG  PLKD SY+TNGYLET +D
Sbjct  128   VMSFTLIASEELGIPEVFFWTISACGLLCYLHNGQLVKKGLVPLKDSSYMTNGYLETAID  187

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ G+K I LRD PSF RT +P + ML+ + +E GRA+ ASAIILNTF+ALEH+ L AL 
Sbjct  188   WLPGIKEILLRDFPSFFRTIDPHDIMLQVLQEECGRAKHASAIILNTFEALEHDVLEALS  247

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             SMLPPVY +GPL  L   V D +++ + S+LWKED  CL+WLDT  P SV+YVN+GSITV
Sbjct  248   SMLPPVYPIGPLTLLLNHVTDEDLKTIGSNLWKEDRECLKWLDTNEPKSVIYVNFGSITV  307

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT  QL EFAWGLANS K FLW+IRPDLV  E  ILP EFV ETKDRG LS WCPQE+VL
Sbjct  308   MTNHQLIEFAWGLANSGKTFLWVIRPDLV-DENTILPYEFVLETKDRGQLSGWCPQEEVL  366

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HPA+GGFLTH+GWNST+ES+CNGVPM+CWPFFAEQ TNC + C +WG+GM+I+ +V RD
Sbjct  367   AHPAIGGFLTHSGWNSTIESLCNGVPMICWPFFAEQPTNCRFCCKEWGVGMQIEGDVTRD  426

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              VE++VRELME +KG+E+  KA+E KKLA E A  +  GSS +N +  +  +LLS
Sbjct  427   RVERLVRELMEGQKGKELTMKALEWKKLA-EDATILKEGSSFLNYDNMVRQVLLS  480



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/485 (64%), Positives = 390/485 (80%), Gaps = 1/485 (0%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M SL +E+  PH VC+P+PAQGHINPMLKLAKILH K FHITFVNTEFNHRRL RS G +
Sbjct  1     MVSLATEKCPPHVVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL +FRFETIPDGLP S+AD+TQ +PSLC+ST   CL PF+DLL+RLN+T+ S  PP
Sbjct  61    SLDGLSTFRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSD +MSFT+ AA+ELGIP V FWT S CGF+ Y+ Y  L++KGY PLKDESYLTN
Sbjct  121   VTCIVSDCIMSFTLKAAQELGIPNVFFWTASVCGFMSYLQYRPLIEKGYVPLKDESYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+GI L+ LP+F+RTT+P + ML F + E   A+ ASA+ILNTFD LE
Sbjct  181   GYLDTVIDWIPGMEGISLKYLPTFIRTTDPGDIMLNFAIGEVESAQNASAVILNTFDDLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L  L S LP +Y +GPLQ L+ Q ++  + ++AS+LWKE+   +EWLD K P+SV+Y
Sbjct  241   SEVLKPLTSTLPHLYTIGPLQLLENQDQENALNSIASNLWKEEPGFIEWLDFKEPHSVIY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMTP QL EFAWGLANS   FLW+IR DLV G++AI+PPEFV ETK+RG+++ 
Sbjct  301   VNFGSITVMTPQQLIEFAWGLANSMCTFLWVIRSDLVVGDSAIVPPEFVAETKERGLVAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE+VL HP++GGFLTH+GWNSTL+S+C GVP++CWPFF+EQQTNCW+ C K GIGME
Sbjct  361   WCPQERVLQHPSIGGFLTHSGWNSTLDSLCCGVPVICWPFFSEQQTNCWFCCNKLGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID++V R+E+E +VRELME ++G+ MK KA E K+ A EAA + P GSS +N+EK IN +
Sbjct  421   IDSDVKRNEIESLVRELMEGDQGQVMKYKAKEWKRKAEEAAAS-PTGSSCLNLEKMINKV  479

Query  1464  LLSHR  1478
             LL+ R
Sbjct  480   LLAPR  484



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 391/483 (81%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + KPHAVCIP+PAQGHI PMLKLAK+LH KGFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIARPEKKPHAVCIPFPAQGHIKPMLKLAKLLHQKGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP F+F+ IPDGLP S+ DATQDI SLCES    CLGPF++LLA LNDT+ S   P
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDVDATQDILSLCESIDRNCLGPFRELLAELNDTSSSEVAP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG  +FT+ AA+ELGIPEV+ WT+SA  +L +  + + ++KG  PLKD SYLTN
Sbjct  121   VSCIVSDGATTFTLAAAQELGIPEVLLWTSSAPSYLAFFQFDKFIEKGIIPLKDASYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T LDW+ G++GIRL+DLPS LRTTNPD++M+KF +QET RAR+ASAII+NTF  LE
Sbjct  181   GYLDTVLDWIPGLEGIRLKDLPSLLRTTNPDDFMVKFAMQETKRARKASAIIINTFQQLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L AL S LPP+Y +GPL  L+  + D ++  L S+LWKE+  CLEWLD K PNSVVY
Sbjct  241   HDVLDALSSHLPPIYTIGPLHLLENHMHDKSLTDLQSNLWKEEPECLEWLDLKDPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI VMTP+QL EFAWGLANSK+ FLWI+RPDLV+G +AILP EF+EETK+R M + 
Sbjct  301   VNFGSIAVMTPEQLVEFAWGLANSKQNFLWILRPDLVSGNSAILPSEFLEETKERSMFAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE+VL HP+VGGFLTH+GWNST+ESI  GVPM+CWPFFA+QQTNCW+ CTKWGIGME
Sbjct  361   WCPQEKVLSHPSVGGFLTHSGWNSTIESISYGVPMICWPFFADQQTNCWFCCTKWGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +V ELM  EKG+EMK+KAM+ KKLA  A     +  S++N+E  I+ +
Sbjct  421   IDNNVKRDEVEGLVSELMAGEKGKEMKKKAMDWKKLAETA-----VTDSNLNLENLIHQV  475

Query  1464  LLS  1472
             LL+
Sbjct  476   LLN  478



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/475 (64%), Positives = 387/475 (81%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPM+K+AK+L+ KGFH+TF NT +NH RL+RS GP ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFCNTVYNHNRLRRSRGPNAVDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST+  CL PFK+LL ++N     + PPVSCI+SDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQINTN--DDVPPVSCILSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAA+ELGIPEV+FWTTSACGFL Y++Y + ++KG  PLKDESYLT  YL+TE+DW
Sbjct  129   MSFTLDAAKELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYLTKEYLDTEIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK +RL+D+PSF+RT NPD+ ML F+++ET R +RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPMMKNLRLKDIPSFIRTANPDDIMLNFLIRETERTKRASAIILNTFDDLEHDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY+VGPL  L+KQ   +D  +  + S+LWKE+T CL+WLDTKA NSVVYVN+GSIT
Sbjct  249   IIPPVYSVGPLHLLEKQEIGEDSEIGRMGSNLWKEETECLDWLDTKARNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+   QL+EFAWGLA + K FLW+IRPDLV G+ A++P EF+ ET+DR ML+SWCPQEQV
Sbjct  309   VLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQEQV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +W +G EI  +V R
Sbjct  369   LSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGNEIGGDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++M+ KA E ++LA EA +    GSS VN E F++ +LL
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAQEWRRLAKEATEH-KHGSSVVNFETFVSKVLL  482



>ref|XP_002525851.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36545.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/481 (65%), Positives = 382/481 (79%), Gaps = 5/481 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  + DKPH VC+PYPAQGH+NPM+KLAK+LH+  FH+TFVNTE+NHRRL  S GP 
Sbjct  1     MGSIVRDHDKPHVVCVPYPAQGHVNPMVKLAKLLHYNDFHVTFVNTEYNHRRLLNSRGPS  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP FRFE I DGLP S+A+ATQDIPSLC+STS   L PF++LL +L  +   + PP
Sbjct  61    SLDGLPDFRFEAISDGLPPSDANATQDIPSLCDSTSKNSLAPFRNLLLKLKSS--DSLPP  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI+SD  MSFT+DAAEE GIPE++FWT S+CG LGY  Y  L++KG TPLKD SYLTN
Sbjct  119   VTCIISDACMSFTLDAAEEFGIPEILFWTPSSCGVLGYSQYHTLIEKGLTPLKDASYLTN  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET LDW+ GMK IR RDLPSF+RTT+ ++ ML F+++E  R  RASA++ NTF A E
Sbjct  179   GYLETTLDWIPGMKDIRFRDLPSFIRTTDRNDIMLNFVVRELERTSRASAVVFNTFYAFE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVK-DINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              + L  L +M PP+Y++GPLQ L  Q+  D N+  + S+LWKE   C++WLDTK PNSVV
Sbjct  239   KDVLDVLSTMFPPIYSIGPLQLLVDQIPIDRNLGNIGSNLWKEQPECIDWLDTKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV+TP Q+ EFAWGLA+SKKPFLWIIRPDLV GE A+LP EFV ETKDRGML+
Sbjct  299   YVNFGSITVITPQQMIEFAWGLASSKKPFLWIIRPDLVIGENAMLPAEFVSETKDRGMLA  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SW PQEQ+L HPAVGGFL+H GWNSTL+S+  GVPM+CWPFFAEQQTNC ++CT+WG+GM
Sbjct  359   SWGPQEQILKHPAVGGFLSHMGWNSTLDSMSGGVPMVCWPFFAEQQTNCRFACTEWGVGM  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RDEV+K+V  LM+ +KG+EMK KAME K  A EAA   P GSSH N+++ +  
Sbjct  419   EIDNNVKRDEVKKLVEVLMDGKKGKEMKSKAMEWKTKAEEAAK--PGGSSHNNLDRLVKF  476

Query  1461  L  1463
             +
Sbjct  477   I  477



>ref|XP_011092429.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=478

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/471 (69%), Positives = 384/471 (82%), Gaps = 7/471 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKG-FHITFVNTEFNHRRLQRSLGP  200
             MGSL   + KPHAVCIPYPAQGH+NPMLKLAK+LHH G FHITFVNTE+NHRRL +S GP
Sbjct  1     MGSLPRPESKPHAVCIPYPAQGHVNPMLKLAKLLHHHGGFHITFVNTEYNHRRLIKSGGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              ++ GL  FRF TIPDGLP S+AD TQD+PSLC ST+ TCL PF DLL++LN    S AP
Sbjct  61    SAVEGLSDFRFHTIPDGLPPSDADTTQDVPSLCVSTTTTCLEPFCDLLSKLN----SEAP  116

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDGVMSFT+ AAE  G+PEV+FWTTSACGFLGY  Y +L+++G+TPL+D S +T
Sbjct  117   PVSCIVSDGVMSFTLKAAERFGLPEVLFWTTSACGFLGYRQYRRLVEEGHTPLRDMSQVT  176

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NG+ ET +DWV GMK IRLRD PSF+RTT+P + ML F++QE   A RA A+I+NTFDAL
Sbjct  177   NGHFETVIDWVPGMKDIRLRDFPSFIRTTDPKDIMLNFLIQEAEAAPRAKALIINTFDAL  236

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L AL +  P +Y VGPLQ +   V+D  + A+ASSLWKED SC+EWLDTK P SVV
Sbjct  237   ERDVLDALSASFPRIYTVGPLQLMMDHVQDERLGAMASSLWKEDLSCMEWLDTKEPESVV  296

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT DQ+SEFAWGLANSKKPFLW+IRPDLV G+ A+LPPEFV ETKDR  L 
Sbjct  297   YVNFGSITVMTADQMSEFAWGLANSKKPFLWVIRPDLVAGDKAMLPPEFVTETKDRSRLM  356

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPAVGGFLTH+GWNST+ESI  GVP++CWPFFAEQQTNC +SC +WG+GM
Sbjct  357   SWCPQEQVLKHPAVGGFLTHSGWNSTIESIVGGVPVICWPFFAEQQTNCRFSCVEWGMGM  416

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSH  1433
             EIDNNV R EVE +V+ELM+ EKG++MK KA+E K+ A EAA   P GSS+
Sbjct  417   EIDNNVKRGEVEALVKELMDGEKGKKMKEKALEWKRKAEEAA--APGGSSY  465



>ref|XP_009391314.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 375/475 (79%), Gaps = 3/475 (1%)
 Frame = +3

Query  54    PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFRF  233
             PHAVCIPYPAQGHI PMLKLAK+LH KGF ITFVNTE+NHRRL  + GP +L GLP FRF
Sbjct  9     PHAVCIPYPAQGHITPMLKLAKLLHSKGFRITFVNTEYNHRRLLNARGPSALDGLPDFRF  68

Query  234   ETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGVM  413
             ETIPDGLP S+ DATQDIP+LC ST  TCL PF DLL+ LND + S  PPVSCIVSDGVM
Sbjct  69    ETIPDGLPPSDDDATQDIPALCRSTMTTCLPPFLDLLSELNDPS-SERPPVSCIVSDGVM  127

Query  414   SFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDWV  593
             SFT+DAA +LGIPEV+FWTTSACGF+GY+HY  L+++G TPLKD   LTNGYL+T +DWV
Sbjct  128   SFTLDAARQLGIPEVLFWTTSACGFMGYIHYRHLVERGLTPLKDVDELTNGYLDTPVDWV  187

Query  594   KGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQSM  773
              GMK +RLRD PSF+RTT+P++ ML  ++ ETGRA  ASAI+LNTFD LE   L A+ ++
Sbjct  188   PGMKNMRLRDFPSFIRTTDPNDTMLHILMAETGRASMASAIVLNTFDELESSVLNAMAAI  247

Query  774   LPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVMT  953
             LPP+Y VGPLQ L  Q+    + A+ S+LWKE+ +CL WL  K P SVVYVN+GSITVMT
Sbjct  248   LPPMYTVGPLQLLTSQIPPSPLDAMGSNLWKEEPACLRWLQGKKPGSVVYVNFGSITVMT  307

Query  954   PDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLGH  1133
               QL EFAWGLANS   FLWI+RPDLV GE+A+LP EF  ETK+RG+L+SWCPQE+VL  
Sbjct  308   NQQLIEFAWGLANSGYEFLWIVRPDLVKGESAVLPQEFTVETKERGLLASWCPQEEVLAQ  367

Query  1134  PAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdev  1313
             PAVGGFLTH+GWNSTLESIC+GV ML WPFFAEQQTNC Y C +WG GMEID++V R+ V
Sbjct  368   PAVGGFLTHSGWNSTLESICSGVSMLSWPFFAEQQTNCRYVCVEWGSGMEIDSDVKREVV  427

Query  1314  ekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             E ++RELM  EKG+EMKR+  E K+ A  AA   P GSS  N+E+ +  +LL  +
Sbjct  428   EGLIRELMGGEKGKEMKRRMTEWKEAAGRAAQ--PGGSSSANLERMVKEVLLPRK  480



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/482 (67%), Positives = 391/482 (81%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL + + KPHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVN+E+N +RL +S G  
Sbjct  1     MGSLGTTK-KPHAVCIPYPAQGHINPMLKLAKLLHLKGFHITFVNSEYNQKRLLKSRGSS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL  L SFRFETIPDGLP S+ DATQDIPSLCEST  TCL  F+ LLA+LN+   S+ PP
Sbjct  60    SLHALSSFRFETIPDGLPDSDVDATQDIPSLCESTVRTCLPHFRKLLAKLNN---SDGPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+DAA+ELG+PEV+FWTTSACGF+ Y+ Y QL  KG TPLKD S +TN
Sbjct  117   VSCIVSDGVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSDVTN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K I+L+D+PSF+RTT+ D+ ML +   E   A RASAIILNTFD LE
Sbjct  177   GYLETTIDWIPGIKEIQLKDIPSFIRTTDSDDIMLNYFRSECKNAPRASAIILNTFDTLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L AL S+LPPVY++GPL  L K V D  + A+ S+LWKED+ C+EWL+TK PNSVVY
Sbjct  237   HDVLEALSSILPPVYSIGPLNLLLKNVDDKELNAIESNLWKEDSECMEWLNTKEPNSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITV+T  QL EFAWGL NS K FLW+IRPDLV GE  +LPPEFVE+TK+RG+LSS
Sbjct  297   VNFGSITVVTSAQLVEFAWGLGNSNKTFLWVIRPDLVAGENVVLPPEFVEQTKNRGLLSS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC QEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGME
Sbjct  357   WCSQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  +V RD++E +V+ELM+ EKG++MK KA++ KKLA  AA   P G+S +N++  ++ +
Sbjct  417   I-EDVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKSAASG-PYGTSFLNLDNMVHEV  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 397/490 (81%), Gaps = 5/490 (1%)
 Frame = +3

Query  6     REREREMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQ  185
             +++ER+MGSL  E   PHAVC+P+PAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL 
Sbjct  4     KQKERQMGSLCPENLPPHAVCVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQRLL  63

Query  186   RSLGPESLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDT  362
             +S GP+SL GLPSFRFETIPDGLP SE A++TQD+PSLC ST   CL PF+ LL++LN++
Sbjct  64    KSRGPDSLNGLPSFRFETIPDGLPSSENANSTQDVPSLCYSTKRNCLAPFRYLLSKLNNS  123

Query  363   AVSNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLK  542
             A SN PPV+CIV D +MSFT+ A +ELG+P V+FWT S CGF+ Y+HY  L++KG+ PLK
Sbjct  124   ASSNVPPVTCIVFDCIMSFTLQAGQELGVPVVLFWTASVCGFMAYLHYRPLVEKGFVPLK  183

Query  543   DESYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIIL  722
             D SYLTNGYL+T ++W+ GM+GIRL++LPSF+RTT+PD+ M+ F + E   AR ASA+I 
Sbjct  184   DASYLTNGYLDTLINWIPGMEGIRLKNLPSFIRTTDPDDIMVNFAIGEVENARNASAVIF  243

Query  723   NTFDALEHEALMALQSMLP-PVYAVGPLQFLQKQVK-DINVRALASSLWKEDTSCLEWLD  896
             NTFD LE+E L  L S+LP P+  +GPLQ L +    +  V ++ S+LW+E   CLEWLD
Sbjct  244   NTFDDLEYEVLTHLCSILPNPILTIGPLQLLLQDQVQESVVNSIKSNLWEEQPGCLEWLD  303

Query  897   TKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEE  1076
             +K PNSV+YVN+GS+TVMTP QL EFAWGLANSKK FLW+IRPDLVTGE+AI+PPEF++E
Sbjct  304   SKEPNSVIYVNFGSVTVMTPQQLVEFAWGLANSKKTFLWVIRPDLVTGESAIIPPEFLKE  363

Query  1077  TKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYS  1256
             TK+RG+L++WCPQE+VL HP++GGFLTH+GWNST+ES+  GVPM+CWPFFAEQQTN W+ 
Sbjct  364   TKERGLLANWCPQEEVLMHPSIGGFLTHSGWNSTIESLAGGVPMICWPFFAEQQTNSWFC  423

Query  1257  CTKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHV  1436
             C KW IGMEIDN+  R E+E++V+ELM S+ G E+K KAME K  A EA  T   GSS++
Sbjct  424   CNKWCIGMEIDNDANRTEIERLVKELMNSKPGSEVKNKAMEWKMKAEEA--TSRTGSSYM  481

Query  1437  NIEKFINHLL  1466
             N++K I  +L
Sbjct  482   NLDKMITMVL  491



>ref|XP_008219457.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/482 (63%), Positives = 397/482 (82%), Gaps = 6/482 (1%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             + ++KPHAV +P+PAQGHINPML+LAK+L++KGFHITFVNTEFNH+R+  S G  +L GL
Sbjct  5     ASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGL  64

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSF+F+TIPDGLP ++ADA +++P +C+STS TCL PFK LL +LN +   ++PPV+CIV
Sbjct  65    PSFQFKTIPDGLPPADADARRNLPLVCDSTSKTCLAPFKALLTKLNSSP--DSPPVTCIV  122

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             +DGV SFT+DAAE  GIPEV+FWTTSACG +GY+ Y +L++KG TP KD     NGYL+T
Sbjct  123   ADGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDT  182

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
             E+DW+ GMK IRL+D+PSF+RTT+P++ ML +++ ET R+++ASAIILNTFDALE E + 
Sbjct  183   EIDWIPGMKDIRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVD  242

Query  759   ALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             AL ++LPP+Y++GPLQ    ++     +++A+ S+LW E+T CL WLDTK PNSVVYVN+
Sbjct  243   ALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNF  302

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GS TVMT +QL EF+WGLANSKKPFLWIIRP LV GE A++PPEF+EETK+RGML+SWCP
Sbjct  303   GSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCP  362

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QEQVL H A+GGFLTH+GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID 
Sbjct  363   QEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDG  422

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              V RD ++ +VR LM+ E+G++M++KA+E KKLA EA  T P GSS++ +E  ++ +LLS
Sbjct  423   EVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEEA--TAPKGSSYLALENVVSKVLLS  480

Query  1473  HR  1478
              R
Sbjct  481   PR  482



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 397/482 (82%), Gaps = 6/482 (1%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             + ++KPHAV +P+PAQGHINPML+LAK+L++KGFHITFVNTEFNH+R+  S G  +L GL
Sbjct  5     ASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGL  64

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSFRFETIPDGLP ++ADA +++P +C+STS TCL PF+ LL +LN +   ++PPV+CIV
Sbjct  65    PSFRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSP--DSPPVTCIV  122

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             +DGV SFT+DAAE  GIPEV+FWTTSACG +GY+ Y +L++KG TP KD     NGYL+T
Sbjct  123   ADGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDT  182

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
             E+DW+ GMK +RL+D+PSF+RTT+P++ ML +++ ET R+++ASAIILNTFDALE E + 
Sbjct  183   EIDWIPGMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVD  242

Query  759   ALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             AL ++LPP+Y++GPLQ    ++     +++A+ S+LW E+T CL WLDTK PNSVVYVN+
Sbjct  243   ALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNF  302

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GS TVMT +QL EF+WGLANSKKPFLWIIRP LV GE A++PPEF+EETK+RGML+SWCP
Sbjct  303   GSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCP  362

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QEQVL H A+GGFLTH+GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID 
Sbjct  363   QEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDG  422

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              V RD ++ +VR LM+ E+G++M++KA+E KKLA +A  T P GSS++ +E  ++ +LLS
Sbjct  423   EVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEDA--TAPKGSSYLALENVVSKVLLS  480

Query  1473  HR  1478
              R
Sbjct  481   PR  482



>gb|KHN24339.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=488

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 398/483 (82%), Gaps = 6/483 (1%)
 Frame = +3

Query  6     REREREMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQ  185
             +E  R M SL +   KPHAVC+P+P QGHINPMLKLAK+LH KGFHITFVNTE+ H+RL 
Sbjct  4     KEETRNMSSLGTIH-KPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLL  62

Query  186   RSLGPESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA  365
             +S GP+S++GLPSFRFETIPDGLP    DATQ IPSLC+ST  TCL  F++LL ++ND  
Sbjct  63    KSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIND--  120

Query  366   VSNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKD  545
              S+APPVSCIVSDGVMSFT+DAAEELG+P+++FWT SACGF+ Y+ + QL++KG  PLKD
Sbjct  121   -SDAPPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLKD  179

Query  546   ESYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILN  725
              S +TNGYLET +DW+ G+K IRLRD+PSF+RTT+ D++ML+F+  E GRAR ASAIILN
Sbjct  180   SSCITNGYLETTIDWIPGIKEIRLRDIPSFIRTTDVDDFMLEFLQWECGRARGASAIILN  239

Query  726   TFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKA  905
             TFDA+EH+ L A  S+LPPVY++GPL  L K + D ++ A+ S+LWKE+  C+EWLDTK 
Sbjct  240   TFDAIEHDVLDAFSSILPPVYSIGPLNLLVKDIDDQDLNAIQSNLWKEELECVEWLDTKE  299

Query  906   PNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKD  1085
              NSVVYVN+GSITV+T +QL EFAWGLA+S K FLW+IRPD+V GE  +LPP+FVE+TK+
Sbjct  300   SNSVVYVNFGSITVLTNEQLIEFAWGLADSNKSFLWVIRPDVVGGENVVLPPKFVEQTKN  359

Query  1086  RGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTK  1265
             RG+LSSWCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +
Sbjct  360   RGLLSSWCPQEQVLAHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKE  419

Query  1266  WGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIE  1445
             WGIG+EI  +V RD++E +VRELM+ EKG+EMK+KA++ K+LA  AA   P GSS +N+E
Sbjct  420   WGIGLEI-EDVKRDKIESLVRELMDGEKGKEMKKKALQWKELAKSAASG-PNGSSFLNLE  477

Query  1446  KFI  1454
               +
Sbjct  478   NLV  480



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 397/482 (82%), Gaps = 6/482 (1%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             + ++KPHAV +P+PAQGHINPML+LAK+L++KGFHITFVNTEFNH+R+  S G  +L GL
Sbjct  5     ASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGL  64

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSFRFETIPDGLP ++ADA +++P +C+STS TCL PF+ LL +LN +   ++PPV+CIV
Sbjct  65    PSFRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSP--DSPPVTCIV  122

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             +DGV SFT+DAAE  GIPEV+FWTTSACG +GY+ Y +L++KG TP KD     NGYL+T
Sbjct  123   ADGVSSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDT  182

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
             E+DW+ GMK +RL+D+PSF+RTT+P++ ML +++ ET R+++ASAIILNTFDALE E + 
Sbjct  183   EIDWIPGMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVD  242

Query  759   ALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             AL ++LPP+Y++GPLQ    ++     +++A+ S+LW E+T CL WLDTK PNSVVYVN+
Sbjct  243   ALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNF  302

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GS TVMT +QL EF+WGLANSKKPFLWIIRP LV GE A++PPEF+EETK+RGML+SWCP
Sbjct  303   GSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCP  362

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QEQVL H A+GGFLTH+GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID 
Sbjct  363   QEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDG  422

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              V RD ++ +VR LM+ E+G++M++KA+E KKLA +A  T P GSS++ +E  ++ +LLS
Sbjct  423   EVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEDA--TSPKGSSYLALENVVSKVLLS  480

Query  1473  HR  1478
              R
Sbjct  481   PR  482



>ref|XP_003544799.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=472

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/474 (64%), Positives = 382/474 (81%), Gaps = 15/474 (3%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             + PHAVCIPYPAQGHINPMLKLAK+LH KGFHITFVNTE+NH+R+ ++ GP SL GLPSF
Sbjct  8     NMPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGPYSLNGLPSF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP    +ATQDIPSLC+ST  TCL  F++LLA++N+   S+ PPV+CIVSDG
Sbjct  68    RFETIPDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINN---SDVPPVTCIVSDG  124

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              MSFT+DAAEELG+P+V+FWT SACGF+ Y+ Y +L++KG  PL D SY+TNGYLET ++
Sbjct  125   GMSFTLDAAEELGVPQVLFWTPSACGFMCYLQYEKLIEKGLMPLIDSSYVTNGYLETTIN  184

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             WV G+K IRL+++PSF+RTTN D+ ML ++L ET R +RASAIILNTFDALEH+ L A  
Sbjct  185   WVPGIKEIRLKEIPSFIRTTNLDDIMLDYLLSETKRTQRASAIILNTFDALEHDVLEAFS  244

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             S+LPPVY++GPL  L + V D +++A+ S+LWKE+  C++WLDTK PNSVVYVN+GSIT+
Sbjct  245   SILPPVYSIGPLNLLVEDVDDEDLKAIGSNLWKEEPECMKWLDTKEPNSVVYVNFGSITI  304

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT +QL EF+WGLANS K FLW++RPDLV GE  +L  EFV+ET++RGMLSSWCPQEQVL
Sbjct  305   MTNEQLIEFSWGLANSNKSFLWVVRPDLVAGENVVLSLEFVKETENRGMLSSWCPQEQVL  364

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HPA+G FLTH+GWNSTLES+C GVPM+CWPFFAEQQ NC + C +WGIG+E        
Sbjct  365   THPAIGVFLTHSGWNSTLESVCGGVPMICWPFFAEQQINCRFCCKEWGIGLE--------  416

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
                K+VRELM+ E G++MK K ++ K+LA  A    P GSS +N++  ++++LL
Sbjct  417   ---KMVRELMDGENGKKMKDKVLQWKELAKNATSG-PNGSSFLNLDNMVHNILL  466



>ref|XP_003544213.2| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=488

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/483 (65%), Positives = 397/483 (82%), Gaps = 6/483 (1%)
 Frame = +3

Query  6     REREREMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQ  185
             +E  R M SL +   KPHAVC+P+P QGHINPMLKLAK+LH KGFHITFVNTE+ H+RL 
Sbjct  4     KEETRNMSSLGTIL-KPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLL  62

Query  186   RSLGPESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA  365
             +S GP+S++GLPSFRFETIPDGLP    DATQ IPSLC+ST  TCL  F++LL ++ND  
Sbjct  63    KSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIND--  120

Query  366   VSNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKD  545
              S+APPVSCIVSDGVMSFT+DAAEELG+P+++FWT SACGF+ Y+ + QL++KG  PLKD
Sbjct  121   -SDAPPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLKD  179

Query  546   ESYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILN  725
              S +TNGYLET +DW+ G+K IRLRD+PSF+RTT+ D++ML+F+  E GRAR ASAIILN
Sbjct  180   SSCITNGYLETTIDWIPGIKEIRLRDIPSFIRTTDVDDFMLEFLQWECGRARGASAIILN  239

Query  726   TFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKA  905
             TFDA+EH+ L A  S+LPPVY++GPL  L K + D ++ A+ S+LWKE+  C+EWLDTK 
Sbjct  240   TFDAIEHDVLDAFSSILPPVYSIGPLNLLVKDIDDQDLNAIQSNLWKEELECVEWLDTKE  299

Query  906   PNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKD  1085
              NSVVYVN+GSITV+T +QL EFAWGLA+S K FLW+IRPD+V GE  +LPP+FVE+TK+
Sbjct  300   SNSVVYVNFGSITVLTNEQLIEFAWGLADSNKSFLWVIRPDVVGGENVVLPPKFVEQTKN  359

Query  1086  RGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTK  1265
             RG+LSSWCPQEQVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +
Sbjct  360   RGLLSSWCPQEQVLAHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKE  419

Query  1266  WGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIE  1445
             WGIG+EI  +V RD++E +VRELM+ EKG+EMK+K ++ K+LA  AA   P GSS +N+E
Sbjct  420   WGIGLEI-EDVKRDKIESLVRELMDGEKGKEMKKKGLQWKELAKSAASG-PNGSSFLNLE  477

Query  1446  KFI  1454
               +
Sbjct  478   NLV  480



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/483 (65%), Positives = 385/483 (80%), Gaps = 7/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++Q KPHAVC+PYPAQGHINPML+LAK+LH KGFHITFVNTE+NH RL RS GP 
Sbjct  1     MGS-GAKQQKPHAVCVPYPAQGHINPMLQLAKLLHSKGFHITFVNTEYNHNRLVRSRGPG  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             ++   PSFRFETI DG+P S+  D+TQDIPSLC ST   CLGPFK LLARLN+    + P
Sbjct  60    AVANRPSFRFETITDGMPPSDDVDSTQDIPSLCISTEKHCLGPFKRLLARLNEAG--DVP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSC+VSDG M FT+DAA+ELGIPEV+ WT SACGFLGY  + +L++ G  P KD ++ T
Sbjct  118   PVSCVVSDGAMFFTIDAAQELGIPEVLLWTASACGFLGYAQFGKLIELGLAPFKDANFST  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NG LE  LDWV GMK IRLRD+PSF+RTT+P+E  + +I +    ++RA+AII N+FDAL
Sbjct  178   NGDLEAVLDWVPGMKNIRLRDIPSFIRTTDPNEPTVAYIQRLVHHSKRAAAIIFNSFDAL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDIN--VRALASSLWKEDTSCLEWLDTKAPNS  914
             E + L ++ S  PP YA+GPL  L + ++ IN   +++++SLWKED  CLEWLD+  PNS
Sbjct  238   EDDVLRSISSNFPPTYALGPLHLLLESMEAINEETKSISTSLWKEDPHCLEWLDSYEPNS  297

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMT DQL EFAWGLANS +PFLWI RPDLV G++A+LPP+F+EETK+RG+
Sbjct  298   VVYVNFGSITVMTNDQLIEFAWGLANSNQPFLWIARPDLVIGDSAVLPPDFLEETKNRGL  357

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++SWC QE VL HPA+GGFLTH GWNST+E++ NGVP++CWPFFAEQQTNCWYSCTKWGI
Sbjct  358   ITSWCDQEHVLAHPAIGGFLTHCGWNSTIETLINGVPIVCWPFFAEQQTNCWYSCTKWGI  417

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEID NV R EVE+ VRELME E+G+EMKR AM+ KKLA EA   +  GSS+ N+++ I
Sbjct  418   GMEIDANVKRSEVERQVRELMEGEQGKEMKRNAMKWKKLAYEAT-AVSTGSSYNNLDEVI  476

Query  1455  NHL  1463
               L
Sbjct  477   KIL  479



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 386/475 (81%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPM+K+AK+L  KGFH+TF NT +NH RL RS GP ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKMAKLLDAKGFHVTFCNTVYNHNRLLRSRGPNAVDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCESTS  CL PFK+LL ++N  A  + PPVSCI+SDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTSKHCLAPFKELLRQIN--AKDDVPPVSCILSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWTTSACGFL Y++Y + ++KG +PLKDESYLT  YL+TE+DW
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPLKDESYLTKEYLDTEIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK +RL+D+PSF+RT NPD+ ML F+++ET R +RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPMMKNLRLKDIPSFIRTANPDDIMLNFLIRETERTKRASAIILNTFDDLEHDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY++GPL  L+KQ   +D  +  + S+LW+E+  CL+WL+TKA NSVVYVN+GSIT
Sbjct  249   IIPPVYSIGPLHLLEKQEIGEDSEIGQMGSNLWREEAECLDWLNTKAQNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+   QL+EFAWGLA + K FLW+IRPDLV G+ A++P EF+ ET+DR ML+SWCPQEQV
Sbjct  309   VLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQEQV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNS LES+C GVPM+CWPFFAEQQTNC +SC +W +G+EI  +V R
Sbjct  369   LSHPAIGGFLTHCGWNSMLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++M+ KA E ++LA EA +    GSS VN + F++ +LL
Sbjct  429   EEVEAVVRELMDGEKGKKMRVKAQEWRRLAKEATEH-KQGSSVVNFQTFVSKVLL  482



>emb|CDP01082.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/485 (67%), Positives = 392/485 (81%), Gaps = 5/485 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   + KPHAVCIP  AQGHI PML LAK+LHH GFHITFVNTEFNHRRL +S GP+
Sbjct  1     MGSIALLEKKPHAVCIPAAAQGHIGPMLNLAKLLHHNGFHITFVNTEFNHRRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP F+F+ IPDGLP S+ DATQDIP+L ES   TCLGPF++LLA LNDT+ S  PP
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDVDATQDIPTLFESMDRTCLGPFRELLAELNDTSSSKVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSD    FT+ AAEEL IPEV+FWT+SAC +LGY  Y++L++KG  PLKD SYLTN
Sbjct  121   VSCIVSDAATGFTLAAAEELSIPEVLFWTSSACSYLGYFQYAKLMEKGIIPLKDASYLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T LDW+  ++GIRL+DLPSFLRTTNPD++M+KF+LQET RAR+ASAII+NT+  LE
Sbjct  181   GYLDTVLDWIPELEGIRLKDLPSFLRTTNPDDFMVKFVLQETQRARKASAIIINTYQQLE  240

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H  L AL S LPP+Y +GPL FL   V   ++  + S+LWKE+  CLEWLD+K PNSVVY
Sbjct  241   HGVLDALSSYLPPIYTIGPLHFLDNHVHYESLTDIQSNLWKEEPECLEWLDSKDPNSVVY  300

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSI V+TP+QL EFAWGLANSK+ FLWI+RPDLV+G +AILP EF+EETK+R M + 
Sbjct  301   VNFGSIAVLTPEQLVEFAWGLANSKQNFLWILRPDLVSGSSAILPSEFLEETKERSMFAG  360

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE+VL HPAVGGFLTH+GWNST+ESI  GVP+ CWPFFA+QQTNCW+ CTKWGIGME
Sbjct  361   WCPQEKVLSHPAVGGFLTHSGWNSTIESISYGVPLFCWPFFADQQTNCWFCCTKWGIGME  420

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVE +V ELM  EKG+EMK+KAM+ KKLA  A     +  S++N+E  I+ +
Sbjct  421   IDNNVKRDEVEGLVSELMAGEKGKEMKKKAMDWKKLAETA-----VTDSNLNLENLIHQV  475

Query  1464  LLSHR  1478
             LL+ +
Sbjct  476   LLNPK  480



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 396/481 (82%), Gaps = 7/481 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             DKPHAVCIPYPAQGHINPMLKLAK+L+ +GFHITFVNT +N+RRL +S GP SL GL  F
Sbjct  8     DKPHAVCIPYPAQGHINPMLKLAKLLNSRGFHITFVNTXYNYRRLLKSRGPNSLSGLVDF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFETIPDGLP S+ DATQDIP+LC ST  +CL PF+ LL++LN+++ SN PP++CI+SDG
Sbjct  68    RFETIPDGLPPSDTDATQDIPTLCNSTKNSCLLPFRTLLSKLNNSSSSNIPPITCIISDG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAAEELGIPEV+FWTTSACGF+ Y+HY  L+++  TPLKD SYLTNGYLET +D
Sbjct  128   VMSFTLDAAEELGIPEVLFWTTSACGFMSYVHYPYLIERCLTPLKDASYLTNGYLETTID  187

Query  588   WVKG-MKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             W+ G MK IRLRDLPSF+RTTNPD+ ML F+ +E  RA+RA  IILNTFD LE + L  L
Sbjct  188   WIPGLMKDIRLRDLPSFVRTTNPDDIMLNFLKEEVERAKRAQGIILNTFDTLERKVLDGL  247

Query  765   QSMLPPVYAVGPLQ-FLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
              SM   VY+VGPL  F   Q+ ++ +++++ S+LWKE+  C+EWLD+K PNSVVYVN+GS
Sbjct  248   SSMFCRVYSVGPLHLFASNQISENDDLKSIDSNLWKEEAGCMEWLDSKKPNSVVYVNFGS  307

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITVMT +QL EFAWGLANS + FLW+IRPDLV G++A+LPPEFV+ TK+RG+L++WCPQE
Sbjct  308   ITVMTGEQLVEFAWGLANSNQTFLWVIRPDLVKGDSALLPPEFVQHTKERGLLANWCPQE  367

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT--KWGIGMEIdn  1292
             Q+L HP++G FLTH GWNSTLESICNGVPMLCWPFFAEQQTNC Y+CT  +WGIGMEI+N
Sbjct  368   QILNHPSIGVFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCRYTCTESEWGIGMEINN  427

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             +V RD+VE +VR+L+  +KG+E+K K ME KK A EA      GSS +N +K I+ +LLS
Sbjct  428   DVKRDDVESLVRQLINGDKGKELKNKVMEWKKKAQEA--ICLGGSSRLNFDKMIDQVLLS  485

Query  1473  H  1475
             +
Sbjct  486   N  486



>ref|XP_006307366.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
 gb|EOA40264.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
Length=484

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 385/475 (81%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPM+K+AK+L+ KGFH+TFVNT +NH RL +S GP ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTIYNHNRLLKSRGPNAVDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST    L PFK LL  +N  A  + PPVSCIVSDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTVKHSLAPFKKLLREIN--AKDDVPPVSCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWTTSACGFL Y+++ + ++KG +P+KDESYLT  YL+TE+DW
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGFLAYLYFYRFIEKGLSPVKDESYLTKEYLDTEIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK ++L+D+PSF+RT NPD+ ML F+++ET R +RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPMMKNLKLKDIPSFIRTANPDDIMLNFLVRETERTKRASAIILNTFDDLEHDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY++GPL  L+KQ   +D  +  + S+LWKE+T CL+WLDTKA NSVVYVN+GSIT
Sbjct  249   IIPPVYSIGPLHLLEKQEIGEDSEIGRMGSNLWKEETECLDWLDTKAQNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+   QL+EFAWGLA + K FLW+IRPDLV G+ A++P EF+ ET+DR ML+SWCPQEQV
Sbjct  309   VLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDDAMVPQEFLTETEDRRMLASWCPQEQV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +W +G+E   +V R
Sbjct  369   LSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIETGGDVNR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++M+ KA E ++LA EA D   +GSS VN+E  +  +LL
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAEEWRRLAKEATDH-KLGSSIVNLETVVRKILL  482



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 387/475 (81%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPM+K+AK+L+ KGFH+TFVNT +NH RL RS GP+++ GL SFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFVNTVYNHNRLLRSRGPKAVDGLASFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST+  CL PFK+LL ++N  A  + PPVSCI+SDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQIN--ANDDVPPVSCILSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELGIPEV+FWTTSACGFL Y++Y + ++KG  PLKDESYLT  YL+TE+DW
Sbjct  129   MSFTLDAAEELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYLTKEYLDTEIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK +RL+D+PSF+RT NPD+ M  F+++ET R +RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPVMKNLRLKDIPSFIRTANPDDIMPNFLIRETERTKRASAIILNTFDDLEHDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY++GPL  L+KQ   +D  +  + S+LW+E+  CL+WLDTKA NSVVYVN+GSIT
Sbjct  249   IIPPVYSIGPLHLLEKQEIGEDSELGRMGSNLWREEAECLDWLDTKARNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+   QL+EFAWGLA + K FLW+IRPDLV G+ A++P EF+ ET+DR ML+SWCPQEQV
Sbjct  309   VLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQEQV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +W +G+EI  +V R
Sbjct  369   LSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++M+ KA + ++LA EA +    GSS VN + F++ +LL
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAQQWRRLAKEATEH-KHGSSVVNFDTFVSKVLL  482



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/487 (64%), Positives = 387/487 (79%), Gaps = 4/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIP PAQGHINPML LAK+LH +GFH+TFVNTE+NH RL RS GP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAP  380
             SL GLPSFRF TIPDGLP S+ D TQDIP+LC+ST   CL  F+DLL RLN+ +A S +P
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDGDTTQDIPALCQSTQRCCLPYFQDLLKRLNEESATSGSP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSC+VSD  M+FT+DAAE +G+PEV+FW  SAC F+G++ +  L+DKG  PLKD SYLT
Sbjct  120   PVSCVVSDITMTFTLDAAEAIGVPEVLFWPISACAFMGFLQFRSLIDKGLVPLKDASYLT  179

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NG L+T +DW+ GM+ IRLRDLPSF+RTT+PD+ M+ F L E  RA+RASA + NTF+ L
Sbjct  180   NGNLDTVIDWIPGMRNIRLRDLPSFIRTTDPDDPMINFCLVEFARAKRASAWVFNTFERL  239

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             EHE L AL++M PP+Y +GP+  L +Q+ D + R +  +LWKED  CLEWLD+K P+SV+
Sbjct  240   EHEVLEALKAMFPPIYTIGPIHLLLEQLSDDDTRLIRFNLWKEDLGCLEWLDSKPPSSVL  299

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV++P QL EFAWGLANS + FLW+IRPDLV G  AILPP+F+  T++R +L+
Sbjct  300   YVNFGSITVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLA  359

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VL H AVGGFLTH GWNS +ESI   VP++CWPFFA+QQTNC YSC +WGIGM
Sbjct  360   SWCPQERVLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGM  419

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDN+V RDEVE+ VRELME  +G+EMKRK ME K++A EA  T P GSS +N+++ IN 
Sbjct  420   EIDNDVRRDEVERQVRELMEGGRGKEMKRKVMEWKEMAREA--THPSGSSFLNLDEVINK  477

Query  1461  LLLSHRK  1481
             +LLS R+
Sbjct  478   VLLSPRR  484



>ref|XP_003544801.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=479

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/483 (65%), Positives = 394/483 (82%), Gaps = 5/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL + + KPHAVC+P+PAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL ++ GP+
Sbjct  1     MGSLEAIK-KPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL SFRFET+ DGLP  + + TQ +PSLC+ T  TCL  F++LL++LND+   + P 
Sbjct  60    SLNGLSSFRFETLADGLPQPDIEGTQHVPSLCDYTKRTCLPHFRNLLSKLNDSP--DVPS  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSC+VSDG+MSFT+DAA+ELG+P V+FWTTSACGF+ Y+ Y QL+++  TPLKD SYLTN
Sbjct  118   VSCVVSDGIMSFTLDAAQELGVPNVLFWTTSACGFMCYVQYQQLVERDLTPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ G+K IRL+D+P+F+RTT+PD+ ML F   E  RA++ASAIILNTFDALE
Sbjct  178   GYLETSIDWIPGIKEIRLKDIPTFIRTTDPDDIMLNFARGECIRAQKASAIILNTFDALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             H+ L A  ++LPPVY++GPL FL  +VKD ++ A+ S+LWKE+  CLEWLDTK  N+VVY
Sbjct  238   HDILEAFSTILPPVYSIGPLNFLLNEVKDKDLNAIGSNLWKEEPGCLEWLDTKEVNTVVY  297

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+TVMT DQL EFAWGLA S K F+W+IRPDLV GE AILP EFV +TK+RG+LSS
Sbjct  298   VNFGSVTVMTNDQLIEFAWGLAASNKTFVWVIRPDLVIGENAILPKEFVAQTKNRGLLSS  357

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQEQVL HPA+GGFLTHNGWNSTLES+C GVPM+CWPFFAEQ TNC + C +WGIG+E
Sbjct  358   WCPQEQVLAHPAIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQHTNCRFCCKEWGIGLE  417

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I  ++ R ++E +VRELM+ EKG+EMK+KA+E K+LA  AA + P G S V  EK I  +
Sbjct  418   I-EDIERGKIESLVRELMDGEKGKEMKKKALEWKRLAKVAASS-PSGYSLVQFEKMIREV  475

Query  1464  LLS  1472
             L++
Sbjct  476   LIA  478



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 374/474 (79%), Gaps = 4/474 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             ++K HAVC+P+PAQGHINPMLKLAK+LH  GF+ITFVNT +NH+RL +S G  SL GLPS
Sbjct  7     KEKQHAVCVPFPAQGHINPMLKLAKLLHFNGFYITFVNTHYNHKRLLKSRGLNSLNGLPS  66

Query  225   FRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             FRFETIPDGLP  E + T  +PSLC+STS TCL  F++LL++LN+   S  P VSCI+SD
Sbjct  67    FRFETIPDGLPEPEVEGTHHVPSLCDSTSTTCLPHFRNLLSKLNNE--SGVPAVSCIISD  124

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             GVMSFT+DA++ELG+P V+FWT+SACGF+ Y+HY QL+ +G  P KD S LTNGYL+T +
Sbjct  125   GVMSFTLDASQELGLPNVLFWTSSACGFMCYVHYHQLIQRGIVPFKDASDLTNGYLDTTI  184

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DWV G+K IRL+D+PSF+RTT+P++ ML F   E  RA +ASAIILNTFDALEH+ L A 
Sbjct  185   DWVAGIKEIRLKDIPSFIRTTDPEDIMLNFARDECIRAEKASAIILNTFDALEHDVLEAF  244

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
              S+LPPVY++GPL FL   V D  + A+ S+LW+E+  CLEWLDTK  N+VVYVN+GS+T
Sbjct  245   SSILPPVYSIGPLSFLLNNVTDKRLNAIGSNLWREEPGCLEWLDTKEANTVVYVNFGSVT  304

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT +Q+ EFAWGLANSKK F+W+IRPDLV GE A+LP EFV +TK+RGMLS WCPQEQV
Sbjct  305   VMTNEQMIEFAWGLANSKKSFVWVIRPDLVVGERAVLPQEFVTQTKNRGMLSGWCPQEQV  364

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             LGHPA+G FLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI++    
Sbjct  365   LGHPAIGVFLTHSGWNSTLESLCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEIEDVERD  424

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
                  V   +M+ EKG++MKRKA+  K LA +AA + P GSS V  +K I  +L
Sbjct  425   HIERLVRA-MMDGEKGKDMKRKAVNWKILAEKAA-SAPTGSSFVQFQKLIREVL  476



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/474 (64%), Positives = 380/474 (80%), Gaps = 5/474 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             K H VC+PYPAQGHINPM+K+AK+LH KGF++TFVNT +NH+RL RS G  +L GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST    L PFK+LL R+N  A    PPV+CIVSDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN--AQDEVPPVNCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWTTSACGFL Y+HY + ++KG +PLKDESYLT  +L+T +DW
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKDESYLTKEHLDTIIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK +RL+D+PSF+RTTNP++ ML F+++ET RA+RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPSMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY++GPL    KQ   +D  +  + S+LWKE+T C++WL+TKAPNSVVYVN+GSIT
Sbjct  249   IVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL EFAWGLA + K FLW+IRPDLV GE +++PPEF+ ET DR ML+SWCPQE+V
Sbjct  309   VMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEEV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC + C +W IG+EI  +V R
Sbjct  369   LSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDVRR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +EVE VVRELM+ EKG++M+ KA E + LA E A     GSS VN +  +  LL
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAAEWRSLA-EKATECKRGSSVVNFDNVVKVLL  481



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/478 (64%), Positives = 379/478 (79%), Gaps = 3/478 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQ HIN ML LAK+LH +GFH+TFVNTE+NH RL RS GP SL  LPSFR
Sbjct  9     KPHAVCIPFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVSDG  407
             F TIPDGLP S+ DATQDIP+LC+ST   CL  F+DLL RL++ +A S +PPVSC+VSD 
Sbjct  69    FRTIPDGLPPSDGDATQDIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVSDV  128

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
               +FT+DAAE +G+PEV+FW  SAC F+G++ +  L+D+G  PLKD SYLTNGYL+T +D
Sbjct  129   STTFTLDAAEAVGVPEVLFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLDTIID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ IRLRDLPSF+RTT+PD+ ML F L E  RA+RASA + NTF+ LEHE L AL+
Sbjct  189   WIPGMRNIRLRDLPSFIRTTDPDDPMLNFCLVEFARAKRASAWVFNTFERLEHEVLEALK  248

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GP+  L +Q+ D + R +  +LWKED  CLEWLD K P SVVYVN+GSITV
Sbjct  249   AMFPPIYTIGPIHLLLEQLSDDDTRLIRFNLWKEDLGCLEWLDLKPPGSVVYVNFGSITV  308

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+P QL EFAWGLANS + FLW+IRPDLV G  AILPP+F+  T++R +L SWCPQE+VL
Sbjct  309   MSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQERVL  368

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H AVGGFLTH GWNS +ESI   VP+ CWPFFA+QQTNC YSC +WGIGMEID++V RD
Sbjct  369   SHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRD  428

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             EVE+ VRELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ +LLS R+
Sbjct  429   EVERQVRELMEGERGKEMKRKAMEWKEMAREA--TCPSGSSFLNLDEVIDKVLLSSRR  484



>gb|AID16086.1| flavonol-3-O-glucoside L-rhamnosyltransferase, partial [Morus 
alba]
Length=447

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/423 (71%), Positives = 356/423 (84%), Gaps = 5/423 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL S  +KPHAVCIP+PAQGH+NPMLKLAK+LH KGFHITFVNTEFNH+RL +S G  
Sbjct  1     MGSL-SFLEKPHAVCIPFPAQGHVNPMLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAH  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLPSFRFE IPDGLP ++ADATQ IP++CEST    L PF+DLL +LN +     PP
Sbjct  60    ALDGLPSFRFEAIPDGLPPTDADATQSIPAICESTPKHSLAPFRDLLLKLNSSP--EVPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSC+VSDG MSFT+DAAEELGIPEV+FWTTSACGFLGY+HY  L++KGYTPLKDESYLTN
Sbjct  118   VSCVVSDGAMSFTLDAAEELGIPEVLFWTTSACGFLGYLHYRALVEKGYTPLKDESYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              YL T +DW+ GMK IRL+D+P+F+RTT+P++ M+ F++ E  RA++ASAIILNTF  LE
Sbjct  178   EYLNTVIDWIPGMKDIRLKDIPTFIRTTDPNDIMVNFVITEAERAQKASAIILNTFYDLE  237

Query  744   HEALMALQSM-LPPVYAVGPLQFLQKQVKDI-NVRALASSLWKEDTSCLEWLDTKAPNSV  917
              +A+ A+ S+  PPVY +G LQ L  Q     ++++L S+LWKED  CLEWLD+K PNSV
Sbjct  238   RDAVNAISSISKPPVYTLGSLQLLLNQFPIAEHLKSLESNLWKEDHKCLEWLDSKEPNSV  297

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITVMT +QL EFAWGLANSKK FLW++RPDLV GE+A+LPPEF EET +RG L
Sbjct  298   VYVNFGSITVMTSEQLVEFAWGLANSKKEFLWVLRPDLVGGESAVLPPEFSEETSERGFL  357

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VLGHPAVGGFLTH GWNST+ESIC+GVPMLCWPFFAEQQTNCWYSC +WGIG
Sbjct  358   TSWCPQEKVLGHPAVGGFLTHCGWNSTIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIG  417

Query  1278  MEI  1286
             MEI
Sbjct  418   MEI  420



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/488 (63%), Positives = 388/488 (80%), Gaps = 6/488 (1%)
 Frame = +3

Query  24    MGSLR-SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS   S   KPHAVC+PYPAQGHINPMLK+AK+LH +GFH+TFVNT +NH RL RS G 
Sbjct  1     MGSAAVSGAQKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTIYNHNRLLRSRGA  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSF+FE+IPDGLP ++A+ATQDIP+LCEST   CL PFKDLL ++N  A  + P
Sbjct  61    NALDGLPSFQFESIPDGLPETDAEATQDIPALCESTMKNCLTPFKDLLQQIN--ARDDVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+DAA+ELG+PEV+FWTTSACGFL Y+H+ + ++KG +PLKDESYLT
Sbjct  119   PVSCIVSDGCMSFTLDAADELGVPEVLFWTTSACGFLAYLHFYRFIEKGLSPLKDESYLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               +L+T++DW+  MK +RL+D+P+F+R TN D+ ML  +++ET RA+RASAIILNTFD L
Sbjct  179   EEHLDTKIDWIPSMKNLRLKDIPTFIRATNHDDIMLNCLIRETDRAKRASAIILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH+ L ++QS+LP VY++GPL  L  +   K   +  + S+LW+E+  CL+WL+TK  NS
Sbjct  239   EHDVLHSIQSILPLVYSIGPLHLLANREIEKGSEIGKMGSNLWREEADCLDWLNTKTRNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMT  QL EFAWGLA S K FLW+IRPDLV GE A++PPEF++ET  R M
Sbjct  299   VVYVNFGSITVMTAKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLKETAGRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L SWCPQE+VL HPA+GGFLTHNGWNSTLES+C GVPM+CWPFFAEQQTNC ++C +W +
Sbjct  359   LVSWCPQEKVLSHPAIGGFLTHNGWNSTLESLCGGVPMVCWPFFAEQQTNCKFTCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEI  +V R+EVE VVRELM+ EKG++M+ KA E ++LA EA +   +GSS VN E  +
Sbjct  419   GMEIGGDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAGEATEH-KLGSSVVNFETVV  477

Query  1455  NHLLLSHR  1478
             N  LL  +
Sbjct  478   NKALLGQK  485



>ref|XP_008808008.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/485 (65%), Positives = 380/485 (78%), Gaps = 10/485 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  E  KPH VCIPYPAQGH+ PMLKLAK+LH KGFHITFVNTEFNH RL +S GP 
Sbjct  1     MGSVAFE--KPHVVCIPYPAQGHVTPMLKLAKLLHSKGFHITFVNTEFNHCRLLKSRGPS  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP FRF TIPDGLP S+ADATQDIPSLC ST  TCL  F+ LL+ L+       PP
Sbjct  59    ALDGLPDFRFATIPDGLPPSDADATQDIPSLCYSTMTTCLPHFRRLLSMLD------GPP  112

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             ++CI+SDGVMSFT+DAA+ELG+PEV+FWTTSACGF+ Y+HY  L++KG  PLKD S LTN
Sbjct  113   LTCIISDGVMSFTLDAAKELGVPEVLFWTTSACGFMSYLHYRHLIEKGLVPLKDASDLTN  172

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T LDW+ G+K +RLRD+PSF+RTT+PD+ M+ F L E  R   ASAIILNTFD LE
Sbjct  173   GYLDTPLDWIPGLKNMRLRDIPSFIRTTDPDDTMINFALHECERTAMASAIILNTFDELE  232

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
                L A+ ++LPP+Y +GPL  L +QV    V AL S+LWKE+T+CL WL  K P SVVY
Sbjct  233   QPVLAAMAAVLPPIYTIGPLTLLARQVPTSPVAALGSNLWKEETACLNWLAGKNPKSVVY  292

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVMT  QL EFAWGLAN+   FLWI RPDLV G+AA+LP EF+EETK+RG+L+S
Sbjct  293   VNFGSITVMTNQQLIEFAWGLANTGHEFLWITRPDLVKGDAAVLPQEFLEETKERGLLAS  352

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE++L +PA+GGFLTH+GWNST+ESIC GVPM+ WPFFAEQ TNC Y CT+WGIGME
Sbjct  353   WCPQEEILSNPAIGGFLTHSGWNSTVESICEGVPMVSWPFFAEQPTNCRYVCTEWGIGME  412

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID+NV R+ VE ++RELM  EKG EMK +AM  K+ A+ A  T P G S +N+E+ +  +
Sbjct  413   IDSNVKREVVEGMIRELMRGEKGEEMKERAMGWKESAVRA--TRPGGPSSLNLERLVTEV  470

Query  1464  LLSHR  1478
             LLS +
Sbjct  471   LLSKK  475



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/474 (65%), Positives = 378/474 (80%), Gaps = 3/474 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LHHKGFHITFVNTE NH+RL RS GP SL GLP F
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-PPVSCIVSD  404
             RF+ IPDGLP S+AD+TQDIPSLC S S   L  F+ LL +L + +     PPV+CIVSD
Sbjct  68    RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVSD  127

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G M+FTVDAAEEL IPEV+FWT SACG  G   Y +L++ G+TPLKD +YL+NGYLET +
Sbjct  128   GGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETTV  187

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
              W  GMK IRLRD+P+F+RT +  + ML F++QE  R+ RASA+ILNTFD LEH+ L +L
Sbjct  188   SWTSGMKSIRLRDIPTFIRTLDHQDIMLNFVIQEVERSSRASAVILNTFDTLEHDVLESL  247

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
              S+ P +Y +GPLQ L  Q++D  +R +  +LW+E+  CL WLD+K P SVVYVN+GSIT
Sbjct  248   SSVFPHIYTIGPLQLLADQIQDEALRLVGGNLWREEPECLSWLDSKEPGSVVYVNFGSIT  307

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             V+T  QL+EFAWGLANS+KPFLWIIRPDLV  E+A+LPPEFVEE   RGML+ WC QE+V
Sbjct  308   VITAGQLTEFAWGLANSQKPFLWIIRPDLVATESAVLPPEFVEEIAGRGMLAHWCRQEEV  367

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L H A+GGFLTH+GWNSTLES+C GVP++CWPFF +QQTNC YSCT+WGIGMEIDN+V R
Sbjct  368   LKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFGDQQTNCRYSCTEWGIGMEIDNDVKR  427

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             DEVE +VRELME EKG+EM++KAME K  A EA   +P G+S+ N+EK I+ +L
Sbjct  428   DEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEA--IMPGGTSYNNVEKLISEVL  479



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/484 (63%), Positives = 394/484 (81%), Gaps = 5/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS +   +KPHAV IPYPAQGHINPML+LAK+L++KGFHITFVNTEFNHRRL ++ GP 
Sbjct  1     MGS-KGMIEKPHAVFIPYPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHRRLLKARGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSFRFETIPDGLP ++ +ATQDI +LC ST   CL PFKDLL++LN  ++ N+PP
Sbjct  60    SLDGLPSFRFETIPDGLPTTDVNATQDITALCFSTRKNCLEPFKDLLSKLN--SLPNSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG M+FT++AA+ELGIP V+F T SACG +GY+    L++KG  PLKD SYLTN
Sbjct  118   VTCIVSDGGMTFTLEAAQELGIPVVIFATASACGLMGYLQLRPLIEKGLIPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+GIRLRD+P+F+RTT+P++ ML+F+  E GR  RASA ILNTF A E
Sbjct  178   GYLDTVIDWIPGMRGIRLRDIPTFIRTTDPNDIMLEFLRVEIGRYHRASAFILNTFYAFE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDIN-VRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE L AL ++LPP+Y+VGPL     Q+   N ++++ S+LW E+  CLEWLD+K PNSVV
Sbjct  238   HEVLDALSTLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV+T +QL+EFAWGLANS + FLW+IRPDL+ GE+A++P EF EETK+R +++
Sbjct  298   YVNFGSITVLTEEQLTEFAWGLANSNQTFLWVIRPDLLVGESAVVPSEFSEETKERSLVA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQ++VL HPA+GGFLTH+GWNS LES+C GVPM+CWPFFAEQQ NC +SC  WGIGM
Sbjct  358   SWCPQQEVLSHPAIGGFLTHSGWNSILESLCGGVPMICWPFFAEQQMNCRFSCKVWGIGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V RD +E +VR++ME E+G+EM++KA+E KKLA EA  T P G+S V++++  + 
Sbjct  418   EIEGDVKRDYIEGLVRKIMEGEEGKEMRKKALEWKKLATEAT-TSPNGTSFVDLDRMASQ  476

Query  1461  LLLS  1472
             +L S
Sbjct  477   VLQS  480



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/479 (65%), Positives = 379/479 (79%), Gaps = 5/479 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIPYPAQGHINPMLKLAK LHHKGFHITFV+TE+N++RL RS GP S+ GLP FR
Sbjct  9     KPHAVCIPYPAQGHINPMLKLAKFLHHKGFHITFVHTEYNYKRLLRSRGPNSVDGLPDFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVS--D  404
             FE I DGLP ++ADATQDIPSLC+STS  CL PF+DLL +LND A +++          D
Sbjct  69    FEAIKDGLPHTDADATQDIPSLCDSTSKNCLAPFRDLLYKLNDVAAASSSIPPVSSIVSD  128

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G MSFTV AAEE GIP+V+FWT SACGFL Y+    L+++G TP+KD +YLTNGYL+  +
Sbjct  129   GGMSFTVKAAEEFGIPDVLFWTPSACGFLCYLQLPSLVERGLTPVKDANYLTNGYLDKVI  188

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+ GMK IR RDLPSF+RT +P++ M  ++L+E  RA +ASAI+LNTFD+LE + L AL
Sbjct  189   DWIPGMKNIRFRDLPSFVRTMDPNDMMFNYLLKEVERAYKASAIVLNTFDSLEQDVLDAL  248

Query  765   QS-MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
                +LPPVY++GPL  L   ++D     + S+LWKE T C+EWL++K PNSVVYVNYGSI
Sbjct  249   SGVLLPPVYSIGPLHLLVDWIRDDESEDINSNLWKEQTECIEWLNSKEPNSVVYVNYGSI  308

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TVMTP+QL EFAWGLANS++ FLWIIRPDLV GE AILPP+FV ETKDRGML+SWCPQEQ
Sbjct  309   TVMTPEQLIEFAWGLANSQRQFLWIIRPDLVAGETAILPPDFVSETKDRGMLASWCPQEQ  368

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL HP++GGFL+H GWNSTLES+C GVPM+CWPFFAEQQ NC ++C  WGIGMEID NV 
Sbjct  369   VLKHPSIGGFLSHMGWNSTLESLCCGVPMVCWPFFAEQQLNCRFACRNWGIGMEIDTNVK  428

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             R++VEK+VREL+E EKG EMK KAME K+ A EA    P GSS  N+EK +  +L + +
Sbjct  429   REDVEKLVRELLEGEKGMEMKTKAMEWKREAEEAIR--PGGSSFQNLEKLVAEVLQTDK  485



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/478 (64%), Positives = 380/478 (79%), Gaps = 3/478 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQ HIN ML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSFR
Sbjct  4     KPHAVCIPFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLLRSRGPSSLDGLPSFR  63

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAPPVSCIVSDG  407
             F TIPDGLP S+ DATQD+P+LC+ST   CL  F+DLL RLN+ +A S +PPVSC+VSDG
Sbjct  64    FRTIPDGLPPSDDDATQDVPALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSDG  123

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
               +FT+DAAE +G+PEV+FW  SAC F+G++H+  L+D+G  PLKD SYLTNGYL+T +D
Sbjct  124   WTTFTLDAAEAVGVPEVLFWPISACAFMGFLHFRSLVDEGRAPLKDASYLTNGYLDTIID  183

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ IRLRDLPSF+RTT+PD+ +L F L E  R +RASA + NTF+ LEHE L AL+
Sbjct  184   WIPGMRNIRLRDLPSFIRTTDPDDPILNFCLVEFARVKRASAWVFNTFERLEHEVLDALK  243

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GP+  L +Q+ D + R + S+L +ED  CLEWLD+K P SVVYVN+GSI V
Sbjct  244   AMFPPIYTIGPIHLLVEQLSDDDTRPIRSNLLEEDLGCLEWLDSKPPGSVVYVNFGSIIV  303

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+P QL EFAWGLANS + FLW+IRPDL+ G  AILPP+F+  T++R +L+SWCPQE+VL
Sbjct  304   MSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQERVL  363

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H AVGGFLTH  WNST+ESI   VP+ CWPFF +QQTNC YSC +WGIGMEID++V RD
Sbjct  364   SHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVRRD  423

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             EVE+ VRELME E+G+EMKRKAME ++ A EA  T P GSS +N+E  IN +LLS R+
Sbjct  424   EVERQVRELMEGERGKEMKRKAMEWQETAREA--TRPSGSSFLNLEGVINEVLLSPRR  479



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 395/487 (81%), Gaps = 4/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S+     K HAV +P+P+QGHINP+++LAK+LH+KGFHITFVNTE+NH+RL +S GP+
Sbjct  1     MSSIALTSKKSHAVFVPFPSQGHINPLMQLAKLLHYKGFHITFVNTEYNHKRLLKSRGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GLP+FRFETI DGLP ++ADATQDIPSLC+STS   L  F+DLL++LN +   ++P 
Sbjct  61    ALNGLPTFRFETISDGLPPTDADATQDIPSLCDSTSKHSLPHFRDLLSKLNSSP--DSPR  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+C+++DGVMSFT+DAA+ELG+P V FWT SACGF+GY+ + QL++KG TP +D SY TN
Sbjct  119   VTCLITDGVMSFTLDAAQELGVPAVFFWTPSACGFMGYVQFHQLIEKGLTPFEDASYFTN  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             G+L T LDWV GM+ IRL+DLP+F+RTT PD+ ML F++ ET R ++ASA+ILNTF  LE
Sbjct  179   GHLNTVLDWVPGMRNIRLKDLPTFMRTTEPDDIMLNFLVGETERTKKASAVILNTFHDLE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDIN-VRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE + +L ++LPPVY++GPL    KQ+   N ++++ S+LW E+  CL+WLDTK PNSVV
Sbjct  239   HEVIDSLSTLLPPVYSIGPLNLQLKQIPAENELKSIVSNLWTEEPECLQWLDTKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSI V T +QL EFAWGLANSKK FLW+IRPDLV GE+A++P EF+EETKDR +L+
Sbjct  299   YVNFGSIAVTTNEQLIEFAWGLANSKKKFLWVIRPDLVRGESAVVPAEFLEETKDRSLLA  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
              WCPQEQVL HPAVGGFLTH+GWNSTLES+C GVP++CW F  EQ TNC YSC +WG+G+
Sbjct  359   HWCPQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPLICWSFCGEQPTNCRYSCREWGVGL  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             E+ ++V R+ VE++VR+LME E+G++M++KA+E KKLA E A T P GSS +++E+ +N 
Sbjct  419   EVGDDVKRNYVEELVRKLMEGEEGKKMRKKALEWKKLA-EEATTGPYGSSFLDLEQMVNK  477

Query  1461  LLLSHRK  1481
             +LLS + 
Sbjct  478   VLLSSKN  484



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/479 (65%), Positives = 378/479 (79%), Gaps = 3/479 (1%)
 Frame = +3

Query  33    LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLR  212
             + S  +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTE NH+RL RS GP SL 
Sbjct  10    ITSLANKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLD  69

Query  213   GLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-PPVS  389
             GLP FRF+ IPDGLP S+AD+TQDIPSLC S S   L  F+ LL +L D +     PPV+
Sbjct  70    GLPHFRFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVT  129

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
              IVSDG+M+FTVDAAEEL IPEV+FW  SACG  G   Y +L++ G+TPLKD +Y +NGY
Sbjct  130   RIVSDGLMAFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLKDPTYFSNGY  189

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             LET + W  GMK IRLRD P+F+RT +  + +L FI+QE  R+ RASAIILNTFD LEH+
Sbjct  190   LETMVSWTSGMKSIRLRDFPTFIRTLDHQDILLNFIIQEVERSSRASAIILNTFDTLEHD  249

Query  750   ALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVN  929
              L +L S+ P +Y +GPLQ L  Q++D  +R++  SLW+E+  CL WLD+K P SVVYVN
Sbjct  250   VLESLSSVFPHIYTIGPLQLLADQIQDEALRSVGGSLWREEPECLPWLDSKEPGSVVYVN  309

Query  930   YGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWC  1109
             +GSITVMT  QL EFAWGLANS+KPFLWIIRPDLV  E+A+LPPEF+EE   RGML+ WC
Sbjct  310   FGSITVMTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWC  369

Query  1110  PQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEId  1289
              QE+VL H A+GGFLTH+GWNSTLES+C+GVP++CWPFF +QQTNC YSCT+WGIGMEID
Sbjct  370   RQEEVLKHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEID  429

Query  1290  nnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             N+V RDEVE +VRELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+ +L
Sbjct  430   NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEA--IMPSGTSYNNVDKLISEVL  486



>emb|CDP21827.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/385 (74%), Positives = 338/385 (88%), Gaps = 0/385 (0%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTEFNH+RL +S GP++L GLP F
Sbjct  8     EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             +F+ IPDGLP ++ DATQD+PSL EST+  CLGPF+DLLA LND + S  PPVSCIVSDG
Sbjct  68    QFKAIPDGLPPADVDATQDVPSLSESTTTHCLGPFRDLLAELNDPSSSQVPPVSCIVSDG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              MSFT++AA ELG+PE++FWT SACGFLGYMHY++L++KG  PLKD SYL+NGYLE  LD
Sbjct  128   AMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLIPLKDASYLSNGYLEQALD  187

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GMK IRLRDLPSFLRTTNPD+YM+KF+LQET RA++A AIILNTF+ LE + + AL 
Sbjct  188   WIPGMKDIRLRDLPSFLRTTNPDDYMVKFVLQETERAKKALAIILNTFEELEEDVINALS  247

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             ++LPP+YA+GPLQ LQK+VKD  +  + S+LWKE+  CLEWLD K PNSVVYVN+GS+TV
Sbjct  248   AILPPIYAIGPLQLLQKEVKDERLSVVGSNLWKEEPECLEWLDPKDPNSVVYVNFGSVTV  307

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MTPDQL EFAWGLANSK+ FLWIIRPDLV+G  AILPPEF+EETKDRG+L+SWCPQEQVL
Sbjct  308   MTPDQLVEFAWGLANSKQTFLWIIRPDLVSGACAILPPEFLEETKDRGLLASWCPQEQVL  367

Query  1128  GHPAVGGFLTHNGWNSTLESICNGV  1202
              HPA+GGFLTH+GWNSTLESIC+GV
Sbjct  368   SHPAIGGFLTHSGWNSTLESICSGV  392



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/475 (64%), Positives = 380/475 (80%), Gaps = 6/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             K H VC+PYPAQGHINPM+K+AK+LH KGF++TFVNT +NH+RL RS G  +L GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST    L PFK+LL R+N  A    PPV+CIVSDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN--AQDEVPPVNCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLK-DESYLTNGYLETELD  587
             MSFT+DAAEELG+PEV+FWTTSACGFL Y+HY + ++KG +PLK DESYLT  +L+T +D
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKADESYLTKEHLDTIID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+  MK +RL+D+PSF+RTTNP++ ML F+++ET RA+RASAIILNTFD LEH+ + ++Q
Sbjct  189   WIPSMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQSMQ  248

Query  768   SMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
             S++PPVY++GPL    KQ   +D  +  + S+LWKE+T C++WL+TKAPNSVVYVN+GSI
Sbjct  249   SIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGSI  308

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TVMT  QL EFAWGLA + K FLW+IRPDLV GE +++PPEF+ ET DR ML+SWCPQE+
Sbjct  309   TVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEE  368

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC + C +W IG+EI  +V 
Sbjct  369   VLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDVR  428

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             R+EVE VVRELM+ EKG++M+ KA E + LA E A     GSS VN +  +  LL
Sbjct  429   REEVEAVVRELMDGEKGKKMREKAAEWRSLA-EKATECKRGSSVVNFDNVVKVLL  482



>ref|XP_002893221.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69480.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/484 (61%), Positives = 379/484 (78%), Gaps = 19/484 (4%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++  KPH VC+PYPAQGHINPM+K+AK+L+ KGFH+TFVNT +NH RL RS G  
Sbjct  1     MGSHVAQ--KPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGSN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             ++ GLPSFRFE+IPDGL  ++ D TQDIP+LCEST   CL PFK+LL ++N  A  + PP
Sbjct  59    AVDGLPSFRFESIPDGLSETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN--AGDDVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELG+PEV+FWTTSACGFL Y+ Y + ++KG +P+KDESYL  
Sbjct  117   VSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLFYYRFIEKGLSPIKDESYLNK  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              +L+T++DW+  MK +RL+D+PSF+RTTNPD+ ML FI++E  RA+RASAIILNTFD LE
Sbjct  177   EHLDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTFDDLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSV  917
             H+ + ++QS++PPVY++GPL  L+KQ   +D  +R + S+LW+E+T CL WL+TKA NSV
Sbjct  237   HDVIQSMQSIVPPVYSIGPLHLLEKQEISEDSEIRRMGSNLWREETECLNWLNTKARNSV  296

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITV++  QL EFAWGLA + K FLW+IRPDLV G+ A++PPEF+ ET DR ML
Sbjct  297   VYVNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTETADRRML  356

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +W +G
Sbjct  357   ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWELG  416

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI              +LM+ EKG +M+ KA E ++LA EA +    GSS +N E  +N
Sbjct  417   IEI------------GGDLMDGEKGNKMREKAGEWRRLAKEATEH-KHGSSKLNFEMVVN  463

Query  1458  HLLL  1469
              +LL
Sbjct  464   KILL  467



>ref|XP_008455179.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=488

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 379/489 (78%), Gaps = 6/489 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S+ +KPHAVCIPYPAQGHI PMLKLAK+LHH+GF+ITFVNT++NHRR  +S GP 
Sbjct  1     MGSV-SQTEKPHAVCIPYPAQGHITPMLKLAKLLHHRGFYITFVNTDYNHRRFLKSRGPH  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS---N  374
             SL GL  F F+TIPDGLP S+A++TQDIP+LCESTS  CL PF+DL+++LN  A S   N
Sbjct  60    SLDGLQDFTFQTIPDGLPYSDANSTQDIPALCESTSKNCLAPFRDLISQLNSMAASPSSN  119

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPVSCIVSD  M F++  A E  IP    WT SACG+LGY  Y  L+D+G  PLKD S 
Sbjct  120   MPPVSCIVSDAAMFFSMVVANEFKIPYAFLWTASACGYLGYFQYEHLIDQGLIPLKDMSQ  179

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             +TNGYLET + W +GMK IRLRDLP+F RTT  D+ +  FI+Q    +R ASAIILNTFD
Sbjct  180   VTNGYLETTVGWTQGMKNIRLRDLPTFFRTTVRDDMIFNFIIQAMKSSREASAIILNTFD  239

Query  735   ALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             A+E +   +L S+L  +Y +GPL  L  Q+ D N+ A+ S+LW E++ C+EWL++K PNS
Sbjct  240   AIEGDVKDSLSSILQSIYTIGPLHMLANQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMTP Q+ EFAWGLA+S KPFLWI RPDL+ G++AILP EFV +TKDR +
Sbjct  300   VVYVNFGSITVMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSL  359

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             +++WC QEQVL HP++GGFLTH+GWNSTLESIC GVPM+ WPFFAEQQTNC Y CT+WGI
Sbjct  360   IANWCCQEQVLNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGI  419

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEIDNNV R+EVE++VRELM+ EKG++MK   M LK  A EA    P GS++  ++K I
Sbjct  420   GMEIDNNVKRNEVEELVRELMDGEKGKKMKENVMYLKSKAEEAYK--PDGSAYKQLDKLI  477

Query  1455  NHLLLSHRK  1481
             N +LLS+ K
Sbjct  478   NEVLLSNIK  486



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/478 (64%), Positives = 380/478 (79%), Gaps = 9/478 (2%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             K H VC+PYPAQGHINPM+K+AK+LH KGF++TFVNT +NH+RL RS G  +L GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIPSLCEST    L PFK+LL R+N  A    PPV+CIVSDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN--AQDEVPPVNCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLK----DESYLTNGYLET  578
             MSFT+DAAEELG+PEV+FWTTSACGFL Y+HY + ++KG +PLK    DESYLT  +L+T
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKVDLADESYLTKEHLDT  188

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
              +DW+  MK +RL+D+PSF+RTTNP++ ML F+++ET RA+RASAIILNTFD LEH+ + 
Sbjct  189   IIDWIPSMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQ  248

Query  759   ALQSMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             ++QS++PPVY++GPL    KQ   +D  +  + S+LWKE+T C++WL+TKAPNSVVYVN+
Sbjct  249   SMQSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNF  308

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSITVMT  QL EFAWGLA + K FLW+IRPDLV GE +++PPEF+ ET DR ML+SWCP
Sbjct  309   GSITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCP  368

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC + C +W IG+EI  
Sbjct  369   QEEVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGG  428

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +V R+EVE VVRELM+ EKG++M+ KA E + LA E A     GSS VN +  +  LL
Sbjct  429   DVRREEVEAVVRELMDGEKGKKMREKAAEWRSLA-EKATECKRGSSVVNFDNVVKVLL  485



>ref|NP_173653.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 sp|Q9ZWJ3.1|U85A2_ARATH RecName: Full=UDP-glycosyltransferase 85A2 [Arabidopsis thaliana]
 gb|AAF87256.1|AC068562_3 Identical to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|T46254, gb|R83990, gb|H37246, gb|W43072, 
gb|R90721, gb|R90712, gb|AA712612, gb|AA404770 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48781.1|AF332418_1 putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 dbj|BAA34687.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AEE30232.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=481

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 387/484 (80%), Gaps = 7/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++  K H VC+PYPAQGHINPM+K+AK+L+ KGFHITFVNT +NH RL RS GP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             ++ GLPSFRFE+IPDGLP ++ D TQDIP+LCEST   CL PFK+LL ++N  A  + PP
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN--ARDDVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELG+PEV+FWTTSACGFL Y++Y + ++KG +P+KDESYLT 
Sbjct  117   VSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTK  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              +L+T++DW+  MK +RL+D+PSF+RTTNPD+ ML FI++E  RA+RASAIILNTFD LE
Sbjct  177   EHLDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTFDDLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSV  917
             H+ + +++S++PPVY++GPL  L+KQ       +    S+LW+E+T CL+WL+TKA NSV
Sbjct  237   HDVIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSV  296

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITV++  QL EFAWGLA + K FLW+IRPDLV G+ A++PPEF+  T DR ML
Sbjct  297   VYVNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRML  356

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +S  +W +G
Sbjct  357   ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVG  416

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI  +V R+EVE VVRELM+ EKG+ M+ KA E ++LA EA +    GSS +N E  +N
Sbjct  417   IEIGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEH-KHGSSKLNFEMLVN  475

Query  1458  HLLL  1469
              +LL
Sbjct  476   KVLL  479



>gb|AAL32657.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAM13356.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
Length=481

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 387/484 (80%), Gaps = 7/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++  K H VC+PYPAQGHINPM+K+AK+L+ KGFHITFVNT +NH RL RS GP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             ++ GLPSFRFE+IPDGLP ++ D TQDIP+LCEST   CL PFK+LL ++N  A  + PP
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN--ARDDVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELG+PEV+FWTTSACGFL Y++Y + ++KG +P+KDESYLT 
Sbjct  117   VSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTK  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              +L+T++DW+  MK +RL+D+PSF+RTTNPD+ ML FI++E  RA+RASAIILNTFD LE
Sbjct  177   EHLDTKIDWIPSMKDLRLKDIPSFIRTTNPDDIMLNFIIREANRAKRASAIILNTFDDLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSV  917
             H+ + +++S++PPVY++GPL  L+KQ       +    S+LW+E+T CL+WL+TKA NSV
Sbjct  237   HDVIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSV  296

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITV++  QL EFAWGLA + K FLW+IRPDLV G+ A++PPEF+  T DR ML
Sbjct  297   VYVNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRML  356

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +S  +W +G
Sbjct  357   ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVG  416

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI  +V R+EVE VVRELM+ EKG+ M+ KA E ++LA EA +    GSS +N E  +N
Sbjct  417   IEIGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEH-KHGSSKLNFEMLVN  475

Query  1458  HLLL  1469
              +LL
Sbjct  476   KVLL  479



>ref|XP_010477496.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=508

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/493 (60%), Positives = 388/493 (79%), Gaps = 5/493 (1%)
 Frame = +3

Query  9     EREREMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQR  188
             E+++      S   KPH VC+P+PAQGHINPMLK+AK+LH +GFH+TFVNT +NH+RL R
Sbjct  19    EKKKMASQTVSRGQKPHVVCVPFPAQGHINPMLKVAKLLHTRGFHVTFVNTIYNHKRLLR  78

Query  189   SLGPESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV  368
             S GP +L G+PSFR+E+IPDGLP +  DATQD+P LC ST   CL PFK+LL R+N    
Sbjct  79    SRGPNALNGIPSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLRRIN--TA  136

Query  369   SNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDE  548
              + PPVS IVSDG+MSFT+DAAEELG+P+V+FWTTSACGFL Y+++   ++KG +PLKDE
Sbjct  137   DDVPPVSSIVSDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLYFYSFIEKGLSPLKDE  196

Query  549   SYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNT  728
             SYLT   L+T++DW+  M+ +RL+D+PSF+RTTNPD+ ML F + E  R +RASAIILNT
Sbjct  197   SYLTKENLDTKIDWIPSMRNLRLKDIPSFIRTTNPDDIMLNFFVHEADRVKRASAIILNT  256

Query  729   FDALEHEALMALQSMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTK  902
             FD LEH+ + +++S++P VY+VGPLQ L K+   KD  +R + ++LW+E+  CL+WL+TK
Sbjct  257   FDELEHDTIQSIKSIIPHVYSVGPLQLLVKREMKKDSEIRQMETNLWREERECLDWLNTK  316

Query  903   APNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETK  1082
             +PNSVVYVN+GSITVM+   L EFAWGLA +KK FLW+IRPDLV G+ A++PPEF+ ET 
Sbjct  317   SPNSVVYVNFGSITVMSAKHLVEFAWGLAATKKDFLWVIRPDLVVGDVAMVPPEFLIETA  376

Query  1083  DRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT  1262
             DR ML+SWCPQE VL HPAVGGFLTH+GWNSTLES+ NGVPM+CWPFFAEQQTNC Y C 
Sbjct  377   DRRMLASWCPQENVLSHPAVGGFLTHSGWNSTLESLSNGVPMVCWPFFAEQQTNCKYCCD  436

Query  1263  KWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNI  1442
             +W +GMEI  +V R+EVE++VRELM+ EKG++M+ KA E ++LA EA   +  GSS ++ 
Sbjct  437   EWEVGMEISGDVRREEVEELVRELMDGEKGKKMREKAEEWRRLAEEATKHM-CGSSELSF  495

Query  1443  EKFINHLLLSHRK  1481
             E  +  +LL  R+
Sbjct  496   EMVVGKVLLGGRE  508



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/481 (61%), Positives = 382/481 (79%), Gaps = 5/481 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPH VC+P+ AQGHINPMLK+AKILH KGFH+TFVNT +NHRRL RS GP++L GLPS
Sbjct  9     RQKPHVVCVPFAAQGHINPMLKVAKILHAKGFHVTFVNTNYNHRRLLRSRGPKALNGLPS  68

Query  225   FRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             F++E+IPDGLP +  DATQDIP LC ST   CL PFK+LL R+N     + PPVSCIVSD
Sbjct  69    FQYESIPDGLPETNEDATQDIPLLCASTKKNCLAPFKELLRRIN--TAEDVPPVSCIVSD  126

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G MSFT+DAAEELG+P V  WTTSACGFL Y+H+ ++++KG +PLKDESYLT  +L+T++
Sbjct  127   GTMSFTLDAAEELGVPNVALWTTSACGFLAYLHFHRIIEKGLSPLKDESYLTKEHLDTKI  186

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+  M+ +RL+D+P+F+RTTNPD+ ML + + ET R +RASAIILNTFD LEH+ + ++
Sbjct  187   DWIPSMRNLRLKDIPTFIRTTNPDDIMLNYFVDETDRIKRASAIILNTFDELEHDTIQSI  246

Query  765   QSMLPPVYAVGPLQFL--QKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             +S++P VY++GPLQ L  ++  KD     + ++LW+ED  CL+WLDTK+PNSV+YVN+GS
Sbjct  247   KSIIPQVYSIGPLQLLVNREMDKDSETGKMETNLWREDRECLDWLDTKSPNSVIYVNFGS  306

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITVM+   L EFAWGLA +KK FLW+IRPDLV G+ A++PPEF+ ET DR ML+SWCPQE
Sbjct  307   ITVMSAKHLVEFAWGLAATKKDFLWVIRPDLVVGDVAMVPPEFLIETADRRMLASWCPQE  366

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL HPAVGGFLTH+GWNSTLES+  GVPMLCWPFFAEQQTNC Y C +W +GMEI  +V
Sbjct  367   KVLSHPAVGGFLTHSGWNSTLESLSCGVPMLCWPFFAEQQTNCKYCCDEWEVGMEISGDV  426

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              R+EVE+++RELM+ +KG++M+ KA E ++LA EA   +  GSS  + E  +  +LL  R
Sbjct  427   RREEVEELIRELMDGDKGKKMREKAEEWRRLAEEATKHM-CGSSERSFEMVVGKVLLGGR  485

Query  1479  K  1481
             +
Sbjct  486   E  486



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/478 (62%), Positives = 378/478 (79%), Gaps = 5/478 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPM+K+AK+ H +GFH+TFVNT +NH RL RS G  ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKVAKLFHIRGFHVTFVNTVYNHNRLLRSRGAHAVNGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDI +LC ST   CL PFK+LL ++N  A  + PPVSCI+SDG 
Sbjct  71    FESIPDGLPETDVDVTQDITALCASTMKNCLTPFKELLRQIN--AGDDVPPVSCILSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWT SACGF+ Y+H+ + ++ G +PLKDESYLT  YL+T +D 
Sbjct  129   MSFTLDAAEELGVPEVLFWTVSACGFMAYLHFYRFVEMGLSPLKDESYLTKEYLDTVIDC  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK ++L+D+PSF+RTTN D+ ML F+L+ET RA+RASAIILNTFD LEH+ L+++QS
Sbjct  189   IPSMKNLKLKDIPSFIRTTNSDDIMLNFVLRETERAKRASAIILNTFDDLEHDILLSMQS  248

Query  771   MLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPVY+VGPL  L  +   +D  +  + S+LWKE+T CL+WLD K  NSVVYVN+GSIT
Sbjct  249   ILPPVYSVGPLHLLANREITEDSEIGKMGSNLWKEETECLDWLDNKPQNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL EFAWGLA S K FLW+IRPDLV GE A++PPEF+ ET DR ML+SWCPQE+V
Sbjct  309   VMTAKQLVEFAWGLAGSGKQFLWVIRPDLVAGEEAMVPPEFLTETADRRMLASWCPQEKV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH+GWNSTLES+  GVPM+CWPFFAEQQTNC ++C +W +G+EI  +V R
Sbjct  369   LSHPAIGGFLTHSGWNSTLESLSGGVPMVCWPFFAEQQTNCKFTCDEWEVGIEIGGDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             +EVE VVRELM+ EKG++M+ KA E ++LA EA +   +GSS VN E  +N   L  R
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAEEWRRLAKEATEH-KLGSSVVNFETVVNKAFLGQR  485



>ref|XP_008372493.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 384/475 (81%), Gaps = 8/475 (2%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAV IP+PAQGHINPM +LAK+LH+KGFHITFVNTE  H+RL  SLG  SL GLP+FR
Sbjct  5     KPHAVFIPFPAQGHINPMQQLAKLLHYKGFHITFVNTEVTHKRLINSLGANSLDGLPTFR  64

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP   A   +D+PSLC ST+ T LGPF++LL +LN +   N+PPV+CI++DGV
Sbjct  65    FETIPDGLP---ATHPRDVPSLCVSTNKTGLGPFRELLKKLNSSP--NSPPVTCIIADGV  119

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             M+FT+DAA ELGIPEV+FWTTSACGFL Y  Y +L+++G TPLKDES+  NGYL+T +DW
Sbjct  120   MTFTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFXNGYLDTVVDW  179

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GMK IRL+D+PSF+RTT+P++ ML+F++ ET R ++ASA++LNTF++ E EAL A+ S
Sbjct  180   LPGMKDIRLKDIPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFESFEKEALDAISS  239

Query  771   MLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             + PP Y+VGPL  L  Q+  D  ++A+ASSLW ED  CL+WLDTK PNSVVYVN+GS TV
Sbjct  240   LFPPTYSVGPLNLLFSQIPADNELKAIASSLWTEDKECLDWLDTKEPNSVVYVNFGSTTV  299

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT +QL EF+WGLANS K FLWIIRP LV G++A++PPEF+EET  RG L+SWCPQEQVL
Sbjct  300   MTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDSAVVPPEFLEETXGRGKLASWCPQEQVL  359

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC Y+C  WGIG+EI++ V RD
Sbjct  360   THPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACKHWGIGIEIEDEVKRD  419

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              +E +VR LME E+G+EM++ A+  KK   +A  T P GSS ++++  IN +L++
Sbjct  420   YIEGLVRRLMEGEEGKEMRKNALGWKKKIEKA--TSPKGSSVLDLDNLINQVLIA  472



>gb|AHL38933.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/484 (62%), Positives = 386/484 (80%), Gaps = 7/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++  K H VC+PYPAQGHINPM+K+AK+L+ KGFHITFVNT +NH RL RS GP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             ++ GLPSFRFE+IPDGLP ++ D TQDIP+LCEST   CL PFK+LL ++N  A  + PP
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN--ARDDVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELG+PEV+FWTTSACGFL Y++Y + ++KG +P+KDESYLT 
Sbjct  117   VSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTK  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              +L+T++DW+  MK +RL+D+PSF+RTTNPD+ ML FI++E  RA+RASAIILNT D LE
Sbjct  177   EHLDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTLDDLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSV  917
             H+ + +++S++PPVY++GPL  L+KQ       +    S+LW+E+T CL+WL+TKA NSV
Sbjct  237   HDVIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSV  296

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITV++  QL EFAWGLA + K FLW+IRPDLV G+ A++PPEF+  T DR ML
Sbjct  297   VYVNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRML  356

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +S  +W +G
Sbjct  357   ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVG  416

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI  +V R+EVE VVRELM+ EKG+ M+ KA E ++LA EA +    GSS +N E  +N
Sbjct  417   IEIGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEH-KHGSSKLNFEMLVN  475

Query  1458  HLLL  1469
              +LL
Sbjct  476   KVLL  479



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/484 (63%), Positives = 389/484 (80%), Gaps = 5/484 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS +   +KPHAV IPYPAQGHI PML+LAK+L++KGFH TFVNTEFNHRRL ++ GP 
Sbjct  1     MGS-KGMIEKPHAVFIPYPAQGHIIPMLQLAKLLNYKGFHTTFVNTEFNHRRLLKARGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GL SFRFETIPDGLP ++ +ATQDI +LC ST   CL PFKDLL++LN  ++ N+PP
Sbjct  60    SLDGLSSFRFETIPDGLPTTDVNATQDITALCFSTKKNCLAPFKDLLSKLN--SLPNSPP  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIVSDG M+FT++AA+ELGIP V+F T SAC  +GY+  S L++KG  PLKD SYLTN
Sbjct  118   VTCIVSDGGMTFTLEAAQELGIPVVIFATASACSLMGYLQLSPLIEKGLIPLKDASYLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GM+GIRLRD+P+F RTT+P++ ML+F+  E GR  RASA ILNTF ALE
Sbjct  178   GYLDTVIDWIPGMRGIRLRDIPTFFRTTDPNDIMLEFLRVEIGRYHRASAFILNTFYALE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDIN-VRALASSLWKEDTSCLEWLDTKAPNSVV  920
             HE L AL ++LPP+Y+VGPL     Q+   N ++++ S+LW E+  CLEWLD+K PNSVV
Sbjct  238   HEVLDALSTLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL+EFAWGLANS + FLW+IRPDLV GE+A++P EF EETK+R +++
Sbjct  298   YVNFGSITVMTEEQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPSEFSEETKERSLVA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC Q++VL HPA+GGFLTH+GWNSTLES+C GVPM+CWP FA+QQ NC +SC +WGIGM
Sbjct  358   SWCLQQEVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPVFADQQMNCRFSCKEWGIGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+ +V RD +E +VR+LME E+G+EM++KA E KKLA EA  T P G S V++++  + 
Sbjct  418   EIEGDVKRDYIEGLVRKLMEGEEGKEMRKKAQEWKKLATEAT-TSPNGMSFVDLDRIASQ  476

Query  1461  LLLS  1472
             +L S
Sbjct  477   VLQS  480



>ref|XP_004305885.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 378/482 (78%), Gaps = 7/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    DKPHAVCIP+P QGHI P+LK AK+LHH+GF ITFVNTE+NHRR  +SLGP 
Sbjct  1     MGSMEV-TDKPHAVCIPFPYQGHIKPLLKFAKLLHHRGFRITFVNTEYNHRRFLKSLGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L GL  F FETIPDGLP S++D+TQDI ++C+S +   L PF+DLL RLN +      P
Sbjct  60    TLDGLTDFHFETIPDGLPPSDSDSTQDITAICDSINKNFLAPFRDLLTRLNSSTF----P  115

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSF+VDAA++L +P V+F+  +A GF+G+  Y  L++KG+ P+KDE  L+N
Sbjct  116   VSCIVSDGFMSFSVDAAQDLRLPIVLFFPVAANGFMGFKQYRALVEKGFAPIKDEKCLSN  175

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK IRL+DLPSF RTT+P++       + T RA +ASA++++TFDALE
Sbjct  176   GYLDTVIDWIPGMKDIRLKDLPSFFRTTDPNDSPFVLTGEATQRAHKASAVVIHTFDALE  235

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              + L AL  MLP VYA+GPLQ L  Q+ +  + ++  SLWKEDT CL WL+ KAPNSVVY
Sbjct  236   RDVLDALSFMLPHVYAIGPLQLLLNQIPEDPLESMGYSLWKEDTECLPWLNAKAPNSVVY  295

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+ VMTP+ L EF WGLANSK PFLW+IRPDLV GE+AILPPEFV ETK RG+++S
Sbjct  296   VNFGSVVVMTPEHLVEFGWGLANSKHPFLWVIRPDLVVGESAILPPEFVAETKGRGIIAS  355

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE+VL HP+VGGFLTHNGWNST+ES+  GVPMLCWPFFAEQQTNCWY C   GIGME
Sbjct  356   WCPQEEVLNHPSVGGFLTHNGWNSTIESVTAGVPMLCWPFFAEQQTNCWYVCNGLGIGME  415

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV RDEVEK+VRELME + G EM+ KA  LKKLA EAAD  P GSS+ N++K +N +
Sbjct  416   IDNNVKRDEVEKLVRELMEGQNGEEMRNKANVLKKLAEEAAD--PQGSSYKNLDKVVNQV  473

Query  1464  LL  1469
             LL
Sbjct  474   LL  475



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 375/475 (79%), Gaps = 7/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIPYPAQGHINPML+LAKI H KGFHITFVN+E+NH RL RS GP +L   PSFR
Sbjct  11    KPHAVCIPYPAQGHINPMLQLAKIFHFKGFHITFVNSEYNHSRLLRSRGPAALADRPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             F+TIPDGLP ++AD+TQDI  LC ST   CLGPFK+L+A LN+    + PPVSCIVSD  
Sbjct  71    FKTIPDGLPPTDADSTQDISLLCASTEQHCLGPFKELIAHLNEAG--DVPPVSCIVSDVS  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDK-GYTPLKDESYLTNGYLETELD  587
             M FT++AA+E G+PEVM WT SACG LGY  Y +L+D+ G  P KD S++TNG L+  +D
Sbjct  129   MFFTLNAAQEFGVPEVMLWTASACGLLGYAQYPKLVDEMGLVPFKDASFITNGELDAVVD  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             WV GM+ ++LRD+PSF+RTTNP++ ML F+ +   ++++ASAI+ N+FDAL+H  L +L 
Sbjct  189   WVPGMEDMQLRDIPSFIRTTNPNDIMLNFVQRLLHKSKQASAIVFNSFDALDHAVLNSLS  248

Query  768   SMLPPVYAVGPLQFLQKQV---KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             S  PP+Y +GPLQ L   +    D  ++ ++++LWKEDT CL WLD+  PNSVVYVN+GS
Sbjct  249   SDFPPLYTLGPLQLLLDSIPGSNDEEIQTISTNLWKEDTHCLGWLDSYEPNSVVYVNFGS  308

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITVMT DQL EFAWGLANS +PFLWIIRPDLV G++A+LPPEF+EETK+RG+++SWC Q+
Sbjct  309   ITVMTNDQLIEFAWGLANSNQPFLWIIRPDLVIGDSAVLPPEFIEETKNRGLIASWCNQD  368

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             QVL HPAVGGFLTH GWNS +E++ NG P++CWPFFAEQQTNCW+SC KWGIGMEID NV
Sbjct  369   QVLAHPAVGGFLTHCGWNSIIETLINGAPIICWPFFAEQQTNCWFSCNKWGIGMEIDVNV  428

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
              R EVE+ VRELM+ EKG+EMKRK ME +KL  EA    P GSS+ N++K I  L
Sbjct  429   KRSEVERQVRELMDGEKGKEMKRKVMEWRKLGHEAT-AAPNGSSYKNLDKVIKVL  482



>emb|CDY38225.1| BnaC05g17420D [Brassica napus]
Length=482

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 380/474 (80%), Gaps = 6/474 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             K H VC+PYPAQGHINPM+K+AK+LH KGF++TFVNT +NH+RL RS G  +L GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ D TQDIP+LCEST    L PFK+LL R+N  A   +PPVSCIVSDG 
Sbjct  71    FESIPDGLPETDVDVTQDIPALCESTVKNSLAPFKELLRRIN--AQDESPPVSCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWTTSACG L Y+HY + ++KG +PLKDESYLT  +L+T +DW
Sbjct  129   MSFTLDAAEELGVPEVLFWTTSACGLLAYLHYHKFIEKGLSPLKDESYLTKEHLDTIIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK +RL+D+PSF+RTTNP++ ML F+++ET RA+RASAIILNTFD LE + + ++QS
Sbjct  189   IPSMKNLRLKDIPSFIRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLELDVIQSMQS  248

Query  771   MLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             ++PPVY++GPL    KQ   +D  +  + S+LWKE+T C++WL+++APNSVVYVN+GSIT
Sbjct  249   IVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNSRAPNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL +FAWGLA + K FLW+IRPDLV GE +++PPEF+ ET DR ML+SWCPQE+V
Sbjct  309   VMTAKQLVDFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEEV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC + C +W IG+EI  +V R
Sbjct  369   LSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEI-GDVRR  427

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +EVE VVRELM+ EKG++M+ KA E + LA E A     GSS VN +K +  +L
Sbjct  428   EEVEAVVRELMDGEKGKKMREKAEEWRSLA-EKATECKRGSSVVNFDKVVKVVL  480



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/482 (65%), Positives = 377/482 (78%), Gaps = 9/482 (2%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIP+PAQGHINPMLKLAK+LHHKGFHITFVNTE NH+RL RS GP SL GLP F
Sbjct  8     EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-PPVSCIVSD  404
             RF+ IPDGLP S+AD+TQDIPSLC S S   L  F+ LL +L + +     PPV+CIVSD
Sbjct  68    RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVSD  127

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G M+FTVDAAEEL IPEV+FWT SACG  G   Y +L++ G+TPLKD +YL+NGYLET +
Sbjct  128   GGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETTV  187

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
              W  GMK IRLRD+P+F+RT +  + ML FI+QE  R+ RASA+ILNTFD LEH+ L +L
Sbjct  188   SWTSGMKSIRLRDIPTFIRTLDHQDIMLNFIIQEVERSSRASAVILNTFDTLEHDVLESL  247

Query  765   QSMLPPVYAVGPLQFLQKQVK------DINVRALASSLWKEDTSCLEWLDTKAPNSVVYV  926
              S+ P +Y +GPLQ L           D  +R++  +LW+E+  CL WLD+K P SVVYV
Sbjct  248   SSVFPHIYTIGPLQLLADWGAGGSPEIDEALRSVGGNLWREEPGCLPWLDSKEPGSVVYV  307

Query  927   NYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSW  1106
             N+GSITVMT  QL+EFAWGLANS+KPFLWIIRPDLV  E+A+LPPEFVEE   RGML SW
Sbjct  308   NFGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSW  367

Query  1107  CPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEI  1286
             C QE+VL H A+GGFLTH+GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEI
Sbjct  368   CQQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEI  427

Query  1287  dnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             DN+V RDEVE +VRELME EKG+EM++KAME K  A EA   +  G+S+ N++K I+ +L
Sbjct  428   DNDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEA--IMLGGTSYNNVDKLISEVL  485

Query  1467  LS  1472
              S
Sbjct  486   SS  487



>gb|KCW45340.1| hypothetical protein EUGRSUZ_L00994 [Eucalyptus grandis]
Length=461

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 377/462 (82%), Gaps = 4/462 (1%)
 Frame = +3

Query  102   MLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFRFETIPDGLPLSEA-DAT  278
             ML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSF+F TIPDGLP S+A DAT
Sbjct  1     MLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSLDGLPSFQFRTIPDGLPPSDATDAT  60

Query  279   QDIPSLCESTSATCLGPFKDLLARLNDTAVS-NAPPVSCIVSDGVMSFTVDAAEELGIPE  455
             QDIP+LC+STS  CL  F+DLL RLN+ + +  +P VSC+VSDG M+FT+DAAE +G+PE
Sbjct  61    QDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPLVSCVVSDGGMTFTLDAAEAIGVPE  120

Query  456   VMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDWVKGMKGIRLRDLPSF  635
             V+ WT SAC F+GY+ Y  L+DKG TPLKD +Y TNG L+T +DW+ GM+ IRLRDLP+F
Sbjct  121   VLIWTASACSFMGYVQYRSLIDKGLTPLKDANYFTNGCLDTTIDWIPGMRNIRLRDLPTF  180

Query  636   LRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQSMLPPVYAVGPLQFLQ  815
             ++TT+PD+ M+ F L+E  RA+RASAI+ NTFD LEHE L AL++M PP+Y +GPL  L 
Sbjct  181   IQTTDPDDLMIPFCLREVERAKRASAIVFNTFDRLEHEVLDALKAMFPPIYTLGPLHLLT  240

Query  816   KQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANS  995
             KQ+ D N R   S+LWKE+  C+EWLD+K P+SVVYVN+GSITVM+P QL EFAWGLANS
Sbjct  241   KQLSDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSITVMSPAQLVEFAWGLANS  300

Query  996   KKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNS  1175
              + FLW+IRPDLV G+AA+LPP+F+  T++R +L+SWCPQE+VL H AVGGFLTH+GWNS
Sbjct  301   GQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVGGFLTHSGWNS  360

Query  1176  TLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGR  1355
             T+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID++V R+EVE+ V+ELME EKG+
Sbjct  361   TIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKRNEVERQVKELMEGEKGK  420

Query  1356  EMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
              MKRKAME K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  421   HMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  460



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/503 (61%), Positives = 389/503 (77%), Gaps = 13/503 (3%)
 Frame = +3

Query  3     ERERE-----REMGSLRSEQD--KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNT  161
             ER++E      EM SL   Q   +PHAVC+P+PAQGHINPM +LAK+LHHKGFHITFVNT
Sbjct  46    ERKKEGLKQRAEMASLIDTQHPRRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNT  105

Query  162   EFNHRRLQRSLGPESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDL  341
             EFN RRL +S GP+SL  +P+FRFETIPDGLP S+ADATQDIPSLC+ST  TC  PF++L
Sbjct  106   EFNQRRLLKSQGPDSLNAVPTFRFETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQEL  165

Query  342   LARLNDTAVSNA-PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLL  518
             L RLN++A+SN  PPV+CIVSD  M FT+ A+++L IP V+F+T SACGF GY+HY  L+
Sbjct  166   LTRLNNSALSNVNPPVTCIVSDWAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLV  225

Query  519   DKGYTPLKDESYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRA  698
             +K   PLKD SYLTNGY+++ +DW+ GM+GI+L+ LPSF+R+T+ D++M+ F++ E   A
Sbjct  226   EKCIFPLKDLSYLTNGYMDSVIDWIPGMEGIQLKYLPSFIRSTDRDDFMVNFVITEIENA  285

Query  699   RRASAIILNTFDALEHEALMALQSMLPPVYAVGPLQFL----QKQVKDINVRALASSLWK  866
               ASA+I NTFD LE E L  L S+ P ++ +GPL  L    +    D  +  + S+LWK
Sbjct  286   HNASALIFNTFDDLEPEVLEELSSIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWK  345

Query  867   EDTSCLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEA  1046
             E   CLEWLD+K  NSVVYVN+GSITV+T +QL EFAWGLANSK+PFLW+IRPD+V    
Sbjct  346   EQPGCLEWLDSKEQNSVVYVNFGSITVLTENQLVEFAWGLANSKRPFLWVIRPDIVNEAT  405

Query  1047  AILPPEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFF  1226
             A++  EFVEETKDRGML+SWCPQEQ+L HPAVGGFLTH GWNST+ES+C+GV MLCWPFF
Sbjct  406   AVITQEFVEETKDRGMLASWCPQEQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFF  465

Query  1227  AEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAA  1406
             AEQQTNCW+  TKWG+G+E++    R E+EK VRELME + G+ MK KA+E K LA +AA
Sbjct  466   AEQQTNCWFCQTKWGVGIEVNPRADRVEIEKRVRELMEGDSGKLMKEKALEWKLLAEKAA  525

Query  1407  DTIPIGSSHVNIEKFINHLLLSH  1475
                P GSS+VN++K IN +LL++
Sbjct  526   AG-PNGSSYVNLDKLINDVLLTY  547



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/501 (61%), Positives = 384/501 (77%), Gaps = 18/501 (4%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M S+   Q  PHAVCIPYPAQGHINPML L K+LHH+GFH+TFVNTE+NH RL RS  P 
Sbjct  1     MSSIEMTQ-MPHAVCIPYPAQGHINPMLNLPKLLHHRGFHVTFVNTEYNHSRLLRSRDPS  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLND-TAVSNAP  380
             SL GLPSF+F TIPDGLP S+ADATQD+P+LC+ST  +CL   +DLL RLN+ +A S +P
Sbjct  60    SLDGLPSFQFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYLRDLLERLNEESATSGSP  119

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              VSC+VSDGVMSFT+DAA+ + +PEV+FWT SACGF+GY+ Y  L+DKG  PLKD SYLT
Sbjct  120   SVSCVVSDGVMSFTLDAAKAVSMPEVLFWTMSACGFMGYVQYRSLIDKGLAPLKDASYLT  179

Query  561   NGYLETELDWVKG--------------MKGIRLRDLPSFLRTTNPDEYMLKFILQETGRA  698
             N YL+T +DW+                M+ I L +L SFLRT +PD+ M+ F L+ET RA
Sbjct  180   NVYLDTIVDWIPSIRNILDTIIDWIPEMRNICLGELLSFLRTPDPDDLMINFCLRETERA  239

Query  699   RRASAIILNTFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTS  878
             +RASAI+ NTFD LEHE L AL++M+PP+Y +GPL  L +Q+ D + +++ S+ WKED  
Sbjct  240   KRASAIVFNTFDRLEHEVLDALKAMVPPIYTLGPLHILTEQLPDDDTKSIGSNPWKEDLG  299

Query  879   CLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILP  1058
             CLEWLD+  P SVVYVN+GSITVM+P QL E AWGLANS + FLW+IRPDLV G  AILP
Sbjct  300   CLEWLDSNPPVSVVYVNFGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILP  359

Query  1059  PEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQ  1238
             P+F+  T+ R +L SWCPQE+VL HPAVGGFLTH GW ST+ESI  GVP++CWPFF EQQ
Sbjct  360   PDFLAATRQRSLLVSWCPQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQ  419

Query  1239  TNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIP  1418
              NCWYSC +WGIG+EID++V RDEVE+ VRELME E+G+ MKRK ME +++A EAA   P
Sbjct  420   RNCWYSCEEWGIGLEIDDDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR--P  477

Query  1419  IGSSHVNIEKFINHLLLSHRK  1481
              GSS  N+++ I+ +LLS R+
Sbjct  478   SGSSCSNLDEVIDKVLLSPRR  498



>ref|XP_008386104.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 384/475 (81%), Gaps = 8/475 (2%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAV IP+PAQGHINPM +LAK+LH+KGFHITFVNTE  H+RL  SLG  SL GLP+FR
Sbjct  5     KPHAVFIPFPAQGHINPMQQLAKLLHYKGFHITFVNTEVTHKRLINSLGANSLDGLPTFR  64

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP S     +D+PSLC ST+ T L PF++L+ +LN +   N+PPV+CI++DGV
Sbjct  65    FETIPDGLPASHP---RDVPSLCVSTNKTGLAPFRELVKKLNSSP--NSPPVTCIIADGV  119

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             M+FT+DAA ELGIPEV+FWTTSACGFL Y  Y +L+++G TPLKDES+ TNGYL+T +DW
Sbjct  120   MTFTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFTNGYLDTMVDW  179

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GMK IRL+D+PSF+RTT+P++ ML+F++ ET R ++ASA++LNTF +LE EAL A+ S
Sbjct  180   LPGMKDIRLKDMPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFKSLEQEALDAISS  239

Query  771   MLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             + PP Y+VGPL  L  Q+ +D  ++A+ASSLW EDT+CL+WLDTK PNSVVYVN+GS TV
Sbjct  240   LFPPTYSVGPLNLLFSQIPEDNELKAIASSLWTEDTACLDWLDTKEPNSVVYVNFGSTTV  299

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT +QL EF+WGLANS K FLWIIRP LV G+ A++PP F+EET+ RG L+SWCPQEQVL
Sbjct  300   MTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDTAVVPPLFLEETEGRGKLASWCPQEQVL  359

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC Y+C  WGIG+EI++ V RD
Sbjct  360   THPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACEHWGIGIEIEDEVKRD  419

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
              +E +VR LME ++G+EM++ A+  KK   E   T   GSS ++++  IN +L++
Sbjct  420   YIEGLVRRLMEGKEGKEMRKNALGWKKKIEEV--TSRKGSSVLDLDNLINQVLIA  472



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/502 (62%), Positives = 387/502 (77%), Gaps = 19/502 (4%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+   Q KPHAVCIPYPAQGHINPML LAK+LHH+GFH+TFVNTE+NH RL  S GP 
Sbjct  1     MGSIDMIQ-KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGPS  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS-NA  377
             SL GLPSFRF TIP+GLP S+ ADATQDIP+LC+STS  CL  F+D L RLN+ + +  +
Sbjct  60    SLDGLPSFRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLGS  119

Query  378   PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
             PPVSC+VSDG+MSFT+DAA+ +G+ EV+FWTTS CGF+GY+ Y  L+DKG  PLKD SYL
Sbjct  120   PPVSCVVSDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYVQYCNLVDKGLAPLKDASYL  179

Query  558   TNGYLETELDWVKG--------------MKGIRLRDLPSFLRTTNPDEYMLKFILQETGR  695
             TN YL+T +DW+                M+ I L +L SFLRT +PD+ M+ F L+ET R
Sbjct  180   TNVYLDTIVDWIPSIRNILDTIIDWIPEMRNICLGELLSFLRTPDPDDLMINFCLRETER  239

Query  696   ARRASAIILNTFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDT  875
             A+RASAI+ NTFD LEHE L AL++M+PP+Y +GPL  L +Q+ D + +++ S+ WKED 
Sbjct  240   AKRASAIVFNTFDRLEHEVLDALKAMVPPIYTLGPLHILTEQLPDDDTKSIGSNPWKEDL  299

Query  876   SCLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAIL  1055
              CLEWLD+  P SVVYVN+GSITVM+P QL E AWGLANS + FLW+IRPDLV G  AIL
Sbjct  300   GCLEWLDSNPPVSVVYVNFGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAIL  359

Query  1056  PPEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQ  1235
             PP+F+  T+ R +L SWCPQE+VL HPAVGGFLTH GW ST+ESI  GVP++CWPFF EQ
Sbjct  360   PPDFLAATRQRSLLVSWCPQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQ  419

Query  1236  QTNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTI  1415
             Q NCWYSC +WGIG+EID++V RDEVE+ VRELME E+G+ MKRK ME +++A EAA   
Sbjct  420   QRNCWYSCEEWGIGLEIDDDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR--  477

Query  1416  PIGSSHVNIEKFINHLLLSHRK  1481
             P GSS  N+++ I+ +LLS R+
Sbjct  478   PSGSSCSNLDEVIDKVLLSPRR  499



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 380/475 (80%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VCIPYPAQGHINPMLK+AK+LH KGFH+TFVNT +NH+RL RS GP +L GLPSF+
Sbjct  11    KPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPSFQ  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE IPDGLP +E DATQDIP+LCEST   CL PFK+LL ++N  A  + PPVSCIVSDGV
Sbjct  71    FEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN--ARKDVPPVSCIVSDGV  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWT SA G + Y+H+   ++KG  P +DES LTN +L+T +DW
Sbjct  129   MSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCLTNEHLDTSIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  M  ++L+D+P+F+RTTNP++ M+ F++ ET +++RASAIILNTFD L+H+ + A+QS
Sbjct  189   IPSMNNLKLKDIPTFIRTTNPNDIMVNFLVHETDQSKRASAIILNTFDDLDHDIIQAMQS  248

Query  771   MLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPVY++GPL  L  +++++      L S+LW+E+T CL+WLDTKA NSVVYVN+GSIT
Sbjct  249   ILPPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL EFAWGLA S+K FLW+IRPDLV GE A++P EF+ ET+ R ML SWCPQE+V
Sbjct  309   VMTAKQLVEFAWGLAASRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQEKV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTHNGWNSTLESI  GVPM+CWPFFAEQQTN  Y C +WG+GMEI  +V R
Sbjct  369   LSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++++ KA E ++LA E A   P GSS VN +  ++ +LL
Sbjct  429   EEVEAVVRELMDGEKGKKLREKAEEWRRLA-EKATEHPCGSSVVNFKTVVDKILL  482



>ref|XP_004136879.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=488

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/489 (62%), Positives = 376/489 (77%), Gaps = 6/489 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S+ +KPHAVCIPYPAQGHI PML LAK+LHHKGF+ITFVNT++NHRRL +S GP 
Sbjct  1     MGSV-SQTEKPHAVCIPYPAQGHITPMLMLAKLLHHKGFYITFVNTDYNHRRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS---N  374
             SL GL  F F TIPDGLP S+A+ TQDIP+LCESTS  CL PF DL+++LN  A S   N
Sbjct  60    SLDGLQDFTFRTIPDGLPYSDANCTQDIPALCESTSKNCLAPFCDLISQLNSMAASPSSN  119

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPVSCIVSD VMSF++ AA E  IP    WT SACG+LGY  Y  L+ +G  PLKD + 
Sbjct  120   MPPVSCIVSDAVMSFSMLAANEFKIPYAFLWTASACGYLGYFQYEHLIKQGLIPLKDMNQ  179

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             +T+GYLET + W +GMK IRL+DLP+ L T   D+ M+ FI+Q   R+R AS IILNTFD
Sbjct  180   VTDGYLETTVGWTQGMKNIRLKDLPTLLGTVVEDDIMINFIIQAMERSREASTIILNTFD  239

Query  735   ALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             A+E +   +L S+L  +Y +GPL  L  Q+ D N+ A+ S+LW E++ C+EWL++K PNS
Sbjct  240   AIEGDVKDSLSSILQSIYTIGPLHMLSNQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMTP Q+ EFAWGLA+S KPFLWI RPDL+ G++AI+  EFV +TKDR M
Sbjct  300   VVYVNFGSITVMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAIMSQEFVTQTKDRSM  359

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++SWC QEQVL HP++GGF+TH+GWNSTLESIC GVPM+ WPFFAEQQTNC Y CT+WGI
Sbjct  360   IASWCSQEQVLNHPSIGGFVTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGI  419

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEIDNNV+R EVE++V ELM+ EKG++MK  AM LK  A EA    P GS++  ++K I
Sbjct  420   GMEIDNNVIRSEVEELVGELMDGEKGKKMKENAMFLKSKAEEAYK--PGGSAYKQLDKLI  477

Query  1455  NHLLLSHRK  1481
             N +LLS+ K
Sbjct  478   NEVLLSNIK  486



>ref|NP_001031078.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 gb|AEE30233.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=469

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 377/484 (78%), Gaps = 19/484 (4%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  ++  K H VC+PYPAQGHINPM+K+AK+L+ KGFHITFVNT +NH RL RS GP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             ++ GLPSFRFE+IPDGLP ++ D TQDIP+LCEST   CL PFK+LL ++N  A  + PP
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN--ARDDVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDG MSFT+DAAEELG+PEV+FWTTSACGFL Y++Y + ++KG +P+KDESYLT 
Sbjct  117   VSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTK  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              +L+T++DW+  MK +RL+D+PSF+RTTNPD+ ML FI++E  RA+RASAIILNTFD LE
Sbjct  177   EHLDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTFDDLE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSV  917
             H+ + +++S++PPVY++GPL  L+KQ       +    S+LW+E+T CL+WL+TKA NSV
Sbjct  237   HDVIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSV  296

Query  918   VYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGML  1097
             VYVN+GSITV++  QL EFAWGLA + K FLW+IRPDLV G+ A++PPEF+  T DR ML
Sbjct  297   VYVNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRML  356

Query  1098  SSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIG  1277
             +SWCPQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +S  +W +G
Sbjct  357   ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVG  416

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             +EI              +LM+ EKG+ M+ KA E ++LA EA +    GSS +N E  +N
Sbjct  417   IEI------------GGDLMDEEKGKNMREKAEEWRRLANEATEH-KHGSSKLNFEMLVN  463

Query  1458  HLLL  1469
              +LL
Sbjct  464   KVLL  467



>ref|XP_003635298.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/472 (62%), Positives = 371/472 (79%), Gaps = 4/472 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+PYP+QGH+ P+++LAK++H +GFHITFVNTEFNHRRL RS GP+S+RGL  FR
Sbjct  8     KPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDFR  67

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE IPDGLP S+ DATQD+P+LC+ST   CL PF+DLLARLN +  S+ PPVSCI+SDGV
Sbjct  68    FEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLNSS--SDVPPVSCIISDGV  125

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSF ++AAEELGIPEV FWT SAC F+GY+HY + + +G  P KDES+ ++G L+T +DW
Sbjct  126   MSFAIEAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFKDESFRSDGTLDTPIDW  185

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GM  IRLRD+PS ++TT+P+  M  F+ +E      + AII NTFDA E E L A+  
Sbjct  186   IPGMPNIRLRDIPSHIQTTDPNSIMFDFMGEEAQNCLNSPAIIFNTFDAFEDEVLQAIAQ  245

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
               P +Y  GPL  L++ + D  V++L SSLWKED++CLEWLD + PNSVVYVNYGS+TVM
Sbjct  246   KFPRIYTAGPLPLLERHMLDGQVKSLRSSLWKEDSTCLEWLDQREPNSVVYVNYGSVTVM  305

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             T   L EFAWGLANSK  FLWIIRPD+V G++A+LP EF++ETKDRG+L SWCPQEQVL 
Sbjct  306   TDRHLKEFAWGLANSKYSFLWIIRPDIVMGDSAVLPEEFLKETKDRGLLVSWCPQEQVLS  365

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HP+VG FLTH GWNS LE+IC GVP++CWPFFA+QQTNC Y+CT WGIG+E+D++V RDE
Sbjct  366   HPSVGVFLTHCGWNSMLEAICGGVPVICWPFFADQQTNCRYACTTWGIGVEVDHDVKRDE  425

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +E++V+E+M  +KG++M++KA E K  A EA D    GSS+ N +KFI   L
Sbjct  426   IEELVKEMMGGDKGKQMRKKAQEWKMKAEEATDV--GGSSYTNFDKFIKEAL  475



>ref|XP_011009478.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009479.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009480.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 381/482 (79%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL  +  K HAVC+PYPAQGHI PMLK+AK+LHHKGFHITFVN+E+NHRRL +S G  
Sbjct  1     MGSL-PKSTKAHAVCLPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRN  59

Query  204   SLRGLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL  LP F+FETIPDGL    +AD TQD   LC+STS  CL PF+ LLA+LN + V   P
Sbjct  60    SLDVLPDFQFETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSSNV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIV+DG MSF +D  +EL IP V+FWT+SACG L Y HY  L+++GY PLK+ES LT
Sbjct  118   PVTCIVADGGMSFALDVKDELQIPVVIFWTSSACGTLAYAHYKHLVERGYIPLKEESDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET++DW+ GMK IRL+D P+F+RTT+ ++ ML F+++   RA +ASA ILNTFD L
Sbjct  178   NGYLETKIDWIPGMKDIRLKDFPTFIRTTDRNDVMLNFVIRIIDRASKASAAILNTFDDL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ L+AL SM PP+Y VGPL  L +Q ++  + ++ SSLWKE+T CL WLD+K PNSVV
Sbjct  238   DHDVLVALSSMFPPIYPVGPLNLLLEQTQNDYLASIGSSLWKEETECLHWLDSKDPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVM P QL EF+WGLANS K FLWIIRPDLV G++A+LPPEF+EET++RG+ +
Sbjct  298   YVNFGSITVMNPQQLVEFSWGLANSMKNFLWIIRPDLVRGDSAVLPPEFLEETRERGLTA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL H ++GGFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++CT W +GM
Sbjct  358   SWCAQEKVLKHSSIGGFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACTDWDVGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++  RDEVEK+V ELM+ EKG+EMKRKAME K  A EA   I  GSS +N++K +N 
Sbjct  418   EIESDANRDEVEKLVIELMDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNLDKLVND  475

Query  1461  LL  1466
             LL
Sbjct  476   LL  477



>ref|XP_002323976.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
 gb|EEF04109.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
Length=482

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/473 (63%), Positives = 376/473 (79%), Gaps = 5/473 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             K HAVC+PYPAQGHI PMLK+AK+LHHKGFHITFVN+E+NHRRL +S G  SL  LP F+
Sbjct  9     KAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  231   FETIPDGL-PLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             FETIPDGL    + D TQD   LC+STS  CL PF+ LLA+LN ++V   PPV+CIV+D 
Sbjct  69    FETIPDGLGDQIDVDVTQDTSFLCDSTSKACLDPFRQLLAKLNSSSV--VPPVTCIVADS  126

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              MSF +D  EEL IP + FWT+SACG L Y HY  L+++GYTPLK+ES LTNGYLET++D
Sbjct  127   GMSFALDVKEELQIPVITFWTSSACGTLAYAHYKHLVERGYTPLKEESDLTNGYLETKID  186

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GMK IRL+DLP+F+RTT+ ++ ML F+++   RA +ASA ++NTFD L+H+ L+AL 
Sbjct  187   WIPGMKDIRLKDLPTFIRTTDRNDVMLNFVIRIIDRASKASAALVNTFDDLDHDVLVALS  246

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             SM PP+Y+VGPL  L  Q ++  + ++ SSLWKE+T CL WLD+K PNSVVYVN+GSITV
Sbjct  247   SMFPPIYSVGPLNLLLDQTQNDYLASIVSSLWKEETECLHWLDSKDPNSVVYVNFGSITV  306

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M P QL EF+ GLANSKK FLWIIRPDLV G++A+LPPEF+EET+DRG+++SWC QE+VL
Sbjct  307   MNPQQLVEFSLGLANSKKNFLWIIRPDLVRGDSAVLPPEFLEETRDRGLMASWCAQEKVL  366

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              H ++GGFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++C  WG+GMEI+++  RD
Sbjct  367   KHSSIGGFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIESDANRD  426

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             EVEK+V ELM+ EKG+EMKRKAME K  A EA   I  GSS +N +K +N +L
Sbjct  427   EVEKLVIELMDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVNDVL  477



>ref|XP_002323978.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
 gb|EEF04111.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
Length=482

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 382/482 (79%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  +  K HAVC+PYPAQGHI PMLK+AK+LHHKGFHITFVN+E+NHRRL +S G  
Sbjct  1     MGSI-PKSTKAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRN  59

Query  204   SLRGLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL  LP F+FETIPDGL    +AD TQD   LC+STS  CL PF+ LLA+LN + V   P
Sbjct  60    SLDVLPDFQFETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSSNV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIV+D  MSF +D  EEL IP V F T+SACG L Y HY  L+++GYTPLK+ES LT
Sbjct  118   PVTCIVADNGMSFALDVKEELQIPVVTFLTSSACGTLAYAHYKHLVERGYTPLKEESDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET++DW+ GMK IRL+DLP+F+RTT+ ++ ML F+++   RA +ASA ++NTFD L
Sbjct  178   NGYLETKIDWIPGMKDIRLKDLPTFIRTTDRNDVMLNFVIRVIDRASKASAALVNTFDDL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ L+AL SM PP+Y+VGPL  L  Q ++  + ++ SSLWKE+T CL+WLD+K PNSVV
Sbjct  238   DHDVLVALSSMFPPIYSVGPLNLLLDQTQNDYLASIGSSLWKEETECLQWLDSKDPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVM P QL EF+WGLANSKK FLWIIRPDLV GE+A+LPPEF+EET++RG+++
Sbjct  298   YVNFGSITVMNPQQLLEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL H ++GGFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++C  WG+GM
Sbjct  358   SWCAQEKVLKHSSIGGFLSHMGWNSTIESMSNGVPMLCWPFFSEQQTNCKFACVDWGVGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++  RDEVEK+V EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N 
Sbjct  418   EIESDANRDEVEKLVIELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVND  475

Query  1461  LL  1466
             +L
Sbjct  476   VL  477



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/485 (63%), Positives = 375/485 (77%), Gaps = 8/485 (2%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPHAVCIPYPAQGHINPMLKLAK+LH +GFHITFVNT FNH R+ +S GP SL GLP 
Sbjct  4     ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRILKSRGPNSLDGLPD  63

Query  225   FRFETIPDGLPLSE--ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA---PPVS  389
             FRFE+IPDGLP +E  ADATQDIPSLCEST  TCL PF+ LL +LND + S+    PPVS
Sbjct  64    FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
             C+VSD  M FT+ A EE GIP  +FWT SACG LGY  Y  L++KG+TP KDES  TNGY
Sbjct  124   CVVSDAAMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             L+T +DW+  +  IRL+DLPSF+RTTNP+E+M+K++++        SAII NTFDALEH 
Sbjct  184   LDTLIDWIPVVNDIRLKDLPSFIRTTNPNEFMVKYVIRLIKLTSTGSAIIFNTFDALEHN  243

Query  750   ALMALQSMLP-PVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYV  926
              L AL SM P P+Y +GPL  L  + +  ++ ++AS+LW E+  CL+WLD+K   S+VYV
Sbjct  244   VLEALSSMFPCPIYTLGPLHLLVNKTQPKSLSSIASNLWVEELECLQWLDSKDSKSIVYV  303

Query  927   NYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSW  1106
             N+GSIT +TP+QL EFAWGLANSKKPF+WIIRPDLV G++AILP EFVEET++R ++SSW
Sbjct  304   NFGSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSW  363

Query  1107  CPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEI  1286
             CPQE+VL HPA+GGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC + C  WG GMEI
Sbjct  364   CPQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCDYWGSGMEI  423

Query  1287  dnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             + NV RD+VEK+VRELM+ EKG +M+ KAME K  A EA +    GSS VN++  I+ +L
Sbjct  424   NPNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHEATEL--GGSSLVNLDNIISKVL  481

Query  1467  LSHRK  1481
             +   K
Sbjct  482   VPSSK  486



>ref|XP_006351765.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=499

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/490 (61%), Positives = 382/490 (78%), Gaps = 7/490 (1%)
 Frame = +3

Query  3     EREREREMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRL  182
             +R ++ +M S  + +   H VC+PYPAQGHI+PMLKLAK++HH GF+ITFVNTEFNH+RL
Sbjct  9     DRPKKIKMASFANFKSG-HVVCVPYPAQGHISPMLKLAKLVHHNGFYITFVNTEFNHKRL  67

Query  183   QRSLGPESLRGLPSFRFETIPDGLPLSE--ADATQDIPSLCESTSATCLGPFKDLLARLN  356
              RS GP+SL GLP FRFETIPDGLP ++   DATQ +PSLC STS  CL PF++L+ ++N
Sbjct  68    LRSNGPQSLDGLPGFRFETIPDGLPSTDHDVDATQHVPSLCASTSKNCLVPFRNLINKIN  127

Query  357   DTAVSNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTP  536
                    PPV+CIVSD +MSFT+DAAEELGIPEV+FWT SACGF+ Y+HY  L+ +GY P
Sbjct  128   AEGNGVVPPVTCIVSDVIMSFTLDAAEELGIPEVLFWTASACGFMCYLHYHHLVQRGYIP  187

Query  537   LKDESYLTNGYLETELDWVKG-MKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASA  713
             LKDE+ + NGYLE  +DWV G +K +RLRD PSF+RTT+P++ ML F + ET R  +ASA
Sbjct  188   LKDENDIKNGYLEKMIDWVPGILKNMRLRDFPSFIRTTDPNDIMLNFFINETERISKASA  247

Query  714   IILNTFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWL  893
             I+LNTFDA EH AL AL ++ P +Y +GPLQ +     D N++++ S+LWKED SC+EWL
Sbjct  248   IVLNTFDAFEHNALNALFAIHPHIYTIGPLQLMLNNTIDENLKSIGSNLWKEDLSCIEWL  307

Query  894   DTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVE  1073
             DTK  NSVVYVN+GSITVM  DQ  E AWGLAN+KK FLWIIRPDL+TG++  LP +F+ 
Sbjct  308   DTKESNSVVYVNFGSITVMNFDQFIEMAWGLANTKKQFLWIIRPDLITGDSVKLPEDFLS  367

Query  1074  ETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWY  1253
             E KDRGM+++WCPQE+VL H A+GGFLTH+GWNSTLES+C GVP+LCWPFFAEQQTNC Y
Sbjct  368   EIKDRGMIANWCPQEKVLKHRAIGGFLTHSGWNSTLESVCAGVPVLCWPFFAEQQTNCRY  427

Query  1254  SCTKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSH  1433
             SC +W +GMEI  ++ R+EVE +VRELM+ EKG++MK KAM  K+ A +AA   P GSS 
Sbjct  428   SCIEWEMGMEI-VDLKRNEVEILVRELMDGEKGKKMKLKAMNWKEEAEKAAS--PGGSSC  484

Query  1434  VNIEKFINHL  1463
             +N+   +N +
Sbjct  485   INLNNVLNEV  494



>ref|XP_007224375.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
 gb|EMJ25574.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
Length=487

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/481 (62%), Positives = 389/481 (81%), Gaps = 6/481 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVC+P+PAQGHINPMLKLAK+LH KGFHITFVNTEF H+RL +S GP SL GLP+F
Sbjct  10    EKPHAVCMPFPAQGHINPMLKLAKLLHFKGFHITFVNTEFIHKRLLKSQGPNSLNGLPTF  69

Query  228   RFETIPDGLPLSEAD-ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             RF+ IPDGLP ++A+ A Q +PSLC+S    CL PF+ LL++L  +   N+PPV+C+VSD
Sbjct  70    RFKMIPDGLPPADANVAAQHMPSLCQSIRKHCLQPFRGLLSKLKSSP--NSPPVTCLVSD  127

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G+M+F++DAA+ELGIP V+FWTTSAC F+GY+ Y  L+ KG  PLKD  YLTNGYL+T +
Sbjct  128   GIMNFSLDAAQELGIPGVIFWTTSACAFMGYIQYGPLIQKGLVPLKDARYLTNGYLDTVI  187

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+ GMK IRL+D+PSF+RTT+P++ +L FI+ +T RA+RASAIILNTFDALEHE L AL
Sbjct  188   DWIPGMKSIRLKDIPSFIRTTDPNDPILDFIMVDTERAKRASAIILNTFDALEHEVLDAL  247

Query  765   QSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
              ++LPP+Y +GPL      +  D  ++++ S+LW E+T CL+WLD+K PNSVVYVN+GS 
Sbjct  248   STLLPPIYCIGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSS  307

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVT-GEAAILPPEFVEETKDRGMLSSWCPQE  1118
             TVMT +QL+EFAWGLANS K F W+IRPDLV  G++ ++ PEFVEETK+RG+L+SWCPQE
Sbjct  308   TVMTSEQLTEFAWGLANSNKAFFWVIRPDLVCEGKSVVVAPEFVEETKERGLLASWCPQE  367

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             QVL HPA+GGFLTH GWNST+ES+  GVPM+CWPF A+QQTNC + C++WGIG+EI+ +V
Sbjct  368   QVLIHPAIGGFLTHCGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDV  427

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              R  +E +VRELME  +G+++++KA+E KKLA EA  T   GSS +++++ +N +LLS R
Sbjct  428   KRYYIEGLVRELMEGGEGKKLRKKALEWKKLAKEAT-TGSNGSSFLDLDQMVNKVLLSPR  486

Query  1479  K  1481
              
Sbjct  487   N  487



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/435 (69%), Positives = 363/435 (83%), Gaps = 4/435 (1%)
 Frame = +3

Query  102   MLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFRFETIPDGLPLSEADATQ  281
             MLKLAK+LH KGFHITFVNTEFNH+RL +S G  +L GLPSFRFE IPDGLP ++ADATQ
Sbjct  1     MLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAHALDGLPSFRFEAIPDGLPPTDADATQ  60

Query  282   DIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGVMSFTVDAAEELGIPEVM  461
              IP++CEST    L PF+DLL +LN +     PPVSC+VSDG MSFT+DAAEELGIPEV+
Sbjct  61    SIPAICESTPKHSLAPFRDLLLKLNSSP--EVPPVSCVVSDGAMSFTLDAAEELGIPEVL  118

Query  462   FWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDWVKGMKGIRLRDLPSFLR  641
             FWTTSACGFLGY+HY  L++KGYTPLKDESYLTN YL T +DW+ GMK IRL+D+P+F+R
Sbjct  119   FWTTSACGFLGYLHYRALVEKGYTPLKDESYLTNEYLNTVIDWIPGMKDIRLKDIPTFIR  178

Query  642   TTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQSM-LPPVYAVGPLQFLQK  818
             TT+P++ M+ F++ E  RA++ASAIILNTF  LE +A+ A+ S+  PPVY +G LQ L  
Sbjct  179   TTDPNDIMVNFVITEAERAQKASAIILNTFYDLERDAVNAMSSISKPPVYTLGSLQLLLN  238

Query  819   QVKDI-NVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVMTPDQLSEFAWGLANS  995
             Q     ++++L S+LWKED  CLEWLD+K PNSVVYVN+GSITVMT +QL EFAWGLANS
Sbjct  239   QFPITEHLKSLESNLWKEDHKCLEWLDSKEPNSVVYVNFGSITVMTSEQLVEFAWGLANS  298

Query  996   KKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNS  1175
             KK FLW++RPDLV GE+A+LPPEF EET +RG L+SWCPQE+VLGHPAVGGFLTH GWNS
Sbjct  299   KKEFLWVLRPDLVAGESAVLPPEFSEETSERGFLTSWCPQEKVLGHPAVGGFLTHCGWNS  358

Query  1176  TLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvrELMESEKGR  1355
             T+ESIC+GVPMLCWPFFAEQQTNCWYSC +WGIGMEID +  R+E+E++VRELM+ EKGR
Sbjct  359   TIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGMEIDGDAKREEIERIVRELMDGEKGR  418

Query  1356  EMKRKAMELKKLAME  1400
             EMKR+  + K+LA E
Sbjct  419   EMKRRVEKWKRLAEE  433



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/485 (61%), Positives = 389/485 (80%), Gaps = 6/485 (1%)
 Frame = +3

Query  21    EMGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             E  ++ SEQ KPH VC+PYPAQGHINPMLK+AK+LH KGFH+TFVNT +NH RL RS GP
Sbjct  2     ESHAVCSEQ-KPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSFRFE+IPDGLP ++ DAT+DIP+LCEST   CL PFK+LL R+N  A  + P
Sbjct  61    HALDGLPSFRFESIPDGLPETDVDATRDIPALCESTVKNCLTPFKELLRRIN--AGDDVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG M+FT+DAAEELGIPEV+F TTSACGFL Y+H+ + ++KG +PLKD S  T
Sbjct  119   PVSCIVSDGCMTFTIDAAEELGIPEVLFRTTSACGFLAYLHFYRFIEKGLSPLKDVSCWT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               +L+T++DW+  M+ +RL+D+PSF+R TNP++ +L F ++E+ RA+RASAIILNTFD L
Sbjct  179   KEHLDTKIDWIPSMRNLRLKDIPSFIRATNPEDILLNFFVRESDRAKRASAIILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH+ +  +QS+LPPVY++GPL  L+ +   KD ++  + S+LW+E+T CL+WLDTK+ NS
Sbjct  239   EHDVIQYMQSILPPVYSIGPLHLLENRHIDKDSDMGRMGSNLWREETECLDWLDTKSRNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVY+N+GS+TVM+   L EFAWGLA S K FLW+IRPDLV GE A++P +F++ET  R M
Sbjct  299   VVYINFGSLTVMSVKHLVEFAWGLAGSGKDFLWVIRPDLVVGEDAMVPSDFLKETAGRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWCPQE+VL H A+GGFLTH+GWNSTLES+ +GVPM+CWPFFAEQQTNC + C +W +
Sbjct  359   LASWCPQEKVLSHQAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFCCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEI  +V R+EVE V+RELM+ EKG++M+ KA E ++LA EA +   +GSS+VN E  +
Sbjct  419   GMEIGGDVKREEVETVIRELMDGEKGKKMREKAEEWRRLAEEAVEH-KLGSSNVNFETLV  477

Query  1455  NHLLL  1469
             N +LL
Sbjct  478   NKVLL  482



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/491 (61%), Positives = 382/491 (78%), Gaps = 8/491 (2%)
 Frame = +3

Query  24    MGSLRSEQD--KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLG  197
             M SL   Q   +PHAVC+P+PAQGHINPM +LAK+LHHKGFHITFVNTEFN RRL +S G
Sbjct  1     MASLIDTQHPRRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQG  60

Query  198   PESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
             P+SL  +P+FRFETIPDGLP S+ADATQDIPSLC+ST  TC  PF++LL RLN++A+SN 
Sbjct  61    PDSLNAVPTFRFETIPDGLPPSDADATQDIPSLCDSTKRTCSAPFQELLTRLNNSALSNV  120

Query  378   -PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPV+CIVSD  M FT+ A+++L IP V+F+T SACGF GY+HY  L++K   PLKD SY
Sbjct  121   NPPVTCIVSDWAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPLKDLSY  180

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             LTNGY+++ +DW+ GM+GI+L+ LPSF+R+T+ D++M+ F++ E   A  ASA+I NTFD
Sbjct  181   LTNGYMDSVIDWIPGMEGIQLKYLPSFIRSTDRDDFMVNFVITEIENAHNASALIFNTFD  240

Query  735   ALEHEALMALQSMLPPVYAVGPLQFL----QKQVKDINVRALASSLWKEDTSCLEWLDTK  902
              LE E L  L S+ P ++ +GPL  L    +    D  +  + S+LWKE   CLEWLD+K
Sbjct  241   DLEPEVLKELSSIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWKEQPGCLEWLDSK  300

Query  903   APNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETK  1082
               NSVVYVN+GSIT +T +QL EFAWGLANSK+PFLW+IRPD++    A++  EFVEETK
Sbjct  301   EQNSVVYVNFGSITALTRNQLVEFAWGLANSKRPFLWVIRPDIINEATAVITQEFVEETK  360

Query  1083  DRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT  1262
             DRGML+SWCPQEQ+L HP+VGGFLTH GWNST+ES+C+GV MLCWPFFAEQQTNCW+  T
Sbjct  361   DRGMLASWCPQEQILRHPSVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQT  420

Query  1263  KWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNI  1442
             KWG+G+E++    R ++EK VRELME E G+ MK KA+E K LA +AA   P GSS+VN+
Sbjct  421   KWGVGIEVNPRADRVDIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAG-PNGSSYVNL  479

Query  1443  EKFINHLLLSH  1475
             +K IN +LL++
Sbjct  480   DKLINDVLLTY  490



>gb|KFK44334.1| hypothetical protein AALP_AA1G244600 [Arabis alpina]
Length=482

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 383/477 (80%), Gaps = 6/477 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPHAVC+PYPAQGHINPMLK+AK+LH KGFH++FVNT +NH RL RS GP +L GLPS
Sbjct  9     KQKPHAVCVPYPAQGHINPMLKVAKLLHSKGFHVSFVNTIYNHNRLLRSRGPNALDGLPS  68

Query  225   FRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             F+FE+IPDGLP ++ +ATQ IP+LCEST  TCL PFKDLL R+N  A  + PPVSCIVSD
Sbjct  69    FQFESIPDGLPETDVEATQHIPTLCESTMKTCLAPFKDLLGRIN--ARDDVPPVSCIVSD  126

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             G MSFT+DAAEE  +PEV+FWTTSACGF  Y+H  + ++KG +PLKDES LT   L+T++
Sbjct  127   GCMSFTLDAAEEFEVPEVLFWTTSACGFSTYLHLYRFIEKG-SPLKDESNLTEEQLDTKI  185

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+  MK ++L+D+PSF+ TTNPD+ ML F+++E  RA+RASAIILNTFD LEH+ + ++
Sbjct  186   DWIPSMKNLKLKDIPSFILTTNPDDIMLNFLIREAERAKRASAIILNTFDDLEHDGVQSI  245

Query  765   QSMLPPVYAVGPLQ-FLQKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             QSMLPPVY++GPL  F  +++ +  ++  + S+LW+E+T CL+WLDTK+ NSV+YVN+GS
Sbjct  246   QSMLPPVYSIGPLHLFANREIAEGSDIGQMGSNLWREETKCLDWLDTKSRNSVLYVNFGS  305

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             + VMT  QL EFAWGLA S K FLW+IRPDLV G+ A +PPEF++ET  R ML+SWCPQE
Sbjct  306   LIVMTTKQLVEFAWGLAGSGKEFLWVIRPDLVAGDEAKVPPEFLKETTGRRMLASWCPQE  365

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL HPA+GGFLTH+GWNSTLES+ +GVPM+CWPFFAEQQTNC ++C +WG+GM+I  +V
Sbjct  366   KVLSHPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFTCDEWGVGMKIGGDV  425

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              R+EVE VVRELM+ E+GR M+ KA E ++LA E A     GSS VN E F+  LLL
Sbjct  426   KREEVEAVVRELMDGERGRRMREKAEEWQRLA-EEATYHKRGSSVVNFETFVTKLLL  481



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/472 (65%), Positives = 372/472 (79%), Gaps = 6/472 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             DKPHAVC+P+PAQGHINPMLKLAKILH  GFHITFVNTE+NHRRL RS G  SL GLP F
Sbjct  3     DKPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGASSLDGLPDF  62

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             +FETIPDGLP S+AD+TQDI +LC STS TCL PF+DL+A+LN ++V   P V+CIVSD 
Sbjct  63    QFETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLIAKLNSSSV--IPQVTCIVSDA  120

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             +M+FT+DAAEE GIP+ +FWT SACG LGY     L ++G TP+KD SYLTN +LET ++
Sbjct  121   IMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRLLFERGLTPVKDVSYLTNEFLETAIE  180

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ G + IRLRDLPS + T + DE  L   L E  R  RASA+I NTF++ E + L AL 
Sbjct  181   WIPGKENIRLRDLPSLVTTADVDEINLIITLIE--RTSRASAVIFNTFESFERDVLDALS  238

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M PP+Y +GPLQ L  Q  + N++   S+LWKE+  C+EWLD+K PNSVVYVN+GSITV
Sbjct  239   TMFPPIYTLGPLQLLVDQFPNGNLKNFGSNLWKEEPGCIEWLDSKEPNSVVYVNFGSITV  298

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             +TP Q+ EFAWGLANS KPFLWIIRPDLV GE+A+LP EFV ETK RGML++WCPQE VL
Sbjct  299   ITPQQMMEFAWGLANSNKPFLWIIRPDLVEGESAMLPSEFVSETKKRGMLANWCPQELVL  358

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HP++GGFL H GWNST++SIC GVP++CWPFFA+QQTNC ++CT+WGIGM+IDNNV RD
Sbjct  359   KHPSIGGFLCHMGWNSTMDSICAGVPLICWPFFADQQTNCMFACTEWGIGMQIDNNVKRD  418

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             EVEK+VRELME EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  419   EVEKLVRELMEGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  468



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/475 (63%), Positives = 379/475 (80%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VCIPYPAQGHINPMLK+AK+LH KGFH+TFVNT +NH+RL RS GP +L GLPSF+
Sbjct  11    KPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPSFQ  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE IPDGLP +E DATQDIP+LCEST   CL PFK+LL ++N  A  + PP+SCIVSDGV
Sbjct  71    FEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN--ARKDVPPISCIVSDGV  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+PEV+FWT SA G + Y+H+   ++KG  P +DES LTN +L+T +DW
Sbjct  129   MSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCLTNEHLDTSIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  M  ++L+D+P+F+RTTNP++ M+  ++ ET +++RASAIILNTFD L+H+ + A+QS
Sbjct  189   IPSMNNLKLKDIPTFIRTTNPNDIMVNILVHETDQSKRASAIILNTFDDLDHDIIQAMQS  248

Query  771   MLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPVY++GPL  L  +++++      L S+LW+E+T CL+WLDTKA NSVVYVN+GSIT
Sbjct  249   ILPPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGSIT  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL EFAWGLA S+K FLW+IRPDLV GE A++P EF+ ET+ R ML SWCPQE+V
Sbjct  309   VMTAKQLVEFAWGLATSRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQEKV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPAVGGFLTHNGWNSTLESI  GVPM+CWPFFAEQQTN  Y C +WG+GMEI  +V R
Sbjct  369   LSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +EVE VVRELM+ EKG++++ KA E ++LA E A   P GSS VN +  ++ +L+
Sbjct  429   EEVEAVVRELMDGEKGKKLREKAEEWRRLA-EKATEHPCGSSVVNFKMVVDKILI  482



>ref|XP_010937416.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=477

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/477 (64%), Positives = 383/477 (80%), Gaps = 8/477 (2%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPH VC+PYPAQGH+ PMLKLAK+LH KGF+ITFVNTEFNHRRL +S GP SL GLP F
Sbjct  7     EKPHVVCVPYPAQGHVTPMLKLAKLLHSKGFYITFVNTEFNHRRLLKSQGPSSLDGLPDF  66

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RF TIPDGLP S+A+ATQD+PSLC ST  TCL  F+ LL+ L+       PP++CI+SDG
Sbjct  67    RFSTIPDGLPPSDANATQDVPSLCYSTMTTCLPHFRRLLSMLD------GPPLTCIISDG  120

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+DAA+ELG+PEV+FWTTSACGF+ Y+HY  L+D+G  PLKD S L+NGYL+T +D
Sbjct  121   VMSFTLDAAKELGVPEVLFWTTSACGFMAYLHYRHLMDRGLVPLKDASDLSNGYLDTHVD  180

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ G+K +RLRD+PSF+RTT+PD+ M+ F L E  RA  ASAIILNTFD LE   L A+ 
Sbjct  181   WIPGLKNMRLRDIPSFIRTTDPDDTMINFALHECKRATMASAIILNTFDELEQPVLDAMA  240

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             ++LPP+Y +GPL  L +Q+    V AL S+LWKE+ +C  WL  K PNSVVYVN+GSITV
Sbjct  241   TILPPIYPIGPLTLLARQLSASPVSALGSNLWKEEPACSNWLAGKNPNSVVYVNFGSITV  300

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT  QL EFAWGLANS   FLWIIRPDLV G+AA+LP EF+EETK+RG+L+SWCPQE++L
Sbjct  301   MTNQQLIEFAWGLANSGHDFLWIIRPDLVKGDAAVLPLEFLEETKERGLLASWCPQEEIL  360

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              +PA+GGFLTH+GWNST+ESIC GVPML WPFFAEQQTNC Y CT+WGIGMEIDNNV R+
Sbjct  361   SNPAIGGFLTHSGWNSTVESICEGVPMLSWPFFAEQQTNCRYVCTEWGIGMEIDNNVKRE  420

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              VE ++RELM+ EKG+EMK++AM  K+ A+ A  ++P G S +N+E+ +  +LL+ +
Sbjct  421   VVEGMIRELMKGEKGKEMKKRAMAWKESAVGA--SLPGGPSSLNLERLVKEVLLARK  475



>ref|XP_002525850.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36544.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=480

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/486 (62%), Positives = 385/486 (79%), Gaps = 9/486 (2%)
 Frame = +3

Query  33    LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLR  212
             + S  +KPHAVCIPYPAQGHINPMLKLAK+LH +GF+ITF+NTE   RRL +S GP++L 
Sbjct  1     MTSMANKPHAVCIPYPAQGHINPMLKLAKLLHQRGFYITFINTEHMQRRLLKSRGPDALN  60

Query  213   GLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVS  389
             GLP F+FETIPDGLP S + D+TQDI +L +S +  C  PF++LLA+L  +   N PP++
Sbjct  61    GLPDFQFETIPDGLPPSPDLDSTQDILALAQSVTNNCPVPFRNLLAKLESSP--NVPPIT  118

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
             CIVSDG+MSFT+DAAEE+G+P V+FWT SACGFL Y +  QL+++G  PLKDESYLTNGY
Sbjct  119   CIVSDGIMSFTLDAAEEIGVPGVLFWTASACGFLAYAYNKQLVERGLIPLKDESYLTNGY  178

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             L+T +DW+ GMKGIRL+DLP+F RTT+P+++ L F +QE   A RAS IILNT+D LEHE
Sbjct  179   LDTTVDWIPGMKGIRLKDLPTF-RTTDPNDFFLNFSIQEVYGALRASGIILNTYDELEHE  237

Query  750   ALMALQSMLPPVYAVGPLQFL--QKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              L+AL SM PP+Y +GPL  +  +   KD N  ++ S+LW +D  CL+WLD+K PNSVVY
Sbjct  238   VLVALSSMFPPIYTIGPLDLVGAKNAEKDQNT-SIGSNLWTDDLECLKWLDSKEPNSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GS+T MT  QL E AWGL NSK+ FLWIIR D+V GE+ ILP EFV+ETK+RG+ +S
Sbjct  297   VNFGSMTNMTRQQLVELAWGLGNSKQTFLWIIRTDIVKGESTILPEEFVDETKERGLRTS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE+VL HP++GGFL+H GWNST+ES+ NGVP++CWPF  EQQ NCW++C KWGIGME
Sbjct  357   WCPQERVLKHPSIGGFLSHMGWNSTIESLSNGVPVICWPFGGEQQINCWFACNKWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             I+N V RDEVEK+VREL+E EKG+EM++KAME K+ A EA D  P G S +N+++ +N +
Sbjct  417   IENEVKRDEVEKLVRELIEGEKGKEMRKKAMEWKRKAEEATD--PNGKSSMNLDRLVNEV  474

Query  1464  LLSHRK  1481
             LLS  K
Sbjct  475   LLSQHK  480



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 384/486 (79%), Gaps = 8/486 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS    +DKPHAV IPYPAQGHINP+LKLAKILHH+GFHITFV+TE+NH+ L +S GP 
Sbjct  1     MGS--EARDKPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPS  58

Query  204   SLRGLPSFRFETIPDGLPLSEAD--ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSN-  374
             SL G P FRF+TIPDGLP S++D   TQ IPSLCESTS  CL PF DLL RL+D +V + 
Sbjct  59    SLDGSPRFRFKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDT  118

Query  375   -APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               P VSC+++DG MSF +DAAE+LG+P V+FWT SACG L Y  Y  L +KG  PLKD S
Sbjct  119   EVPKVSCVIADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDAS  178

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
             YLTNG+L+T +DW+ GMK IRLRDLPSF+RTT+ ++ M+ +I+++  R  +ASA+ILNTF
Sbjct  179   YLTNGFLDTTIDWIPGMKNIRLRDLPSFIRTTDGNDIMVNYIIRQMERTNKASAVILNTF  238

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             D LE + LMA  S+ P +Y +GP+  L  +++D N   + S+LWKED +CL WLD+K PN
Sbjct  239   DCLEKDVLMAFSSIFPNLYTIGPIHLLLNKIEDDNSCRIGSNLWKEDFACLGWLDSKEPN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SV+++N+GSI V+T +QL EF+WGLANS+KPFLWIIRPDLV G+  +LP EF+ ETKDRG
Sbjct  299   SVLFINFGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRG  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             ML+ WCPQE+VL HP+VGGFLTH GWNS LESIC GVP+LCWPFFAEQQTNC+Y+  +WG
Sbjct  359   MLAGWCPQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWG  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IGMEIDN+V R+EVEK+VRELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  
Sbjct  419   IGMEIDNSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETL  476

Query  1452  INHLLL  1469
             ++ +L+
Sbjct  477   LSQVLV  482



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/479 (61%), Positives = 384/479 (80%), Gaps = 11/479 (2%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHI+PM K+AK+LH KGFH+TFVNT +NH RL RS G  +L G PSFR
Sbjct  11    KPHAVCVPFPAQGHIDPMQKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGTNALDGFPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP  + DATQD PSLCE+T   CL PFK+L+ R+N  A  + PPVSCIVSDGV
Sbjct  71    FESIPDGLPEIDGDATQDPPSLCEATMKNCLAPFKELVRRIN--AEDDVPPVSCIVSDGV  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+D AEELG+PEV+FWTTSACGF+ Y+H+ + ++KG +PLKDES+L     +T++DW
Sbjct  129   MSFTLDVAEELGVPEVLFWTTSACGFMAYLHFYRFIEKGLSPLKDESFL-----DTKIDW  183

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYM-LKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             +  M+ +RLRD+PSF+R TNPD+++ L F L ET RA+RASAIILNTFD LE + + ++Q
Sbjct  184   IPSMRNLRLRDIPSFIRATNPDDHIILNFFLHETDRAKRASAIILNTFDDLEQDVIQSMQ  243

Query  768   SMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
             S+LPPV+++GPL  L KQ   +D  +  + S+LW+EDT+CL+WLDTK  NSVVYVN+GS+
Sbjct  244   SILPPVHSIGPLHLLAKQEIGEDSEIGRMGSNLWREDTNCLDWLDTKPRNSVVYVNFGSV  303

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TVM+  QL EFAWGLA+++K FLW+IRPDLV G+ A++P EF++ET+DR MLSSWCPQ++
Sbjct  304   TVMSAKQLVEFAWGLASTEKDFLWVIRPDLVAGDVAVVPTEFLKETEDRRMLSSWCPQQK  363

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL HPA+GGFLTHNGWNSTLESI +GVPM+CWPFFAEQQTNC + C +W +GMEI  +V 
Sbjct  364   VLSHPAIGGFLTHNGWNSTLESISSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIGGDVK  423

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
             R+EVE VVRELM+ EKG++M+ KA E ++LA  A + +  GSS  N +  ++ +LL ++
Sbjct  424   REEVEAVVRELMDGEKGKKMREKAEEWRRLAENATEHMR-GSSGSNFQMVVDKVLLGYK  481



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/479 (63%), Positives = 382/479 (80%), Gaps = 6/479 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             +DKPHAV IPYPAQGHINP++KLAKILHH+GFHITFV+TE+NH+RL +S G  SL G P 
Sbjct  6     RDKPHAVVIPYPAQGHINPIMKLAKILHHRGFHITFVHTEYNHKRLLKSRGLSSLDGSPR  65

Query  225   FRFETIPDGLPLSEAD--ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSN--APPVSC  392
             FRFETIPDGLP S++D   TQ IPSLCESTS  CL PF DLL RLND +V +   P VSC
Sbjct  66    FRFETIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLNDKSVDDTEVPKVSC  125

Query  393   IVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYL  572
             +++DG MSF +DAAE+LG+P V+FWT SACG L Y  Y  L +KG  PLKD SYLTNG+L
Sbjct  126   VIADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDASYLTNGFL  185

Query  573   ETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEA  752
             +T +DW+ GMK IRL+DLPSF+RTT+ ++ M+ +I+++  R  +ASA+ILNTFD LE++ 
Sbjct  186   DTTIDWIPGMKNIRLQDLPSFIRTTDGNDIMVNYIIRQIERTNKASAVILNTFDCLENDV  245

Query  753   LMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             LMA  S+   +Y +GP+  L  +++D N   + S+LWKED +CL WLD+K PNSV+++N+
Sbjct  246   LMAFSSIFLNLYTIGPIHLLLNKMEDDNWCRIGSNLWKEDFACLGWLDSKEPNSVLFINF  305

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSI V+T +QL EF+WGLANS+KPFLWIIRPDLV G+  +LP EF+ ETKDRGML+ WCP
Sbjct  306   GSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCP  365

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL HP+VGGFLTH GWNS LESIC GVP+LCWPFFAEQQTNC+YS  +WGIGMEIDN
Sbjct  366   QERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDN  425

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +V R+EVEK+VRELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++H+L+
Sbjct  426   SVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSHVLV  482



>ref|XP_002308831.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
 gb|EEE92354.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
Length=480

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/475 (62%), Positives = 375/475 (79%), Gaps = 2/475 (0%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             DKPHAVCIP PAQ HI  MLKL+K+LH+KGFHIT+VNTEFNH+RL +S GP+++ GLP F
Sbjct  8     DKPHAVCIPSPAQSHIKSMLKLSKLLHYKGFHITYVNTEFNHKRLLKSRGPDAMNGLPDF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFE+IPDGLP S  + TQD+ +LCE+     L PF DLL +LND+A SN PPV+CIVSDG
Sbjct  68    RFESIPDGLPPSNENETQDVAALCEAAKKNLLAPFNDLLDKLNDSASSNVPPVTCIVSDG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M   +DAAE   IP  +F+T SA  F+G+  +  L +KG TPLKDES+LTNGYL+  +D
Sbjct  128   FMPVAIDAAEMRQIPIALFFTISASSFMGFKQFQALREKGLTPLKDESFLTNGYLDKVVD  187

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ IRLRDLPSF+RTT+P++++ K+ L+ TGRA   SA+I +TFD LE E L AL 
Sbjct  188   WIPGMRDIRLRDLPSFVRTTDPNDFIFKYCLECTGRASEGSAVIFHTFDVLEQEVLNALY  247

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             SM P V+A+GPLQ L  Q++++ + ++  +LWKE+  CL+WLD+  P SV+YVN+GSIT 
Sbjct  248   SMFPRVHAIGPLQLLLNQIQEVYLSSIGCNLWKEEVECLQWLDSNKPKSVIYVNFGSITT  307

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             +T +QL EF  GLA S  PFLWIIRPD+VTG++AILPPEF EETK+R  + SWCPQE+VL
Sbjct  308   VTKEQLVEFGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTEETKERSFICSWCPQEEVL  367

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HP++GGFLTH+GW ST+ESI +GVPMLCWPFFA+QQTNC Y+C++WGIGMEIDNNV RD
Sbjct  368   NHPSIGGFLTHSGWGSTIESISSGVPMLCWPFFADQQTNCRYTCSEWGIGMEIDNNVKRD  427

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             +VEK+VRELME EKG+ MK+KAME KKLA EA+   P GSS +N++K +  +LLS
Sbjct  428   KVEKLVRELMEGEKGKSMKKKAMEWKKLAEEASG--PSGSSSMNLDKLVKEVLLS  480



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/482 (63%), Positives = 374/482 (78%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+    +KPHAVCIPYPAQGH+ P+LKLAK+LH +GF+ITFVNT FNH RL RS    
Sbjct  1     MGSI---PEKPHAVCIPYPAQGHVTPLLKLAKLLHVRGFYITFVNTHFNHNRLLRSGAIS  57

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL  LP FRFE+IPDGLP S+ DATQD+PSLC+S    CL PF+DL+ +LN  + S  P 
Sbjct  58    SLDSLPDFRFESIPDGLPPSDEDATQDVPSLCDSIPKNCLPPFRDLITKLNGPS-SPTPK  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVMSFT+DAA+EL IPEV+FWTTSACG +GY+HY  L ++G  PLKD S LTN
Sbjct  117   VSCIVSDGVMSFTLDAAKELQIPEVLFWTTSACGMMGYLHYQHLTERGIFPLKDASDLTN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ GMK +RLRDLP+FLRT +P + M  +  +E  R+   SAIILNTFD  E
Sbjct  177   GYLDTPIDWISGMKNVRLRDLPTFLRTLDPKDIMFNYCNREAQRSSMGSAIILNTFDEFE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
                L A+ SMLPP+Y +GPL  L +Q+    + +++S+LWKEDT+CLEWL  + P SVVY
Sbjct  237   RFVLDAMASMLPPIYTIGPLSLLSRQITTGPLTSISSNLWKEDTTCLEWLQGREPGSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMT +QL EF WGLANSK  FLW+IRPDLV G+ A+LP EF+ ETK+RG+L++
Sbjct  297   VNYGSITVMTNEQLIEFTWGLANSKHDFLWVIRPDLVKGDTAVLPQEFLNETKERGLLAN  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE VL HP++G FLTH+GWNSTLESIC GVP++ WPFFAEQQTNC Y+CT+WGIGME
Sbjct  357   WCPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPVISWPFFAEQQTNCRYACTEWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDNNV R +VE++VRELM  EKG+EM+R+A+E K+ A  A  T P GSS  N E+ +   
Sbjct  417   IDNNVKRGDVERLVRELMVGEKGKEMRRRAVEWKESATRA--TQPGGSSFQNFERLVKEA  474

Query  1464  LL  1469
             LL
Sbjct  475   LL  476



>ref|XP_008229740.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 377/486 (78%), Gaps = 7/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS ++  +KPH VC+P PAQ HI   LK AK+LHH+G H+TFVNTEFNH R  +SLGP 
Sbjct  1     MGS-KAAANKPHVVCVPAPAQSHIKANLKFAKLLHHRGVHVTFVNTEFNHNRFLKSLGPN  59

Query  204   SLRGLPSFRFETIPDGLPL-SEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-  377
             SL GLP FRFETIPDGLP+ S+ DATQD+  + +S ++  L PF+DLL +LND + SN  
Sbjct  60    SLDGLPHFRFETIPDGLPVGSDQDATQDVSLVSDSINSKLLAPFRDLLMKLNDRSTSNGD  119

Query  378   --PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               PPV+CIVSDG M FT  AAEE+G+P V+ +T +AC F+GY  Y  L++KG  PLKDES
Sbjct  120   INPPVTCIVSDGFMPFTTTAAEEIGVPIVLLFTIAACSFMGYKQYPALVEKGLAPLKDES  179

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
              LTNG+L+  +DW+ GMKGIRLRDLP+  RTT+P++++    L+   R  +ASA++L+TF
Sbjct  180   CLTNGFLDKVIDWIPGMKGIRLRDLPANFRTTDPNDFVFNLSLESIERVHKASAVVLHTF  239

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             DALE + L AL SMLP VYA+GP Q L  Q+ +  ++ +  SLWKE+T CLEWL +KAPN
Sbjct  240   DALEPDVLNALSSMLPLVYAIGPDQLLLNQLPEDPLKHIRYSLWKEETECLEWLKSKAPN  299

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SVVYVN+GSI V+TP QL EF WGLANSK PF W+IRPDLV GE+AILPPEFV ETK+RG
Sbjct  300   SVVYVNFGSIAVLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERG  359

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             +++SWCPQEQVL  P+VGGFLTH GWNST+ES+C GVPMLCWPFFA+QQTNC+Y C  WG
Sbjct  360   LIASWCPQEQVLNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNDWG  419

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IG+EI+N+V RD+VEK+V+ELME EKG++MK K ME KK+A EA  T P GSS  N++  
Sbjct  420   IGLEINNDVKRDQVEKLVKELMEGEKGKKMKNKVMEWKKIAEEA--TSPHGSSSRNLDNL  477

Query  1452  INHLLL  1469
             +N +LL
Sbjct  478   VNQVLL  483



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/475 (61%), Positives = 373/475 (79%), Gaps = 5/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+P+PAQGHINPMLK+AK+LH KGFH+TFVNT +NH RL RS GP++L GLPSFR
Sbjct  11    KPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPDALDGLPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP S+ D TQDIP+LC ST+  CL PF +LL R+N     + PPVSCI+SDGV
Sbjct  71    FESIPDGLPESDGDTTQDIPALCVSTTKNCLAPFMELLRRINTR--DDVPPVSCIISDGV  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELG+P+V FWT SACGF+  + +   ++KG  P KDESY++  +L+T +DW
Sbjct  129   MSFTLDAAEELGVPDVFFWTPSACGFMALLQFPHFIEKGVAPFKDESYMSKEHLDTVIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  M  +RL+D+PSF+RTTNPD+ ML FI+QE  +++RA+AIILNTF+ L+HE + A+QS
Sbjct  189   IPSMNNLRLKDIPSFIRTTNPDDIMLNFIVQEVEQSKRATAIILNTFEDLDHEVIKAMQS  248

Query  771   MLPPVYAVGPLQFLQKQVKD--INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPVY++GPL  L  Q  D    +  +  +LWKE+T CL+WLDTK+ NSV+Y+++G I 
Sbjct  249   ILPPVYSIGPLHLLANQDIDEGSEIARMGLNLWKEETECLDWLDTKSRNSVMYISFGCIA  308

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VM+  QL EFAWGLA S K FLW+IRPDLV G+AA++PPEF+ ET+DR ML+SWCPQE+V
Sbjct  309   VMSAKQLVEFAWGLAASGKDFLWVIRPDLVAGDAAVIPPEFLAETEDRRMLASWCPQEKV  368

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQ TNC + C +WG+GMEI  NV R
Sbjct  369   LSHPAIGGFLTHCGWNSTLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGNVKR  428

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             +E+E VVRELM+ EKG++M+ KA E + LA EA     +GSS VN    +N +LL
Sbjct  429   EELETVVRELMDGEKGKKMREKAEEWRHLAEEATKD-KLGSSVVNFNTLVNKVLL  482



>ref|XP_002893223.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH69482.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/485 (61%), Positives = 377/485 (78%), Gaps = 6/485 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS +     KPH VC+PYPAQGHINPMLK+AK+LH +GFH+TFVNT +NH RL +S G 
Sbjct  1     MGSHVVCNAQKPHVVCVPYPAQGHINPMLKVAKLLHVRGFHVTFVNTVYNHNRLLQSRGA  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSFRFE IPDGLP +  DATQDIP+LCEST   CL PFK LL ++N +   + P
Sbjct  61    NALDGLPSFRFECIPDGLPENGVDATQDIPALCESTMKNCLVPFKKLLQQINTS--EDVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+D  EELG+PEV+FWT SACGF+ Y+H+   ++KG  P+KDES LT
Sbjct  119   PVSCIVSDGSMSFTLDVVEELGVPEVIFWTPSACGFMAYLHFYLFIEKGLCPVKDESCLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               YL+T +DW+  MK ++L+D+PSF+RTTNP++ ML FI++ET RA+RASAIILNTFD L
Sbjct  179   KEYLDTVIDWIPSMKNLKLKDIPSFIRTTNPNDIMLNFIVRETCRAKRASAIILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH+ + ++QS+LPPVY +GPL  L  +   +D  +  + S+LWKE+T C +WLDTKAPNS
Sbjct  239   EHDIIRSMQSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECFDWLDTKAPNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             +VYVN+GSIT MT  QL EFAWGLA + K FLW++RPDLV GE A++P E + ET DR M
Sbjct  299   IVYVNFGSITTMTTTQLVEFAWGLAATGKEFLWVMRPDLVAGEGAVIPSEVLAETADRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWCPQE+VL HPA+GGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC +SC +W +
Sbjct  359   LTSWCPQEKVLSHPAIGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             G+EI  +V R+EVE VVRELM+ EKG++M+ KA E ++LA E A  +P GSS +  E  +
Sbjct  419   GIEIGGDVKREEVEAVVRELMDGEKGKKMREKAEEWQRLA-EKATELPCGSSVIGFETIV  477

Query  1455  NHLLL  1469
             N +LL
Sbjct  478   NKVLL  482



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/471 (64%), Positives = 372/471 (79%), Gaps = 6/471 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHINPMLKLAKILH  GFHITFVNTE+NHRRL RS G  SL GLP F+
Sbjct  4     KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  63

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP S+AD+TQDI +LC STS TCL PF+DL+++LN ++V   P V+CIVSD V
Sbjct  64    FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSV--IPQVTCIVSDAV  121

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             M+FT+DAAEE GIP+ +FWT SACG LGY     L ++G  P+KD SY+TN +LET ++W
Sbjct  122   MNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIEW  181

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             ++G + IRLRDLPS + T + DE  L   L E  R  RASA+I NTF++ E + L AL +
Sbjct  182   IQGKENIRLRDLPSLVTTADEDEINLIITLVE--RTSRASAVIFNTFESFERDVLDALSA  239

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
             M PP+Y +GPLQ L  Q  + N++ + S+LWKE+  CLEWLD+K PNSVVYVN+GSITV+
Sbjct  240   MFPPIYTLGPLQLLVDQFPNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSITVI  299

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             TP Q+ EFAWGLANS  PFLWIIRPDLV GE+++LP EFV ETK RGML++WCPQE VL 
Sbjct  300   TPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLK  359

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HP++GGFL+H GWNST++SIC GVP++CWPFFA+QQTNC ++CTKWGIGM+IDNNV RDE
Sbjct  360   HPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDE  419

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             VEK+VRELM+ EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  420   VEKLVRELMKGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  468



>ref|XP_006303659.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
 gb|EOA36557.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
Length=483

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/482 (61%), Positives = 381/482 (79%), Gaps = 8/482 (2%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             S   KPH VC+P+PAQGHINPML++AK+LH KGFH+TF NT +NH+RL RS G  +L  L
Sbjct  7     SSGQKPHVVCVPFPAQGHINPMLQVAKLLHAKGFHVTFANTIYNHKRLLRSRGSNALNVL  66

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSFR+E+IPDGLP +  DATQD+P LC ST   CL PFK+LL R+N     + PPVSCIV
Sbjct  67    PSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLTRIN--TADDVPPVSCIV  124

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             SDG+MSFT+DAAEELG+P+V+FWTTSACGFL Y+H+   ++KG +P KDES     +LET
Sbjct  125   SDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLHFYCFVEKGLSPQKDES---KEHLET  181

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
             ++DW+  MK +RL+D+PSF+RTTNPD+ ML F + E  R +RASAIILNTFD LEH+ + 
Sbjct  182   KIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFFVHEADRVKRASAIILNTFDDLEHDTIQ  241

Query  759   ALQSMLPPVYAVGPLQFL--QKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             +++S++P V+++GPLQ L  QK  KD  +  +A++LWKE+  CL+WLDTK+PNSVVYVN+
Sbjct  242   SIKSIIPQVHSIGPLQLLVNQKMDKDSEIGQMATNLWKEERECLDWLDTKSPNSVVYVNF  301

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSITVM+   L EFAWGLA +KK FLW+IRPDLV G+ A++PPEF+ ET DR ML+SWCP
Sbjct  302   GSITVMSAKHLMEFAWGLAATKKDFLWVIRPDLVDGDVAVVPPEFLIETADRRMLASWCP  361

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL HPAVGGFLTH+GWNSTLES+ +GVPM+CWPFFAEQQTNC Y C +W +GMEI  
Sbjct  362   QEKVLSHPAVGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKYCCDEWEVGMEISG  421

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             +V R+EVE++VRELM+ +KG++M+ KA E ++LA EA   + +GSS +N +  ++ +LL 
Sbjct  422   DVRREEVEELVRELMDGDKGKKMREKAEEWRRLAEEATKHM-LGSSELNFQMVVDKVLLR  480

Query  1473  HR  1478
              R
Sbjct  481   AR  482



>ref|XP_008380053.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/484 (63%), Positives = 382/484 (79%), Gaps = 5/484 (1%)
 Frame = +3

Query  24    MGSLR-SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS+  +   KPHAVC+P+P QGHI P+LK AK+LHH+G  ITFVNTE+NHRRL +SLGP
Sbjct  1     MGSMEVAANHKPHAVCLPFPYQGHIKPLLKFAKLLHHRGIRITFVNTEYNHRRLLKSLGP  60

Query  201   ESLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSN-  374
              +L G   F FETIPDGLP S+ AD+TQDI  +C++     L PF+ LLA+LN  A SN 
Sbjct  61    NTLDGFKDFHFETIPDGLPPSDSADSTQDIYDICDAIQNNLLAPFQSLLAKLNAVAASNN  120

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPV+ IVSDG MSF++ AAEELG+P V+F+ T+ACGF+G+ HY  L +KG+TPLKDE Y
Sbjct  121   TPPVTSIVSDGFMSFSITAAEELGLPIVLFFPTAACGFMGFKHYRALAEKGFTPLKDERY  180

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             L+NGYL+T +DW+ GMKGIRLRDLP+FLRTTNP++       + T RA +ASA++++TF+
Sbjct  181   LSNGYLDTVIDWIPGMKGIRLRDLPTFLRTTNPNDTAFSLTSEATERAHKASAVVIHTFE  240

Query  735   ALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             ALE + L A+ SM+P +Y +GPLQ L  Q+++  +++L  SLWKE+  C+ WLDTKAPNS
Sbjct  241   ALEQDILDAISSMIPHLYPIGPLQLLINQIEEDPLKSLGYSLWKEEAECIPWLDTKAPNS  300

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GS+ VMTP+ L EF WGLANSK  FLW+IRPDLV GE+AILPPEFV ETK+R +
Sbjct  301   VVYVNFGSVVVMTPEHLVEFGWGLANSKHHFLWVIRPDLVIGESAILPPEFVAETKERCL  360

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++ WCPQE+VL HP+VGGFLTH+GWNST+ES+  GVPML WPFFAEQQTNCWY+C   G 
Sbjct  361   IAGWCPQEEVLNHPSVGGFLTHSGWNSTIESVTAGVPMLSWPFFAEQQTNCWYTCNGLGT  420

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEIDN+V RDEVEK+VRELME EKG++MKRKA E KKLA EA  T P GSS  N++  +
Sbjct  421   GMEIDNDVKRDEVEKLVRELMEGEKGKKMKRKANEWKKLAEEA--TGPHGSSIKNLDFVV  478

Query  1455  NHLL  1466
             N++L
Sbjct  479   NNVL  482



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 383/489 (78%), Gaps = 7/489 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS +     KPH VC+PYPAQGHINPM+K+AK+LH +GFH+TFVNT +NH R  RS G 
Sbjct  1     MGSQIVHNSQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSRGS  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSFRFE+IPDGLP ++ DATQDI +LCEST   CL PF++LL ++N  A  N P
Sbjct  61    NALEGLPSFRFESIPDGLPETDMDATQDITALCESTMKNCLAPFRELLQQIN--AGDNVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+D AEELG+PEV+FWTTS C FL Y+H+   ++KG +PLKDESYLT
Sbjct  119   PVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLSPLKDESYLT  178

Query  561   NGYLE-TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
               YL+ T +D++  MK ++L+D+PSF+RTTNPD+ M+ F L ET RA+RASAIILNTFD 
Sbjct  179   KEYLDDTVIDFIPTMKNLKLKDIPSFIRTTNPDDVMINFALHETERAKRASAIILNTFDD  238

Query  738   LEHEALMALQSMLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPN  911
             LEH+ +  +QS+LPPVY+VGPL  L  +++++   +  ++S+LWKE+  CL+WLDTK  N
Sbjct  239   LEHDVVQTMQSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTKN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SV+Y+N+GSITV++  QL EFAWGLA S K FLW+IRPDLV GE A++PPEF+ ETKDR 
Sbjct  299   SVIYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAVVPPEFLTETKDRS  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             ML+SWCPQE+VL HPA+GGFLTH GWNS LES+ +GVPM+CWPFFA+QQ NC + C +W 
Sbjct  359   MLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSSGVPMVCWPFFADQQMNCKFCCDEWD  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             +G+EI  +V R+EVE VVRELM+ EKG++M++KA+E ++LA  A +   +GSS VN E  
Sbjct  419   VGIEIGGDVKREEVETVVRELMDGEKGKKMRQKAVEWRRLARGATEH-KLGSSVVNFETV  477

Query  1452  INHLLLSHR  1478
             I+  L+  +
Sbjct  478   ISKYLVGQK  486



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 374/485 (77%), Gaps = 8/485 (2%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPHAVCIPYPAQGHINPMLKLAK+LH +GFHITFVNT FNH RL +S GP SL GLP 
Sbjct  4     ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPD  63

Query  225   FRFETIPDGLPLSE--ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA---PPVS  389
             FRFE+IPDGLP +E  ADATQDIPSLCEST  TCL PF+ LL +LND + S+    PPVS
Sbjct  64    FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
             C+VSD  M FT+ A EE GIP  +FWT SACG LGY  Y  L++KG+TP KDES  TNGY
Sbjct  124   CVVSDPAMPFTLTAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             L+T +DW+  +  IRL+DLPSF+RTTNP+E+M+K++++        +A+I NTFD+LEH 
Sbjct  184   LDTLIDWIPAVNDIRLKDLPSFIRTTNPNEFMVKYVIRLIKLTSTGNAMIFNTFDSLEHN  243

Query  750   ALMALQSMLP-PVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYV  926
              L AL SM P P+Y +GPL  L  + +  ++ ++AS+LW E+  CL+WLD+K   S+VYV
Sbjct  244   VLEALSSMFPCPIYTLGPLHVLVNKTQSKSLSSIASNLWVEELECLQWLDSKDSKSIVYV  303

Query  927   NYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSW  1106
             N+GSIT +TP+QL EFAWGLANSKKPF+WIIRPDLV G++AILP EFVEET++R ++SSW
Sbjct  304   NFGSITAVTPEQLVEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSW  363

Query  1107  CPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEI  1286
             CPQE+VL HPA+GGFLTH GWNSTLES+  GVP +CWPFFAEQQTNC + C  WG GMEI
Sbjct  364   CPQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPTICWPFFAEQQTNCKFLCDYWGSGMEI  423

Query  1287  dnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             + NV RD+VEK+VRELM+ EKG +M+ KAME K  A EA +    GSS VN++  I+ +L
Sbjct  424   NPNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHEATEL--GGSSLVNLDNIISKVL  481

Query  1467  LSHRK  1481
             +   K
Sbjct  482   VPSSK  486



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/475 (61%), Positives = 376/475 (79%), Gaps = 6/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+P+PAQGHINPMLK+AK+LH KGFH+TFVNT +NH+RL RS GP +L G PSFR
Sbjct  11    KPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSFR  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE+IPDGLP ++ + TQDIPSLC ST   CL PFKDLL ++N     + PPVSCIVSD V
Sbjct  71    FESIPDGLPETDGNTTQDIPSLCVSTMNNCLSPFKDLLRKINTG--DDVPPVSCIVSDAV  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNG-YLETELD  587
             MSFT+DAAEELG+P+V+FWT SACG + ++ + + ++KG TP KDESY++N  +LET +D
Sbjct  129   MSFTLDAAEELGVPDVVFWTASACGLMAFLQFQRFIEKGLTPFKDESYISNKEHLETVID  188

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+  MK  RL+D PSF+ TT+PD+ ML F ++E  R + A+AIILNTFD LEH+ + +++
Sbjct  189   WIPSMKNFRLKDFPSFILTTDPDDIMLNFSIREVERFKGATAIILNTFDDLEHDVIQSIK  248

Query  768   SMLPPVYAVGPLQFLQKQ--VKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
             SMLPPVY++GPL  L  Q    D ++  +  +LW+E+T CL+WLDTKAPNSVV+VN+G I
Sbjct  249   SMLPPVYSIGPLNLLASQEVYVDSDMGQMGLNLWREETECLDWLDTKAPNSVVFVNFGCI  308

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TVM+ +QL EFAWGLA S K FLW+IRPDLV GEAA +PPEF+ ET+DRGM++SWCPQE+
Sbjct  309   TVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQEK  368

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL HPA+GGFLTH GWNSTLES+  GVPM+CWPFFAEQ TNC + C +WG+GMEI  +V 
Sbjct  369   VLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDVK  428

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             R+EVE V+RELM+ EKG++++ KA + ++LA EA +  P GSS+V+ E  +N +L
Sbjct  429   REEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATE-YPSGSSNVSFETLVNKVL  482



>ref|XP_008455196.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=485

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 378/487 (78%), Gaps = 6/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ S+  KPHAVCIPYPAQGHI PMLKLAK+LHHKGF+ITFVNT++NHRRL +S GP 
Sbjct  1     MGSI-SQTKKPHAVCIPYPAQGHITPMLKLAKLLHHKGFYITFVNTDYNHRRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS---N  374
             SL GL  F F TIPDGLP S+ + TQDI +L +STS  CL P  DL+++LN  A S   N
Sbjct  60    SLDGLQDFTFRTIPDGLPYSDENCTQDIRALSQSTSKNCLAPLCDLISQLNSIAASPSSN  119

Query  375   APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPVSCIVSDGVMSF++ AA E  IP  +FWT SACG+LGY+ +  L+++G  PLKD S 
Sbjct  120   MPPVSCIVSDGVMSFSMLAANEFNIPYALFWTASACGYLGYLKFLDLVNQGLIPLKDMSQ  179

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             + +G+LE  ++W +GMK IRL+D+P+F+RTT+ D+ ML FILQE  R+R ASAI++NTFD
Sbjct  180   IIDGFLENTIEWTQGMKNIRLKDIPTFIRTTDLDDIMLDFILQEMKRSREASAIMINTFD  239

Query  735   ALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             ALE +A  +L S+   +Y +GP+  L  Q+ D N+ A+ S+LW E++ C+EWL++K PNS
Sbjct  240   ALEGDAKDSLSSIFQSIYTIGPIHMLANQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSITVMT  Q+ EFAWGLA+S KPFLWI RPDL+ G++AILP EFV +TKDR +
Sbjct  300   VVYVNFGSITVMTSQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSL  359

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++SWC QEQVL HP+ GGFLTH+GWNSTLESIC GVPM+CWPF AEQQTNC+Y C  WGI
Sbjct  360   IASWCCQEQVLSHPSTGGFLTHSGWNSTLESICAGVPMICWPFIAEQQTNCYYCCNVWGI  419

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GMEIDNNV R+EVE++VRELM+ EKGR+MK K M LK  A EA      GS+   ++K I
Sbjct  420   GMEIDNNVKRNEVEELVRELMDGEKGRKMKEKVMSLKSKAEEAYKL--GGSAWKQLDKVI  477

Query  1455  NHLLLSH  1475
             + +LLS+
Sbjct  478   DEVLLSN  484



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 381/483 (79%), Gaps = 8/483 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS    +DKPHAV IPYPAQGHINP+LKLAKILHH+GFHITFV+TE+NH+ L +S GP 
Sbjct  1     MGS--EARDKPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPS  58

Query  204   SLRGLPSFRFETIPDGLPLSEAD--ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSN-  374
             SL G P FRF+TIPDGLP S++D   TQ IPSLCESTS  CL PF DLL RL+D +V + 
Sbjct  59    SLDGSPRFRFKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDT  118

Query  375   -APPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               P VSC+++DG MSF +DAAE+LG+P V+FWT SACG L Y  Y  L +KG  PLKD S
Sbjct  119   EVPKVSCVIADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDAS  178

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
             YLTNG+L+T +DW+ GMK IRLRDLPSF+RTT+ ++ M+ +I+++  R  +ASA+ILNTF
Sbjct  179   YLTNGFLDTTIDWIPGMKNIRLRDLPSFIRTTDGNDIMVNYIIRQMERTNKASAVILNTF  238

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             D LE + LMA  S+ P +Y +GP+  L  +++D N   + S+LWKED +CL WLD+K PN
Sbjct  239   DCLEKDVLMAFSSIFPNLYTIGPIHLLLNKIEDDNSCRIGSNLWKEDFACLGWLDSKEPN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SV+++N+GSI V+T +QL EF+WGLANS+KPFLWIIRPDLV G+  +LP EF+ ETKDRG
Sbjct  299   SVLFINFGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRG  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             ML+ WCPQE+VL HP+VGGFLTH GWNS LESIC GVP+LCWPFFAEQQTNC+Y+  +WG
Sbjct  359   MLAGWCPQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWG  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IGMEIDN+V R+EVEK+VRELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  
Sbjct  419   IGMEIDNSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETL  476

Query  1452  INH  1460
             ++ 
Sbjct  477   LSQ  479



>emb|CDO97432.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 382/480 (80%), Gaps = 4/480 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHA+ IPYPAQGHI P+LKLAKILH +GF+ITFVNTEFNHRRL R+ GP+S++GL  F+
Sbjct  2     KPHALVIPYPAQGHIRPILKLAKILHSQGFYITFVNTEFNHRRLIRAHGPDSVKGLDDFQ  61

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             F+TIPDGL  S+ +ATQDIPSLC S   TCL PF +L+  LN++  S++P VSCIVSDGV
Sbjct  62    FKTIPDGLSPSDTNATQDIPSLCNSIQNTCLVPFLNLVKNLNES--SDSPRVSCIVSDGV  119

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+ AAEEL IPEV+F+T SACGF+GY+HY++L+ +GY PLKDES+LTNGYL+T +DW
Sbjct  120   MSFTLQAAEELNIPEVVFFTISACGFMGYLHYAELVARGYVPLKDESWLTNGYLDTTIDW  179

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GMKGIRL+DLP+F+RTT+PD+ ML + + +T  A RA AII NT+D LE E L A+ +
Sbjct  180   IPGMKGIRLKDLPNFIRTTDPDDIMLNYNIVQTRDASRARAIIFNTYDDLEKEVLEAINT  239

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
                 VY +GPL  +++ V    + ++ASSLW+E+  CLEWLD +   SV+YVN+GSITVM
Sbjct  240   KFDRVYTIGPLLMMEQNVNFGKLESVASSLWEEEVGCLEWLDQREMKSVIYVNFGSITVM  299

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             + +QL EFAWGLA+SK+ FLWIIRPDLV+GE+AILP EF+EETKDRG+L+ WCPQE+VL 
Sbjct  300   SVEQLQEFAWGLADSKQNFLWIIRPDLVSGESAILPAEFLEETKDRGILAGWCPQERVLA  359

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HP+VG FLTH GWNST+ESI  GVPM+CWPFFAEQQTNC Y+C+ W  G+EID+N  R++
Sbjct  360   HPSVGVFLTHCGWNSTIESISCGVPMICWPFFAEQQTNCRYACSTWENGVEIDSNATREK  419

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*HP  1490
             V + V+E+ME EKGR M+ KA+E K+ A  A  T P GSS+ N+EK I + LL +   +P
Sbjct  420   VAESVKEMMEGEKGRNMRAKALEWKEKARLA--TKPGGSSYQNLEKLIRNTLLENGTNYP  477



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 374/480 (78%), Gaps = 6/480 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             +PHAVC+PYPAQGHINPM +LAK+LHHKGFHITFVNTEFN RRL +S GP+SL  +P+FR
Sbjct  12    RPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTFR  71

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-PPVSCIVSDG  407
             FETIPDGLP S+ADATQDIPSLC+ST  TC  PF+ LL  LN++A+SNA PPV+CIVSD 
Sbjct  72    FETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQALLTTLNNSALSNANPPVTCIVSDW  131

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M FT+ A+++L IP V+F+T SACGF+GY+HY  L +K   PLKD SYLTNGY++T +D
Sbjct  132   SMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLAEKCIFPLKDLSYLTNGYMDTVID  191

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+GI+L+ LPSF+R+T+ D+ M+ F++ E      ASA+I NTFD LE E L  L 
Sbjct  192   WIPGMEGIQLKYLPSFIRSTDRDDVMVNFVITEIENTHNASALIFNTFDDLEPEVLKELS  251

Query  768   SMLPPVYAVGPLQFL----QKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYG  935
             S+ P ++ VGPL  L    +    D  +  + S+LW+E   CLEWLD+K  NSVVYVN+G
Sbjct  252   SIYPNIFTVGPLNQLVLNNEVSAHDSALSLIGSNLWREQPGCLEWLDSKEQNSVVYVNFG  311

Query  936   SITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQ  1115
             SIT +T +QL EFAWGLANSK+PFLW+IRPD+V    A++  EFVEETKDRGML+SWCPQ
Sbjct  312   SITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQ  371

Query  1116  EQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnn  1295
             EQ+L HPAVGGFLTH GWNST+ES+C+GV MLCWPFFAEQQTNCW+  TKWG+G+E++  
Sbjct  372   EQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPR  431

Query  1296  vvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  1475
               R E+EK VRELME E G+ MK KA E K LA +AA   P GSS+VN++K +N +LL++
Sbjct  432   ADRVEIEKRVRELMEGESGKLMKEKAWEWKLLAEKAAAG-PNGSSYVNLDKLMNDVLLTY  490



>ref|XP_009380209.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetin glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/481 (63%), Positives = 377/481 (78%), Gaps = 8/481 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +E  KPHAVC+PYPAQGHI PMLKLAK+LH  GFH+TFVNT FNH+RL RS    
Sbjct  1     MGSIPAE--KPHAVCVPYPAQGHITPMLKLAKLLHSHGFHVTFVNTLFNHKRLIRSRAIS  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +L  LPSFRF +IPDGLP S+ DATQDIPSLCE+   T L PF+ +L +LN+     +PP
Sbjct  59    ALHALPSFRFASIPDGLPPSDEDATQDIPSLCEAIPRTALPPFRHVLRQLNE----ESPP  114

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCIVSDGVM+FT+DAA+ELG+PEV+FWTTSACGF+GY+HY  L ++G TPLKDE  +T+
Sbjct  115   VSCIVSDGVMTFTLDAAQELGVPEVVFWTTSACGFMGYLHYQHLRERGLTPLKDEGDITS  174

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+  +DW+ G   +RLRD PSF+RTT+P + ML F  +E  RA  ASA+ILNTF+ LE
Sbjct  175   GYLDMPVDWIPGFDNMRLRDFPSFIRTTDPKDVMLNFCTREAQRASMASAVILNTFEELE  234

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
                L A+ S+LP VY VGPL  L ++V D  + ++ S+LWKED+ C+EWL+ + P SVVY
Sbjct  235   RPVLEAMASILPAVYTVGPLTLLSQRVADSPLTSIHSNLWKEDSGCMEWLEGRRPGSVVY  294

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VN+GSITVM+  QL EFAWGLANS   FLW+IRPDLV G+AA+LP EFVEETK+RG+L+S
Sbjct  295   VNFGSITVMSNTQLLEFAWGLANSGYDFLWVIRPDLVRGDAAVLPQEFVEETKERGLLAS  354

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE VL H +VGGFLTH+GWNST+ESI  GVPML WPFFAEQQTNC Y+CT+WGI ME
Sbjct  355   WCPQEAVLSHASVGGFLTHSGWNSTIESISGGVPMLSWPFFAEQQTNCRYACTEWGIAME  414

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             IDN+V R+EVE ++R+LM  +KG+EM++K ME  + AM A  T P GSS VN+E+ I  +
Sbjct  415   IDNDVKREEVEALIRKLMGGDKGKEMRKKTMEWNEKAMRA--TQPGGSSFVNLERLIKDV  472

Query  1464  L  1466
             +
Sbjct  473   M  473



>ref|XP_010030926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=865

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/480 (65%), Positives = 379/480 (79%), Gaps = 7/480 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTE  H+RL RS GP SL GLP F
Sbjct  386   EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHIHKRLLRSQGPHSLDGLPHF  445

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV-SNAPPVSCIVSD  404
             RF+ IPDGLP S+ D+TQDIPSLC S S   L  F+ LL +L + +  +  PPV+CIVSD
Sbjct  446   RFDMIPDGLPPSDPDSTQDIPSLCASLSEHGLSAFRSLLLKLQEQSQDAVVPPVTCIVSD  505

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLK----DESYLTNGYL  572
             GVM+FTVDAAEEL IPEV+F T SACG LGY  Y +L++ G+T LK    D +YL NGYL
Sbjct  506   GVMTFTVDAAEELKIPEVVFCTPSACGLLGYTKYRRLVEDGFTLLKGLMTDPTYLLNGYL  565

Query  573   ETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEA  752
             ET + W  GMK IRLRD P+F+RT +  + ML F++QE  R+ RASA+ILNTFD LEH+ 
Sbjct  566   ETTVSWTSGMKSIRLRDFPTFIRTLDHQDIMLNFVIQEVERSSRASAVILNTFDTLEHDV  625

Query  753   LMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             L +L S+ P +Y +GPLQ L  Q++D  +R++  +LW+E+  CL WLD+K P SVVYVN+
Sbjct  626   LESLSSVFPHIYTIGPLQLLADQIQDEALRSVGGNLWREEPGCLPWLDSKEPGSVVYVNF  685

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSITVMT  QL+EFAWGLANS+KPFLWIIRPDLV  E+A+LPPEFVEE   RGML SWC 
Sbjct  686   GSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWCQ  745

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL H A+GGFLTH+GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN
Sbjct  746   QEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDN  805

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             +V RDEVE +VRELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+ +L S
Sbjct  806   DVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEA--IMPGGTSYNNVDKLISEVLSS  863


 Score =   246 bits (628),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 162/271 (60%), Gaps = 65/271 (24%)
 Frame = +3

Query  24   MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
            MGS R   DK HAV IPYPAQGHINP+LKLAKILHH+GFHITFV+T++N++RL +S G  
Sbjct  1    MGSAR---DKHHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTDYNYKRLLKSRGLT  57

Query  204  SLRGLPSFRFETIPDGLPLSEAD--ATQDIPSLCESTSATCLGPFKDLLAR-----LNDT  362
            SL GLP F FETIPDGLP S++D   TQ IPSLC+STS  CL PF DLL R     ++DT
Sbjct  58   SLDGLPRFHFETIPDGLPTSDSDEDVTQHIPSLCDSTSKNCLAPFMDLLGRLNDKSVDDT  117

Query  363  AV--------------------SNAPPVSCIVS---------------------------  401
             V                     + P V   V+                           
Sbjct  118  EVPKIIEMAENNQVPFNVPNDLGDVPMVDSTVAMEDVQPSGPEFVAANATGPWANTNFGG  177

Query  402  --------DGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYL  557
                    +G MSF +D AE+LG+P V+FWT SACG L Y  Y  L  KG  PLKD SYL
Sbjct  178  VGTSHTTANGGMSFALDVAEKLGVPGVLFWTPSACGSLVYTQYHMLRKKGLFPLKDASYL  237

Query  558  TNGYLETELDWVKGMKGIRLRDLPSFLRTTN  650
            TNG+L+T +DW+ GMK IRLRDLPSF+RTT+
Sbjct  238  TNGFLDTTIDWIPGMKNIRLRDLPSFIRTTD  268


 Score =   139 bits (349),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 98/156 (63%), Gaps = 37/156 (24%)
 Frame = +3

Query  936   SITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQ  1115
             S    T +QL E +WGLANS+KPFLWIIRPDLV G+  +LP EF+ ETKDRGML      
Sbjct  262   SFIRTTDEQLIEVSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGML------  315

Query  1116  EQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnn  1295
                                            +CWPFFAEQQTNC YS T+WGIGMEIDN+
Sbjct  316   -------------------------------VCWPFFAEQQTNCQYSYTEWGIGMEIDND  344

Query  1296  vvrdevekvvrELMESEKGREMKRKAMELKKLAMEA  1403
             V RDEVE +VRELME EKG+EM++KAME K  A EA
Sbjct  345   VKRDEVEGLVRELMEGEKGKEMRKKAMEWKVKAKEA  380



>ref|XP_008219458.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=471

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 385/474 (81%), Gaps = 6/474 (1%)
 Frame = +3

Query  69    IPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFRFETIPD  248
             +P+PAQGHINPMLKLAK+LH KGFHITFVNTEF H+RL +S GP SL GLP+FRFE IPD
Sbjct  1     MPFPAQGHINPMLKLAKLLHFKGFHITFVNTEFIHKRLLKSQGPNSLNGLPTFRFEMIPD  60

Query  249   GLPLSEAD-ATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGVMSFTV  425
             GLP ++A+ A Q +PSLC+S    CL PF+ LL++LN +   N+PPV+C+VSDG+M+F++
Sbjct  61    GLPPADANVAAQHMPSLCQSIRKHCLQPFRGLLSKLNCSP--NSPPVTCVVSDGIMNFSL  118

Query  426   DAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDWVKGMK  605
             DAA+ELGIP V+FWTTSAC F+GY+ Y  L+ KG  PLKD SYLTNGYL+T +DW+ GMK
Sbjct  119   DAAQELGIPGVIFWTTSACAFMGYIQYGPLIQKGLVPLKDASYLTNGYLDTVIDWIPGMK  178

Query  606   GIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQSMLPPV  785
              IRL+D+PSF+RTT+P++ ++  I+ +T R++RASAIILNTFDALEHE L AL ++LPP+
Sbjct  179   SIRLKDIPSFIRTTDPNDLIMDLIMVDTERSKRASAIILNTFDALEHEVLDALTTLLPPI  238

Query  786   YAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVMTPDQ  962
             Y +GPL      +  D  ++++ S+LW E+T CL+WLD+K PNSVVYVN+GS TVMT +Q
Sbjct  239   YCIGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSSTVMTSEQ  298

Query  963   LSEFAWGLANSKKPFLWIIRPDLV-TGEAAILPPEFVEETKDRGMLSSWCPQEQVLGHPA  1139
             L+EFAWGLANSKK F W+IRPDLV  G++ ++ PEFVEETK+RG+L+SWCPQEQVL HPA
Sbjct  299   LTEFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASWCPQEQVLSHPA  358

Query  1140  VGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevek  1319
             +GGFLTHNGWNST+ES+  GVPM+CWPF A+QQTNC + C++WGIG+EI+ +V R  +E 
Sbjct  359   IGGFLTHNGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDVKRYYIEG  418

Query  1320  vvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  1481
             +VRELME E+G+++++KA E KKLA EA  T   GSS +++++ +N +LLS R 
Sbjct  419   LVRELMEGEEGKKLRKKASEWKKLAKEAT-TGSNGSSFLDLDQMVNKVLLSPRN  471



>ref|XP_002323977.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
 gb|EEF04110.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
Length=482

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 380/482 (79%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  +  K HAVC+PYPAQGHI PMLK+AK+LHH+GFHITFVN+E+NHRRL +S G  
Sbjct  1     MGSI-PKSTKAHAVCVPYPAQGHIAPMLKVAKLLHHQGFHITFVNSEYNHRRLLKSRGCN  59

Query  204   SLRGLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL  LP F+FETIPDGL    +AD TQD   LC+S S  CL PF+ LLA+LN + V   P
Sbjct  60    SLDVLPDFQFETIPDGLGDQIDADVTQDTSFLCDSISKACLVPFRKLLAKLNSSNV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIV+DG MSFT D  EEL IP V FWT+SACG L Y HY  L+++GYTPLK+ES LT
Sbjct  118   PVTCIVADGGMSFTFDVKEELQIPAVSFWTSSACGTLAYAHYKHLVERGYTPLKEESDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET++DW+ GMK IRL+DLP+F+RTT+ ++ +L ++++   RA +ASA ++NTFD L
Sbjct  178   NGYLETKIDWIPGMKDIRLKDLPTFIRTTDQNDVILNYVIRIIDRASKASAALVNTFDDL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ L+AL SM PP+Y+VGPL  L    +   + ++ S+LWKE+T CL+WLD+K PNSVV
Sbjct  238   DHDVLVALSSMFPPIYSVGPLNLLLDHTQKDYLASIGSNLWKEETECLQWLDSKDPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVM P QL EF+WGLANSKK FLWIIRPDLV GE+A+LPPEF+EET++RG+++
Sbjct  298   YVNFGSITVMNPQQLVEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMT  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL H ++GGFL+H GWNST+ES+ NGV MLCWPFF+EQQTNC ++C  WG+GM
Sbjct  358   SWCAQEKVLKHSSIGGFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++  RD+VEK+V EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N 
Sbjct  418   EIESDANRDDVEKLVIELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVND  475

Query  1461  LL  1466
             +L
Sbjct  476   VL  477



>ref|XP_002323974.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
 gb|EEF04107.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
Length=482

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 380/482 (79%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL  +  K HAVC+PYPAQGHI PMLK+AK+LHHKGFHITFVN+E+NHRRL +S G  
Sbjct  1     MGSL-PKSTKAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRN  59

Query  204   SLRGLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL  LP F+FETIPDGL    +AD TQD   LC+S S  CL PF++LLA+LN + V   P
Sbjct  60    SLDVLPDFQFETIPDGLGDQIDADVTQDTSFLCDSISKACLVPFRNLLAKLNSSNV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIV+D  MSF +D  EEL IP V FWT+SACG L Y HY  L+++GYTPLK+ES LT
Sbjct  118   PVTCIVADSGMSFALDVKEELQIPVVTFWTSSACGTLAYAHYKHLVERGYTPLKEESDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET++DW+ GMK IRL+DLP+F+RTT+ ++ +L ++++   RA +ASA ++NTFD L
Sbjct  178   NGYLETKIDWIPGMKDIRLKDLPTFIRTTDRNDVILNYVIRIIDRASKASAALVNTFDDL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ L+AL SM PP+Y+VGPL  L    +   + ++ S+LWKE+T CL+WLD+K PNSVV
Sbjct  238   DHDVLVALSSMFPPIYSVGPLNLLLDHTQKDYLASIGSNLWKEETECLQWLDSKDPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVM P QL EF+WGLANSKK FLWIIRPDLV GE+A+LPPEF+EET++RG+++
Sbjct  298   YVNFGSITVMNPQQLVEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL H ++GGFL+H GWNST+ES+ NGV MLCWPFF+EQQTNC ++C  WG+GM
Sbjct  358   SWCAQEKVLKHSSIGGFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++  RD+VEK+V EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N 
Sbjct  418   EIESDANRDDVEKLVIELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVND  475

Query  1461  LL  1466
             +L
Sbjct  476   VL  477



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 374/485 (77%), Gaps = 8/485 (2%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPHAVCIPYPAQGHI+PMLKLAK+LH +GFHITFVNT FNH RL +S GP SL GLP 
Sbjct  4     ETKPHAVCIPYPAQGHISPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPD  63

Query  225   FRFETIPDGLPLSE--ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA---PPVS  389
             FRFE+IPDGLP +E  ADATQDIPSLCEST  TCL PF+ LL +LND + S+    PPVS
Sbjct  64    FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  390   CIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGY  569
             C+VSD  M FT+ A EE GIP  +FWT SACG LGY  Y  L++KG+TP KDES  TNGY
Sbjct  124   CVVSDASMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  570   LETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHE  749
             L+T +DW+  +  IRL+DLPSF+RTTNP+++M+K++++        SAII NTFD+LE  
Sbjct  184   LDTLIDWIPAVNDIRLKDLPSFIRTTNPNDFMVKYVIRLIKLMSTGSAIIFNTFDSLERN  243

Query  750   ALMALQSMLP-PVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYV  926
              L AL SM+P P+Y +GPL  L    +  ++ ++AS+LW E+  CL+WLD+K   S+VYV
Sbjct  244   VLEALSSMIPCPIYTLGPLHLLVNNTQPKSLSSIASNLWVEELECLQWLDSKDSKSIVYV  303

Query  927   NYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSW  1106
             N+GSIT +TP+QL EFAWGLANSKKPF+WIIRPDLV G++AILP EFVEET++R ++SSW
Sbjct  304   NFGSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSW  363

Query  1107  CPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEI  1286
             CPQE+VL HPA+GGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC + C  WG GMEI
Sbjct  364   CPQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCNYWGSGMEI  423

Query  1287  dnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             + NV RD+VEK+VRELM+ EKG +M+ KAME K  A EA +    GSS VN++  I+ +L
Sbjct  424   NPNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHEATEL--GGSSLVNLDNIISKVL  481

Query  1467  LSHRK  1481
             +   K
Sbjct  482   VPSSK  486



>ref|XP_011009482.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009483.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/482 (62%), Positives = 380/482 (79%), Gaps = 6/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL  +  K HA+C+PYPAQGHI PMLK+AK+LHHKGFHITFVN+E+NHRRL +S G  
Sbjct  1     MGSL-PKSTKAHALCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRN  59

Query  204   SLRGLPSFRFETIPDGLPLS-EADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL  LP F+FETIPDGL    +AD TQD   LC+STS  CL PF+ LLA+LN + V   P
Sbjct  60    SLDVLPDFQFETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSSNV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PV+CIV+DG MSF +D  +EL IP V+FWT+SACG L Y HY  L+++GY PLK+ES LT
Sbjct  118   PVTCIVADGGMSFALDVKDELQIPVVIFWTSSACGTLAYAHYKHLVERGYIPLKEESDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET++D + GMK IRL+DLP+F+RTT+ ++ ML F+++   RA +ASA ILNTFD L
Sbjct  178   NGYLETKIDCIPGMKDIRLKDLPTFIRTTDRNDVMLNFVIRRIDRASKASAAILNTFDDL  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             +H+ L+AL SM PP+Y+VGPL  L +Q ++  + ++ SSLWKE+T CL WLD+K PNSVV
Sbjct  238   DHDVLVALSSMFPPIYSVGPLNLLLEQTQNDYLASIGSSLWKEETECLHWLDSKDPNSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSIT+M P QL EF+WGLANS K FLWIIRPDLV G++A+LPPEF+EET++RG+ +
Sbjct  298   YVNFGSITMMNPQQLVEFSWGLANSMKNFLWIIRPDLVRGDSAVLPPEFLEETRERGLTA  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWC QE+VL H ++GGFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++CT W +GM
Sbjct  358   SWCAQEKVLRHSSIGGFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACTDWDVGM  417

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EI+++  RDEVEK+V ELM+  KG+EMKRKAME K  A EA   I  GSS +N +K +N 
Sbjct  418   EIESDANRDEVEKLVIELMDGGKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVND  475

Query  1461  LL  1466
             +L
Sbjct  476   VL  477



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/491 (61%), Positives = 379/491 (77%), Gaps = 8/491 (2%)
 Frame = +3

Query  24    MGSLRSEQD--KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLG  197
             M SL   Q   +PHAVC+PYPAQGHINPM +LAK+LHHKGFHITFVNTEFN RRL +S G
Sbjct  1     MASLIDTQRPRRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQG  60

Query  198   PESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA  377
             P+SL  +P+FRFETIPDGLP S++DATQDIPSLC+ST  TC  PF++LL RLN++A+SN 
Sbjct  61    PDSLNAVPTFRFETIPDGLPPSDSDATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNV  120

Query  378   -PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESY  554
              PPV+CIVSD  M FT+ A+++L IP V+F+T SACGF+GY+HY  L++K   PLKD SY
Sbjct  121   NPPVTCIVSDWSMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLVEKCIFPLKDLSY  180

Query  555   LTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFD  734
             LTNGY+++ +DW+  M+GI+L+ LPSF+R+T+ D+ M+ F++ E      ASA+I NTFD
Sbjct  181   LTNGYMDSVIDWIPVMEGIQLKYLPSFIRSTDRDDIMVNFVITEIENTHNASALIFNTFD  240

Query  735   ALEHEALMALQSMLPPVYAVGPLQFL----QKQVKDINVRALASSLWKEDTSCLEWLDTK  902
              LE E L  L S+ P ++ +GPL  L    +    D  +  + S+LW+E   CLEWLD+K
Sbjct  241   DLEPEVLKELSSIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWREQPGCLEWLDSK  300

Query  903   APNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETK  1082
               NSVVYVN+GSIT +T +QL EFAWGLANSK+PFLW+IRPD+V    A++  EFVEETK
Sbjct  301   EQNSVVYVNFGSITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETK  360

Query  1083  DRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT  1262
             DRGML+SWCPQEQ+L HPAVGGFLTH GWNST+ES+C+GV MLCWPFFAEQQTNCW+  T
Sbjct  361   DRGMLASWCPQEQILSHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQT  420

Query  1263  KWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNI  1442
             KWG+G+E++    R E+EK VRELME E G+ MK KA+E K LA +AA   P GSS+VN+
Sbjct  421   KWGVGIEVNPRGDRVEIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAG-PNGSSYVNL  479

Query  1443  EKFINHLLLSH  1475
             +  IN +LL++
Sbjct  480   DNLINDVLLTY  490



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/471 (64%), Positives = 372/471 (79%), Gaps = 6/471 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHINPMLKLAKILH  GFHITFVNTE+NHRRL RS G  SL GLP F+
Sbjct  33    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  92

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FETIPDGLP S+AD+TQDI +LC STS TCL PF+DL+++LN ++V   P V+CIVSD V
Sbjct  93    FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSV--IPQVTCIVSDAV  150

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             M+FT+DAAEE GIP+ +FWT SACG LGY     L ++G  P+KD SY+TN +LET ++W
Sbjct  151   MNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIEW  210

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             ++G + IRLRDLPS + T + DE  L   L E  R  RASA+I NTF++ E + L AL +
Sbjct  211   IQGKENIRLRDLPSLVTTADEDEINLIITLVE--RTSRASAVIFNTFESFERDVLDALSA  268

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
             M PP+Y +GPLQ L  Q  + N++ + S+LWKE+  CLEWLD+K PNSVVYVN+GSITV+
Sbjct  269   MFPPIYTLGPLQLLVDQFPNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSITVI  328

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             TP Q+ EFAWGLANS  PFLWIIRPDLV GE+++LP EFV ETK RGML++WCPQE VL 
Sbjct  329   TPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLK  388

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HP++GGFL+H GWNST++SIC GVP++CWPFFA+QQTNC ++CTKWGIGM+IDNNV RDE
Sbjct  389   HPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDE  448

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             VEK+VRELM+ EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  449   VEKLVRELMKGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  497



>ref|XP_008229481.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/484 (63%), Positives = 373/484 (77%), Gaps = 10/484 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS      KPHAVCIP P QGHI   LKLAKILHHKGFHITFVNTEFNH+RL +SLGP 
Sbjct  1     MGS----NSKPHAVCIPVPTQGHIKAHLKLAKILHHKGFHITFVNTEFNHKRLVKSLGPN  56

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA--  377
             SL GLP FRFETIPDGLP S+ DATQD+  LC+S     L PF DLL +LN+   S +  
Sbjct  57    SLDGLPDFRFETIPDGLPDSDEDATQDLTLLCDSILKNFLAPFLDLLTKLNNDVTSTSNN  116

Query  378   --PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               PPV+CIVSD  M FT  AAE+LGIP  +F+T +A  F+G+  Y  L++KG  PL DES
Sbjct  117   APPPVTCIVSDPFMPFTTPAAEQLGIPVTLFFTFAASSFMGFKQYPTLVEKGLAPLTDES  176

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
             +LTNG+L+  +DWV GMKGIRLRDLP+   TTNP++ +   IL+  GR R+ASA++++TF
Sbjct  177   FLTNGFLDQVIDWVPGMKGIRLRDLPNNFITTNPNDSIFNGILEVIGRLRKASAVVVHTF  236

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             DALE + L AL SM PPVYA+GPLQ L  Q+ +  +++L  SLWKE+T CL+WL++   N
Sbjct  237   DALEPDVLDALSSMSPPVYAIGPLQLLLNQIPEHPLKSLGYSLWKEETECLQWLNSNTTN  296

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SVVYVN+GSITVMTP+QL EF WGLANSK  F W+IRPDLV GE+AILPPEFVEETK+R 
Sbjct  297   SVVYVNFGSITVMTPNQLVEFGWGLANSKLHFFWVIRPDLVIGESAILPPEFVEETKERS  356

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             +++SWCPQEQVL HP+VGGFLTHNGWNST+ES+  GVPMLCWPFFA+QQTNC Y+C +WG
Sbjct  357   LIASWCPQEQVLNHPSVGGFLTHNGWNSTIESLSAGVPMLCWPFFADQQTNCHYTCKEWG  416

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IGMEI+N+V RD+VEK+VRELME EKG+++K KAME K LA EA  T   GSS  N++  
Sbjct  417   IGMEINNDVKRDDVEKLVRELMEGEKGKKIKNKAMEWKTLAEEA--TSLHGSSSTNLDNL  474

Query  1452  INHL  1463
              N +
Sbjct  475   ANQM  478



>ref|XP_007141201.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
 gb|ESW13195.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
Length=479

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/472 (64%), Positives = 376/472 (80%), Gaps = 3/472 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVC+P+PAQGHINPMLKLAK+LH  GFHITFVNTE NH+RL +S G +SL GLPSFR
Sbjct  9     KPHAVCVPFPAQGHINPMLKLAKLLHSNGFHITFVNTECNHKRLLKSRGLDSLNGLPSFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             F+TIPDGLP  + + T  +PSLC+ST ATCL  F++LL++LN+      P VSCIVSDGV
Sbjct  69    FQTIPDGLPEPDDEGTHQVPSLCDSTRATCLPHFRNLLSKLNNDC-PGVPAVSCIVSDGV  127

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DA++ELGIP V+FWT+SACGF+ Y+HY+QL+ +G  PLKD SYL NGYL+T +DW
Sbjct  128   MSFTLDASQELGIPNVLFWTSSACGFMCYVHYNQLVQRGIVPLKDASYLKNGYLDTTIDW  187

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + G+K IRL+D+PSF+RTT+P++ M  F   E  RA +A AIILNTFDALEH+ L A  S
Sbjct  188   IAGIKEIRLKDIPSFIRTTDPEDIMFNFASGECKRAEKACAIILNTFDALEHDVLEAFSS  247

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
             +LPPVY++GPL  L   V D ++ A+  +LW+E+  CLEWLDTK  N+VVYVN+GS+TVM
Sbjct  248   ILPPVYSIGPLSLLLDDVSDKSLNAIGFNLWREEPGCLEWLDTKEANTVVYVNFGSVTVM  307

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             T DQL EFAWGLANS K FLW+IR DLV GE A+LPPEFV +TK+RG+LSSWC QEQVL 
Sbjct  308   TNDQLIEFAWGLANSYKTFLWVIRQDLVVGEKAVLPPEFVTQTKNRGLLSSWCAQEQVLA  367

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             HPA+G FLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +V R +
Sbjct  368   HPAIGVFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEI-EDVERHQ  426

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +E +VRE+ E EKGREMK+KA++ K LA +AA   P GSS V+ +K    +L
Sbjct  427   IEMLVREMTEGEKGREMKKKALKWKALAKKAASG-PTGSSFVHFQKMTREVL  477



>ref|XP_008229792.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=484

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 372/483 (77%), Gaps = 6/483 (1%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             S  +KPHAVCIP P Q HI  MLKLAK+LHHKGFHITFVNTEFNH+R  +SLGP SL GL
Sbjct  5     SVDNKPHAVCIPLPFQSHIKAMLKLAKLLHHKGFHITFVNTEFNHKRFLKSLGPNSLDGL  64

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-PPVSCI  395
             P FRFETIPDGLP SE D+ QD   LC+S    CL PF++L+ +LNDT  SN  PPV+CI
Sbjct  65    PDFRFETIPDGLPDSE-DSAQDPYLLCDSVRKNCLAPFRNLIMKLNDTTSSNVNPPVTCI  123

Query  396   VSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLE  575
             VSDG M+FT+ AAEEL +P  + +T +AC F+G   Y  L++KG  PLKDES LTNG+L+
Sbjct  124   VSDGFMTFTITAAEELRLPVTLLFTIAACAFMGSKQYPILVEKGLAPLKDESCLTNGFLD  183

Query  576   TELDWVKGMKGIRLRDLPSFLRTTN-PDEYMLKFILQETGRARRASAIILNTFDALEHEA  752
               +DW+  MKGIRLRDLPSF  TTN P++  L F ++   RA  ASA++L+TFD LE + 
Sbjct  184   KVIDWIPAMKGIRLRDLPSFFETTNDPNDIFLNFTIEAMDRAHTASAVMLHTFDVLERDV  243

Query  753   LMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVN  929
             L AL SMLPPVYA+GPLQ L  ++ ++  ++ +  SLWKE+T C +WL+ KAPNSVVYVN
Sbjct  244   LDALSSMLPPVYAIGPLQLLLNKIPQEYPLKPMGYSLWKEETECFKWLNDKAPNSVVYVN  303

Query  930   YGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWC  1109
             +GSI VMTP+ L EF WGLANSK PFLWIIRPDLV G +AILPPEFV ETK+R +++SWC
Sbjct  304   FGSIAVMTPECLVEFGWGLANSKNPFLWIIRPDLVVGASAILPPEFVAETKERALIASWC  363

Query  1110  PQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEId  1289
             PQEQVL HP++GGFLTH+GWNST+ES+  GVPM+CWP FA+Q  NCWY+C +WG GMEID
Sbjct  364   PQEQVLNHPSIGGFLTHSGWNSTIESLSAGVPMVCWPLFADQPINCWYTCNEWGCGMEID  423

Query  1290  nnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              NV R+EVEK+VRELME EKG++MK KAME KKLA EA  T P GSS  N++  +N +LL
Sbjct  424   KNVKREEVEKLVRELMEGEKGKKMKNKAMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  481

Query  1470  SHR  1478
              + 
Sbjct  482   KNN  484



>ref|XP_006304665.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
 gb|EOA37563.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
Length=486

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 381/488 (78%), Gaps = 6/488 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS +   Q KPH VC+PYPAQGHINPMLK+AK+LH++GFH+TFVNT +NH+RL RS G 
Sbjct  1     MGSHVVCNQQKPHVVCVPYPAQGHINPMLKVAKLLHNRGFHVTFVNTVYNHKRLIRSRGT  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             ++L  +PSFRFE IPDGLP ++ DATQDIP+L EST   CL PFK+L+ R+N     + P
Sbjct  61    DALGRVPSFRFEAIPDGLPETDVDATQDIPTLSESTEKNCLAPFKELIGRINTR--EDVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIV+DG MSFT+D AEELG+PEV+FWT S CGF+ Y+HY   ++KG  P++DES LT
Sbjct  119   PVSCIVADGAMSFTLDVAEELGVPEVLFWTPSGCGFMAYLHYYLFIEKGLCPVQDESCLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               +L+T +DW+  MK ++L+D+PSF+RTTNP++ M+ FI++ET R +RASA+ILNTFD L
Sbjct  179   KEHLDTVIDWIPSMKNLKLKDIPSFIRTTNPNDIMVNFIVRETCRTKRASAVILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH+ + ++QS+LPPVY +GPL  L  +   +D  +  +  +LWKE+T CL WLDTK+ NS
Sbjct  239   EHDIIRSMQSILPPVYPIGPLHLLVNREIDEDSEIGRMGLNLWKEETECLNWLDTKSRNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSIT+MT  Q+ EFAWGLA + K FLW++RPDLV GE A++P EF+ ET DR M
Sbjct  299   VVYVNFGSITIMTVTQILEFAWGLAATGKEFLWVMRPDLVAGEEAVIPTEFLTETADRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWCPQE+VL HPA+GGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC +SC +W +
Sbjct  359   LASWCPQEKVLSHPAIGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             G+EI  +V R+EVE VVRELM+ EKG++M+ KA E ++LA +A +  P GSS +N E  +
Sbjct  419   GIEIGGDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAQKATEQ-PCGSSVINFETIV  477

Query  1455  NHLLLSHR  1478
             + +LL  +
Sbjct  478   SKVLLGKK  485



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/478 (63%), Positives = 378/478 (79%), Gaps = 6/478 (1%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             +++ KPHAVCIPYPAQGHINP+LKLAK+LH +GFHITFV+TE+N+ RL RS GP++L GL
Sbjct  4     AQEQKPHAVCIPYPAQGHINPLLKLAKLLHSQGFHITFVHTEYNYNRLLRSRGPDALAGL  63

Query  219   PSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCI  395
             P+FRFE I DG+P +E A+ATQDIPSLC ST    LGPFK+L+ RLN++   + P VSCI
Sbjct  64    PTFRFEAISDGMPCTEDANATQDIPSLCISTEYRSLGPFKELINRLNESG--DVPQVSCI  121

Query  396   VSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLE  575
             V+D  M FT+DAAEELGIPEV+ +T S CGFL Y  + +L++ G TP KDE++LTNG L+
Sbjct  122   VADAAMYFTLDAAEELGIPEVLQYTASPCGFLAYTQFPKLVELGITPFKDENFLTNGDLD  181

Query  576   TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEAL  755
               LDWV  MK I+++ +PSF+RTTNP+E ML  + +E   A+RASAI+ N+FDAL+HE L
Sbjct  182   VVLDWVPCMKNIQVKYMPSFIRTTNPNEIMLNRLQREIPSAKRASAILFNSFDALDHEIL  241

Query  756   MALQSMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVN  929
              AL    P ++ +GPL  L   +  K+     +  SLWKED++C+EWLD+ APNSVVY+N
Sbjct  242   QALAPDFPSLFTLGPLMLLLDSIEAKEEEATTINPSLWKEDSTCIEWLDSHAPNSVVYIN  301

Query  930   YGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWC  1109
             +GSITVMT DQL EFAWGLANS +PFLWI RPDLV G++++LPPEF+EETKDR +++SWC
Sbjct  302   FGSITVMTNDQLVEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEETKDRRLIASWC  361

Query  1110  PQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEId  1289
              QE+VL H A+G FLTH+GWNSTLESI NGVPM+CWPFFAEQQTNCW+ C KWGIG+EI+
Sbjct  362   NQEKVLAHQAIGVFLTHSGWNSTLESISNGVPMICWPFFAEQQTNCWFCCKKWGIGIEIN  421

Query  1290  nnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
              NV R+EVE  VRELM+ EKG+EMKRKA+E KKLA EAA + P GSS+ N++  I  L
Sbjct  422   VNVKRNEVETQVRELMQGEKGKEMKRKAIEWKKLAHEAAAS-PNGSSYSNLDNVIKVL  478



>ref|XP_007208223.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
 gb|EMJ09422.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
Length=480

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/483 (58%), Positives = 375/483 (78%), Gaps = 7/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+R    K HAVC+P+PAQGH++P+++LAK+LH +GFHITFVNTEFNHRRL RS GP+
Sbjct  1     MGSVREATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S++GLP F+FETIPDGLP S+ DATQD+P+LC+ST  TCLGPFK+L+ ++N +  S  P 
Sbjct  61    SVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKINSS--SQVPQ  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIV+DG+  F   AA+ELGIPEV FWT SACGFLGY+ YS+L+ +G  P K+E++L +
Sbjct  119   VTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFKEETFLHD  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             G L+T +DW+ GMK +RLRD+PSF+R T+ ++ M  F+  E+    ++SAII NT+D  E
Sbjct  179   GTLDTPIDWIPGMKNVRLRDIPSFIRVTDVNDIMFDFLGSESRNCLKSSAIIFNTYDEFE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDIN---VRALASSLWKEDTSCLEWLDTKAPNS  914
             HE L  + ++ P +Y +GPL+ L++ +       V +L+S+LWKEDT CL+WLD K P+S
Sbjct  239   HEVLEVISTIFPNIYTIGPLKLLERHLSKTETKLVESLSSNLWKEDTECLKWLDQKKPSS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVNYGSIT MT   L EFAWGLANSK PFLWI+RPD+V G++AILP EF EE K+RG 
Sbjct  299   VVYVNYGSITTMTDQHLKEFAWGLANSKHPFLWIVRPDVVEGDSAILPNEFFEEIKERGY  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++SWCPQ+QVL HP+VG FLTH GWNSTLES+  GVP++CWPFFA+Q TNC Y+CT+WGI
Sbjct  359   IASWCPQDQVLAHPSVGAFLTHTGWNSTLESVSEGVPVICWPFFADQHTNCRYACTEWGI  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GME+  +V RDE+E +V+E++E EKG +M++KA E KK A++A D    GSS+ N ++ I
Sbjct  419   GMEVSPDVKRDEIEVLVKEILEGEKGMKMRQKAKEWKKKAVQATDI--GGSSYNNFDRLI  476

Query  1455  NHL  1463
               L
Sbjct  477   KSL  479



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/490 (61%), Positives = 385/490 (79%), Gaps = 9/490 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS   E    HAVCIP+PAQGHINPMLKLAK+LH KGFHITFVNTE+NH+RL +S G  
Sbjct  1     MGSSIVENFGGHAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSN  60

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVS---  371
             S+  L +FRFETIPDGLP S+ AD+TQD+PSLC+ST   CL PF+DLL +LND   S   
Sbjct  61    SIDCLSTFRFETIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSSSS  120

Query  372   NAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               PPV+CIVSD VMSFT++AA+EL IP V+ WT SACGF+ Y HY QL++KG+ PLKD S
Sbjct  121   KVPPVTCIVSDFVMSFTIEAAKELEIPIVLSWTASACGFMAYAHYRQLVEKGFVPLKDAS  180

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
             YLTNG+L+T +DW+ GM+GI L+ LPSF+RT  P++ ++ F++ E   AR ASAII+NTF
Sbjct  181   YLTNGFLDTVIDWIPGMEGISLKYLPSFVRTLEPEDVVVNFVIGEFENARYASAIIINTF  240

Query  732   DALEHEALMALQSMLP-PVYAVGPLQFLQKQ---VKDINVRALASSLWKEDTSCLEWLDT  899
             D LEHE LM L  + P P+Y +GPLQ  Q     VK+  +  + S+LWKE   CLEWLD+
Sbjct  241   DELEHEVLMHLPFIFPNPIYTIGPLQQFQDDQDQVKENYLNRIKSNLWKEQPGCLEWLDS  300

Query  900   KAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEET  1079
             K P SV+YVN+GS+TVM+P+QL EFAWGLANSKKPFLW+IRPDLV G++AI+P EF++ET
Sbjct  301   KKPESVIYVNFGSVTVMSPEQLIEFAWGLANSKKPFLWVIRPDLVNGDSAIIPVEFLQET  360

Query  1080  KDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSC  1259
             K+RG+L+SW  QE+VL HP++GGFLTHNGWNSTLES+C GVP++CWPFFAEQQTNCW+ C
Sbjct  361   KERGLLASWSSQEEVLRHPSIGGFLTHNGWNSTLESLCGGVPLICWPFFAEQQTNCWFCC  420

Query  1260  TKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVN  1439
              KW IG+EI+ +V R+E+E++V+EL++ ++G+E+K+K ME  KL  E A     GSS+ N
Sbjct  421   NKWKIGIEIEKDVKRNEIERLVQELIDGKQGKELKKKVMEW-KLKAEEATASANGSSYAN  479

Query  1440  IEKFINHLLL  1469
             +++ IN +LL
Sbjct  480   LDRVINEVLL  489



>ref|NP_173655.2| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 sp|Q9LMF1.2|U85A3_ARATH RecName: Full=UDP-glycosyltransferase 85A3 [Arabidopsis thaliana]
 gb|AEE30236.1| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 gb|AHL38931.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=488

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/485 (61%), Positives = 375/485 (77%), Gaps = 6/485 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS   S + KPH VC+PYPAQGHINPM+K+AK+LH KGFH+TFVNT +NH RL RS G 
Sbjct  1     MGSRFVSNEQKPHVVCVPYPAQGHINPMMKVAKLLHVKGFHVTFVNTVYNHNRLLRSRGA  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSF+FE+IPDGLP +  DATQDIP+L EST+  CL PFK LL R+      + P
Sbjct  61    NALDGLPSFQFESIPDGLPETGVDATQDIPALSESTTKNCLVPFKKLLQRI--VTREDVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+D AEELG+PE+ FWTTSACGF+ Y+H+   ++KG  P+KD S LT
Sbjct  119   PVSCIVSDGSMSFTLDVAEELGVPEIHFWTTSACGFMAYLHFYLFIEKGLCPVKDASCLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               YL+T +DW+  M  ++L+D+PSF+RTTNP++ ML F+++E  R +RASAIILNTFD L
Sbjct  179   KEYLDTVIDWIPSMNNVKLKDIPSFIRTTNPNDIMLNFVVREACRTKRASAIILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQV--KDINVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH+ + ++QS+LPPVY +GPL  L  +   +D  +  + S+LWKE+T CL WL+TK+ NS
Sbjct  239   EHDIIQSMQSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECLGWLNTKSRNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVN+GSIT+MT  QL EFAWGLA + K FLW++RPD V GE A++P EF+ ET DR M
Sbjct  299   VVYVNFGSITIMTTAQLLEFAWGLAATGKEFLWVMRPDSVAGEEAVIPKEFLAETADRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWCPQE+VL HPAVGGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC +SC +W +
Sbjct  359   LTSWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             G+EI  +V R EVE VVRELM+ EKG++M+ KA+E ++LA E A  +P GSS +N E  +
Sbjct  419   GIEIGGDVKRGEVEAVVRELMDGEKGKKMREKAVEWRRLA-EKATKLPCGSSVINFETIV  477

Query  1455  NHLLL  1469
             N +LL
Sbjct  478   NKVLL  482



>ref|XP_008789348.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X1 [Phoenix 
dactylifera]
Length=477

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/474 (63%), Positives = 368/474 (78%), Gaps = 3/474 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             ++PHAV IP PAQGH+ PMLKLAK+LH +GF+ITFVNT FN  RL RS    SL  LP F
Sbjct  7     ERPHAVLIPIPAQGHVTPMLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAISSLDSLPEF  66

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFE+IPDGLP S+ DATQD+PSLC+S    C+ PF+DL+  LND + S  P VSCIVSDG
Sbjct  67    RFESIPDGLPPSDEDATQDVPSLCDSIPKYCIAPFRDLITELNDPS-SPTPTVSCIVSDG  125

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
             VMSFT+D A+EL IPEV+FWT SACG +GY+HY  L+++G  PLKD S LTNGYLET +D
Sbjct  126   VMSFTLDVAKELQIPEVLFWTPSACGVMGYLHYQHLIERGIFPLKDASDLTNGYLETPID  185

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GMK +RLRDLP+FLRT +  + M  F  +   R+  ASAIILNTFD LE   L A+ 
Sbjct  186   WISGMKNVRLRDLPTFLRTVDSKDIMFHFCNRAAQRSSMASAIILNTFDELERPVLDAMA  245

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             SMLPP+Y +GPL  L +Q+    + +++S+LWKED +CLEWL  + P SVVYVNYGSITV
Sbjct  246   SMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVYVNYGSITV  305

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             MT +QL EFAWGLANSK  F W+IRPDLV G++A+LP EF+ ETK+RG+L+SWCPQE VL
Sbjct  306   MTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWCPQEAVL  365

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HP++G FLTH+GWNSTLESIC GVP + WPFFAEQQTNC Y+CT+WGIGMEID+NV R+
Sbjct  366   SHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKRE  425

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
             EVE++VRELME EKG+EM+R+A+E K+ A+ A  T P GSS  N ++ +   LL
Sbjct  426   EVERLVRELMEGEKGKEMRRRAVEWKESAIRA--TQPGGSSFQNFDRLVKEALL  477



>ref|XP_007047908.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92065.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=484

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/481 (60%), Positives = 371/481 (77%), Gaps = 6/481 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   KPHAVC+PYP+QGH+ PM+ LAK+LH KGFHITFVNTEFN+RRL R  G E
Sbjct  1     MGSIGAS--KPHAVCVPYPSQGHVTPMMHLAKLLHSKGFHITFVNTEFNYRRLVRFKGAE  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             +++GLP FRF++IPDGLP S+ DATQDIP+LC+ST   CL PF +L+A+LN +  S  PP
Sbjct  59    AVKGLPDFRFDSIPDGLPHSDRDATQDIPALCDSTRKNCLAPFLELIAKLNSS--SEVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VSCI+SDGVMSF + A E LGIPE  FWT S CGF+GY+ YS+L  +G  P KD +++++
Sbjct  117   VSCIISDGVMSFGIKAGEILGIPEFQFWTASVCGFMGYLQYSELAKRGIVPFKDGNFISD  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             G L+T +DW+ GM  +RL+D+PSF+RTT+P++ M  F+  E     ++SAII NTFD LE
Sbjct  177   GTLDTPIDWIPGMSNMRLKDIPSFIRTTDPNDIMFDFLGSEAQNCLKSSAIIFNTFDELE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
              E L A+ +  P VY +GPL  L + V    +R+  SSLWKEDTSC+EWL+ + PNSVVY
Sbjct  237   QEVLEAIVAKFPSVYTIGPLTLLGRHVPQSQLRSARSSLWKEDTSCIEWLNKREPNSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGS+TVM+   L EFAWGLANSK PFLWIIRPD+V GE+AILP EF EE KDRG+++S
Sbjct  297   VNYGSVTVMSDHHLKEFAWGLANSKHPFLWIIRPDVVMGESAILPEEFFEEIKDRGLITS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQ++VL HP+VG FLTH GWNSTLESI  GVP++CWPFFAEQQTNC Y+CTKWGIGME
Sbjct  357   WCPQDEVLCHPSVGVFLTHCGWNSTLESISGGVPVICWPFFAEQQTNCRYACTKWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ++ +V RD+V+ +V+E+ME + G++M++KA+E +  A  A D    GSS+ N ++FIN  
Sbjct  417   VNPDVKRDDVKALVKEMMEGDNGKQMRQKALEWRSKAEVATDI--GGSSYNNFDRFINEA  474

Query  1464  L  1466
             L
Sbjct  475   L  475



>ref|XP_011003867.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Populus euphratica]
 ref|XP_011003868.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=483

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/482 (65%), Positives = 383/482 (79%), Gaps = 7/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +  DKPHAVC+P+PAQGHINPMLKLAK+LH KGFH+TFVNTE+NH+RL +S G  
Sbjct  1     MGSI-APADKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHVTFVNTEYNHKRLLKSRGTN  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL G P F+FETIPDGLP S+ ADATQDIPSLC+ TS T L P  DLLA+LN + V   P
Sbjct  60    SLDGFPDFQFETIPDGLPSSDIADATQDIPSLCKYTSQTALAPLCDLLAKLNSSGV--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              V+CIV+D  MSF++DAAEE GIPE +FWT SACG LGY  Y  L+++G  PLKD   LT
Sbjct  118   QVTCIVADACMSFSLDAAEEFGIPEAVFWTPSACGVLGYSQYRPLIERGLIPLKDARDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DW+ GMK IRL+DLP+F+RTT+ +++ML+F+ +E  R  RASA+ILNTFD+ 
Sbjct  178   NGYLETPVDWIPGMKDIRLKDLPTFIRTTDVNDFMLQFLKREIDRTSRASAVILNTFDSF  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L AL  M PP+Y VGPLQ L  Q+ + +++ + S+LWKE   C+EWLD+K P SVV
Sbjct  238   EQDVLDALSPMFPPIYTVGPLQLLVDQIPNGDLKNIGSNLWKEQPECIEWLDSKEPKSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV+TP Q+ EFAWGLANS + FLWIIRPD+V GEAA+LPPEF+ ETKDRGML 
Sbjct  298   YVNFGSITVITPQQMIEFAWGLANSNQTFLWIIRPDIVVGEAAMLPPEFLSETKDRGMLV  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT-KWGIG  1277
             SWCPQEQVL HP++GGFL+H GWNSTL+SIC GVPM+CWPFFAEQQTNC  +CT +WGIG
Sbjct  358   SWCPQEQVLKHPSIGGFLSHMGWNSTLDSICGGVPMVCWPFFAEQQTNCRLACTDQWGIG  417

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEIDNNV RDEVEK+VR LM  +KG+ MK+KAME K  A EAA  +   SSH N+++ +N
Sbjct  418   MEIDNNVKRDEVEKLVRGLMVGDKGKAMKKKAMEWKTKAEEAA--LAGNSSHRNLDQLVN  475

Query  1458  HL  1463
              L
Sbjct  476   AL  477



>ref|XP_006416203.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
 gb|ESQ34556.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
Length=759

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 378/474 (80%), Gaps = 6/474 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPH VC+PYPAQGHINPMLK+AK+LH KGFH+TFVNT +NH RL RS GP +L GLPSF+
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGPNALDGLPSFQ  70

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             FE IPDGLP ++ DATQDIP+LCEST   CL PFK+LL ++N  A  + PPVSCIVSDG 
Sbjct  71    FEAIPDGLPETDVDATQDIPALCESTMKNCLAPFKELLRQIN--ARDDVPPVSCIVSDGC  128

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAAEELGIPEV+FWT SAC  + Y+H+   ++KG +P  DESYLT  YL+T +DW
Sbjct  129   MSFTLDAAEELGIPEVLFWTPSACATMAYLHFYLFIEKGLSPFIDESYLTKEYLDTVIDW  188

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             +  MK ++L+D+PSF+RTTNPD+ MLKF+++ET R++RASAIILNTFD LEH+ + ++QS
Sbjct  189   IPSMKNLKLKDIPSFIRTTNPDDIMLKFVIRETERSKRASAIILNTFD-LEHDIIQSMQS  247

Query  771   MLPPVYAVGPLQFL-QKQVKDIN-VRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
             +LPPVY+VGPL  L  +++++ +    + S+LWKE+  CL WLDTKAPNSVVYVN+GSIT
Sbjct  248   ILPPVYSVGPLHLLANREIQESSETGKMGSNLWKEEVECLAWLDTKAPNSVVYVNFGSIT  307

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VM+  QL EFAWGLA S K FLW+IRPDLV GE A++ PEF+ ET DR ML+SWCPQE+V
Sbjct  308   VMSAKQLEEFAWGLAGSGKEFLWVIRPDLVAGEEAVVSPEFLTETADRRMLASWCPQEKV  367

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L HP+VGGFLTHNGWNS LES+  GVPM+CWPFFA+QQTNC + C +W +GMEI  +V R
Sbjct  368   LAHPSVGGFLTHNGWNSMLESLSGGVPMVCWPFFADQQTNCKFCCDEWEVGMEIGGDVRR  427

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             +E+EKV+RELM+ EKG++M+ KA E ++LA EA +    GSS VN E  +   L
Sbjct  428   EEIEKVIRELMDGEKGKKMRDKAEEWRRLAEEATEH-EHGSSVVNFETVVKEHL  480


 Score =   361 bits (927),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 227/272 (83%), Gaps = 2/272 (1%)
 Frame = +3

Query  567   YLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEH  746
             +L+T +DW+  MK ++L+D+P+F+RT+NP++ ML F+++ETGR++RASAIILNTFD LEH
Sbjct  479   HLDTVVDWIPSMKNLKLKDIPTFIRTSNPNDIMLNFLVRETGRSKRASAIILNTFDDLEH  538

Query  747   EALMALQSMLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             + + ++QS+LPPVY++GPL  +  K++++      + S+LW+E+  CL+WLDTK PNSVV
Sbjct  539   DIIRSMQSILPPVYSIGPLHLIVNKEIEEGSEAGRMGSNLWREEMECLDWLDTKTPNSVV  598

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVM+  QL EFAWGLA ++K FLW+IRPDLV G+ A++PPEF+ ET+ R MLS
Sbjct  599   YVNFGSITVMSAKQLVEFAWGLAATRKDFLWVIRPDLVAGDEAVIPPEFLMETEGRRMLS  658

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQE+VL HPA+GGFLTHNGWNSTLESI  GVPM+CWPFFAEQQTNC + C +W +GM
Sbjct  659   SWCPQEKVLSHPAIGGFLTHNGWNSTLESISGGVPMVCWPFFAEQQTNCKFCCDEWEVGM  718

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAM  1376
             EI  +V+R+EVE VVRELM+ EKG++M+ KA+
Sbjct  719   EIGGDVMREEVEAVVRELMDGEKGKKMREKAL  750



>ref|XP_008229473.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
 ref|XP_008229474.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=486

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/477 (63%), Positives = 369/477 (77%), Gaps = 6/477 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP PAQ HI  MLK AK+LHH+GFHITFVNTEFNH+R  +SLGP SL GLP F+
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFQ  68

Query  231   FETIPDGLPLSEADATQDIPSLCEST-SATCLGPFKDLLARLNDTAVSNA--PPVSCIVS  401
             FE IPD LP S+ DATQD+  LCES      L PF  LLA+LN+ A+S +  PPV+CIVS
Sbjct  69    FEAIPDSLPDSDEDATQDVTLLCESIRKQNFLAPFLALLAKLNNDAISTSTNPPVTCIVS  128

Query  402   DGVMS-FTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             DG MS FT+ AAEE+G+P V+F+T +AC F+G+     L++KG  PLKDES  TNGYL+T
Sbjct  129   DGFMSTFTITAAEEIGVPIVLFYTIAACSFMGFKQIRALVEKGLAPLKDESCFTNGYLDT  188

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
              +DW+ GM+ IRLRDLP+F RTTNPD+ +  FI++ET RA  ASAII++TF ALE + L 
Sbjct  189   VIDWIPGMRDIRLRDLPTFFRTTNPDDILFNFIMEETDRAHEASAIIIHTFHALEPDVLD  248

Query  759   ALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             AL  MLP VY++GPLQ    ++ +  ++ +  SLWKE+T CLEWL+T  PNSVVYVN+GS
Sbjct  249   ALSFMLPRVYSIGPLQLHLNEIPEHPLKMVGYSLWKEETECLEWLNTNTPNSVVYVNFGS  308

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             I VMT +QL EF WGLANSK PF W+IRPDLV GE+AI PPEFV ETK+R +++ WCPQE
Sbjct  309   IAVMTSEQLVEFGWGLANSKLPFFWVIRPDLVIGESAIFPPEFVAETKERSLIAGWCPQE  368

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             QVL HP+VGGFLTH+GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V
Sbjct  369   QVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  428

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              RDEVEK+V+ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  429   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  483



>ref|XP_009103240.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=490

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 377/475 (79%), Gaps = 5/475 (1%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPH +C+PYPAQGHINPMLK+AK+LH +GFH+TFVNT +NH RL RS GP ++ GLPSF
Sbjct  10    EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPHAVEGLPSF  69

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDG  407
             RFE+IPDGLP ++ D TQ+I +LC+ST   CL PF +LL R+N  A  + PPVSCIV+DG
Sbjct  70    RFESIPDGLPETDVDVTQNITALCDSTMKNCLTPFNELLQRIN--AGDDVPPVSCIVADG  127

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              MSFT+DAAEELG+PEV+FWTT A  F+ Y+H+   ++KG  P+K E YLTN YL+T +D
Sbjct  128   CMSFTLDAAEELGVPEVLFWTTGASAFMIYLHFYLFIEKGLAPIKAEDYLTNEYLDTVID  187

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             ++  MK ++ +D+PSF+RTTNPD+ MLKF L+ET R++RASAIILNTFD L+H+ + ++ 
Sbjct  188   FMPSMKNLKFKDIPSFIRTTNPDDIMLKFALRETERSKRASAIILNTFDDLDHDVIQSMN  247

Query  768   SMLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSI  941
             S+LPPVY VGPL  L  +++++   +  + S+LWKE+T CL+WLDTKAPNS+VYVN+GSI
Sbjct  248   SILPPVYPVGPLHVLANREIEEGSELGKMGSNLWKEETGCLDWLDTKAPNSIVYVNFGSI  307

Query  942   TVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQ  1121
             TV+T  QL+EFAWGLA S K FLW+IRPDLV G+ A++PPEF+ ET DR ML+SWCPQE+
Sbjct  308   TVITAKQLTEFAWGLAGSGKEFLWVIRPDLVAGDEAMVPPEFLTETADRRMLASWCPQEK  367

Query  1122  VLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvv  1301
             VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC   C +W +GME   +V 
Sbjct  368   VLCHPAIGGFLTHCGWNSTLESLCGGVPMICWPFFADQQTNCKNCCDEWEVGMETGGDVR  427

Query  1302  rdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  1466
             R+E+EKV+RELM+ EKG++M+ KA E  +LA EAA     GSS VN EK +  LL
Sbjct  428   REEIEKVIRELMDGEKGKKMREKAAEWGRLA-EAATEHERGSSVVNFEKVVKVLL  481



>ref|XP_006304493.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
 gb|EOA37391.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
Length=488

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/488 (60%), Positives = 378/488 (77%), Gaps = 6/488 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS +     KPH VC+PYPAQGHINPM+K+AK+LH +GFH+TFVNT +NH+R  RS G 
Sbjct  1     MGSHVVGNTQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTIYNHKRFLRSRGS  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSFRFE+IPDGLP ++ D TQDI +LCEST   CL PF++L+ R+N  A  N P
Sbjct  61    NALDGLPSFRFESIPDGLPETDMDTTQDITALCESTMKNCLAPFQELIQRIN--AGDNVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+D AEELG+PEV+FWTTS C FL Y+H+   ++KG +P+KDESYLT
Sbjct  119   PVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGISPMKDESYLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
               +L+T +D++  MK ++L+D+PSF+RTTNPD+ +LKF L ET RARRASAIILNTFD L
Sbjct  179   KEHLDTVIDFIPSMKNLKLKDIPSFIRTTNPDDAVLKFALHETERARRASAIILNTFDDL  238

Query  741   EHEALMALQSMLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPNS  914
             EH  + A+Q +LPPVY+VGPL  L  +++++   V  + S+LWKE+  CL+WLDTK  NS
Sbjct  239   EHGVIQAMQPLLPPVYSVGPLHLLANREIEEGSEVGMMNSNLWKEEMKCLDWLDTKTQNS  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             V+Y+N+GSITV++ +QL EFAWGLA S K FLW+IRPDLV GE A++P EF+ ET DR M
Sbjct  299   VIYINFGSITVLSREQLIEFAWGLAGSGKEFLWVIRPDLVGGEEAVVPSEFLTETADRRM  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             L+SWCPQE+VL HPAVGGFLTH GWNS LES+  GVPM+CWPFFA+QQTNC + C +W +
Sbjct  359   LASWCPQEKVLSHPAVGGFLTHCGWNSILESLSGGVPMVCWPFFADQQTNCKFCCDEWEV  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             G+E   +V R EVE VVRELM+ +KG++M+ KA E ++L  EA + + +GSS VN +  +
Sbjct  419   GIETGGDVKRGEVEAVVRELMDGDKGKKMREKAGEWRRLVEEATE-LKLGSSFVNFQTVV  477

Query  1455  NHLLLSHR  1478
             +  LL  +
Sbjct  478   SKFLLGQK  485



>ref|XP_004299645.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/487 (62%), Positives = 386/487 (79%), Gaps = 6/487 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS  SE  KPHAVCIPYPAQGHINPMLKLAKILH++GFHITFVNTE+NH RL RS GP 
Sbjct  1     MGSNASE--KPHAVCIPYPAQGHINPMLKLAKILHYRGFHITFVNTEYNHERLLRSRGPN  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLPSFRF++IPDGLP ++A+ TQDIP+LC S     L PF+ LL+ L   + SN+PP
Sbjct  59    SLDGLPSFRFKSIPDGLPPTDANVTQDIPALCGSIRNNFLAPFRSLLSEL--NSSSNSPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI+SD   +FT+DA  ELG+P V+F T SAC  + Y+H++ L++KG  PLK+ SYLTN
Sbjct  117   VTCIISDLGTTFTLDATHELGLPVVLFQTASACTLMCYLHHAHLIEKGIVPLKEASYLTN  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYL+T +DW+ G+  IRLRD+P+F+RTT+PD+ ML FIL    +A+RASAII+NTFDALE
Sbjct  177   GYLDTVIDWLPGLGSIRLRDMPTFIRTTDPDDVMLSFILYMIEQAQRASAIIINTFDALE  236

Query  744   HEALMALQSMLPPVYAVGPL-QFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             H+ L A  S+LPPVY++GPL Q L    +D + + + S+LWKE+  CLEWL++K PNSVV
Sbjct  237   HKVLDAFSSLLPPVYSIGPLHQQLSHIQEDDDSKTIGSNLWKEEPECLEWLESKEPNSVV  296

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITVMT +QL EFAWGLANS   FLW+IRPDLV G +A++PPEFVEETK R  L+
Sbjct  297   YVNFGSITVMTDEQLIEFAWGLANSNMTFLWVIRPDLVAGNSAVVPPEFVEETKGRSWLA  356

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HPA+GGFLTH GWNST+ES+C GVPM+CWPFFA+QQ NC + C +WG+ M
Sbjct  357   SWCPQEQVLNHPAIGGFLTHCGWNSTVESLCGGVPMICWPFFADQQINCRFCCKEWGVAM  416

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             +I+ +V R+ +E +VR+LME ++G++M++K++E KKLA EA  T P GSS +N+ K +N 
Sbjct  417   QIEGDVRRNYIEVLVRKLMEGQEGKQMRKKSLEWKKLAEEAV-TAPNGSSFLNLNKMVNQ  475

Query  1461  LLLSHRK  1481
             +LLS + 
Sbjct  476   VLLSPKN  482



>gb|KCW45706.1| hypothetical protein EUGRSUZ_L00512, partial [Eucalyptus grandis]
Length=471

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 373/471 (79%), Gaps = 9/471 (2%)
 Frame = +3

Query  48    DKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSF  227
             +KPHAVCIPYPAQGHINPMLKLAK+LHHKGFHITFVNTE  H+RL RS GP SL GLP F
Sbjct  8     EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHIHKRLLRSQGPHSLDGLPHF  67

Query  228   RFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV-SNAPPVSCIVSD  404
             RF+ IPDGLP S+ D+TQDIPSLC S S   L  F+ LL +L + +  +  PPV+CIVSD
Sbjct  68    RFDMIPDGLPPSDPDSTQDIPSLCASLSEHGLSAFRSLLLKLQEQSQDAVVPPVTCIVSD  127

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
             GVM+FTVDAAEEL IPEV+F T SACG LGY  Y +L++ G+T LKD +YL+NGYLET +
Sbjct  128   GVMTFTVDAAEELKIPEVVFCTPSACGLLGYTKYRRLVEDGFTLLKDPTYLSNGYLETTV  187

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
              W  GMK IRLRD P+F+RT +  + +L F+++E  R+ RASA+ILNTFD LEH+ L +L
Sbjct  188   SWTSGMKSIRLRDFPTFIRTLDHQDILLNFVIREVARSFRASAVILNTFDTLEHDVLESL  247

Query  765   QSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSIT  944
              S+ P +Y +GPLQ L  Q++D  +R++  +LW+E+  CL WLD+K P SVVYVN+GSIT
Sbjct  248   SSVFPHIYTIGPLQLLADQIQDEALRSVGGNLWREEPGCLPWLDSKEPGSVVYVNFGSIT  307

Query  945   VMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQV  1124
             VMT  QL+EFAWGLANS+KPF+WIIRPDLV  ++A+LPPEF+EE   +GML      E+V
Sbjct  308   VMTTGQLTEFAWGLANSQKPFMWIIRPDLVVSKSAVLPPEFMEEIAGQGML------EEV  361

Query  1125  LGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvr  1304
             L H A+GGFLTH+GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN+V R
Sbjct  362   LKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKR  421

Query  1305  devekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             DEVE +VRELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+
Sbjct  422   DEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEA--IMPGGTSYNNVDKLIS  470



>ref|NP_173656.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 sp|Q9SK82.1|U85A1_ARATH RecName: Full=UDP-glycosyltransferase 85A1; AltName: Full=Cytokinin-O-glucosyltransferase 
2; AltName: Full=Zeatin O-glucosyltransferase 
2; Short=AtZOG2 [Arabidopsis thaliana]
 gb|AAF18537.1|AC006551_23 Putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL91228.1| putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAP49527.1| At1g22400 [Arabidopsis thaliana]
 gb|AEE30237.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 gb|AHL38930.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/489 (60%), Positives = 381/489 (78%), Gaps = 7/489 (1%)
 Frame = +3

Query  24    MGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS +     KPH VC+PYPAQGHINPM+++AK+LH +GF++TFVNT +NH R  RS G 
Sbjct  1     MGSQIIHNSQKPHVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGS  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSFRFE+I DGLP ++ DATQDI +LCEST   CL PF++LL R+N  A  N P
Sbjct  61    NALDGLPSFRFESIADGLPETDMDATQDITALCESTMKNCLAPFRELLQRIN--AGDNVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG MSFT+D AEELG+PEV+FWTTS C FL Y+H+   ++KG  PLKDESYLT
Sbjct  119   PVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLKDESYLT  178

Query  561   NGYLE-TELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDA  737
               YLE T +D++  MK ++L+D+PSF+RTTNPD+ M+ F L+ET RA+RASAIILNTFD 
Sbjct  179   KEYLEDTVIDFIPTMKNVKLKDIPSFIRTTNPDDVMISFALRETERAKRASAIILNTFDD  238

Query  738   LEHEALMALQSMLPPVYAVGPLQFL-QKQVKD-INVRALASSLWKEDTSCLEWLDTKAPN  911
             LEH+ + A+QS+LPPVY+VGPL  L  +++++   +  ++S+LWKE+  CL+WLDTK  N
Sbjct  239   LEHDVVHAMQSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTQN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SV+Y+N+GSITV++  QL EFAWGLA S K FLW+IRPDLV GE A++PP+F+ ETKDR 
Sbjct  299   SVIYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPDFLMETKDRS  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             ML+SWCPQE+VL HPA+GGFLTH GWNS LES+  GVPM+CWPFFA+QQ NC + C +W 
Sbjct  359   MLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWD  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             +G+EI  +V R+EVE VVRELM+ EKG++M+ KA+E ++LA E A    +GSS +N E  
Sbjct  419   VGIEIGGDVKREEVEAVVRELMDGEKGKKMREKAVEWQRLA-EKATEHKLGSSVMNFETV  477

Query  1452  INHLLLSHR  1478
             ++  LL  +
Sbjct  478   VSKFLLGQK  486



>ref|XP_007207648.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
 gb|EMJ08847.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
Length=480

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/483 (59%), Positives = 372/483 (77%), Gaps = 7/483 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+R    K HAVC+P+PAQGH++P+++LAK+LH +GFHITFVNTEFNHRRL RS GP+
Sbjct  1     MGSVREATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPD  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S++GLP F+FETIPDGLP S+ DATQD+P+LC+ST  TCLGPFK+L+ ++N +  S  P 
Sbjct  61    SVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKINSS--SQVPQ  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CIV+DG+  F   AA+ELGIPEV FWT SACGFLGY+ YS+L+ +G  P +DE++L +
Sbjct  119   VTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFQDETFLHD  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             G L+T +DWV GMK  RLRD+PSF+R T+ ++ M  F+  E+    ++SAII NT+D  E
Sbjct  179   GTLDTPIDWVPGMKNARLRDIPSFIRVTDVNDIMFDFLGSESRNCLKSSAIIFNTYDEFE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDIN---VRALASSLWKEDTSCLEWLDTKAPNS  914
             HE L  + +M P +Y +GPL+ L++ + +     V +L+S+LWKEDT CL+WLD K P+ 
Sbjct  239   HEVLEVISTMFPNIYTIGPLKLLERHLPETETKLVESLSSNLWKEDTECLKWLDQKKPSL  298

Query  915   VVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGM  1094
             VVYVNYGSIT MT   L EFAWGLANSK PFLWI+RPD+V G++AILP EF EE K+RG 
Sbjct  299   VVYVNYGSITTMTDQHLKEFAWGLANSKHPFLWIVRPDVVEGDSAILPNEFFEEIKERGY  358

Query  1095  LSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGI  1274
             ++SWCPQ+QVL HP+VG FLTH GWNSTLES+  GVP++CWPFFAEQ TNC Y+CT W I
Sbjct  359   IASWCPQDQVLAHPSVGAFLTHTGWNSTLESVSEGVPVICWPFFAEQHTNCRYACTDWEI  418

Query  1275  GMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  1454
             GME+  +V RDE+E +V+E++E EKG +M++KA E KK A+EA D    GSS+ N ++ I
Sbjct  419   GMEVSPDVKRDEIEVLVKEILEGEKGMKMRQKAKEWKKKAVEATDI--RGSSYNNFDRLI  476

Query  1455  NHL  1463
               L
Sbjct  477   KSL  479



>emb|CDP01073.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 382/484 (79%), Gaps = 4/484 (1%)
 Frame = +3

Query  24    MGSLRSE-QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGP  200
             MGS  +  + KPHA+ IP+PAQG INPM KLAKILHHKGFHITFV++EFN RRL +S G 
Sbjct  1     MGSTETATKPKPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGK  60

Query  201   ESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
              +L GLPSF+FETIPDGLP S+ADATQD+PSLC+STS  CL PF+ L+ RLN +     P
Sbjct  61    NALDGLPSFQFETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLNSSP--GVP  118

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
             PVSCIVSDG+MSFT++ A ELGIP+V FWT  A G + Y++Y  L++KGYTPLKD SYLT
Sbjct  119   PVSCIVSDGIMSFTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLKDWSYLT  178

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             +GYL+T +DW+ GMKGIRL+DLPSF+RT + ++ ML F + +  +   ASA+ILNTFDA+
Sbjct  179   DGYLDTVIDWIPGMKGIRLKDLPSFIRTRDRNDIMLNFAINQAEKIHDASALILNTFDAM  238

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L A  S+LP VY +GPL  ++ Q+ D  +++L S+LWKE+  C+EWLD+K PNSVV
Sbjct  239   EPDVLDAFSSILPAVYTLGPLHLIEDQLPDNELKSLGSNLWKEELGCIEWLDSKEPNSVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+TVMTP QL EFAWGLA S + FLWIIRPDLV GE AILPPEFV +TK+RG+L+
Sbjct  299   YVNFGSVTVMTPQQLVEFAWGLAKSGRTFLWIIRPDLVIGETAILPPEFVLDTKERGLLA  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQ  VL HP++GGFLTH GWNSTLESIC GV M+CWPFFAEQQTNCWY C   G  M
Sbjct  359   SWCPQVDVLKHPSIGGFLTHCGWNSTLESICAGVAMVCWPFFAEQQTNCWYCCNHLGTAM  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV  DEVEK+V ELM  ++G+EMK+KA ELKKLA EA  T P GSS  N+E  +++
Sbjct  419   EIDNNVKSDEVEKLVNELMFGDRGQEMKKKAAELKKLAEEAI-TAPSGSSIKNLESLVHN  477

Query  1461  LLLS  1472
             +L+S
Sbjct  478   VLIS  481



>ref|XP_008229475.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Prunus 
mume]
Length=485

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/477 (63%), Positives = 370/477 (78%), Gaps = 7/477 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP PAQ HI  MLK AK+LHH+GFHITFVNTEFNH+R  +SLG  SL GLP FR
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGSNSLDGLPDFR  68

Query  231   FETIPDGLPLSEADATQDIPSLCEST-SATCLGPFKDLLARLNDTAVSNA--PPVSCIVS  401
             FE IPD LP S+ DATQD+  LCES      L PF  LLA+LN+ A+S +  PPV+CIVS
Sbjct  69    FEAIPDSLPDSDEDATQDVTLLCESVRKQNLLAPFHALLAKLNNDAISTSSNPPVTCIVS  128

Query  402   DGVMS-FTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             DG MS FT+ AAE++G P V+F+T +AC F+G   +  ++ KG  PLKDES  TNGYL+T
Sbjct  129   DGFMSTFTITAAEQIGAPIVLFYTIAACSFMGCKQFRAVVKKGLAPLKDESCFTNGYLDT  188

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
              +DW+ GM+ IRLRDLP+FL+TTN D+ M  FI++ T RA  ASA++L+TFDALE + L 
Sbjct  189   VIDWIPGMRDIRLRDLPTFLQTTNADDTMFNFIMEATDRAHEASAVVLHTFDALEPDVLD  248

Query  759   ALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             AL SMLP VY VGPLQ    Q+ +  ++ +  SLWKE+T CLEWL+T+APNSVVYVN+GS
Sbjct  249   ALSSMLPHVYTVGPLQLHLNQIPEHPLK-MGYSLWKEETECLEWLNTEAPNSVVYVNFGS  307

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             I VMTP+QL EF WGLAN+K PF W+IRPDLV GE+AILPPEFV ETK+R +++ WCPQE
Sbjct  308   IAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQE  367

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             QVL HP+VGGFLTH+GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  427

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  1469
              RDEVEK+V+ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  428   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  482



>ref|XP_008789349.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X2 [Phoenix 
dactylifera]
Length=477

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 374/482 (78%), Gaps = 5/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  +  +PHAV +PYPAQGH+ P+LKLAK+LH +GF+ITFVNT FN  RL RS    
Sbjct  1     MGSMVPQ--RPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL  LP FRFE+I DGLP ++ DATQD+PSLC+S    C+ PF+DL+  LND + S  P 
Sbjct  59    SLDSLPDFRFESIRDGLPPTDKDATQDVPSLCDSIPKNCIAPFRDLIKELNDPS-SPTPT  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VS IVSDGVMSFT+D A+EL IPEV+FWT SACG++GY+HY  L+++G  PLKD S LTN
Sbjct  118   VSRIVSDGVMSFTLDVAKELQIPEVLFWTPSACGYMGYLHYQHLMERGIVPLKDASDLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ GMK +RLRDLPSFLRT +  + M  ++ +E  R+  ASAIILNTFD LE
Sbjct  178   GYLETPIDWISGMKNVRLRDLPSFLRTLDSKDIMFHYLNREAQRSSMASAIILNTFDELE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
                L A+ SMLPP+Y +GPL  L +Q+    + +++S+LWKED +CLEWL  + P SVVY
Sbjct  238   RPVLDAMASMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVY  297

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMT +QL EFAWGLANSK  F W+IRPDLV G++A+LP EF+ ETK+RG+L+S
Sbjct  298   VNYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLAS  357

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE VL HP++G FLTH+GWNSTLESIC GVP + WPFFAEQQTNC Y+CT+WGIGME
Sbjct  358   WCPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGME  417

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID+NV R+EVE++VRELME EKG+EM+R+A+E K+ A+ A  T P GSS  N ++ +   
Sbjct  418   IDSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAIRA--TQPGGSSFQNFDRLVKEA  475

Query  1464  LL  1469
             LL
Sbjct  476   LL  477



>ref|XP_007047909.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92066.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=478

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/481 (59%), Positives = 372/481 (77%), Gaps = 6/481 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  E  KPHAVCIPYP+QGH+ PM++LAK+LH +GFHITFVNTEFNHRRL RS GP+
Sbjct  1     MGSV--ETRKPHAVCIPYPSQGHVTPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPD  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             S++GLP FRFETIP+GLP S+ DATQD+P+LC+ST   CL PF +LL++LN +A    PP
Sbjct  59    SVKGLPDFRFETIPEGLPPSDRDATQDVPALCDSTRKNCLAPFLELLSKLNSSA--QVPP  116

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI+SDGVMSF + AAE LGIPEV FWT SAC F+GY+ +S+LL++G  P K+E++L++
Sbjct  117   VTCIISDGVMSFAIKAAEVLGIPEVQFWTASACSFMGYLQFSELLERGIIPFKNENFLSD  176

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             G L+T +DW+ GM  IRLRD+PSF+R  NP++ M  F+  E     +A AII NTFD  E
Sbjct  177   GTLDTPIDWIPGMSNIRLRDIPSFIRVNNPNDIMFDFMGSEARNCLKAPAIIFNTFDEFE  236

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
             HE L A+ +  P +Y  GPL  L + + D   +++ SSLWKEDT+C+EWL+ + P+SVVY
Sbjct  237   HEVLEAIAAKFPRIYTTGPLPSLARHMPDGPSKSITSSLWKEDTNCIEWLNKREPSSVVY  296

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGS+TVM+   L EFAWGLANSK PFLWI+RPD+V G++AILP EF EE KDR +++S
Sbjct  297   VNYGSVTVMSEQHLKEFAWGLANSKHPFLWIVRPDVVMGDSAILPEEFFEEIKDRALITS  356

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WC Q QVL HP+VG FLTH GWNST+E+IC GVP++CWPFFA+QQTNC Y+CT WGIGME
Sbjct  357   WCAQYQVLSHPSVGVFLTHCGWNSTMEAICGGVPVICWPFFADQQTNCRYACTTWGIGME  416

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             +D++V R+ +E +V+E+ME + G++MK KA+E KK A  A D    G+S+ + ++F+   
Sbjct  417   VDHDVKRENIEFLVKEMMEGDAGKKMKEKALEWKKKAEAATDV--GGASYNDFDRFVKEA  474

Query  1464  L  1466
             L
Sbjct  475   L  475



>ref|XP_008229476.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X2 [Prunus 
mume]
Length=485

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 374/486 (77%), Gaps = 8/486 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS +    KPHAVCIP P Q HI  MLK AK+LHH+GFHITFVNTEFNH+R  +SLGP 
Sbjct  1     MGS-KEVASKPHAVCIPLPVQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV--SNA  377
             SL GLP FRFE IPD LP S  + TQD  SLCES     L PF  LLA+LN+ A+  S+ 
Sbjct  60    SLDGLPDFRFEAIPDSLPDSNDNTTQDGTSLCESIRNNFLAPFHALLAKLNNDAIETSSN  119

Query  378   PPVSCIVSDGVMS-FTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKD-ES  551
             PPVSCIVSDG+MS FT+ AAEE+G P V+F+T +AC F+G   +  +++KG  PLKD ES
Sbjct  120   PPVSCIVSDGLMSMFTITAAEEIGAPIVLFYTIAACSFMGIKQFRAVVEKGLAPLKDDES  179

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
               TNGYL+T +DW+ GM+ IRLRDLP+FL+TTN D+ M  FI++ T RA  ASA++L+TF
Sbjct  180   CFTNGYLDTVIDWIPGMRDIRLRDLPTFLQTTNADDTMFNFIMEATDRAHEASAVVLHTF  239

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             DALE + L AL SMLP VY VGPLQ    Q+ +  ++ +  SLWKE+T CLEWL+T+APN
Sbjct  240   DALEPDVLDALSSMLPHVYTVGPLQLHLNQIPEHPLK-MGYSLWKEETECLEWLNTEAPN  298

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SVVYVN+GSI VMTP+QL EF WGLAN+K PF W+IRPDLV GE+AILPPEFV ETK+R 
Sbjct  299   SVVYVNFGSIAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERS  358

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             +++ WCPQEQVL HP+VGGFLTH+GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WG
Sbjct  359   LIAGWCPQEQVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWG  418

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IGMEI N+V RDEVEK+V+ELME EKG++MK K ME KKLA EA  T P GSS  N++  
Sbjct  419   IGMEISNDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNL  476

Query  1452  INHLLL  1469
             +N +LL
Sbjct  477   VNQVLL  482



>ref|XP_010040276.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=554

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/475 (62%), Positives = 367/475 (77%), Gaps = 3/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAVCIP+PAQ HI+ ML LAK+LHH+GFH+TFVNTE+NH RL RS GP SL GLPSFR
Sbjct  4     KPHAVCIPFPAQSHISAMLNLAKLLHHRGFHVTFVNTEYNHNRLMRSRGPSSLDGLPSFR  63

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAV-SNAPPVSCIVSDG  407
             F TIPDGLP S  D TQDI SLC+ST   CL  F+DL+ RLN+ +V S +PPVSC+VSD 
Sbjct  64    FRTIPDGLPPSNGDVTQDILSLCQSTQKCCLPHFQDLIERLNEESVMSGSPPVSCVVSDS  123

Query  408   VMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELD  587
              M+FT+D AE + +PEV+FW  S C F+ Y  +  L+DKG  PLKD SYLTNGYL+T +D
Sbjct  124   SMTFTLDTAEAVSVPEVLFWPMSVCAFMAYAQFRSLIDKGLAPLKDVSYLTNGYLDTVID  183

Query  588   WVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  767
             W+ GM+ I LRDLPSF RTT+PD+ +L F L E  R +RASA++ NTF+ LEHE L AL+
Sbjct  184   WIPGMRNIHLRDLPSFFRTTDPDDPILNFCLVEFARVKRASALVFNTFEGLEHEVLDALK  243

Query  768   SMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITV  947
             +M P VY +GPL  L +Q+ D + R + S++WKED  CLEWLD K P  VVYVN+GSITV
Sbjct  244   AMFPTVYTIGPLHLLVEQLSDDDTRPIKSNMWKEDLGCLEWLDLKPPGLVVYVNFGSITV  303

Query  948   MTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVL  1127
             M+  QL EFAWGLA+S + FLW+IRPDLV G+AAILPP+F+  T++R +L SWCPQE+VL
Sbjct  304   MSQAQLVEFAWGLASSSQVFLWVIRPDLVVGDAAILPPDFLAATRERSLLVSWCPQERVL  363

Query  1128  GHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrd  1307
              HPAVGGF TH GWNST+ESI  GV ++CWPF  +QQT+C YS  +WGIGMEID++V RD
Sbjct  364   SHPAVGGFPTHCGWNSTIESIATGVLVVCWPFMGDQQTSCRYSYHEWGIGMEIDSDVKRD  423

Query  1308  evekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             E E+ VRELME E+G+EMKRK ME K++A EA  T P GSS +N+++ I+ +LLS
Sbjct  424   EGERQVRELMEGERGKEMKRKVMEWKEMAREA--THPSGSSFLNLDEVIDKVLLS  476



>ref|XP_009103241.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=488

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/480 (61%), Positives = 373/480 (78%), Gaps = 5/480 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPH   +PYPAQGHINPMLKLAK+LH KG H+TFVNT +NH RL RS GP +L GLPS
Sbjct  9     RQKPHVAFVPYPAQGHINPMLKLAKLLHAKGIHVTFVNTVYNHNRLLRSRGPNALDGLPS  68

Query  225   FRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             FRFETIPDGLP ++ DATQDI +LCEST   CL PF++LL R+N  A  + PPVSCI+SD
Sbjct  69    FRFETIPDGLPETDVDATQDITALCESTMKNCLAPFEELLWRIN--ARDDVPPVSCIISD  126

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
               MSFT+DAAE+L I  V+FW+TSACG + Y+H+   +++G  P+KDES+LT  YL+T +
Sbjct  127   DCMSFTLDAAEKLCIRHVLFWSTSACGLMAYLHFYHFIERGLCPVKDESFLTKEYLDTPI  186

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+  MK ++L+D+PSF+RTT+ D+ MLKF L E  RA+R SAIILNTFD LEH+ + ++
Sbjct  187   DWIPSMKNLKLKDVPSFIRTTDRDDIMLKFTLHEVERAKRTSAIILNTFDDLEHDVIRSI  246

Query  765   QSMLPPVYAVGPLQFLQKQVKDIN--VRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             Q +  PVY+VGPL  L  +V + +  V  + S+LWKE   CL WLDTKAP+SVVYVN+GS
Sbjct  247   QPIFSPVYSVGPLHLLDNRVIEDSGEVGRMGSNLWKEKIECLAWLDTKAPDSVVYVNFGS  306

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITV +  QL+EFA GLA S K FLW+IRPDLV GEAA++PPEF+ ET+DRGM++SWCPQE
Sbjct  307   ITVTSAKQLAEFALGLAGSGKEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWCPQE  366

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL HPAVGGFLTH GWNS LES+C GVPM+CWPFFAEQ TNC + C +WG+GMEI+ NV
Sbjct  367   KVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCEEWGVGMEINENV  426

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              R+E+E VV+ELM+ EKGR+M+ KA E ++LA +A ++   GSS +N E  ++ ++L  R
Sbjct  427   KREEIEAVVKELMDGEKGRKMREKAREWRRLAEKATES-KYGSSVINFETVVSKVVLRQR  485



>ref|XP_008229741.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=485

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 373/486 (77%), Gaps = 7/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS ++   K H VC+P PAQGHI   LK AK+LHH+G H+TFVNTEFNH R  +SLGP 
Sbjct  1     MGS-KAAAHKRHVVCVPAPAQGHIKANLKFAKLLHHRGVHVTFVNTEFNHNRFLKSLGPN  59

Query  204   SLRGLPSFRFETIPDGLPL-SEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNA-  377
             SL GLP FRFETIPDGLP  S+ DATQD+  + +S     L PF+DLL +L+D + SN+ 
Sbjct  60    SLDGLPDFRFETIPDGLPAGSDQDATQDVSLVADSIRNKLLAPFRDLLMKLDDRSTSNSD  119

Query  378   --PPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDES  551
               PPV+C+VSDG M FT  AAEE+G+P V+ +T +AC F+G   +  L++KG  PLKDES
Sbjct  120   INPPVTCVVSDGFMPFTTTAAEEIGVPVVLLFTIAACSFMGCKQFPALVEKGLAPLKDES  179

Query  552   YLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTF  731
              LTNG+L+  +DW+ GMKGIRLRDLP+  RTT+P++ +  F L+   R  +ASA++L+TF
Sbjct  180   CLTNGFLDKVIDWIPGMKGIRLRDLPTNFRTTDPNDILFNFALESIERVHKASAVVLHTF  239

Query  732   DALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPN  911
             DALE + L AL SMLP VYA+GP Q L  Q+ +  ++ +  SLWKE+T CLEWL +K PN
Sbjct  240   DALEPDVLNALSSMLPLVYAIGPDQLLLNQLPEDPLKHIGYSLWKEETECLEWLKSKTPN  299

Query  912   SVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRG  1091
             SVVYVN+GSI V+TP QL EF WGLANSK PF W+IRPDLV GE+AILPPEFV ETK+RG
Sbjct  300   SVVYVNFGSIAVLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERG  359

Query  1092  MLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWG  1271
             +++SWCPQEQVL  P+VGGFLTH GWNST+ES+C GVPMLCWPFFA+QQTNC+Y C +WG
Sbjct  360   LIASWCPQEQVLNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNEWG  419

Query  1272  IGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKF  1451
             IG+EI+N+V RD+VEK+V+ELME EKG++MK K ME KKLA EA  T P GSS  N++  
Sbjct  420   IGLEINNDVKRDQVEKLVKELMEGEKGKKMKNKVMEWKKLAEEA--TSPHGSSSTNLDNL  477

Query  1452  INHLLL  1469
             +N ++L
Sbjct  478   VNQVIL  483



>ref|XP_011087901.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=473

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/475 (60%), Positives = 376/475 (79%), Gaps = 4/475 (1%)
 Frame = +3

Query  51    KPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPSFR  230
             KPHAV IPYPAQGHI P+L+LAK+LH++GF ITFVNTEFNH RL R+ GPE+++GL  F+
Sbjct  2     KPHAVVIPYPAQGHIAPVLRLAKLLHYRGFFITFVNTEFNHNRLVRARGPEAVKGLDDFQ  61

Query  231   FETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  410
             F+TIPDGLP SE+DATQDIP L +S S  CL PF DL+  LND+   + P VSCIVSDGV
Sbjct  62    FKTIPDGLPPSESDATQDIPLLSQSMSKNCLAPFLDLINSLNDSP--DCPNVSCIVSDGV  119

Query  411   MSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETELDW  590
             MSFT+DAA+++ IPEV+F+TTSACGF+GY+HY +L+ +GY P KDES  TNGYL+TE+DW
Sbjct  120   MSFTLDAADKVNIPEVVFFTTSACGFMGYLHYGELVTRGYVPFKDESCFTNGYLDTEIDW  179

Query  591   VKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQS  770
             + GMKGIRLRD+P+F+RTT+P++ ML + + +   A RA AII NT+D LE E L A+++
Sbjct  180   IPGMKGIRLRDIPTFIRTTDPEDIMLNYNIVQHENASRARAIIFNTYDDLEDEVLEAIRA  239

Query  771   MLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGSITVM  950
                 VY +GPLQ L+ ++ +  + ++ S+LWKED  CL+WL+ +   SV+Y+N+GSIT +
Sbjct  240   KFDKVYTIGPLQLLENEIYERKLTSIGSNLWKEDVECLDWLEQREDASVLYINFGSITPL  299

Query  951   TPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQEQVLG  1130
             TPDQ+ EFAWGL++S + FLWIIRPDL+ G+ ++LP  F+EETK RG++  WCPQEQVLG
Sbjct  300   TPDQMVEFAWGLSSSNQNFLWIIRPDLINGKGSVLPEGFLEETKGRGLMVGWCPQEQVLG  359

Query  1131  HPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde  1310
             H AVGGFLTH GWNST+E+I +GVPM+CWPFFAEQQTNC Y+C KWG+G+EI+ +V R +
Sbjct  360   HRAVGGFLTHCGWNSTIETISSGVPMVCWPFFAEQQTNCRYACAKWGVGVEIEGDVTRGK  419

Query  1311  vekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  1475
             VEK+VR +ME EKG+EM++KA+E K  A  AA   P GSS  N+E  IN  LL++
Sbjct  420   VEKMVRVMMEGEKGKEMRKKALEWKDKARVAAK--PGGSSFTNLETLINATLLNN  472



>ref|XP_007042950.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98781.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=496

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 376/486 (77%), Gaps = 3/486 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             M    +  D PHAVCIPYPAQGHINPMLKLAK+LH KGFH+TFVNT++NH+RL RS GP 
Sbjct  1     MACNNAVADMPHAVCIPYPAQGHINPMLKLAKVLHLKGFHVTFVNTDYNHKRLLRSRGPN  60

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL GLP F FETIPDGLP S+ADATQDI  L ES S  CL PF+DLL +LND+A S  PP
Sbjct  61    SLDGLPDFCFETIPDGLPPSDADATQDILPLFESLSKNCLDPFRDLLYKLNDSASSIVPP  120

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI++D  MSF ++AAEE GIP V FWT SAC  + +    +L+++G TP+ +   LTN
Sbjct  121   VTCIIADDGMSFPMEAAEEFGIPGVRFWTASACLCVCFAQLPRLVEEGLTPVTNAGGLTN  180

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
              YL+T +DW+ GMK +R RDLPS+ RTT+P+++ML ++L +     +ASA I NTFD+LE
Sbjct  181   EYLDTVIDWMPGMKKMRFRDLPSYFRTTDPNDWMLNYLLDQASLDSKASAFIFNTFDSLE  240

Query  744   HEALMALQSM-LPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              +AL A+ +M L PVY++GP+  L  Q+    ++ + S+LWKE+T CL+WLDTK PNSVV
Sbjct  241   KDALDAISAMFLTPVYSIGPIHLLVDQIGHDKLKHIDSNLWKEETECLKWLDTKEPNSVV  300

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GS+ V++P QL EFAWGLANSKK FLWI+RPDLV GEAAILPPEFV ETKDRGML+
Sbjct  301   YVNFGSVAVLSPQQLVEFAWGLANSKKQFLWIMRPDLVAGEAAILPPEFVSETKDRGMLA  360

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQVL HP++GGFL+H GWNST+ESI  GVPMLC P  A+QQTNC  +CT+WGIGM
Sbjct  361   SWCPQEQVLKHPSIGGFLSHMGWNSTIESISAGVPMLCLPVLADQQTNCRLACTEWGIGM  420

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV RD+VE +VRELME +KG EMK  A+E KK A EA+   P G S  N++K +NH
Sbjct  421   EIDNNVKRDQVEMLVRELMEGDKGVEMKANALEWKKKAAEASR--PGGGSFENLDKLLNH  478

Query  1461  LLLSHR  1478
             +LLS +
Sbjct  479   VLLSDK  484



>emb|CDY62992.1| BnaC07g48400D [Brassica napus]
Length=488

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/480 (60%), Positives = 372/480 (78%), Gaps = 5/480 (1%)
 Frame = +3

Query  45    QDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGLPS  224
             + KPH   +PYPAQGHINPMLKLAK+LH KG  +TFVNT +NH RL RS GP +L GLPS
Sbjct  9     RQKPHVAFVPYPAQGHINPMLKLAKLLHAKGIQVTFVNTVYNHNRLLRSRGPNALDGLPS  68

Query  225   FRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSD  404
             FRFETIPDGLP ++ +ATQDI +LCEST   CL PF++LL R+N  A  + PPVSCI+SD
Sbjct  69    FRFETIPDGLPETDVEATQDITALCESTMKNCLAPFEELLWRIN--ARDDVPPVSCIISD  126

Query  405   GVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLETEL  584
               MSFT+DAAE+L IP V+FW+TSACG + Y+H+   ++KG  P+KDES+LT GYL+T +
Sbjct  127   DCMSFTLDAAEKLCIPHVLFWSTSACGLMAYLHFYHFIEKGLCPVKDESFLTKGYLDTAI  186

Query  585   DWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMAL  764
             DW+  MK ++L+D+PSF+RTT+ D+ MLKF L E  RA+R SAIILNTFD LEH+ + ++
Sbjct  187   DWIPSMKNLKLKDVPSFIRTTDRDDIMLKFTLHEVERAKRTSAIILNTFDDLEHDVIRSI  246

Query  765   QSMLPPVYAVGPLQFLQKQVKDIN--VRALASSLWKEDTSCLEWLDTKAPNSVVYVNYGS  938
             Q +  PVY++GPL  L  +V + +  V  + S+LWKE+  CL WLDTKAP+SVVYVN+GS
Sbjct  247   QPIFSPVYSIGPLHLLANRVIEDSGEVGRMGSNLWKEEIECLAWLDTKAPDSVVYVNFGS  306

Query  939   ITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCPQE  1118
             ITV +  QL+EFA GLA S + FLW+IRPDLV GEAA++PPEF+ ET+DRGM++SWCPQE
Sbjct  307   ITVTSGKQLAEFALGLAGSGEEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWCPQE  366

Query  1119  QVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnv  1298
             +VL HPAVGGFLTH GWNS LES+C GVPM+CWPFFAEQ TNC + C +WG+GMEI  NV
Sbjct  367   KVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEISENV  426

Query  1299  vrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  1478
              R+E+E VV+ELM+ E GR+M+ KA E ++LA +A +    GSS +N E  ++ ++L  R
Sbjct  427   KREEIETVVKELMDGENGRKMREKAREWRRLAEKATENT-YGSSVINFETVVSKVVLRQR  485



>ref|XP_002300186.1| hypothetical protein POPTR_0001s31950g [Populus trichocarpa]
 gb|EEE84991.1| hypothetical protein POPTR_0001s31950g [Populus trichocarpa]
Length=483

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 380/482 (79%), Gaps = 7/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGSL    DKPHAVC+P+PAQGHINPMLKLAK+LH KGFH+TFVNTE+NH+RL +S G  
Sbjct  1     MGSL-VPADKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHVTFVNTEYNHKRLLKSRGTN  59

Query  204   SLRGLPSFRFETIPDGLPLSE-ADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAP  380
             SL G P F+FETIPDGLP S+ ADATQD+PSLC+ TS T L P  DL+A+LN +     P
Sbjct  60    SLDGFPDFQFETIPDGLPSSDIADATQDVPSLCKYTSQTALAPLCDLIAKLNSSGA--VP  117

Query  381   PVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLT  560
              V+CIV+D  MSF++DAAEE GIPE +FWT SACG LGY  Y  L+++G  PLKD   LT
Sbjct  118   QVTCIVADACMSFSLDAAEEFGIPEAVFWTPSACGVLGYSQYRPLIERGLIPLKDARDLT  177

Query  561   NGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDAL  740
             NGYLET +DW+ GMK IRL+DLP+F+RTT+ ++ ML+F+ +E  R  RASA+ILNTFD+ 
Sbjct  178   NGYLETPVDWIPGMKDIRLKDLPTFIRTTDVNDVMLQFVKREIDRTSRASAVILNTFDSF  237

Query  741   EHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
             E + L AL  M PP+Y VGPLQ L  Q+ + +++ + S+LWKE   C+EWLD+K P SVV
Sbjct  238   EQDVLDALSPMFPPIYTVGPLQLLVDQIPNGDLKNIGSNLWKEQPECIEWLDSKEPKSVV  297

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV+TP Q+ EFAWGLANS + FLWIIRPD+V GEAA+LPPEF+ ETKDRGML 
Sbjct  298   YVNFGSITVITPQQMIEFAWGLANSNQTFLWIIRPDIVLGEAAMLPPEFLSETKDRGMLV  357

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT-KWGIG  1277
             SWCPQEQVL HP++GGFL+H GWNSTL+SIC GVPM+CWPFFAEQQTNC  +CT +WGIG
Sbjct  358   SWCPQEQVLKHPSIGGFLSHMGWNSTLDSICGGVPMVCWPFFAEQQTNCRLACTDQWGIG  417

Query  1278  MEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  1457
             MEIDNNV R+EVEK+VRELME EKG+ MK+KAME K  A EAA  +    SH N+++ + 
Sbjct  418   MEIDNNVKRNEVEKLVRELMEGEKGKAMKKKAMEWKTKAEEAA--LAGNGSHRNLDQLVK  475

Query  1458  HL  1463
              L
Sbjct  476   AL  477



>ref|XP_008789350.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 372/482 (77%), Gaps = 5/482 (1%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+  +  +PHAV +PYPAQGH+ P+LKLAK+LH +GF+ITFVNT FN  RL RS    
Sbjct  1     MGSMVPQ--RPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL  LP FRFE+I DGLP ++ DATQD+PSLC+S    C+ PF+DL+  LND + S  P 
Sbjct  59    SLDSLPDFRFESIRDGLPPTDKDATQDVPSLCDSIPKNCIAPFRDLIKELNDPS-SPTPT  117

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             VS IVSDGVMSFT+D A+EL IPEV+FWT SACG++GY+HY  L+++G  PLKD S LTN
Sbjct  118   VSRIVSDGVMSFTLDVAKELQIPEVLFWTPSACGYMGYLHYQHLMERGIVPLKDASDLTN  177

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ GMK +RLRDLP+FLRT +  + M  F  +   R+  ASAIILNTFD LE
Sbjct  178   GYLETPIDWISGMKNVRLRDLPTFLRTVDSKDIMFHFCNRAAQRSSMASAIILNTFDELE  237

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQVKDINVRALASSLWKEDTSCLEWLDTKAPNSVVY  923
                L A+ SMLPP+Y +GPL  L +Q+    + +++S+LWKED +CLEWL  + P SVVY
Sbjct  238   RPVLDAMASMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVY  297

Query  924   VNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSS  1103
             VNYGSITVMT +QL EFAWGLANSK  F W+IRPDLV G++A+LP EF+ ETK+RG+L+S
Sbjct  298   VNYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLAS  357

Query  1104  WCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGME  1283
             WCPQE VL HP++G FLTH+GWNSTLESIC GVP + WPFFAEQQTNC Y+CT+WGIGME
Sbjct  358   WCPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGME  417

Query  1284  IdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  1463
             ID+NV R+EVE++VRELME EKG+EM+R+A+E K+ A+ A  T P GSS  N ++ +   
Sbjct  418   IDSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAIRA--TQPGGSSFQNFDRLVKEA  475

Query  1464  LL  1469
             LL
Sbjct  476   LL  477



>ref|XP_010459994.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Camelina sativa]
Length=513

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/493 (60%), Positives = 380/493 (77%), Gaps = 6/493 (1%)
 Frame = +3

Query  9     EREREMGS-LRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQ  185
             E  ++MGS +     KPH VC+PYPAQGHINPM+K+AK+LH +GFH+TFVNT +NH R  
Sbjct  21    EVRKKMGSHVALNAQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFL  80

Query  186   RSLGPESLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTA  365
             RS G  +L GL SFRFE+IPDGLP ++ D TQDI +LCEST   CL PF++LL R+N  A
Sbjct  81    RSHGSIALDGLHSFRFESIPDGLPETDMDTTQDITALCESTMKNCLVPFQELLQRIN--A  138

Query  366   VSNAPPVSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKD  545
               + PPVSCIVSDGVMSFT+DAAEELG+PEV+FWTTS C FL Y+H+   ++KG TPLKD
Sbjct  139   RDDVPPVSCIVSDGVMSFTLDAAEELGVPEVLFWTTSGCAFLTYLHFYLFIEKGITPLKD  198

Query  546   ESYLTNGYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILN  725
             ESYLT  +L+  +D++  M  ++L+D+PSF+RTT+PD++MLKF  +ET R++RASAIILN
Sbjct  199   ESYLTKEHLDMVIDFIPTMTNLKLKDIPSFVRTTDPDDFMLKFACRETERSKRASAIILN  258

Query  726   TFDALEHEALMALQSMLPPVYAVGPLQFLQKQVKDINVRA--LASSLWKEDTSCLEWLDT  899
             TFD LEH  + A+QS+LPPVYAVGPL  L  +  +    A  + SSLWKE+  CLEWLDT
Sbjct  259   TFDDLEHGVIQAMQSLLPPVYAVGPLHLLANREIEEGSEAGMMNSSLWKEEMECLEWLDT  318

Query  900   KAPNSVVYVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEET  1079
             K  NSV+Y+N+GSITV++ +QL EFAWGLA S K FLW+IRPDLV GE A++PPEF+ ET
Sbjct  319   KPQNSVIYINFGSITVLSAEQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLTET  378

Query  1080  KDRGMLSSWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSC  1259
              DR +L+ WCPQE+VL HPAVGGFLTH GWNS LES+  GVPM+CWPFFA+QQ NC + C
Sbjct  379   ADRRLLAGWCPQEKVLSHPAVGGFLTHCGWNSILESLSCGVPMVCWPFFADQQINCKFCC  438

Query  1260  TKWGIGMEIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVN  1439
              +WG+G+E   +V RDEVE VVRE+M+ +KG++M+ KA+E ++LA EA +   +GSS VN
Sbjct  439   DEWGVGIETGGDVKRDEVEAVVREVMDGDKGKKMREKAVEWQRLAEEATEH-KLGSSIVN  497

Query  1440  IEKFINHLLLSHR  1478
              E  ++  LL  +
Sbjct  498   FETVVSKFLLGQK  510



>ref|XP_006416204.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
 gb|ESQ34557.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
Length=487

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/482 (59%), Positives = 378/482 (78%), Gaps = 10/482 (2%)
 Frame = +3

Query  39    SEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPESLRGL  218
             S   KPHAVC+P+PAQGHINPM+K+AK+LH KGFH+TFVNT +N  RL RS G ++L G 
Sbjct  7     SSGQKPHAVCVPFPAQGHINPMMKVAKLLHAKGFHVTFVNTVYNQNRLIRSRGQKALDGF  66

Query  219   PSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  398
             PSFRF++IPDGLP  + D  QD+PSLCEST   CL PFK+L+ R+N     + PPVSCIV
Sbjct  67    PSFRFKSIPDGLPEIDGDKMQDVPSLCESTMKNCLTPFKELIRRIN--VEDDVPPVSCIV  124

Query  399   SDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTNGYLET  578
             +DG+M+FT+D AEELG+PEV+FWTTSACGF+ Y+H+ + +++G +PLKDES L     +T
Sbjct  125   ADGLMTFTLDVAEELGVPEVLFWTTSACGFMAYLHFYRFIEEGLSPLKDESDL-----DT  179

Query  579   ELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALM  758
             ++DW+  MK +RL+D+PSF+RTTNP + ML F L E  RA+RASAIILNTFD LEH+ + 
Sbjct  180   KIDWIPSMKNLRLKDIPSFIRTTNPKDIMLNFFLHEVDRAKRASAIILNTFDDLEHDIIQ  239

Query  759   ALQSMLPPVYAVGPLQFL-QKQVKDIN-VRALASSLWKEDTSCLEWLDTKAPNSVVYVNY  932
             ++QS+LPPVY++GPL  L  +++ D N +R + ++LW+E+T CL+WLDTK  NSVVYVN+
Sbjct  240   SMQSILPPVYSIGPLHLLVNRELDDDNEIRRMETNLWREETKCLDWLDTKPRNSVVYVNF  299

Query  933   GSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLSSWCP  1112
             GSITVM+  QL EFAWGLA + K FLW+IRPDLV G+ A++P EF+ ET DR ML+SWCP
Sbjct  300   GSITVMSAKQLVEFAWGLAATGKDFLWVIRPDLVAGDVAVVPAEFLTETADRRMLASWCP  359

Query  1113  QEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdn  1292
             QE+VL HPA+G FLTH+GWNSTLES+C GVPM+CWP+FAEQQTNC + C +W +GMEI  
Sbjct  360   QEKVLSHPAIGVFLTHSGWNSTLESLCGGVPMVCWPYFAEQQTNCKFCCDEWEVGMEIGG  419

Query  1293  nvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  1472
             +V R+E+EKV+RELM+ EKG+ M+ KA E ++LA E A     GSS +N +  ++ +LL+
Sbjct  420   DVKREEIEKVIRELMDGEKGKRMREKAEEWRRLA-EKATAQKDGSSELNFQMVVDKVLLA  478

Query  1473  HR  1478
              +
Sbjct  479   SK  480



>gb|KDP40911.1| hypothetical protein JCGZ_24910 [Jatropha curcas]
Length=487

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/490 (64%), Positives = 387/490 (79%), Gaps = 8/490 (2%)
 Frame = +3

Query  24    MGSLRSEQDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLQRSLGPE  203
             MGS+ +   K H VC+PYPAQGH+NPM KLAK+LH  GFHITFVNTE+NHRRL +S GP 
Sbjct  1     MGSI-ARDTKLHVVCVPYPAQGHVNPMFKLAKLLHFNGFHITFVNTEYNHRRLLKSRGPN  59

Query  204   SLRGLPSFRFETIPDGLPLSEADATQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  383
             SL G   F FETI DGLP S+ADATQDIPSLC+STS   L PF +LL+ L  ++ SN PP
Sbjct  60    SLDGFQDFHFETISDGLPASDADATQDIPSLCDSTSKHSLIPFCNLLSSLG-SSSSNLPP  118

Query  384   VSCIVSDGVMSFTVDAAEELGIPEVMFWTTSACGFLGYMHYSQLLDKGYTPLKDESYLTN  563
             V+CI+SD  MSFT+DAA+E GIP+V+FWT S+CG LGY  Y  L+++G TPLKD SYLTN
Sbjct  119   VTCIISDACMSFTLDAAQEFGIPQVLFWTPSSCGVLGYSQYCHLIERGLTPLKDASYLTN  178

Query  564   GYLETELDWVKGMKGIRLRDLPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  743
             GYLET +DW+ GMK IRL+DLPSF+RTT+  + ML F+++E  R  RA A+ILNTFDA E
Sbjct  179   GYLETTIDWIPGMKNIRLKDLPSFIRTTDKKDIMLNFLVREIERTTRACAVILNTFDAFE  238

Query  744   HEALMALQSMLPPVYAVGPLQFLQKQV-KDINVRALASSLWKEDTSCLEWLDTKAPNSVV  920
              + L  L +M PP+Y +GPLQ L +Q+    +++ L S+LWKE   C+EWLD+   N+VV
Sbjct  239   QDVLDILSTMFPPIYTIGPLQLLVEQIPSSSSLKNLGSNLWKEQPECIEWLDSNEENAVV  298

Query  921   YVNYGSITVMTPDQLSEFAWGLANSKKPFLWIIRPDLVTGEAAILPPEFVEETKDRGMLS  1100
             YVN+GSITV+TP Q+ EFAWGLANSKKPFLWIIRPDLV G+ A+LPPEFV ETK+RGML+
Sbjct  299   YVNFGSITVITPQQMIEFAWGLANSKKPFLWIIRPDLVVGDKAMLPPEFVSETKERGMLA  358

Query  1101  SWCPQEQVLGHPAVGGFLTHNGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGM  1280
             SWCPQEQ+L HP++GGFL+H GWNSTL+S+C  VPM+CWPFFAEQQTNCW++C KWG+GM
Sbjct  359   SWCPQEQILKHPSIGGFLSHMGWNSTLDSMCGCVPMVCWPFFAEQQTNCWFACNKWGVGM  418

Query  1281  EIdnnvvrdevekvvrELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  1460
             EIDNNV R+EVEK+VRELM+ +KG+EMK+KA+E K  A EA  T P GSS  N ++F+  
Sbjct  419   EIDNNVKREEVEKLVRELMDGKKGKEMKKKAIEWKSKAEEA--TGPGGSSRRNFDEFVGF  476

Query  1461  LL---LSHRK  1481
             LL   LS +K
Sbjct  477   LLNNQLSRKK  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4991792167216