BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25317_g1_i2 len=1771 path=[1:0-214 4412:215-237 239:238-371
4988:372-479 487:480-586 3620:587-717 725:718-792 800:793-828
836:829-859 4218:860-862 870:863-929 937:930-947 955:948-1061
4036:1062-1075 1083:1076-1103 4962:1104-1106 1114:1107-1162
5320:1163-1209 1217:1210-1251 1259:1252-1329 1337:1330-1332
1340:1333-1403 1411:1404-1470 1478:1471-1505 3774:1506-1565
1541:1566-1601 4305:1602-1639 1614:1640-1770]

Length=1771
                                                                      Score     E

ref|XP_006353629.1|  PREDICTED: cytochrome P450 716B2-like              608   0.0      
emb|CDP18172.1|  unnamed protein product                                599   0.0      
ref|XP_004241821.1|  PREDICTED: beta-amyrin 28-oxidase-like             598   0.0      
ref|XP_006353706.1|  PREDICTED: cytochrome P450 716B2-like              589   0.0      
gb|EYU22847.1|  hypothetical protein MIMGU_mgv1a022104mg                585   0.0      
ref|XP_004242231.1|  PREDICTED: beta-amyrin 28-oxidase-like             584   0.0      
ref|XP_011099144.1|  PREDICTED: beta-amyrin 28-oxidase-like             580   0.0      
ref|XP_009620720.1|  PREDICTED: beta-amyrin 28-oxidase-like             580   0.0      
ref|XP_009768074.1|  PREDICTED: beta-amyrin 28-oxidase-like             579   0.0      
ref|XP_009768075.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       573   0.0      
ref|XP_009601238.1|  PREDICTED: beta-amyrin 28-oxidase-like             563   0.0      
emb|CDP10718.1|  unnamed protein product                                558   0.0      
emb|CDP10717.1|  unnamed protein product                                554   0.0      
ref|XP_010056285.1|  PREDICTED: beta-amyrin 28-oxidase-like             538   0.0      
ref|XP_010056287.1|  PREDICTED: beta-amyrin 28-oxidase-like             529   1e-179   
ref|XP_010070480.1|  PREDICTED: beta-amyrin 28-oxidase-like             527   8e-179   
ref|XP_010063751.1|  PREDICTED: beta-amyrin 28-oxidase-like             526   1e-178   
gb|EYU22845.1|  hypothetical protein MIMGU_mgv1a021193mg                521   1e-176   
ref|XP_006376223.1|  hypothetical protein POPTR_0013s11080g             512   4e-173   
gb|KCW72951.1|  hypothetical protein EUGRSUZ_E01403                     505   9e-171   
ref|XP_002279623.1|  PREDICTED: beta-amyrin 28-oxidase                  504   3e-170   Vitis vinifera
ref|XP_002521782.1|  cytochrome P450, putative                          504   4e-170   Ricinus communis
ref|XP_002278948.1|  PREDICTED: beta-amyrin 28-oxidase                  504   6e-170   Vitis vinifera
ref|XP_002319920.2|  hypothetical protein POPTR_0013s11090g             504   1e-169   Populus trichocarpa [western balsam poplar]
ref|XP_011001074.1|  PREDICTED: beta-amyrin 28-oxidase-like             502   8e-169   
ref|XP_011003986.1|  PREDICTED: beta-amyrin 28-oxidase-like             501   1e-168   
ref|XP_010252185.1|  PREDICTED: beta-amyrin 28-oxidase-like             501   1e-168   
ref|XP_011001073.1|  PREDICTED: beta-amyrin 28-oxidase-like             501   2e-168   
ref|XP_007023618.1|  Cytochrome P450                                    500   2e-168   
ref|XP_010669702.1|  PREDICTED: beta-amyrin 28-oxidase-like             496   5e-167   
ref|XP_007023620.1|  Cytochrome P450                                    496   7e-167   
ref|XP_002325975.1|  hypothetical protein POPTR_0019s10970g             496   7e-167   Populus trichocarpa [western balsam poplar]
ref|XP_002526799.1|  cytochrome P450, putative                          495   2e-166   Ricinus communis
ref|XP_011074929.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    493   2e-166   
ref|XP_007014637.1|  Cytochrome P450                                    495   2e-166   
ref|XP_002279608.1|  PREDICTED: beta-amyrin 28-oxidase                  493   1e-165   Vitis vinifera
ref|XP_010048517.1|  PREDICTED: beta-amyrin 28-oxidase-like             493   2e-165   
ref|NP_001268115.1|  cytochrome P450 CYP716A15                          491   4e-165   
ref|XP_002513183.1|  cytochrome P450, putative                          490   2e-164   Ricinus communis
ref|XP_002528002.1|  cytochrome P450, putative                          488   5e-164   Ricinus communis
ref|XP_010696134.1|  PREDICTED: beta-amyrin 28-oxidase-like             488   8e-164   
ref|XP_006338129.1|  PREDICTED: cytochrome P450 716B2-like              488   1e-163   
gb|AGN04219.1|  cytochrome P450                                         488   1e-163   
ref|XP_011078182.1|  PREDICTED: beta-amyrin 28-oxidase-like             488   2e-163   
ref|XP_002266024.1|  PREDICTED: beta-amyrin 28-oxidase                  487   2e-163   Vitis vinifera
ref|XP_011031513.1|  PREDICTED: beta-amyrin 28-oxidase-like             486   4e-163   
ref|XP_007011469.1|  Cytochrome P450                                    487   4e-163   
gb|AHL46848.1|  cytochrome P450                                         486   8e-163   
gb|KDP42281.1|  hypothetical protein JCGZ_01605                         486   8e-163   
emb|CAN72302.1|  hypothetical protein VITISV_041935                     485   2e-162   Vitis vinifera
ref|NP_001268076.1|  cytochrome P450 CYP716A17                          485   2e-162   
ref|XP_003530525.1|  PREDICTED: cytochrome P450 716B2                   484   3e-162   
ref|XP_004239296.1|  PREDICTED: beta-amyrin 28-oxidase                  483   6e-162   
ref|XP_002325964.2|  hypothetical protein POPTR_0019s10730g             483   9e-162   Populus trichocarpa [western balsam poplar]
ref|XP_007222742.1|  hypothetical protein PRUPE_ppa004988mg             483   1e-161   
ref|XP_010058451.1|  PREDICTED: beta-amyrin 28-oxidase-like             483   1e-161   
ref|XP_011093941.1|  PREDICTED: beta-amyrin 28-oxidase-like             483   1e-161   
emb|CBI39273.3|  unnamed protein product                                498   1e-161   
dbj|BAP59951.1|  cytochrome P450 monooxygenase CYP716A50                483   1e-161   
ref|XP_009345334.1|  PREDICTED: beta-amyrin 28-oxidase-like             483   1e-161   
ref|XP_008224572.1|  PREDICTED: beta-amyrin 28-oxidase-like             482   3e-161   
ref|XP_006372247.1|  cytochrome P450 family protein                     481   4e-161   
ref|XP_010048515.1|  PREDICTED: beta-amyrin 28-oxidase-like             481   4e-161   
ref|XP_009609682.1|  PREDICTED: beta-amyrin 28-oxidase-like             481   5e-161   
gb|AJD25248.1|  cytochrome P450 CYP716A89                               481   6e-161   
ref|XP_003525322.1|  PREDICTED: cytochrome P450 716B2-like              481   7e-161   
ref|XP_007160209.1|  hypothetical protein PHAVU_002G302100g             481   8e-161   
ref|XP_009759030.1|  PREDICTED: beta-amyrin 28-oxidase-like             481   8e-161   
ref|XP_004243906.1|  PREDICTED: beta-amyrin 28-oxidase-like             480   1e-160   
ref|XP_011031249.1|  PREDICTED: beta-amyrin 28-oxidase-like             480   2e-160   
ref|XP_010245748.1|  PREDICTED: beta-amyrin 28-oxidase-like             479   2e-160   
ref|XP_008391096.1|  PREDICTED: beta-amyrin 28-oxidase                  479   2e-160   
ref|XP_009787233.1|  PREDICTED: beta-amyrin 28-oxidase-like             478   7e-160   
ref|XP_007020143.1|  Cytochrome P450                                    478   7e-160   
ref|XP_007020151.1|  Cytochrome P450                                    478   8e-160   
ref|XP_007020144.1|  Cytochrome P450                                    478   9e-160   
ref|XP_011017588.1|  PREDICTED: beta-amyrin 28-oxidase-like             477   2e-159   
ref|XP_010252179.1|  PREDICTED: beta-amyrin 28-oxidase-like             477   3e-159   
gb|AIT93302.1|  cytochrome P450 monooxygenase CYP716A12                 476   5e-159   
ref|XP_009376339.1|  PREDICTED: beta-amyrin 28-oxidase-like             476   5e-159   
gb|ABC59076.1|  cytochrome P450 monooxygenase CYP716A12                 476   5e-159   Medicago truncatula
ref|XP_010046875.1|  PREDICTED: beta-amyrin 28-oxidase-like             476   6e-159   
ref|XP_009591188.1|  PREDICTED: beta-amyrin 28-oxidase-like             475   1e-158   
emb|CBN88268.1|  cytochrome P450 monoxygenase                           474   2e-158   
ref|XP_002263499.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       474   3e-158   Vitis vinifera
emb|CBI39948.3|  unnamed protein product                                474   3e-158   
ref|XP_002522937.1|  cytochrome P450, putative                          474   4e-158   Ricinus communis
sp|I7C6E8.1|C7A52_PANGI  RecName: Full=Beta-amyrin 28-oxidase; Al...    473   5e-158   
ref|XP_002280969.1|  PREDICTED: beta-amyrin 28-oxidase                  473   6e-158   Vitis vinifera
gb|AFK47215.1|  unknown                                                 473   6e-158   
gb|EYU25770.1|  hypothetical protein MIMGU_mgv1a005482mg                473   9e-158   
ref|XP_011019870.1|  PREDICTED: beta-amyrin 28-oxidase-like             473   1e-157   
gb|KCW72928.1|  hypothetical protein EUGRSUZ_E01367                     472   1e-157   
gb|EYU26567.1|  hypothetical protein MIMGU_mgv1a005379mg                473   1e-157   
gb|ACJ84447.1|  unknown                                                 472   1e-157   Medicago truncatula
ref|XP_006353745.1|  PREDICTED: cytochrome P450 716B2-like              472   2e-157   
gb|AED99868.1|  cytochrome P450                                         472   3e-157   
ref|XP_003531849.1|  PREDICTED: cytochrome P450 716B2 isoform X1        472   3e-157   
ref|XP_002264643.3|  PREDICTED: beta-amyrin 28-oxidase-like             472   4e-157   Vitis vinifera
gb|AEX07772.1|  cytochrome P450                                         471   5e-157   
ref|XP_002309057.1|  hypothetical protein POPTR_0006s08560g             471   5e-157   Populus trichocarpa [western balsam poplar]
emb|CBI39253.3|  unnamed protein product                                470   7e-157   
emb|CDP14237.1|  unnamed protein product                                470   1e-156   
ref|XP_002279472.1|  PREDICTED: beta-amyrin 28-oxidase                  470   1e-156   Vitis vinifera
ref|XP_010095208.1|  Cytochrome P450                                    469   4e-156   
gb|AHF22088.1|  CYP716A75                                               468   6e-156   
dbj|BAP59949.1|  cytochrome P450 monooxygenase CYP716A48                468   6e-156   
ref|XP_006353795.1|  PREDICTED: cytochrome P450 716B2-like              468   8e-156   
ref|XP_004503562.1|  PREDICTED: cytochrome P450 716B2-like              466   4e-155   
gb|KDO67048.1|  hypothetical protein CISIN_1g037867mg                   466   5e-155   
ref|XP_006488697.1|  PREDICTED: cytochrome P450 716B2-like              468   6e-155   
gb|KHN16705.1|  Cytochrome P450 716B2                                   465   9e-155   
gb|EYU26566.1|  hypothetical protein MIMGU_mgv1a021994mg                465   9e-155   
ref|XP_006425177.1|  hypothetical protein CICLE_v10030148mg             465   2e-154   
ref|XP_004296643.1|  PREDICTED: cytochrome P450 716B1-like              464   5e-154   
ref|XP_009778451.1|  PREDICTED: beta-amyrin 28-oxidase-like             463   7e-154   
emb|CAN67939.1|  hypothetical protein VITISV_013692                     461   3e-153   Vitis vinifera
dbj|BAP59952.1|  cytochrome P450 monooxygenase CYP716A51                461   5e-153   
emb|CBI39268.3|  unnamed protein product                                461   7e-153   
emb|CDP19704.1|  unnamed protein product                                457   2e-151   
ref|XP_007139495.1|  hypothetical protein PHAVU_008G034400g             456   4e-151   
ref|XP_011017728.1|  PREDICTED: beta-amyrin 28-oxidase-like             456   5e-151   
ref|XP_002324669.1|  hypothetical protein POPTR_0018s13390g             454   3e-150   Populus trichocarpa [western balsam poplar]
gb|AFK79029.1|  cytochrome P450 CYP716A41                               453   5e-150   
emb|CBI39252.3|  unnamed protein product                                455   9e-150   
gb|KCW72929.1|  hypothetical protein EUGRSUZ_E01368                     450   2e-149   
ref|XP_004296583.1|  PREDICTED: cytochrome P450 716B1-like              451   3e-149   
gb|KDP43440.1|  hypothetical protein JCGZ_16727                         449   6e-149   
gb|ACU20818.1|  unknown                                                 449   8e-149   Glycine max [soybeans]
gb|AHF22083.1|  CYP716A14v2                                             449   1e-148   
emb|CBI24045.3|  unnamed protein product                                447   1e-148   
sp|I7CT85.1|C7A53_PANGI  RecName: Full=Protopanaxadiol 6-hydroxyl...    448   4e-148   
gb|AHK23636.1|  cytochrome P450                                         447   9e-148   
gb|KHM99864.1|  Cytochrome P450 716B2                                   444   1e-147   
gb|AED99872.1|  cytochrome P450                                         446   3e-147   
ref|XP_004139087.1|  PREDICTED: cytochrome P450 716B1-like              446   4e-147   
gb|ABC94483.1|  putative taxadiene 5-alpha-hydroxylase cytochrome...    445   5e-147   Artemisia annua [sweet Annie]
ref|XP_008443638.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       444   3e-146   
ref|XP_002279492.2|  PREDICTED: beta-amyrin 28-oxidase                  442   3e-146   Vitis vinifera
gb|EYU25767.1|  hypothetical protein MIMGU_mgv1a025883mg                442   7e-146   
gb|EYU25763.1|  hypothetical protein MIMGU_mgv1a024885mg                441   2e-145   
gb|EYU26851.1|  hypothetical protein MIMGU_mgv1a005213mg                440   1e-144   
gb|AGC31652.1|  cytochrome P450 CYP6H                                   438   2e-144   
ref|XP_010533078.1|  PREDICTED: beta-amyrin 28-oxidase-like             437   4e-144   
gb|KDP42282.1|  hypothetical protein JCGZ_01606                         436   9e-144   
ref|XP_010661150.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       436   1e-143   
gb|EYU38301.1|  hypothetical protein MIMGU_mgv1a005334mg                437   1e-143   
gb|EYU38302.1|  hypothetical protein MIMGU_mgv1a006499mg                434   4e-143   
emb|CDP12479.1|  unnamed protein product                                434   9e-143   
gb|EYU26852.1|  hypothetical protein MIMGU_mgv1a005293mg                434   1e-142   
gb|AHA50080.1|  cytochrome P450                                         433   2e-142   
gb|EYU25766.1|  hypothetical protein MIMGU_mgv1a005367mg                432   9e-142   
gb|EYU38303.1|  hypothetical protein MIMGU_mgv1a025102mg                429   2e-141   
emb|CAN63680.1|  hypothetical protein VITISV_036273                     430   4e-141   Vitis vinifera
emb|CBI39267.3|  unnamed protein product                                430   5e-141   
ref|XP_008340177.1|  PREDICTED: beta-amyrin 28-oxidase-like             429   1e-140   
gb|AEY75213.1|  cytochrome P450 CYP716A47                               429   1e-140   
gb|AFU93031.1|  cytochrome P450                                         429   1e-140   
emb|CDP19705.1|  unnamed protein product                                429   1e-140   
sp|H2DH16.2|C7A47_PANGI  RecName: Full=Dammarenediol 12-hydroxyla...    429   1e-140   
emb|CDP04721.1|  unnamed protein product                                427   5e-140   
gb|EPS63621.1|  hypothetical protein M569_11161                         427   8e-140   
gb|AED99867.1|  cytochrome P450                                         426   3e-139   
gb|AIN44011.1|  cytochrome P450                                         426   3e-139   
ref|XP_002325238.1|  hypothetical protein POPTR_0018s13420g             425   4e-139   Populus trichocarpa [western balsam poplar]
emb|CBI24076.3|  unnamed protein product                                425   1e-138   
ref|XP_002325242.2|  hypothetical protein POPTR_0018s13490g             423   2e-138   Populus trichocarpa [western balsam poplar]
gb|EYU26126.1|  hypothetical protein MIMGU_mgv1a017761mg                422   2e-138   
ref|XP_011074924.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    414   2e-137   
ref|XP_006372166.1|  hypothetical protein POPTR_0018s13380g             414   7e-136   
ref|XP_004308257.1|  PREDICTED: cytochrome P450 716B1-like              417   1e-135   
ref|XP_007139496.1|  hypothetical protein PHAVU_008G034500g             416   2e-135   
ref|XP_008227229.1|  PREDICTED: beta-amyrin 28-oxidase-like             416   4e-135   
ref|XP_010098502.1|  Cytochrome P450                                    412   3e-134   
gb|KFK23969.1|  hypothetical protein AALP_AAs58682U000100               412   4e-134   
gb|KDP33425.1|  hypothetical protein JCGZ_06996                         412   5e-134   
ref|XP_011048169.1|  PREDICTED: beta-amyrin 28-oxidase-like             411   7e-134   
ref|XP_002324668.2|  hypothetical protein POPTR_0018s13380g             408   1e-133   Populus trichocarpa [western balsam poplar]
ref|XP_002527982.1|  cytochrome P450, putative                          410   2e-133   Ricinus communis
ref|XP_011017724.1|  PREDICTED: beta-amyrin 28-oxidase-like             408   1e-132   
ref|XP_008385453.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    407   7e-132   
emb|CDO98601.1|  unnamed protein product                                405   2e-131   
ref|XP_009337414.1|  PREDICTED: beta-amyrin 28-oxidase-like             407   2e-131   
ref|XP_007206798.1|  hypothetical protein PRUPE_ppa025666mg             406   3e-131   
ref|XP_008227237.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    405   4e-131   
ref|XP_011048168.1|  PREDICTED: beta-amyrin 28-oxidase-like             403   2e-130   
ref|XP_009758679.1|  PREDICTED: beta-amyrin 28-oxidase-like             402   2e-130   
emb|CDP14240.1|  unnamed protein product                                397   3e-130   
gb|KCW87056.1|  hypothetical protein EUGRSUZ_B03598                     402   6e-130   
ref|XP_010052577.1|  PREDICTED: beta-amyrin 28-oxidase-like             401   6e-130   
ref|XP_003532790.1|  PREDICTED: cytochrome P450 716B2-like              401   7e-130   
ref|XP_008385452.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    402   9e-130   
ref|XP_010044931.1|  PREDICTED: beta-amyrin 28-oxidase-like             402   9e-130   
ref|XP_009364167.1|  PREDICTED: beta-amyrin 28-oxidase-like             399   1e-129   
gb|KDP42301.1|  hypothetical protein JCGZ_01625                         396   1e-129   
ref|XP_002299097.1|  hypothetical protein POPTR_0001s04010g             400   2e-129   Populus trichocarpa [western balsam poplar]
ref|XP_006405735.1|  hypothetical protein EUTSA_v10027740mg             400   2e-129   
ref|XP_003531282.1|  PREDICTED: cytochrome P450 716B2-like isoformX1    400   2e-129   
ref|XP_007159554.1|  hypothetical protein PHAVU_002G247300g             400   2e-129   
ref|XP_004504209.1|  PREDICTED: cytochrome P450 716B1-like              399   4e-129   
ref|XP_006852240.1|  hypothetical protein AMTR_s00049p00153870          399   4e-129   
ref|XP_004293194.1|  PREDICTED: cytochrome P450 716B1-like              400   5e-129   
ref|XP_004299475.1|  PREDICTED: cytochrome P450 716B2-like              400   8e-129   
ref|XP_009617496.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    399   8e-129   
ref|XP_009598096.1|  PREDICTED: beta-amyrin 28-oxidase-like             398   1e-128   
ref|XP_007213882.1|  hypothetical protein PRUPE_ppa005225mg             397   2e-128   
ref|XP_010044930.1|  PREDICTED: cytochrome P450 716B1-like              397   2e-128   
emb|CDP19706.1|  unnamed protein product                                397   2e-128   
ref|XP_011085174.1|  PREDICTED: beta-amyrin 28-oxidase-like             397   3e-128   
ref|XP_002317072.2|  hypothetical protein POPTR_0011s15910g             397   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011089169.1|  PREDICTED: beta-amyrin 28-oxidase-like             397   4e-128   
ref|XP_004306884.1|  PREDICTED: cytochrome P450 716B1-like              397   4e-128   
ref|XP_011040561.1|  PREDICTED: beta-amyrin 28-oxidase-like             397   5e-128   
ref|XP_003633047.1|  PREDICTED: beta-amyrin 28-oxidase-like             396   5e-128   
ref|XP_004293684.1|  PREDICTED: cytochrome P450 716B2-like              396   8e-128   
sp|Q50EK0.1|C16B2_PICSI  RecName: Full=Cytochrome P450 716B2; Alt...    397   8e-128   Picea sitchensis
ref|XP_008358591.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    396   9e-128   
gb|KHG26601.1|  Cytochrome P450 protein                                 395   1e-127   
ref|XP_010060835.1|  PREDICTED: beta-amyrin 28-oxidase-like             395   2e-127   
ref|XP_008358589.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    395   2e-127   
ref|XP_006370477.1|  hypothetical protein POPTR_0001s43070g             395   2e-127   
ref|XP_002868459.1|  CYP716A1                                           394   4e-127   
ref|XP_004295460.1|  PREDICTED: cytochrome P450 716B1-like              394   5e-127   
ref|XP_007022977.1|  Cytochrome P450 716B1                              396   9e-127   
ref|XP_008349137.1|  PREDICTED: beta-amyrin 28-oxidase-like             393   9e-127   
ref|XP_002529893.1|  cytochrome P450, putative                          393   1e-126   Ricinus communis
gb|AHF49536.1|  CYP450 716-like protein                                 393   1e-126   
emb|CBI20810.3|  unnamed protein product                                390   2e-126   
ref|XP_003524231.1|  PREDICTED: cytochrome P450 716B2-like              392   3e-126   
sp|Q50EK1.1|C16B1_PICSI  RecName: Full=Cytochrome P450 716B1; Alt...    392   4e-126   Picea sitchensis
ref|XP_008225706.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    391   6e-126   
ref|XP_008225708.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    391   7e-126   
ref|NP_198460.1|  cytochrome P450, family 716, subfamily A, polyp...    390   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089170.1|  PREDICTED: beta-amyrin 28-oxidase-like             391   1e-125   
ref|XP_008225705.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    390   1e-125   
ref|XP_007213963.1|  hypothetical protein PRUPE_ppa004999mg             390   2e-125   
ref|XP_008350555.1|  PREDICTED: beta-amyrin 28-oxidase-like             390   2e-125   
ref|XP_009353896.1|  PREDICTED: beta-amyrin 28-oxidase-like             389   3e-125   
ref|XP_006340081.1|  PREDICTED: cytochrome P450 716B1-like              389   3e-125   
ref|XP_010450437.1|  PREDICTED: beta-amyrin 28-oxidase-like             389   5e-125   
gb|EPS63622.1|  hypothetical protein M569_11162                         403   9e-125   
ref|XP_002325241.2|  hypothetical protein POPTR_0018s13450g             387   1e-124   Populus trichocarpa [western balsam poplar]
gb|EPS59491.1|  hypothetical protein M569_15315                         387   2e-124   
ref|XP_011096738.1|  PREDICTED: beta-amyrin 28-oxidase-like             387   3e-124   
gb|AHF22082.1|  CYP716D22                                               387   3e-124   
ref|XP_006445580.1|  hypothetical protein CICLE_v10015070mg             387   4e-124   
ref|XP_006488945.1|  PREDICTED: cytochrome P450 716B2-like              387   6e-124   
ref|XP_004301516.1|  PREDICTED: cytochrome P450 716B2-like              387   6e-124   
ref|XP_003629928.1|  Cytochrome P450                                    399   2e-123   
gb|EYU33953.1|  hypothetical protein MIMGU_mgv1a023105mg                384   5e-123   
ref|XP_011004881.1|  PREDICTED: beta-amyrin 28-oxidase-like             384   5e-123   
ref|XP_006852242.1|  hypothetical protein AMTR_s00049p00155050          383   1e-122   
ref|XP_004233188.1|  PREDICTED: beta-amyrin 28-oxidase-like             382   2e-122   
ref|XP_009617512.1|  PREDICTED: beta-amyrin 28-oxidase-like             382   3e-122   
gb|KHN48077.1|  Cytochrome P450 716B2                                   380   3e-122   
ref|XP_002529895.1|  cytochrome P450, putative                          381   3e-122   Ricinus communis
ref|XP_006340080.1|  PREDICTED: cytochrome P450 716B2-like isofor...    381   6e-122   
ref|XP_010435488.1|  PREDICTED: beta-amyrin 28-oxidase-like             380   7e-122   
ref|XP_008388261.1|  PREDICTED: beta-amyrin 28-oxidase-like             380   7e-122   
ref|XP_011016385.1|  PREDICTED: beta-amyrin 28-oxidase-like             379   8e-122   
gb|KDP34865.1|  hypothetical protein JCGZ_09153                         379   9e-122   
gb|AJD25249.1|  cytochrome P450 CYP716C12                               380   1e-121   
gb|ABC94482.1|  putative taxane 13-alpha-hydroxylase cytochrome P450    380   1e-121   Artemisia annua [sweet Annie]
gb|ABD60225.1|  ent-kaurenoic acid 13-hydroxylase                       380   1e-121   Stevia rebaudiana
ref|XP_010440783.1|  PREDICTED: beta-amyrin 28-oxidase-like             379   2e-121   
gb|KHN48078.1|  Cytochrome P450 716B2                                   377   6e-121   
ref|XP_008225710.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    377   6e-121   
gb|ACL10147.1|  cytochrome P450 monooxygenase                           378   9e-121   Stevia rebaudiana
ref|XP_008225709.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    377   9e-121   
ref|XP_006353039.1|  PREDICTED: cytochrome P450 716B2-like              377   1e-120   
gb|AJD25250.1|  cytochrome P450 CYP716D25                               377   1e-120   
ref|XP_006852236.1|  hypothetical protein AMTR_s00049p00150940          377   2e-120   
gb|ABR16707.1|  unknown                                                 377   2e-120   Picea sitchensis
ref|XP_008388262.1|  PREDICTED: beta-amyrin 28-oxidase-like             377   2e-120   
ref|XP_006340079.1|  PREDICTED: cytochrome P450 716B2-like isofor...    377   3e-120   
gb|KDP27043.1|  hypothetical protein JCGZ_20978                         372   7e-120   
ref|XP_006283658.1|  hypothetical protein CARUB_v10004715mg             374   2e-119   
ref|XP_010031614.1|  PREDICTED: cytochrome P450 716B1-like              374   2e-119   
gb|EYU43204.1|  hypothetical protein MIMGU_mgv1a005450mg                375   2e-119   
gb|KHN06480.1|  Cytochrome P450 716B2                                   371   5e-119   
ref|XP_004306780.1|  PREDICTED: cytochrome P450 716B1-like              369   3e-117   
emb|CDP21516.1|  unnamed protein product                                367   9e-117   
gb|AHF45909.1|  CYP716Y1                                                367   2e-116   
emb|CDP18585.1|  unnamed protein product                                363   2e-116   
gb|EYU25768.1|  hypothetical protein MIMGU_mgv1a006650mg                363   7e-116   
ref|XP_006852239.1|  hypothetical protein AMTR_s00049p00153260          365   1e-115   
gb|KCW52345.1|  hypothetical protein EUGRSUZ_J01761                     363   2e-115   
gb|KCW78587.1|  hypothetical protein EUGRSUZ_C00059                     361   8e-115   
ref|XP_004291627.1|  PREDICTED: cytochrome P450 716B2-like              362   2e-114   
gb|EYU29474.1|  hypothetical protein MIMGU_mgv1a020714mg                359   2e-114   
ref|XP_006829767.1|  hypothetical protein AMTR_s00119p00024530          360   1e-113   
emb|CAN77161.1|  hypothetical protein VITISV_020236                     358   2e-113   
gb|KDO51686.1|  hypothetical protein CISIN_1g011873mg                   358   2e-113   
ref|XP_004171393.1|  PREDICTED: cytochrome P450 716B1-like              352   5e-113   
ref|XP_006432202.1|  hypothetical protein CICLE_v10001024mg             357   5e-113   
ref|XP_006585768.1|  PREDICTED: cytochrome P450 716B2 isoform X2        351   6e-113   
ref|XP_006585214.1|  PREDICTED: cytochrome P450 716B2-like isofor...    353   6e-112   
ref|XP_008443639.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       348   8e-112   
ref|XP_008389235.1|  PREDICTED: beta-amyrin 28-oxidase-like             352   5e-111   
ref|XP_006852238.1|  hypothetical protein AMTR_s00049p00152020          354   1e-110   
ref|XP_010247736.1|  PREDICTED: beta-amyrin 28-oxidase-like             350   2e-110   
ref|XP_010046682.1|  PREDICTED: beta-amyrin 28-oxidase-like             349   1e-109   
emb|CAN71865.1|  hypothetical protein VITISV_033123                     347   2e-109   
emb|CDP21078.1|  unnamed protein product                                346   7e-109   
gb|KDO54465.1|  hypothetical protein CISIN_1g013728mg                   344   2e-108   
emb|CDP19442.1|  unnamed protein product                                335   1e-107   
ref|XP_006351699.1|  PREDICTED: cytochrome P450 716B2-like              343   2e-107   
gb|EYU26850.1|  hypothetical protein MIMGU_mgv1a018058mg                340   5e-107   
ref|XP_002523409.1|  cytochrome P450, putative                          341   9e-107   
ref|XP_006351700.1|  PREDICTED: cytochrome P450 716B2-like              341   1e-106   
dbj|BAC23044.1|  cytochrome P450                                        340   4e-106   
ref|XP_010098504.1|  Cytochrome P450                                    340   4e-106   
gb|KEH21306.1|  cytochrome P450 family protein                          337   6e-106   
ref|XP_006580231.1|  PREDICTED: cytochrome P450 716B2-like              338   1e-105   
ref|XP_006443082.1|  hypothetical protein CICLE_v10019893mg             338   2e-105   
ref|XP_006443083.1|  hypothetical protein CICLE_v10019890mg             338   2e-105   
gb|KDO41269.1|  hypothetical protein CISIN_1g011325mg                   338   4e-105   
emb|CDP10715.1|  unnamed protein product                                325   3e-104   
emb|CDP21077.1|  unnamed protein product                                333   9e-104   
ref|XP_009344146.1|  PREDICTED: beta-amyrin 28-oxidase-like             327   1e-103   
ref|XP_003630001.1|  Abscisic acid 8'-hydroxylase                       332   2e-103   
ref|XP_004250858.1|  PREDICTED: beta-amyrin 28-oxidase                  331   8e-103   
ref|XP_010034533.1|  PREDICTED: beta-amyrin 28-oxidase-like             328   4e-102   
gb|KCW52344.1|  hypothetical protein EUGRSUZ_J01759                     328   1e-101   
ref|XP_007159604.1|  hypothetical protein PHAVU_002G251200g             328   2e-101   
ref|XP_002299098.2|  hypothetical protein POPTR_0001s04020g             323   4e-101   
ref|XP_002310350.1|  hypothetical protein POPTR_0007s15190g             320   3e-100   
emb|CDP11383.1|  unnamed protein product                                316   8e-98    
ref|XP_009786412.1|  PREDICTED: beta-amyrin 28-oxidase-like             317   2e-97    
emb|CDP17152.1|  unnamed protein product                                313   3e-96    
gb|ABK26968.1|  unknown                                                 308   6e-96    
ref|XP_006453162.1|  hypothetical protein CICLE_v10010450mg             311   1e-95    
ref|XP_009620428.1|  PREDICTED: beta-amyrin 28-oxidase-like             312   2e-95    
ref|XP_008227243.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    303   3e-94    
ref|XP_011074931.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    303   2e-93    
gb|ACU18094.1|  unknown                                                 297   4e-93    
ref|XP_011048247.1|  PREDICTED: beta-amyrin 28-oxidase-like             306   1e-92    
ref|XP_009358879.1|  PREDICTED: beta-amyrin 28-oxidase-like             299   1e-91    
ref|XP_002299099.2|  hypothetical protein POPTR_0001s04030g             299   3e-91    
sp|Q8W4T9.1|T13H_TAXCU  RecName: Full=Taxane 13-alpha-hydroxylase...    300   7e-91    
ref|XP_002971610.1|  hypothetical protein SELMODRAFT_231756             298   2e-90    
gb|AAX59903.1|  13-alpha-hydroxylase                                    299   2e-90    
gb|AAX20147.1|  taxane 13-alpha-hydroxylase                             299   3e-90    
gb|KHN06510.1|  Cytochrome P450 716B2                                   295   4e-90    
ref|XP_002965726.1|  hypothetical protein SELMODRAFT_84634              298   4e-90    
gb|AFD32415.1|  taxane 14b-hydroxylase                                  298   1e-89    
ref|XP_003634587.2|  PREDICTED: beta-amyrin 28-oxidase                  287   4e-89    
emb|CBI39272.3|  unnamed protein product                                287   6e-89    
ref|XP_002325239.2|  hypothetical protein POPTR_0018s13420g             291   2e-88    
ref|XP_002522969.1|  cytochrome P450, putative                          293   2e-88    
ref|XP_008226970.1|  PREDICTED: cytochrome P450 716B1-like              293   3e-88    
gb|AAU93341.1|  taxadiene 5-alpha hydroxylase                           293   5e-88    
sp|Q84KI1.1|T14H_TAXCU  RecName: Full=Taxoid 14-beta-hydroxylase;...    293   1e-87    
ref|XP_009607399.1|  PREDICTED: cytochrome P450 716B1-like              292   1e-87    
ref|XP_007214033.1|  hypothetical protein PRUPE_ppa017328mg             291   1e-87    
ref|XP_006346227.1|  PREDICTED: cytochrome P450 716B1-like              292   1e-87    
gb|AAS89065.2|  taxoid 2-alpha-hydroxylase                              292   2e-87    
sp|Q6WG30.2|T5H_TAXCU  RecName: Full=Taxadiene 5-alpha hydroxylase      292   2e-87    
gb|AET00449.2|  cytochrome P450 family protein                          291   2e-87    
gb|AFD32421.1|  5-alpha-hydroxylase                                     291   2e-87    
ref|XP_002981278.1|  hypothetical protein SELMODRAFT_114324             291   2e-87    
ref|XP_002991753.1|  hypothetical protein SELMODRAFT_161932             290   4e-87    
gb|KHN38289.1|  Taxadiene 5-alpha hydroxylase                           290   4e-87    
ref|XP_009793750.1|  PREDICTED: cytochrome P450 716B1-like              290   6e-87    
ref|XP_010682414.1|  PREDICTED: dammarenediol 12-hydroxylase-like       281   6e-87    
ref|NP_001242838.1|  uncharacterized protein LOC100790001 precursor     289   8e-87    
ref|XP_010921144.1|  PREDICTED: cytochrome P450 716B1-like isofor...    289   1e-86    
ref|XP_007141897.1|  hypothetical protein PHAVU_008G235000g             288   2e-86    
ref|XP_001755044.1|  predicted protein                                  288   2e-86    
ref|XP_004491368.1|  PREDICTED: cytochrome P450 716B1-like              288   2e-86    
ref|XP_011030804.1|  PREDICTED: cytochrome P450 716B1-like              289   2e-86    
ref|XP_010921143.1|  PREDICTED: taxane 13-alpha-hydroxylase-like ...    289   2e-86    
ref|XP_004244351.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      287   7e-86    
ref|XP_002989743.1|  hypothetical protein SELMODRAFT_130337             286   9e-86    
ref|XP_008803662.1|  PREDICTED: cytochrome P450 716B1-like              287   1e-85    
ref|XP_007214243.1|  hypothetical protein PRUPE_ppa023488mg             286   1e-85    
gb|AFJ04877.1|  taxadiene 5nalpha hydroxylase                           285   2e-85    
gb|AAV54171.1|  taxoid 2-alpha-hydroxylase                              286   3e-85    
gb|AFJ04873.1|  taxadiene 5nalpha hydroxylase                           284   3e-85    
gb|AFJ04862.1|  taxadiene 5nalpha hydroxylase                           284   3e-85    
gb|AFJ04860.1|  taxadiene 5nalpha hydroxylase                           284   3e-85    
gb|AFJ04872.1|  taxadiene 5nalpha hydroxylase                           284   4e-85    
gb|AFJ04859.1|  taxadiene 5nalpha hydroxylase                           284   4e-85    
ref|XP_007020904.1|  Cytochrome P450                                    285   6e-85    
gb|AFJ04880.1|  taxadiene 5nalpha hydroxylase                           284   6e-85    
gb|AFJ04884.1|  taxadiene 5nalpha hydroxylase                           284   6e-85    
gb|AFJ04874.1|  taxadiene 5nalpha hydroxylase                           283   6e-85    
gb|AFJ04876.1|  taxadiene 5nalpha hydroxylase                           283   6e-85    
gb|AFJ04888.1|  taxadiene 5nalpha hydroxylase                           283   7e-85    
gb|AFJ04871.1|  taxadiene 5nalpha hydroxylase                           283   7e-85    
gb|AFJ04863.1|  taxadiene 5nalpha hydroxylase                           283   7e-85    
gb|AFJ04882.1|  taxadiene 5nalpha hydroxylase                           283   8e-85    
gb|AFJ04878.1|  taxadiene 5nalpha hydroxylase                           283   8e-85    
gb|AFJ04870.1|  taxadiene 5nalpha hydroxylase                           283   8e-85    
gb|AFJ04866.1|  taxadiene 5nalpha hydroxylase                           283   1e-84    
gb|AFJ04869.1|  taxadiene 5nalpha hydroxylase                           283   1e-84    
ref|XP_008782776.1|  PREDICTED: cytochrome P450 716B1-like              284   1e-84    
ref|XP_004140824.1|  PREDICTED: cytochrome P450 716B1-like              283   1e-84    
gb|AFJ04881.1|  taxadiene 5nalpha hydroxylase                           283   1e-84    
gb|AFJ04865.1|  taxadiene 5nalpha hydroxylase                           282   2e-84    
gb|AFJ04858.1|  taxadiene 5nalpha hydroxylase                           282   2e-84    
ref|XP_010658310.1|  PREDICTED: cytochrome P450 716B1                   284   2e-84    
gb|AFJ04887.1|  taxadiene 5nalpha hydroxylase                           282   2e-84    
gb|AFJ04883.1|  taxadiene 5nalpha hydroxylase                           282   2e-84    
gb|AFJ04867.1|  taxadiene 5nalpha hydroxylase                           282   3e-84    
gb|AFJ04875.1|  taxadiene 5nalpha hydroxylase                           282   3e-84    
gb|AFJ04879.1|  taxadiene 5nalpha hydroxylase                           282   3e-84    
emb|CAN70350.1|  hypothetical protein VITISV_012582                     283   4e-84    
ref|XP_003617490.1|  Taxane 13-alpha-hydroxylase                        282   5e-84    
gb|AAN52360.1|  5-alpha-taxadienol-10-beta-hydroxylase                  283   5e-84    
ref|XP_008457111.1|  PREDICTED: cytochrome P450 716B1-like              281   1e-83    
gb|AFJ04861.1|  taxadiene 5nalpha hydroxylase                           280   1e-83    
ref|XP_004299710.1|  PREDICTED: cytochrome P450 716B1-like              281   2e-83    
gb|AFJ04864.1|  taxadiene 5nalpha hydroxylase                           280   2e-83    
gb|KDO41268.1|  hypothetical protein CISIN_1g045001mg                   280   2e-83    
gb|KDP39106.1|  hypothetical protein JCGZ_00863                         278   6e-83    
ref|XP_008371267.1|  PREDICTED: cytochrome P450 716B1-like              279   6e-83    
ref|XP_010923918.1|  PREDICTED: cytochrome P450 716B2-like              278   2e-82    
ref|XP_009607400.1|  PREDICTED: cytochrome P450 716B1-like              278   2e-82    
ref|XP_008243438.1|  PREDICTED: beta-amyrin 28-oxidase-like             273   2e-82    
ref|XP_008226931.1|  PREDICTED: cytochrome P450 716B1-like              277   3e-82    
ref|XP_008369414.1|  PREDICTED: cytochrome P450 716B1-like              278   3e-82    
ref|XP_007011311.1|  Cytochrome P450, putative                          287   3e-82    
ref|XP_004957873.1|  PREDICTED: cytochrome P450 716B1-like              278   3e-82    
ref|XP_007213798.1|  hypothetical protein PRUPE_ppa004984m2g            274   4e-82    
gb|EYU19246.1|  hypothetical protein MIMGU_mgv1a005723mg                277   4e-82    
ref|XP_004308981.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        277   5e-82    
ref|XP_010060379.1|  PREDICTED: cytochrome P450 716B1-like              276   6e-82    
ref|XP_009363898.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      276   7e-82    
ref|XP_004295817.1|  PREDICTED: cytochrome P450 716B1-like              276   1e-81    
emb|CDP18586.1|  unnamed protein product                                275   1e-81    
ref|XP_009334824.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    275   2e-81    
ref|XP_001762633.1|  predicted protein                                  275   2e-81    
emb|CDP20362.1|  unnamed protein product                                273   2e-81    
ref|XP_008345868.1|  PREDICTED: cytochrome P450 716B1-like              275   2e-81    
ref|XP_010092132.1|  Cytochrome P450                                    275   2e-81    
gb|AAT47183.1|  taxoid 10-beta hydroxylase                              275   2e-81    
ref|XP_006376949.1|  hypothetical protein POPTR_0012s11470g             275   2e-81    
ref|XP_002278616.2|  PREDICTED: cytochrome P450 716B1-like              275   3e-81    
ref|XP_009617504.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    271   5e-81    
ref|XP_006474348.1|  PREDICTED: cytochrome P450 716B1-like              271   6e-81    
ref|XP_011003573.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      274   6e-81    
ref|XP_003563018.2|  PREDICTED: cytochrome P450 716B1-like              275   1e-80    
ref|XP_009794406.1|  PREDICTED: LOW QUALITY PROTEIN: taxane 13-al...    274   1e-80    
ref|XP_002969665.1|  hypothetical protein SELMODRAFT_231370             273   1e-80    
emb|CBI24039.3|  unnamed protein product                                263   1e-80    
emb|CBI18205.3|  unnamed protein product                                261   3e-80    
gb|AHF49535.1|  CYP450 725 family protein                               273   4e-80    
emb|CBI26615.3|  unnamed protein product                                274   6e-80    
gb|EYU39276.1|  hypothetical protein MIMGU_mgv1a023490mg                268   9e-80    
ref|XP_009768076.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       259   2e-79    
sp|Q6JTJ0.1|T7H_TAXCU  RecName: Full=Taxoid 7-beta-hydroxylase          269   6e-79    
ref|XP_009352449.1|  PREDICTED: cytochrome P450 716B1-like              268   7e-79    
ref|XP_011003980.1|  PREDICTED: beta-amyrin 28-oxidase-like             264   7e-79    
ref|XP_002267028.1|  PREDICTED: cytochrome P450 716B1                   268   8e-79    
ref|XP_002987404.1|  hypothetical protein SELMODRAFT_126145             268   9e-79    
emb|CBI23510.3|  unnamed protein product                                269   1e-78    
dbj|BAC19981.1|  putative 5-alpha-taxadienol-10-beta-hydroxylase        268   2e-78    
gb|AJD25254.1|  cytochrome P450 CYP728D17                               268   2e-78    
ref|XP_002960196.1|  hypothetical protein SELMODRAFT_402287             267   3e-78    
gb|AFD32418.1|  cytochrome P450 taxane 7-beta-hydroxylase               267   3e-78    
ref|XP_011097890.1|  PREDICTED: cytochrome P450 716B1-like isofor...    266   3e-78    
ref|XP_002983285.1|  hypothetical protein SELMODRAFT_1987               266   3e-78    
ref|XP_011097891.1|  PREDICTED: cytochrome P450 716B1-like isofor...    266   4e-78    
ref|XP_009334834.1|  PREDICTED: cytochrome P450 716B1-like              266   4e-78    
ref|XP_011040241.1|  PREDICTED: cytochrome P450 716B1-like              266   6e-78    
ref|XP_010103649.1|  Taxadiene 5-alpha hydroxylase                      266   1e-77    
ref|XP_002967511.1|  hypothetical protein SELMODRAFT_144826             265   1e-77    
sp|Q9AXM6.1|T10H_TAXCU  RecName: Full=Taxane 10-beta-hydroxylase;...    266   1e-77    
gb|AFD32419.1|  10-beta-hydroxylase                                     266   1e-77    
ref|XP_002979923.1|  hypothetical protein SELMODRAFT_112151             265   2e-77    
gb|ACR78247.1|  taxoid 7-beta-hydroxylase                               265   3e-77    
gb|EAZ04083.1|  hypothetical protein OsI_26220                          264   3e-77    
ref|XP_011001398.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        265   3e-77    
gb|AAS49032.1|  5-alpha-taxadienol-10-beta-hydroxylase                  265   4e-77    
ref|XP_002325485.2|  hypothetical protein POPTR_0019s08620g             264   5e-77    
gb|EYU25992.1|  hypothetical protein MIMGU_mgv1a017984mg                259   8e-77    
gb|AAW03151.1|  taxane 10-beta-hydroxylase                              263   9e-77    
ref|XP_010102173.1|  Taxadiene 5-alpha hydroxylase                      263   9e-77    
ref|NP_001148166.1|  taxane 13-alpha-hydroxylase precursor              263   1e-76    
ref|XP_003617455.1|  Taxane 13-alpha-hydroxylase                        263   1e-76    
ref|XP_002266981.2|  PREDICTED: cytochrome P450 716B1-like              262   2e-76    
tpg|DAA62930.1|  TPA: putative cytochrome P450 superfamily protein      262   2e-76    
ref|XP_004158484.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    262   3e-76    
ref|XP_004152028.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      261   3e-76    
ref|XP_010921145.1|  PREDICTED: cytochrome P450 716B1-like isofor...    259   4e-76    
ref|NP_001140840.1|  putative cytochrome P450 superfamily protein       261   5e-76    
ref|XP_008454553.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    261   5e-76    
ref|XP_002981450.1|  hypothetical protein SELMODRAFT_444868             260   7e-76    
ref|XP_010922745.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        261   1e-75    
ref|XP_004296016.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      259   2e-75    
ref|XP_002443327.1|  hypothetical protein SORBIDRAFT_08g017540          260   2e-75    
ref|XP_010092133.1|  Cytochrome P450                                    258   2e-75    
ref|XP_008229454.1|  PREDICTED: taxadiene 5-alpha hydroxylase           259   2e-75    
emb|CDP18717.1|  unnamed protein product                                259   2e-75    
ref|XP_009374386.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      259   3e-75    
ref|XP_002462934.1|  hypothetical protein SORBIDRAFT_02g034870          259   5e-75    
ref|XP_011095373.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      258   5e-75    
ref|XP_010323638.1|  PREDICTED: taxadiene 5-alpha hydroxylase           258   6e-75    
ref|XP_006449045.1|  hypothetical protein CICLE_v10018288mg             258   7e-75    



>ref|XP_006353629.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/466 (64%), Positives = 373/466 (80%), Gaps = 18/466 (4%)
 Frame = +2

Query  134   IIYFITKANTSK---PNLPPGSTGWPVIGESIDLMV---PDKYISDRMKKYSPEVFKTSI  295
             +I+FI K N S     NLPPGS GWP++GE+ID+     P+K+I +RM+K+S +VFKTS+
Sbjct  20    LIFFILKGNYSNNKHTNLPPGSYGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ----NTLRKISTLNRNNI  463
              GEK+A+FCG++GNKF F+NEN LLTTWWPQS+ KPL+ PTQ    N+++KI+  NR  +
Sbjct  80    FGEKIAIFCGSSGNKFLFSNENKLLTTWWPQSLTKPLLCPTQSQSQNSIKKIALSNRGFL  139

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              EI KPENLK YIP +DSMA++H+ +EW PF+EVK+Y L K YTF LACKLFLSIE    
Sbjct  140   LEILKPENLKQYIPFMDSMARDHLKQEWVPFKEVKIYPLVKKYTFGLACKLFLSIEDFQH  199

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             VK+L DP I+V+SGMF++P+N PGT YNRA+KGG MVR +L+++IKERK         + 
Sbjct  200   VKKLSDPFILVTSGMFTVPINLPGTPYNRAIKGGKMVREELMKIIKERKI-------NEK  252

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              N    +L RL++ +DE GQ +N+ EIY+ IIG+L+ +Y + SAAITFVLK+LAELP I+
Sbjct  253   NNHSDHLLSRLISFSDENGQFMNDAEIYNNIIGLLVASYDTTSAAITFVLKYLAELPKIF  312

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +VYKEQ+EI KSKG  E L+W+D+QKMKYSWNV CEA+RL PP QG FRE +++FT+ G
Sbjct  313   NEVYKEQMEIRKSKGEGELLNWDDIQKMKYSWNVACEAIRLMPPAQGAFREAITDFTFGG  372

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             FTIPKGWKTFWNVYSTHKNPKYF EPEKFDP RFEGSGPAP+TFVPFG GPRMCPGKEYA
Sbjct  373   FTIPKGWKTFWNVYSTHKNPKYFPEPEKFDPCRFEGSGPAPYTFVPFGGGPRMCPGKEYA  432

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             RLEILVFM+NVVTNFK+EKL+P EKI+Y  ++P P+NGLPVR+ PH
Sbjct  433   RLEILVFMYNVVTNFKLEKLVPHEKIIY-QSSPVPLNGLPVRIQPH  477



>emb|CDP18172.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 377/461 (82%), Gaps = 7/461 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESID--LMVPDKYISDRMKKYSPEVFKTSILGEKV  310
             I+ I K N+S   LPPG++GWP++GES+   L+ P K++ DRMKKYSP+VF+TS++GEK+
Sbjct  21    IFLIRKRNSSSLKLPPGTSGWPMVGESLQFALLGPQKFVKDRMKKYSPDVFQTSLMGEKM  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             A+FCGA GNKF FTNEN LLT+WWPQS+ K L+FP   +++L+++S L R+ +H+I KPE
Sbjct  81    AIFCGAQGNKFLFTNENKLLTSWWPQSMKKALLFPEFVEDSLKEVSALKRSFMHDILKPE  140

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              LK YIP +D++A+EHI +EWAP +EVKV+ LSK YTF LAC+LFLS+   + +K+L DP
Sbjct  141   ALKQYIPVMDALAREHIEQEWAPHKEVKVFPLSKKYTFDLACRLFLSVMDPEHIKKLADP  200

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
               +V++GMFS+P++ PGTAYN A+KGG MVR +L+ VI+ER+ E M   + +     +D+
Sbjct  201   FHLVTNGMFSVPIDLPGTAYNGAIKGGKMVREELLRVIRERRKELM--ENKETAAACKDL  258

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L R+L +TDE+GQ+L+E EI + IIG+L+ +Y + S A+TFVLK LAELPHIY++V +EQ
Sbjct  259   LSRMLLVTDEDGQYLSEMEISNNIIGLLVASYETTSTAVTFVLKHLAELPHIYREVLREQ  318

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             +EIAK+KGP+E L+WED++KMKYSWNV  E+LR+ PP QG FRE+V++FTYAGFTIPKGW
Sbjct  319   MEIAKTKGPDELLTWEDIEKMKYSWNVARESLRVTPPAQGAFRESVADFTYAGFTIPKGW  378

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             KTFW V++THKNPKYF EPEKFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLE+LVF
Sbjct  379   KTFWTVHTTHKNPKYFPEPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEVLVF  438

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             M+ +VT F+++K +P+EKIVY +A+P P NGLPV L PH K
Sbjct  439   MYRIVTQFQLKKAIPNEKIVY-HASPVPANGLPVLLQPHGK  478



>ref|XP_004241821.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/464 (62%), Positives = 372/464 (80%), Gaps = 18/464 (4%)
 Frame = +2

Query  137   IYFITKANTSK---PNLPPGSTGWPVIGESIDLMV---PDKYISDRMKKYSPEVFKTSIL  298
             +YFI K N S     NLP GS GWP++GE+ID+     P+K+I +RM+K+S +VFKTS+L
Sbjct  18    LYFIFKGNYSNNKHTNLPLGSNGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSLL  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ----NTLRKISTLNRNNIH  466
             G+K+A+FCG +GNKF F+NEN LLTTWWP S+ KPLM PTQ    N++++I+ LNR  + 
Sbjct  78    GQKIAIFCGTSGNKFLFSNENKLLTTWWPPSLTKPLMCPTQSQSQNSVKEIALLNRGFLR  137

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
             EI KPENLK YIP +DSMA++H+ +EW PF+EVK+Y L K YTF+LACKLFLSI+    V
Sbjct  138   EILKPENLKQYIPFMDSMARDHLKQEWIPFKEVKIYPLVKKYTFSLACKLFLSIDDFRHV  197

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
             K+L DP ++V+SGMF++P+N PGT YNRA+KGG MV  +L+++IKERK         +  
Sbjct  198   KKLSDPFVLVTSGMFTVPINLPGTPYNRAIKGGKMVHEELMKIIKERKI-------NEKN  250

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             N   D+L +L++ +DE GQ +N+ EIY+ IIG+L+ +Y + SAAITFVLK+LAELP+I+ 
Sbjct  251   NHSNDLLSQLISFSDENGQFMNDAEIYNNIIGLLVASYDTTSAAITFVLKYLAELPNIFN  310

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +VYKEQ+EIAKSKG  E L+W+D+QKMKYSWNV CEA+RL PP QG FRE +++FT+ GF
Sbjct  311   EVYKEQMEIAKSKGEGELLNWDDIQKMKYSWNVACEAIRLMPPAQGAFREAITDFTFGGF  370

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             T+PKGWKTFW+VYSTHKNPKYF EPEKFDP RFEGSGP P+TFVPFG GPRMCPGKEYAR
Sbjct  371   TVPKGWKTFWSVYSTHKNPKYFPEPEKFDPCRFEGSGPEPYTFVPFGGGPRMCPGKEYAR  430

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LEILVFM+N+VTNFK+EKL+P EKI+Y  ++P P+NGLPVR+ P
Sbjct  431   LEILVFMYNIVTNFKLEKLVPHEKIIY-KSSPVPLNGLPVRIQP  473



>ref|XP_006353706.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=474

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/454 (61%), Positives = 369/454 (81%), Gaps = 9/454 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESID--LMVPDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K ++S   LPPG++GWP++GE+++  L+ P K+I DRM+KYSPEVF+TSI+GEK+A FCG
Sbjct  24    KRDSSSKTLPPGTSGWPLLGENMEFALLGPQKFIKDRMEKYSPEVFQTSIMGEKMAFFCG  83

Query  326   AAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPENLKHY  499
             A GNKF F++EN LLT+WWPQS+ K L+FP   +++L+++S L R+ +H+I KPE LK Y
Sbjct  84    AQGNKFLFSSENKLLTSWWPQSMKKALLFPEFVESSLKEVSALKRSFLHDILKPEALKQY  143

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             IP +D+MA+EH+ E W   R VKV+ LSK YTF LAC+LF+S+   +E+KRL DP  +V+
Sbjct  144   IPLMDAMAREHLDENWNSNRVVKVFPLSKKYTFDLACRLFMSLVDPEEIKRLADPFTLVT  203

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
             +GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ E     +   E  GRD+L ++L
Sbjct  204   NGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKEL----TENQETAGRDLLSKML  259

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
              +TDE+GQ ++E EI + IIG+L+ ++ + S+A+T VLK+LAELPH+Y +VY+EQ+ IAK
Sbjct  260   LVTDEDGQFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDEVYREQMAIAK  319

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKG  + L+WED++KMKYSWN   E+LRL PP QG FRET+++FTYAGFTIPKGWKTFW+
Sbjct  320   SKGAEDLLTWEDIEKMKYSWNAARESLRLTPPAQGSFRETITDFTYAGFTIPKGWKTFWS  379

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
             V+STHKNPKYF++PEKFDPSRFEGSGPAPFTFVPFG GPRMCPGKEYARLE+LVFMHNVV
Sbjct  380   VHSTHKNPKYFSDPEKFDPSRFEGSGPAPFTFVPFGGGPRMCPGKEYARLEVLVFMHNVV  439

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
               FK+EK +PDEKIV+ +A+P PV GLPVRL PH
Sbjct  440   KRFKLEKDIPDEKIVF-HASPVPVYGLPVRLLPH  472



>gb|EYU22847.1| hypothetical protein MIMGU_mgv1a022104mg [Erythranthe guttata]
Length=477

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/462 (61%), Positives = 374/462 (81%), Gaps = 10/462 (2%)
 Frame = +2

Query  137   IYFITKAN-TSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             + F+ K   T   NLPPGS GWP++GE+++  +  P +++ +RM+KYSPEVF+TS+LGEK
Sbjct  21    VSFLRKTGPTESKNLPPGSNGWPMLGENMEFALSGPQQFVKERMQKYSPEVFRTSLLGEK  80

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKP  481
             +AVFCGA GNKF FTNEN LLT+WWPQS+ K L+FP   ++ L+++S L R+  H+I KP
Sbjct  81    MAVFCGAQGNKFLFTNENKLLTSWWPQSMKKALLFPEFIESNLKEVSALKRSFHHDILKP  140

Query  482   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
             E LK YIP +DS+A++H+  +W P   VKV+ LSK YTF LACKLFLS+  ++++K+L D
Sbjct  141   EALKQYIPAMDSLARQHLDSDWLPNTVVKVFPLSKKYTFELACKLFLSLVDQEDIKKLSD  200

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P  +V++GMFS+P++FPGTAYN A+KGG MVR +L+ +I ER+ E +M++    E EGRD
Sbjct  201   PFTLVTNGMFSVPIDFPGTAYNGAIKGGKMVREELMRIITERRKEIVMNN----ETEGRD  256

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L ++L + DE+G  ++E EI + IIG+L+ ++ + S+A+T V+ +LA LPHIY++V+KE
Sbjct  257   LLSKMLLVRDEDGNFMSEMEISNNIIGLLVASFETTSSAVTAVMNYLAGLPHIYREVFKE  316

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+EIAKSKGPNE L+WED++KMKYSWNV  E+LRL PP QG FRET++EFTYAGFT+PKG
Sbjct  317   QMEIAKSKGPNELLTWEDIEKMKYSWNVARESLRLTPPAQGAFRETITEFTYAGFTVPKG  376

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WKTFW V+STHKNPKYF EPEKFDP RFEG+GPAP+TFVPFG GPRMCPGKEYARLE+LV
Sbjct  377   WKTFWTVHSTHKNPKYFPEPEKFDPKRFEGTGPAPYTFVPFGGGPRMCPGKEYARLEVLV  436

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             FMHNVVT FK+EK +P+EKIV+ +A+P+P +GLPV L PH+K
Sbjct  437   FMHNVVTRFKLEKAIPNEKIVF-HASPTPAHGLPVHLHPHEK  477



>ref|XP_004242231.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/459 (59%), Positives = 371/459 (81%), Gaps = 9/459 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESID--LMVPDKYISDRMKKYSPEVFKTSILGEKV  310
             ++ + K ++S  +LPPG+ GWP++GE+++  L+ P K+I DRM+KYS +VF+TSI+GEK+
Sbjct  20    MFILRKRDSSSKSLPPGTCGWPLLGENVEFALLGPQKFIKDRMEKYSAQVFQTSIMGEKM  79

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             A FCGA GNKF F++EN L+T+WWPQS+ K L+FP   +++L+++S L R+ +H+I KPE
Sbjct  80    AFFCGAQGNKFLFSSENKLVTSWWPQSMKKALLFPEFVESSLKQVSALKRSFLHDILKPE  139

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              LK YIP +D+MA++H+ + W   R V V+ LSK YTF LAC+LF+S+   +E+KRL DP
Sbjct  140   ALKQYIPLMDAMARQHLHQNWDSNRVVTVFPLSKKYTFDLACRLFMSLVDPEEIKRLADP  199

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
               +V++GMFS+P++ PGTAY+RA+KGG+MVR +L+ +I +R+ E     +   E  GRD+
Sbjct  200   FTLVTNGMFSMPIDLPGTAYHRAIKGGTMVRDELMRIITQRRKEL----TENQETSGRDL  255

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L ++L +TDE+GQ ++E EI + IIG+L+ ++ + S+A+T VLK+LAELPH+Y QVY+EQ
Sbjct  256   LSKMLLVTDEDGQFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDQVYREQ  315

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             + IAKSKG  + L+WED++KMKYSWN   E+LRL PP QG FRET+++FTYAGFTIPKGW
Sbjct  316   MAIAKSKGAEDLLTWEDIEKMKYSWNAARESLRLTPPAQGSFRETITDFTYAGFTIPKGW  375

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             KTFW+V+STHKNPKYF++PEKFDPSRFEGSGPAPFTFVPFG GPRMCPGKEYARLE+LVF
Sbjct  376   KTFWSVHSTHKNPKYFSDPEKFDPSRFEGSGPAPFTFVPFGGGPRMCPGKEYARLEVLVF  435

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             MHNVV  FK+EK +PDEKIV+ +A+P PV GLPVRL PH
Sbjct  436   MHNVVKRFKLEKEIPDEKIVF-HASPVPVYGLPVRLLPH  473



>ref|XP_011099144.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=477

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/449 (62%), Positives = 363/449 (81%), Gaps = 9/449 (2%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GE+I+  V  P K++ DRM+KYSPEVF+TS+LGEK+A+FCGA GNKF 
Sbjct  34    NLPPGSRGWPMLGENIEFAVLGPQKFVKDRMEKYSPEVFQTSLLGEKMAIFCGAQGNKFL  93

Query  347   ftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSM  520
             F NEN LLT+WWPQS+ K L+FP   ++ L+++S L R+  H+I KPE LK YIP +D++
Sbjct  94    FMNENKLLTSWWPQSMKKALLFPEFVESNLKEVSALKRSFHHDILKPEALKQYIPVMDAL  153

Query  521   AKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLP  700
             A+EH+  +W P   VKV  LSK YTF LAC+LFLS+   + +KRL +P  +V++GMFS+P
Sbjct  154   AREHLDNDWTPNSVVKVSPLSKKYTFELACRLFLSVVDPEHIKRLSEPFTLVTNGMFSVP  213

Query  701   LNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEG  880
             ++ PGTAYNRA+KGG +VR +L+ +I ER+ E     + K E EGRD+L ++L +TDE+G
Sbjct  214   IDLPGTAYNRAIKGGKLVREELMRIITERRKEL----TEKKETEGRDLLSKMLLVTDEDG  269

Query  881   QHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNER  1060
             Q L+E EI + IIG+L+ ++ + S+A+T V+ +LAELPHIY+QV +EQ+EIAKSKGP+E 
Sbjct  270   QFLSEMEISNNIIGLLVASFETTSSAVTAVMNYLAELPHIYKQVLEEQMEIAKSKGPDEL  329

Query  1061  LSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKN  1240
             L+WED++KM+YSWNV  E+LRL PP QG FRET +EFTYAGFTIPKGWKTFW V+S+HKN
Sbjct  330   LTWEDIEKMRYSWNVARESLRLTPPAQGAFRETTTEFTYAGFTIPKGWKTFWTVHSSHKN  389

Query  1241  PKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEK  1420
             PKYF EPEKF+PSRFEGSGPAP+TFVPFG GPRMCPGKEYARLE+LVFMHNVV  F++EK
Sbjct  390   PKYFPEPEKFNPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEVLVFMHNVVRRFRLEK  449

Query  1421  LMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
              +P+EKIV+ +A+P+P  GLPV L PH+K
Sbjct  450   AIPNEKIVF-HASPTPAYGLPVHLHPHEK  477



>ref|XP_009620720.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/460 (60%), Positives = 374/460 (81%), Gaps = 7/460 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESID--LMVPDKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++   LPPG++GWP++GE+++  L+ P+K+I +RM+KYSP+VF+TSI+GEK+
Sbjct  18    IFFLRKRDSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKNRMEKYSPQVFQTSIMGEKM  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             AVFCGA GNKF F++EN LLT+WWPQS+ K L+FP   +++L+++S L R  +H+I KPE
Sbjct  78    AVFCGAQGNKFLFSSENKLLTSWWPQSMKKALLFPEFAESSLKQVSALQRGFLHDILKPE  137

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
              LK YIP +DSMA+EH+ E W P   V KV+ LSK YTF LAC+LF+++   +E+KRL D
Sbjct  138   ALKQYIPVMDSMAREHVDENWIPNNGVVKVFPLSKKYTFDLACRLFMNLVNPEEIKRLAD  197

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P  +V++G+FS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ E  M +   +   GRD
Sbjct  198   PFTLVTNGIFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKELQMENKEIIAG-GRD  256

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L ++L +TDE G+ ++E EI + IIG+L+ ++ + S+A+T VLK+LAELPH+Y QVYKE
Sbjct  257   LLSKMLLVTDENGRFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYYQVYKE  316

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+ IAK KG +E LSWED++KMKYSWNV  E+LRL PP QG FRET+++ TYAGFTIPKG
Sbjct  317   QMAIAKLKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDCTYAGFTIPKG  376

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WKTFW+V+STHKNPKYF++PEKFDP+RFEGSGPAP+TF+PFG GPRMCPGKEYARLEILV
Sbjct  377   WKTFWSVHSTHKNPKYFSDPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEILV  436

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              MHNVV  FK+EK++PDE+IV+ +A+P P +GLPVRL PH
Sbjct  437   LMHNVVKRFKLEKVIPDEEIVF-HASPVPKHGLPVRLLPH  475



>ref|XP_009768074.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/460 (60%), Positives = 373/460 (81%), Gaps = 7/460 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESID--LMVPDKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++   LPPG++GWP++GE+++  L+ P+K+I  RM+KYSP+VF+TSI+GEK+
Sbjct  21    IFFLRKRHSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKKRMEKYSPQVFQTSIMGEKM  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             AVFCGA GNKF F+NEN LLT+WWP+S+ K L+FP   +++L+++S L R  +H+I KPE
Sbjct  81    AVFCGAQGNKFLFSNENKLLTSWWPKSMKKALLFPEFAESSLKEVSALQRGFLHDILKPE  140

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
              LK YIP +DSMA++H+ E W P   V KV+ LSK YTF LAC+LF+S+   +E+KRL D
Sbjct  141   ALKQYIPVMDSMARDHLDENWIPNNGVVKVFPLSKKYTFDLACRLFMSLVNPEEIKRLAD  200

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P  +V++G+FS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ E  M +   +   GRD
Sbjct  201   PFTLVTNGIFSMPIDLPGTAYNRAIKGGKMVRVELMRIITQRRKELQMENKETIAG-GRD  259

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L ++L +TDE G+ ++E EI + +IG+L+ ++ + S+A T VLK+LAELPH+Y QVYKE
Sbjct  260   LLSKMLLVTDENGRFMSEMEISNNLIGMLVASFETTSSAATSVLKYLAELPHVYDQVYKE  319

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+ IAKSKG +E LSWED++KMKYSWNV  E+LRL PP QG FRET+++ TYAGFTIPKG
Sbjct  320   QMAIAKSKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDSTYAGFTIPKG  379

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WKTFW+V+STHKNPKYF+ PEKFDP+RFEGSGPAP+TF+PFG GPRMCPGKEYARLE+LV
Sbjct  380   WKTFWSVHSTHKNPKYFSNPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEVLV  439

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              MHNVV  FK+EK++PDEKIV+ +A+P P++GLPVRL PH
Sbjct  440   LMHNVVKRFKLEKVIPDEKIVF-HASPVPMHGLPVRLLPH  478



>ref|XP_009768075.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Nicotiana sylvestris]
Length=476

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/459 (59%), Positives = 367/459 (80%), Gaps = 6/459 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+   +++   LPPG++GWP++GE+I+L +  P+K++ +R +KYSP VF+T I+GEK+
Sbjct  18    IFFLRNRDSNSKKLPPGTSGWPLLGENIELALLGPEKFLKNRTEKYSPHVFQTLIMGEKL  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             AVFCGA GNKF F+NEN LLT+WWP+S+ K L+FP   +++L+ + TL R  + +I KPE
Sbjct  78    AVFCGAQGNKFLFSNENKLLTSWWPKSMKKALLFPEFAESSLKDVLTLQRGFLQDILKPE  137

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              LK YIP +D+MA+EH+ E W P   VKV+ LSK YTF LAC+LF+S+   +E+KRL DP
Sbjct  138   ALKQYIPIMDAMAREHLDENWIPNGVVKVFPLSKKYTFDLACRLFMSLVNPEEIKRLADP  197

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
               +V++GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ E  M +   +   GRD+
Sbjct  198   FTLVTNGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIISQRRKELQMENKETIAG-GRDL  256

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L ++L +TDE G+ ++E EI + IIG+L+ ++ + S+A+T VLK+LAELPH+Y QVYKEQ
Sbjct  257   LSKILLVTDENGRFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDQVYKEQ  316

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             + IAK KG +E L+WED++KMKYSWNVV E+LRL PP QG FRET+++ TYAGFTIPKGW
Sbjct  317   MAIAKLKGEDELLTWEDIEKMKYSWNVVRESLRLTPPAQGAFRETITDCTYAGFTIPKGW  376

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             KTFW+V+STHKNPKYFT+PEKFDP RFEGSGPAP+TF+PFG GPRMCPGKEYAR E+LV 
Sbjct  377   KTFWSVHSTHKNPKYFTDPEKFDPMRFEGSGPAPYTFIPFGGGPRMCPGKEYARTEVLVL  436

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             MHNVV  FK+EK++PDEKIV+ +A+P P +GLPVRL PH
Sbjct  437   MHNVVKRFKLEKVIPDEKIVF-DASPVPKHGLPVRLLPH  474



>ref|XP_009601238.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/460 (58%), Positives = 366/460 (80%), Gaps = 7/460 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++    PPG++GWP++GE+++L +  P+K+I +RM+KYSP+VF+T+I+GEK+
Sbjct  18    IFFLRKRDSNSKKHPPGTSGWPLLGENMELALLGPEKFIKNRMEKYSPQVFQTTIVGEKM  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             AVFCGA GNKF F++EN LLT+WWP+S+ K L FP   +++L+++  L     ++I KPE
Sbjct  78    AVFCGAQGNKFLFSSENILLTSWWPKSMKKALFFPEFAESSLKEVLALQLGIQYDILKPE  137

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
              LK Y+P +D+MA+EH+ E W P   V KV+ LSK YTF +AC+LF+++   +E+KRL D
Sbjct  138   ALKQYVPVMDAMAREHVDENWIPNNGVVKVFPLSKKYTFDVACRLFMNLVNPEEIKRLAD  197

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P  +V++GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ E  + +   +   GRD
Sbjct  198   PFTLVTNGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKELQIENKETIAG-GRD  256

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L +LL +TDE G+ ++E EI + IIG+LL ++ + S A+T VLK+LAELPHIY QVYKE
Sbjct  257   LLSKLLLVTDENGRFMSEMEISNNIIGMLLASFETTSTAVTSVLKYLAELPHIYDQVYKE  316

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+ IAK KG +E LSWED++KMKYSWNV  E+LRL PP QG FRET+++FTYAGFTIPKG
Sbjct  317   QMAIAKLKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDFTYAGFTIPKG  376

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WKTFW+V+STHKNPKYF++PEKFDP+RFEGSGPAP+TF+PFG GPRMCPGKEYARLEILV
Sbjct  377   WKTFWSVHSTHKNPKYFSDPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEILV  436

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              MHNVV  FK+EK++PDEKIV+  A+  P +GLPVRL P 
Sbjct  437   LMHNVVKRFKLEKVIPDEKIVF-RASLVPKHGLPVRLVPR  475



>emb|CDP10718.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/451 (60%), Positives = 354/451 (78%), Gaps = 9/451 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K   +K  LPPG+ GWPV+GE++D     P K+I +RM KYS +VFKTS +GEKV+VFCG
Sbjct  27    KPKFNKSKLPPGNIGWPVLGENVDFARGGPRKFIEERMSKYSSQVFKTSFMGEKVSVFCG  86

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHY  499
              AGNKF F+NE+  +T+W P+S+ K L+FP+     L+++  L  + +HEI KPE LK Y
Sbjct  87    PAGNKFLFSNEDKAVTSWLPRSMRKALLFPSYVDAPLKEVGALQHSFLHEILKPEALKKY  146

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             IP +D+MA++H+  EWAPF EVKVY L+K YTF LAC+LFL+IE  + VKRL DP   V 
Sbjct  147   IPVMDAMARKHLDAEWAPFEEVKVYHLAKKYTFALACRLFLNIEDPEHVKRLADPFARVM  206

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
             +G+FS+PL+FPGTAYN A+KGG+ VR +L++++  RK E +   S    + GRD+L R++
Sbjct  207   NGLFSIPLDFPGTAYNGAIKGGNKVREELLKIVTNRKKELVEDES----SAGRDLLSRMI  262

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
              + DE+G+ +NE EI + I+G+L+ ++ + S A+TFVLK+L+ELPHIY++VY+E +EIA+
Sbjct  263   LVKDEDGKLMNEMEICNNIVGLLVASFDTTSCAVTFVLKYLSELPHIYEKVYQEIMEIAE  322

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKGP + LSWED+QKM YSWNV  E+LRL PP QG FRE  S+F YAGFTIPKGWKTFW+
Sbjct  323   SKGPEDLLSWEDIQKMTYSWNVGRESLRLTPPAQGSFREAKSDFDYAGFTIPKGWKTFWS  382

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
             VYSTH+N K+F  P+ FDPSRFEGSGPAPFTF+PFG GP+MCPGKEYARLEILVFM+NVV
Sbjct  383   VYSTHRNAKHFANPDVFDPSRFEGSGPAPFTFIPFGGGPKMCPGKEYARLEILVFMYNVV  442

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             T FKME+L+PDEKI+ N A+P+PVNGLPVRL
Sbjct  443   TRFKMERLIPDEKII-NLASPTPVNGLPVRL  472



>emb|CDP10717.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/451 (60%), Positives = 351/451 (78%), Gaps = 9/451 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K   +K  LPPG+ GW ++GE++D     P K+I +RM KYS +VFKTS +GEKVAVFCG
Sbjct  27    KPKVNKSKLPPGNLGWAILGENVDFATGGPRKFIEERMSKYSSQVFKTSFMGEKVAVFCG  86

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHY  499
              AGNKF F+NE+  +T+W P+S+ K L+FP+     L+++  L  + +HEI KPE LK Y
Sbjct  87    PAGNKFLFSNEDKTVTSWLPRSMRKALLFPSYVDAPLKEVGALQHSFLHEILKPEALKKY  146

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             IP +D+MA++H+  EWA F+EVKVY L+K YTF LAC+LFL+IE  + VKRL DP   V 
Sbjct  147   IPAMDAMARKHLDAEWARFQEVKVYHLAKKYTFALACRLFLNIEDPEHVKRLSDPFACVL  206

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
             +G+FS+PL+FPGTAYN A+KGG+ VR +L++++  RK E M   S    + GRD+L R++
Sbjct  207   NGLFSIPLDFPGTAYNGAIKGGNKVREELLKIVTNRKKELMEDES----SAGRDLLSRMI  262

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
              + DE+G+ +NE EI + I+G+L+ ++ + S A+TFVLK L +LPHIY++VY+E +EIAK
Sbjct  263   LVKDEDGKLMNEMEICNNIVGLLVASFDTTSCAVTFVLKNLLDLPHIYEKVYQEIMEIAK  322

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKGP++ LSWED+QKM YSWNV  E+LRL PP QG FRE  ++F YAGFTIPKGWKTFW+
Sbjct  323   SKGPDDILSWEDIQKMTYSWNVARESLRLTPPAQGSFREAKTDFDYAGFTIPKGWKTFWS  382

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
             VYSTH+NPK+F  P+ FDPSRFEGSGPAPFTF+PFG GP+MCPGKEYARLEILVFM+NVV
Sbjct  383   VYSTHRNPKHFANPDVFDPSRFEGSGPAPFTFIPFGGGPKMCPGKEYARLEILVFMYNVV  442

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             T FKM KL+PDEKI+ N A+P+PVNGLPV L
Sbjct  443   TRFKMHKLIPDEKII-NLASPTPVNGLPVLL  472



>ref|XP_010056285.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72950.1| hypothetical protein EUGRSUZ_E01401 [Eucalyptus grandis]
Length=479

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/465 (54%), Positives = 351/465 (75%), Gaps = 17/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGES+D +       P+K+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSAPNLPPGKKGWPIIGESLDFVGAGKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNI  463
             LGE +AVFCGA+GNKF F+ ++  +TTWWP S+ K  +FP   T+ K +  +    R+ +
Sbjct  80    LGEDMAVFCGASGNKFLFSGQDKYITTWWPSSMKKVTIFP--ETMEKFNKDDPKKMRSFL  137

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              E  KPE L+HYIP +DSM +EH+  +W P++EVKV+ L+K YTF LAC+LF++I+    
Sbjct  138   PEFLKPEALQHYIPVMDSMTREHLESDWYPYKEVKVFPLTKNYTFALACRLFMNIKDPQV  197

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V +   P   ++ G  S+P+NFPGT +N+A++GG ++R++L+ +I++RK E    S GK 
Sbjct  198   VSKFASPFARIAPGFTSVPINFPGTPFNKAVEGGKVIRQELLNIIRQRKKEI---SEGK-  253

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
             + + RD+L RLL   D++G    E ++ + IIG+L+ ++ + S +IT ++ +LA LPHIY
Sbjct  254   DAKSRDLLSRLLTEADDDGSVYYEMDVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIY  313

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             ++VYKEQ+EIAKSK P E L+W+D+QKMKYSWNV CE++RL PP QG FRE +++FT+AG
Sbjct  314   EKVYKEQMEIAKSKAPGELLNWDDIQKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAG  373

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWKTFW VY+THKNPKYF +PEKFDPSRFEG+GP PFT+VPFG GPRMCPGKEYA
Sbjct  374   YTIPKGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPTPFTYVPFGGGPRMCPGKEYA  433

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             RLEIL+F+HN+VT FK+EK++PDEKI Y N +P P NGL +RL P
Sbjct  434   RLEILIFIHNLVTKFKLEKVIPDEKIFY-NPSPVPANGLLIRLRP  477



>ref|XP_010056287.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72954.1| hypothetical protein EUGRSUZ_E01406 [Eucalyptus grandis]
Length=479

 Score =   529 bits (1362),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 347/465 (75%), Gaps = 17/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++   +  +  PNLPPG  GWP+IGES++ +       P+K+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLAFRKKSPAPNLPPGKKGWPIIGESLEFVGTAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNI  463
             LGE +AVFCGA+GNKF F+ +N  +TTWWP S+ K ++FP   T+ K +  +    R+ +
Sbjct  80    LGEDMAVFCGASGNKFLFSGQNKYVTTWWPTSMKKVVIFP--ETMEKFNKDDPKKMRSFL  137

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              E  KPE L+ YIP +DSM +EH+  +W+P++EVKV+ L+K YTF LAC+LF++I+    
Sbjct  138   PEFLKPEALQCYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPKV  197

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V +  DP   ++ G  S+P+N PGT +N+A+ GG ++R++L+ +I++RK E    S GK 
Sbjct  198   VSKFADPFARIAPGFTSVPINIPGTPFNKAVGGGKLIRQELLNIIRQRKQEI---SEGKD  254

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              N  RD+L RLL   D++G    E  + + IIG+L+ ++ + S +IT ++ +LA LPHIY
Sbjct  255   AN-ARDLLTRLLTEADDDGSVFYEMNVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIY  313

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             ++VYKEQ+EIAKSK P E L+W D+QKMKYSWNV CE++RL PP QG FRE +++F++AG
Sbjct  314   ERVYKEQMEIAKSKAPGELLNWNDIQKMKYSWNVACESMRLTPPAQGAFREAITDFSFAG  373

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWK FW VY+THKNPKYF +PEKFDPSRFEG+GPAPFT+VPFG GPRMCPGKEYA
Sbjct  374   YTIPKGWKAFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPAPFTYVPFGGGPRMCPGKEYA  433

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             RLEILVF+HN+VT FK+EK++PDEKI+Y N +P P NGL +RL P
Sbjct  434   RLEILVFIHNLVTKFKLEKVIPDEKIIY-NPSPVPANGLLIRLKP  477



>ref|XP_010070480.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW59275.1| hypothetical protein EUGRSUZ_H01951 [Eucalyptus grandis]
Length=479

 Score =   527 bits (1357),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 350/465 (75%), Gaps = 17/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGES++         P+K+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSAPNLPPGKKGWPIIGESLEFFGAAKSGCPEKFINDRTTKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNI  463
             LGE +AVFC A+GNKF F+ ++  +TTWWP S+ K ++FP   T+ K +  +    R+ +
Sbjct  80    LGEDMAVFCSASGNKFLFSGQDKYITTWWPSSMKKVIIFP--KTMEKFNKDDPKKMRSFL  137

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              E  KPE L++YIP +DSM +EH+  +W+P++EVKV+ L+K YTF LAC+LF++I+    
Sbjct  138   PEFLKPEALQNYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPQV  197

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V +  DP   ++ G  S+P+N PGT +N+A++ G ++R++L+ +I++RK E    S GK 
Sbjct  198   VSKFADPFARIAPGFTSVPINIPGTPFNKAVEAGKVIRQELLNIIRQRKKEI---SEGK-  253

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
             + + RD+L RLL   D++G    E ++ + IIG+L+ ++ + S +IT ++ +LA LPHIY
Sbjct  254   DAKSRDLLSRLLTEADDDGSVYYEMDVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIY  313

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             ++VYKEQ+EIAKSK P E L+W+D+QKMKYSWNV CE++RL PP QG FRE +++FT+AG
Sbjct  314   EKVYKEQMEIAKSKAPGELLNWDDIQKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAG  373

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWKTFW VY+THKNPKYF +PEKFDPSRFEG+GP PFT+VPFG GPR CPGKEYA
Sbjct  374   YTIPKGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPTPFTYVPFGGGPRKCPGKEYA  433

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             ++EIL+F+HN+VT FK+EK++PDEKI+Y N +P P NGL +RL P
Sbjct  434   QIEILIFVHNLVTKFKLEKVIPDEKIIY-NPSPVPANGLLIRLRP  477



>ref|XP_010063751.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW71006.1| hypothetical protein EUGRSUZ_F04112 [Eucalyptus grandis]
Length=482

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 347/468 (74%), Gaps = 17/468 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             I++ + +   S PNLPPG  GWP+IGES++ +       P+K+I+DR  KYS EVF+TS+
Sbjct  20    ILFLVFRKKPSPPNLPPGRRGWPLIGESLEFVGTAKGGCPEKFIADRTAKYSSEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNI  463
             LGE +AVFCGA+GNKF F+ +N  +TTWWP S+ K L+FP   TL K +  +    R+ +
Sbjct  80    LGENLAVFCGASGNKFLFSGQNKYITTWWPSSMKKVLVFP--ETLEKFNKDDPKKMRSFL  137

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              E  KPE L+HYIP +DSMA++H+  +W    EV+V+  +K YTF LAC+LF++I+    
Sbjct  138   PEFLKPEALQHYIPIMDSMARDHLDTDWLRREEVEVFPSAKNYTFALACRLFMNIKDPKI  197

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V +  DP   ++ G+ S+P+N PGT +++A++GG  +R +L+ +I++RK E    S GK 
Sbjct  198   VSKFADPFACIAPGLTSVPINLPGTPFSKAVEGGKQIREELLAIIRQRKKEL---SEGKD  254

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              N  RD+L RLL   D++G    E E+ + IIG+L+ ++ + S +IT V+ FLA+ P ++
Sbjct  255   AN-ARDLLSRLLLEADDDGSMFYEMEVSNKIIGLLIASHDTTSTSITVVVNFLAQFPDVF  313

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             Q+VY+EQ+EIAKSKGP+E L+W+D+QKMKYSWNV CE++RL PP QG FRE +++FT+AG
Sbjct  314   QRVYEEQMEIAKSKGPDELLNWDDIQKMKYSWNVACESIRLCPPAQGAFREAITDFTFAG  373

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWKTFW VYSTHKNPKYF +PEKFDPSRFEG GPAPFT+VPFG GPRMCPGKEYA
Sbjct  374   YTIPKGWKTFWTVYSTHKNPKYFPDPEKFDPSRFEGDGPAPFTYVPFGGGPRMCPGKEYA  433

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             RLE+LVF+HN+VT FK+EK +PDEKI+Y N +P P NGL +RL  H +
Sbjct  434   RLELLVFIHNLVTRFKIEKAIPDEKIIY-NPSPVPANGLLIRLRTHNE  480



>gb|EYU22845.1| hypothetical protein MIMGU_mgv1a021193mg [Erythranthe guttata]
Length=473

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/451 (55%), Positives = 339/451 (75%), Gaps = 7/451 (2%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             T   NLPPGS GWP++GE+++     P K+I DRM+KYSPEVF TS+LG+K+A+FCGA G
Sbjct  28    TGSKNLPPGSNGWPLLGENMEFAFSGPQKFIQDRMRKYSPEVFMTSLLGQKIAIFCGAKG  87

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F N++ L T++W QS+ K L+FP       IS L R+   +  KPE LK YIP +D
Sbjct  88    NKFLFMNDDKLFTSFWLQSMKKALLFPEPAKGNFISILKRSYHGDFLKPEALKQYIPAMD  147

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
             ++A++H+   W P   V+V+ LSK YTF LAC+LFL++     + +L  P  +V+SGM  
Sbjct  148   ALARQHLDSYWIPNSVVEVFPLSKKYTFELACRLFLNVVDPAHIGKLSGPFTLVTSGMLY  207

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             +P+N PGTAY+RA+KGG +VR ++V ++ +R+ E +M+     E EGRD+L ++L LTDE
Sbjct  208   VPVNLPGTAYHRAVKGGKLVREKVVSIVTKRRKELVMNE----ETEGRDLLSKMLLLTDE  263

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
             +G+ L+E E+ +  IG L+ +Y + S+AIT V+ +LAE PH+Y++V+KEQ+ IAKSKGP+
Sbjct  264   DGRFLSEMEVSNIFIGYLVASYMTTSSAITVVMNYLAEFPHVYREVFKEQMAIAKSKGPD  323

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTH  1234
             E L+WED++KMKYSWNV  E+ RL PP QG  RET +EFTYAGFTIPKG K  W V+S+H
Sbjct  324   ELLTWEDIEKMKYSWNVARESFRLMPPAQGAIRETTNEFTYAGFTIPKGSKIVWTVHSSH  383

Query  1235  KNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKM  1414
             KNP+YF EPEKFDP+RFEGSGPAP+T+VPFG G R+CPG EYARLE+LVFMHNVVT FK+
Sbjct  384   KNPEYFPEPEKFDPTRFEGSGPAPYTYVPFGGGSRICPGIEYARLEVLVFMHNVVTRFKL  443

Query  1415  EKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             EK +P+EKI++ +A   P +GLP+RL PH+K
Sbjct  444   EKAIPNEKILF-HAETVPAHGLPLRLHPHEK  473



>ref|XP_006376223.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
 gb|ERP54020.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
Length=486

 Score =   512 bits (1319),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 337/464 (73%), Gaps = 11/464 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I+ + K  +S    PPG  GWP+IGE+   ++      P+K+ +DRMKKYS EVF+TS+
Sbjct  21    LIFLVYKKKSSNIKFPPGRIGWPIIGEAWGFVMAGKRGTPEKFFNDRMKKYSTEVFQTSL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHE  469
              G+ +AVFCGA+GNKF F++EN  + TWWP+++ K + FP    N+  + +   R  + E
Sbjct  81    FGDNMAVFCGASGNKFLFSSENKYVATWWPRTIKKIIYFPEHVDNSSIEETAALRRFLPE  140

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+HYIP +DSMA+E +  +W P ++V+V+ LSK YTF LAC+LF+ I   D V 
Sbjct  141   FLKPEALQHYIPIMDSMAREQLEADWCPHKQVRVFPLSKKYTFALACRLFMRIRDPDHVT  200

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL +   +V+ G+ S+P+NFPGT YNRA+KGG M+R +L+ ++K+R+ E +  S  K + 
Sbjct  201   RLANQFALVTDGLVSVPINFPGTTYNRAIKGGKMIREELLAIMKQREGELI--SDNKDDA  258

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L R+L  +D+ G+ +N  EI + I+G+L+ ++ + S++IT V+ +LA+ P IYQ+
Sbjct  259   GAIDLLTRMLITSDDNGKTMNHKEIANKIVGLLVASHDTTSSSITMVMYYLAQHPCIYQK  318

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V KEQ EIA SK P E L+W DVQKMKYSW VVCEA+R   P QG FRE +++F YAGF 
Sbjct  319   VLKEQTEIAMSKAPGELLNWNDVQKMKYSWCVVCEAMRFSSPSQGAFREAITDFFYAGFI  378

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK  W+V+STHKNPKYF +PE+FDPSRFEGSGPAP+TFVPFG GPRMC GKEYARL
Sbjct  379   IPKGWKVHWSVHSTHKNPKYFPDPERFDPSRFEGSGPAPYTFVPFGGGPRMCAGKEYARL  438

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EILVFMHNVVT FK EK++P+EK++ N + P PVNGLP+ L PH
Sbjct  439   EILVFMHNVVTKFKWEKIIPEEKVL-NISFPMPVNGLPILLQPH  481



>gb|KCW72951.1| hypothetical protein EUGRSUZ_E01403 [Eucalyptus grandis]
Length=459

 Score =   505 bits (1301),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 334/461 (72%), Gaps = 29/461 (6%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGES+D +       P+K+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSSPNLPPGKKGWPIIGESLDFVGAAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE +AVFCGA+GNKF F+ ++  +TTWWP                  S++ +  + E  
Sbjct  80    LGEDMAVFCGASGNKFLFSGQDKYITTWWP------------------SSMKKLLLLEFL  121

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+HYIP +DSM +EH+  +W+P++EVKV+ L+K YTF LAC+LF++I+    V + 
Sbjct  122   KPEALQHYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPQVVSKF  181

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP   ++ G  S+P+N  GT +++A++GG ++R++L+ +I++R  E       K+    
Sbjct  182   ADPFARIAPGFTSVPINISGTPFSKAVEGGKVIRQELLNIIRQRTKEISEGKDAKL----  237

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             RD+L RLL   D++G    E ++ + I G+L+ +Y +   +IT ++ +LA LPHIY++ Y
Sbjct  238   RDLLSRLLTEADDDGSVYYEMDVSNKIFGLLIASYDTTGTSITVIVNYLASLPHIYEKAY  297

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIAKSK   E L+W+D++KMKYSWNV CE++RL PP QG FRE +++FT+AG+TIP
Sbjct  298   KEQMEIAKSKAAGELLNWDDIRKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAGYTIP  357

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWKTFW VY+THKNPKYF +PEKFDPSRFEG+G  PFT+VPFG GPRMCPGKEYARLEI
Sbjct  358   KGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGLTPFTYVPFGGGPRMCPGKEYARLEI  417

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             L+F+HN+VT FK+EK++PDEKI+Y N +P P NGL +RL P
Sbjct  418   LIFIHNLVTKFKLEKVIPDEKIIY-NPSPVPANGLLIRLRP  457



>ref|XP_002279623.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=476

 Score =   504 bits (1299),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 256/467 (55%), Positives = 337/467 (72%), Gaps = 18/467 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II+ +++  ++   LPPG  GWP+IGE+ +  +      P+++I+DRMKKYSP VF+TS+
Sbjct  19    IIFLVSRRKSACSKLPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMF---PTQNTLRKISTLNRNNIH  466
             LGEKVAVFCG AGNKF F+N N L+TTW P S+ K L+F   P +   R +    R+ + 
Sbjct  79    LGEKVAVFCGPAGNKFLFSNHNKLITTWKPPSMEKALLFQSSPPKAEPRGM----RSFVL  134

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
             E  +P+ L+  I  +DSMA ++I  +WAP +EV VY LSK YTFTLAC LF+SI+  + +
Sbjct  135   EFLRPDALQRNIHIMDSMAHQNINTDWAPHKEVNVYPLSKKYTFTLACHLFISIKDPEHI  194

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              R+  P   + SG+ SLP++FPGTA+N A KGG M+R +LV +IK+R+ E     S K E
Sbjct  195   ARIARPFHQMLSGLVSLPIDFPGTAFNSAKKGGKMLRHELVAIIKQRRKEL----SEKEE  250

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  RD+L  LL  TDE G  LN+ EI   I+GI L ++ S S  +TF+  +LAE PH Y 
Sbjct  251   SVARDLLSSLLLATDENGAVLNDMEISDKIVGIFLASFDSTSTTLTFIFNYLAEFPHAYD  310

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KEQ+EIA SK P E L W D+QKMKY+W VV E +RL PP QG FRE +++FT+ GF
Sbjct  311   KVLKEQMEIAMSKDPEEFLKWNDIQKMKYTWCVVKETMRLAPPAQGTFREAITDFTFEGF  370

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIPKGWKT+W+V+ST+KNPKYF +PEKFDPSRFEG GPAP+TFVPFG GPR+CPGKEY R
Sbjct  371   TIPKGWKTYWSVHSTNKNPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYVR  430

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             L ILVF+HN+VT FK  K++P+EKI+Y N +P PVNGLP+RL PH+K
Sbjct  431   LVILVFIHNMVTRFKWAKVVPNEKIIY-NPSPFPVNGLPIRLQPHEK  476



>ref|XP_002521782.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40592.1| cytochrome P450, putative [Ricinus communis]
Length=483

 Score =   504 bits (1299),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 340/467 (73%), Gaps = 14/467 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSIL  298
             I+ I K+  + P  PPG TGWPVIGE++D +      VPDK++  RMK YSP+VF+TS+L
Sbjct  17    IFLIYKSKPANPQFPPGKTGWPVIGETLDYLINARHGVPDKFVIKRMKTYSPDVFQTSLL  76

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEI  472
             G+++AVFCGA+GNKF F+  N  +  WWP+S+ + L+FP    N+  + S + R+ + + 
Sbjct  77    GDRMAVFCGASGNKFIFSTGNKFVQAWWPRSLKQALLFPETHDNSYNEESCILRSFLRDF  136

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
              + E LK YIP +DSMAKEH+  EW P++EVKV+   K Y F LAC++F+SI+    VKR
Sbjct  137   LRAEALKDYIPVMDSMAKEHLEAEWLPYKEVKVFPQVKTYIFALACRMFMSIKDPVHVKR  196

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
             + D   +V++G+FSLP+N PGTA+NRA +GG ++R + + +IK+R++E ++ + G  E  
Sbjct  197   VKDLFDVVAAGVFSLPVNIPGTAFNRAFRGGKIMREEFLAIIKQRRSE-LLENKG-TEEA  254

Query  833   GRDVLGRLLNLTD---EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
             G D++ R+L   D   +EG  L+E +I + I+G+L+  Y + + ++T ++ +LAE P+IY
Sbjct  255   GMDLMSRMLLGLDHDHQEGGTLDEMKIANRIMGLLIAGYDTTTISLTAIVNYLAENPNIY  314

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +V +EQ+EIAKSK P E L+W DVQKMKY+W V CE++RL PP QG F+E  ++FTYAG
Sbjct  315   DKVLREQMEIAKSKIPGELLNWGDVQKMKYAWCVACESMRLSPPVQGTFKEVTTDFTYAG  374

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             F IPKGWKT W V+ST+K+PKYF +P KFDPSRFEG GP P+TFVPF  GPRMCPGKEYA
Sbjct  375   FIIPKGWKTHWTVHSTYKDPKYFPDPGKFDPSRFEGQGPPPYTFVPFAGGPRMCPGKEYA  434

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             R EILVF+HN+VT F+ EK++PDEKI+Y     +P NGLPVRL PHQ
Sbjct  435   RFEILVFVHNLVTKFQWEKVIPDEKIIYIPNV-TPENGLPVRLLPHQ  480



>ref|XP_002278948.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score =   504 bits (1298),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 247/468 (53%), Positives = 332/468 (71%), Gaps = 16/468 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I F+     S   LPPG  G P+IGESI+  +      P  +I+DRM +YSP+VF+TS+
Sbjct  20    LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-----RNN  460
             +GE +AV CGAAGNKF F+NEN L+ +WWP+SV K L FP+ N        +     ++ 
Sbjct  80    MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSVYKVLYFPSPNDKDSSGAADLMMNMKSY  139

Query  461   IHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRD  640
             + E  KP+ L+ YIP +DSMA+EHI  +WAP REVKV+ L + YTF LAC+LF+ I+G +
Sbjct  140   LIEFVKPDALQQYIPVMDSMAREHIDMDWAPNREVKVFQLVQKYTFALACRLFMYIQGEE  199

Query  641   EVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGK  820
              + ++  P  ++  G  S+P++ PGT +NR +KGG M+R ++  VIK R+ E +     K
Sbjct  200   NIAKIAHPFHLIVQGFMSVPIDLPGTGFNRGIKGGKMIREEIEAVIKRRRTELLEKGVSK  259

Query  821   VENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHI  1000
             V     D+L R+L   DE+G+HLN+ EI  Y++G+LL ++ + S+AITF LK+LA  P +
Sbjct  260   VP----DLLSRMLLSPDEKGRHLNDIEINSYMVGLLLASHDTTSSAITFTLKYLALFPDV  315

Query  1001  YQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYA  1180
             + +V KEQ+EIA+SKGP E L+W D+QKMKY+W V  E++RL PP QG FRE  ++FT+A
Sbjct  316   HNKVLKEQMEIAQSKGPGELLNWSDIQKMKYTWCVARESMRLAPPAQGAFREATTDFTFA  375

Query  1181  GFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEY  1360
             GFTIPKGWKT W V+STHKNPKYF  PEKFDPSRFEG GP P+TFVPFG GPRMC GKEY
Sbjct  376   GFTIPKGWKTHWCVHSTHKNPKYFPNPEKFDPSRFEGKGPEPYTFVPFGGGPRMCVGKEY  435

Query  1361  ARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ARLEILVF+HNVVT FK+E ++ +EKI++  +A  P  GLP+RL PHQ
Sbjct  436   ARLEILVFIHNVVTKFKLETVLENEKILFGLSA-LPAKGLPIRLQPHQ  482



>ref|XP_002319920.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
 gb|EEE95843.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
Length=500

 Score =   504 bits (1298),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 247/465 (53%), Positives = 340/465 (73%), Gaps = 13/465 (3%)
 Frame = +2

Query  137   IYFITKA---NTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKT  289
             +Y +  A    +S    PPG TGWP+IGE+ D +       P+K+++DRM KYS +VF T
Sbjct  35    LYLVVSAYRRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHT  94

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNI  463
             S+LG+ +A+FCG +GNKF F++EN  +TTWWP+ + + L FP +   + +  ST+ R  +
Sbjct  95    SLLGDNLAMFCGVSGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFL  154

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
              EI KPE LKHYIP +DSMAK+H+  +W+P+++V+V  LSK YTF LAC+LF++I+    
Sbjct  155   PEILKPEALKHYIPVMDSMAKDHLEADWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAH  214

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V RL +   +V++G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK E + S + + 
Sbjct  215   VSRLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGE-LASENYEE  273

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
               E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + + S+AIT V+ +LAE PHIY
Sbjct  274   RAEATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIY  333

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             Q V +EQ EIA SK P E L+W+DVQKMKYSW+V CE LR+ PP  G FRE +++F++AG
Sbjct  334   QGVLEEQKEIAMSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAG  393

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             FTIPKGWK +W+VYSTHKNPKYF +PEKFDPSRFEG GPAP+TFVPFG GP MC GKEYA
Sbjct  394   FTIPKGWKAYWSVYSTHKNPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYA  453

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             RLEILVFMHN+V   K EK++P+EKI+Y + A  PV GLPV L P
Sbjct  454   RLEILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQP  497



>ref|XP_011001074.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score =   502 bits (1293),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 245/463 (53%), Positives = 340/463 (73%), Gaps = 10/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++      +S    PPG TGWP+IGE+ D +       P+K+++DRM KYS +VF TS+
Sbjct  46    LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNIHE  469
             LG+ +A+FCGA+GNKF F++EN  +TTWWP+ + + L FP +   + +  ST+ R  + E
Sbjct  106   LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFLPE  165

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
             I KPE LK+YIP +DSMAK+H+  +W+P+++V+V  LSK YTF LAC+LF++I+    V 
Sbjct  166   ILKPEALKYYIPVMDSMAKDHLEADWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAHVS  225

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL +   +V++G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK E + S + +   
Sbjct  226   RLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGE-LASENYEERA  284

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + + S+AIT V+ +LAE PHIYQ+
Sbjct  285   EATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIYQR  344

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V +EQ EIA SK P E L+W+DVQKMKYSW+V CE LR+ PP  G FRE +++F++AGFT
Sbjct  345   VLEEQKEIAVSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAGFT  404

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+VYSTHKNPKYF  PEKFDPSRFEG GPAP+TFVPFG GP MC GKEYARL
Sbjct  405   IPKGWKAYWSVYSTHKNPKYFPNPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYARL  464

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             EILVFMHN+V   K EK++P+EKI+Y + A  PV GLPV L P
Sbjct  465   EILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQP  506



>ref|XP_011003986.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 334/465 (72%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I  + K        PPG TGWP+IGE+ D M+      P+K+I+DR+ KYSPEVF+TS+
Sbjct  20    LIVLLHKRKYWNTKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKYSPEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHE  469
             LG  +AVFCG+ GNKF +++EN  +T W P S++K L  P    N+ ++ S   R  + E
Sbjct  80    LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHSIMKILFSPEHASNSYKEDSAKLRKFLPE  139

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+HYIP +DSMAK+H+  +W P+++VKV+ LSK YTF+LAC+LF++I+  + V 
Sbjct  140   FLKPEPLQHYIPLMDSMAKDHLKADWFPYKQVKVFPLSKTYTFSLACRLFMNIKDPEHVS  199

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL +   I++ G+ SLPLNFPGTAYNRA+KGG+M+R +++ ++KER+       S + E 
Sbjct  200   RLQNHFNIITKGILSLPLNFPGTAYNRAIKGGNMIREEILGIMKERRELI----SERKEP  255

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E  D+L R+L +TDE    +N+ EI   ++G+L  ++ + SA+I+  + +LA  PH+Y +
Sbjct  256   EFIDLLTRMLLVTDENA--MNDMEIADRVVGLLFGSHDTTSASISMAMHYLANNPHVYTK  313

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V KEQ+EI K K P E L+W D+QKMKY+W VVCE +RL PPGQGGFRE +++F+YAGFT
Sbjct  314   VLKEQMEIQKLKAPGESLTWNDIQKMKYTWCVVCEVMRLSPPGQGGFREAITDFSYAGFT  373

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK  W+V+STHKNPKYF +PEKFDPSRFEG    P++FVPFG GPRMCPGKEYARL
Sbjct  374   IPKGWKVHWSVHSTHKNPKYFPDPEKFDPSRFEGKDIEPYSFVPFGGGPRMCPGKEYARL  433

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              ILVFMHNVVT FK E++  DEKI+Y  + P P   LP+ L PH+
Sbjct  434   AILVFMHNVVTQFKWERVTQDEKIIY-MSIPMPACSLPITLHPHK  477



>ref|XP_010252185.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=488

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 332/464 (72%), Gaps = 16/464 (3%)
 Frame = +2

Query  140   YFITK-ANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSIL  298
             YF+ K   T    LPPGS GWPV+GES++ +       P+K+  DRMKKYSPEVFKTS+L
Sbjct  31    YFVCKYKRTGGAYLPPGSLGWPVVGESLEFLSTGRNGTPEKFFEDRMKKYSPEVFKTSLL  90

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEI  472
             GE  AVFCGA GNKF F+NEN L+T+WWP+SV K  +FPT  Q + ++ +   R  +   
Sbjct  91    GEPAAVFCGAGGNKFLFSNENKLVTSWWPRSVEK--IFPTSLQTSTKEEAVKMRKLLPSF  148

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
              KPE L+ Y+  +D +A+ H+   W    +V V+ L K YTF+LAC+LF+SIE  D V +
Sbjct  149   LKPEALQKYVGIMDIVARRHLDASWDGKEQVTVFPLVKRYTFSLACRLFMSIEDPDHVAK  208

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
               DP  ++++G+ SLP+N PGT +NRA+K   ++R++L+ +I++RK +     + K  + 
Sbjct  209   FADPFHVLAAGVMSLPINLPGTPFNRAIKAAQLIRKELLAIIRKRKTDL----AEKTVSS  264

Query  833   GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQV  1012
              +D+L  +L  TDE G+ +NE +I   I+G+L+  + + SAAITF++K+LAELP IY +V
Sbjct  265   TQDILSHMLTTTDESGKFMNELDIADKILGLLIGGHDTASAAITFIMKYLAELPEIYNEV  324

Query  1013  YKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTI  1192
              KEQ EIAKSK   E L+WED+QKMKYSWNV CE +RL PP QG FRE +++FT+AGF+I
Sbjct  325   LKEQTEIAKSKASGELLTWEDIQKMKYSWNVACEVMRLAPPLQGTFREALTDFTFAGFSI  384

Query  1193  PKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLE  1372
             PKGWK +W   STH+NPKYF EP KFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLE
Sbjct  385   PKGWKLYWTSNSTHRNPKYFPEPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLE  444

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ILVF++++V  FK E  +PDEKI+  +  P P  GLPVRL PH+
Sbjct  445   ILVFIYHLVRRFKWENALPDEKIIV-DPMPQPAKGLPVRLQPHK  487



>ref|XP_011001073.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/463 (53%), Positives = 340/463 (73%), Gaps = 10/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             +++      +S    PPG TGWP+IGE+ D +       P+K+++DRM KYS +VF TS+
Sbjct  46    LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNIHE  469
             LG+ +A+FCGA+GNKF F++EN  +TTWWP+ + + L FP +   + +  ST+ R  + E
Sbjct  106   LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFLPE  165

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
             I KPE LK+YIP +DSMAK+H+  +W+P+++V+V  LSK YTF LAC+LF++I+    V 
Sbjct  166   ILKPEALKYYIPVMDSMAKDHLEVDWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAHVS  225

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL +   +V++G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK E + S + +   
Sbjct  226   RLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGE-LASENYEERA  284

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + + S+AIT V+ +LAE PHIYQ+
Sbjct  285   EATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIYQR  344

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V +EQ EIA SK P E L+W+DVQKMKYSW+V CE LR+ PP  G FRE +++F++AGFT
Sbjct  345   VLEEQKEIAVSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAGFT  404

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+VYSTHKNPKYF  PEKFDPSRFEG GPAP+TFVPFG GP MC GKEYARL
Sbjct  405   IPKGWKAYWSVYSTHKNPKYFPNPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYARL  464

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             EILVFMHN+V   K EK++P+EKI+Y + A  PV GLPV L P
Sbjct  465   EILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQP  506



>ref|XP_007023618.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26240.1| Cytochrome P450 [Theobroma cacao]
Length=478

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 247/463 (53%), Positives = 330/463 (71%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++ +    N S PNLPPG  G P+IGES++ ++      P+K+++DRM KYS +VFKTSI
Sbjct  20    VLLYSKNPNASHPNLPPGRMGLPLIGESLEYLLTGRKGYPEKFLNDRMAKYSSQVFKTSI  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE +AV CGAAGNKF F+NEN L+T WWP SV K     TQ + ++ S   R  +    
Sbjct  80    LGESMAVVCGAAGNKFLFSNENKLVTAWWPDSVNKIFPSSTQTSSKEESKKMRKMLPNFL  139

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H    W   +E+ V+ L+K YTF +ACK+FLSIE  + V + 
Sbjct  140   KPEALQRYIGMMDNIAQRHFEASWEGKQEITVFPLAKRYTFWVACKVFLSIEDPEHVSKF  199

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP   ++SG+ S+P+N PGT + RA+    ++R++L+ +IK+RK +   + +       
Sbjct  200   ADPFNALASGIISVPINLPGTPFRRAINASELIRKELMAIIKQRKIDLAENKAAP----N  255

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  TDE GQ+LNE  I   I+G+L+  + + SAAITF++K+LAELP IY +VY
Sbjct  256   QDILSHMLLATDENGQYLNELNIADRILGLLIGGHDTASAAITFIIKYLAELPDIYNEVY  315

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIA+SK P E L+WED+QKMKYSWNV CE +RL PP QG FRE +++FT++GF+IP
Sbjct  316   KEQMEIARSKEPGELLNWEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTFSGFSIP  375

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK  WNV STHKN + F EPEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  376   KGWKLHWNVNSTHKNVECFPEPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  435

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHNV+  F  EKL+PDEKI+  +  P P  GLPVRL PH+
Sbjct  436   LVFMHNVMKRFNWEKLLPDEKIIV-DPLPMPAKGLPVRLLPHK  477



>ref|XP_010669702.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=482

 Score =   496 bits (1278),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 331/464 (71%), Gaps = 15/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             I+++  K+     NLPPG TGWP++GE+++ +       P+K++ DRM KYS E FKT+I
Sbjct  22    IVFYKNKSIFFSANLPPGRTGWPLLGETLEFLSTGWRGHPEKFVYDRMVKYSQECFKTNI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHE  469
             LGE VA+ CGA GNKF F+NEN L+T WWP SV K  +FPT  Q   ++ +   R  + +
Sbjct  82    LGEPVAIVCGATGNKFLFSNENKLVTAWWPDSVNK--VFPTSLQTNSKEEAKKMRKLLPQ  139

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               K E L+ YI  +D+ A+ H A EW   +E+ V+ L+K YTF LAC+LFLS+E  D + 
Sbjct  140   FLKAEALQRYIGIMDTFAQRHFANEWENQKEICVFPLAKRYTFWLACRLFLSVEDPDHIA  199

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             R   P  ++++G+ S+P++FPGT +N+A+K   ++R++L  +IK+RK    +  + K   
Sbjct  200   RFAGPFHLLAAGIISIPIDFPGTPFNKAIKAAELIRKELKLIIKQRK----IDLAEKKAT  255

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L +T+E GQ++ E +I   I+G+L+  + + S  ITF++K+LAE PHIY  
Sbjct  256   PTQDILSHMLTITNENGQNMTEMDIADKILGLLIGGHDTASVVITFIVKYLAEFPHIYNA  315

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQ+EIAKSK P E L WED+QKMKYSWNV CE +RL PP QG FRE ++EFTYAGFT
Sbjct  316   VYKEQMEIAKSKAPGELLKWEDIQKMKYSWNVACEVMRLTPPQQGAFREAMTEFTYAGFT  375

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+ YSTH++PKYF +PEKFDP+RFEG+GPAP+T+VPFG GPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSAYSTHRDPKYFVDPEKFDPTRFEGNGPAPYTYVPFGGGPRMCPGKEYARL  435

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EIL FMHNVV  F+ EKL+ +EKI+  +  P P  GLP+RL PH
Sbjct  436   EILAFMHNVVKRFRWEKLLANEKIIV-DPFPVPTKGLPIRLIPH  478



>ref|XP_007023620.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26242.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score =   496 bits (1278),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 328/462 (71%), Gaps = 11/462 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             I  +  K N S+PNLPPG TG P IGES++ +       P+K+I DRM K+S +VF+TSI
Sbjct  23    IFSYACKTNASQPNLPPGKTGLPYIGESLEFLSTGRKGHPEKFIYDRMAKFSSQVFRTSI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AVFCGAAGNKF F+NEN L+T WWP SV K     TQ + ++ +   R  +    
Sbjct  83    LGEATAVFCGAAGNKFLFSNENKLVTAWWPNSVNKVFPSSTQTSSKEEAKKMRKLLPNFL  142

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ Y+  +D++A+ H    W   +EV V+ L+K YTF +A K+FLS+E    V +L
Sbjct  143   KPEALQRYVGMMDTIAQRHFESGWEGQQEVSVFPLAKNYTFWVASKVFLSVEDPKHVAKL  202

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  +++SG+ S+P++ PGT +NRA+K  +++R++L  +IK+RK +     + K  +  
Sbjct  203   GDPFNVLASGIISIPIDLPGTPFNRAIKASNLIRKELTAIIKQRKIDL----AEKKASPT  258

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  +DE G+++NE +I   I+G+L+  + + SAAITF++K+LAELP IYQ+V 
Sbjct  259   QDILSHMLLTSDENGRYMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPEIYQKVQ  318

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQ+EIAKSK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE ++EF YAGF IP
Sbjct  319   SEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALNEFIYAGFNIP  378

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STH+NP+ F EPEKFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  379   KGWKLYWSANSTHRNPECFPEPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  438

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LVFMHN+V  F  EKL+PDE I+  +  P P  GLPVRL P 
Sbjct  439   LVFMHNIVKRFNWEKLLPDENIIV-DPMPMPAKGLPVRLLPQ  479



>ref|XP_002325975.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
 gb|EEF00357.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
Length=478

 Score =   496 bits (1277),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 337/465 (72%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I  + K        PPG TGWP+IGE+ D M+      P+K+I+DR+ K+SPEVF+TS+
Sbjct  20    LIVLLHKRKFWNSKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKFSPEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHE  469
             LG  +AVFCG+ GNKF +++EN  +T W P  ++K L  P    N+ ++ S   R  + E
Sbjct  80    LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHPIMKVLFSPEHASNSYKEDSAKLRKFLPE  139

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+HYIP +DSMAK+H+  +W P+++VKV+ LSK YTF+LAC+LF++I+  ++V 
Sbjct  140   FLKPEPLQHYIPVMDSMAKDHLKADWFPYKQVKVFPLSKTYTFSLACRLFMNIKDPEQVS  199

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL +   +V+ G+ SLPLNFPGTAYNRA+KGG+M+R +++ ++KER+   ++S S   E 
Sbjct  200   RLQNHFNLVTKGILSLPLNFPGTAYNRAIKGGNMIREEILGLMKERRE--LISESK--EP  255

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E  D+L R+L +TDE    +++ EI   ++G+L  ++ + SA+I+  + +LA  PH+Y +
Sbjct  256   EFIDLLTRMLLVTDENA--MDDMEIADRVVGLLFGSHDTTSASISMAMYYLAGNPHVYTK  313

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V KEQ+EI K K P E L+W D+QKMKY+W VVCE +RL PPGQGGFRE +++F+YAGFT
Sbjct  314   VLKEQMEIQKLKAPGELLTWNDIQKMKYTWCVVCEVMRLSPPGQGGFREAITDFSYAGFT  373

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK  W+V+STHKNPKYF +PEKFDPSRFEG    P++FVPFG GPRMCPGKEYARL
Sbjct  374   IPKGWKVHWSVHSTHKNPKYFPDPEKFDPSRFEGKDIEPYSFVPFGGGPRMCPGKEYARL  433

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              ILVFMHNVVT FK EK++ DEKI+Y  + P P   LP+ L PH+
Sbjct  434   AILVFMHNVVTQFKWEKVIKDEKIIY-MSIPMPACSLPITLHPHK  477



>ref|XP_002526799.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF35534.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 236/450 (52%), Positives = 326/450 (72%), Gaps = 13/450 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG+ GWP IGES+  ++      P+K+I+DR+ KYS +VF+TS+LGE +AVFCGAAG
Sbjct  35    KLPPGTKGWPFIGESLAFLMTSRRGHPEKFINDRVTKYSADVFQTSLLGENMAVFCGAAG  94

Query  335   NKffftnentllttWWPQSVIKPLMFPTQN--TLRKISTLNRNNIHEIFKPENLKHYIPT  508
             NK  FT+EN  +  WWP+S++K  + P  +  + +++ST  R  + E  KPE L+  IP 
Sbjct  95    NKLLFTSENKYVKAWWPKSLLKAFLVPDPDEFSFKEVSTGYRRILTEFLKPEALQRSIPV  154

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +DSMA+EH+  +W PF+EVKV+ L + Y+F L+C+LF+SI+  + V +LL P  +VSSGM
Sbjct  155   MDSMAREHLKTDWHPFKEVKVFPLIRKYSFALSCRLFISIKDPNLVSKLLGPFALVSSGM  214

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              S+P+NFPGT Y +A+K   ++    +E++  RK E     + K      D+L RLL   
Sbjct  215   LSVPINFPGTPYYKAIKASKVINHDFLEIMNRRKLEL----AEKKNITSPDLLTRLLLHK  270

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             +++G+ + +  +Y  I+ +L  ++ +IS AITF+ K LAE PH+  +V+KEQ+EIAKSK 
Sbjct  271   EDDGRSMTDAGVYSRIMALLFASHDTISTAITFMFKHLAEHPHVSNRVFKEQMEIAKSKE  330

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
             P E L+WED+QKMKY+W V CE +RL PP QG FRE +++FTYAGFTIPKGWK +W V+S
Sbjct  331   PGELLNWEDIQKMKYTWCVACETMRLLPPSQGAFREAITDFTYAGFTIPKGWKIYWTVHS  390

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             THKNPKYF +PEKFDPSR+EG GPAP+TFVPFG GP MCPG+EYARLEIL+FMHN+VT F
Sbjct  391   THKNPKYFPDPEKFDPSRYEGDGPAPYTFVPFGGGPVMCPGREYARLEILIFMHNMVTKF  450

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             K  K++  EKI++ ++AP PV GLP+ L P
Sbjct  451   KWHKVIEGEKIIF-HSAPIPVKGLPILLEP  479



>ref|XP_011074929.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Sesamum indicum]
Length=421

 Score =   493 bits (1268),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 236/432 (55%), Positives = 323/432 (75%), Gaps = 17/432 (4%)
 Frame = +2

Query  218   IDLMVPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVI  397
             + L+   K++ +RM+KYSP+VF+TS+ GE++AVFCGA GNKF FTN+N LLT+W P+++ 
Sbjct  3     LALLGQQKFVKNRMEKYSPDVFQTSLFGERMAVFCGAQGNKFLFTNDNKLLTSWSPKTMT  62

Query  398   KPLMFP---TQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVK  568
             K  +F      + L++++ + R+  ++I KPE+LK YIP +D++A+EH+  EW P   V 
Sbjct  63    KTFLFTEFVDSSNLKQVTAVRRSFQYDILKPESLKQYIPVMDALAREHMDREWTPNALVN  122

Query  569   VYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGS  748
             V  LSK YTF LACKLFL +   +++KRL DP  + + GM  +P+N PG AYNRA++GG 
Sbjct  123   VVPLSKKYTFDLACKLFLDVVDVEDIKRLSDPFSLATQGMLGVPINLPGMAYNRAIRGGK  182

Query  749   MVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGIL  928
             M+R++L+ +I ER+ + +     K E   +D+L ++L +TDE GQ  +E EI + I+G L
Sbjct  183   MIRKELIRIINERRKKLL----EKKETRHQDLLSKMLLVTDENGQFYSEMEISNNIVGFL  238

Query  929   LPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVV  1108
             + ++ + S+A++ V+ +LA LPHIY+QV KEQ+EIAKSKGP+E L+WED+QKMKYSWNV 
Sbjct  239   VASFDATSSAVSSVINYLAHLPHIYEQVLKEQMEIAKSKGPDELLTWEDIQKMKYSWNVA  298

Query  1109  CEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFE  1288
              E+LRL P  QGGFRET +EFTYAGFTIPKGWKT W V+S+H+NP+YF EPEKFDPSRF+
Sbjct  299   RESLRLGPSSQGGFRETTTEFTYAGFTIPKGWKTHWTVHSSHRNPEYFPEPEKFDPSRFD  358

Query  1289  GSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSP  1468
             GSGP P+TFVPFG GPRMCPG+EYA+LEILVFMHNVV  FK+EK +P+E          P
Sbjct  359   GSGPPPYTFVPFGGGPRMCPGREYAKLEILVFMHNVVRRFKLEKAIPNE----------P  408

Query  1469  VNGLPVRLTPHQ  1504
             V+GL V L PH+
Sbjct  409   VDGLAVHLQPHE  420



>ref|XP_007014637.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY32256.1| Cytochrome P450 [Theobroma cacao]
Length=480

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 337/465 (72%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  K+N S PNLPPG  G P++GES++ +       P+K+I DR+ KYS +VFKT+I
Sbjct  22    VLFYRHKSNYSAPNLPPGKPGLPIVGESLEFLSTGWKGHPEKFIFDRIAKYSSQVFKTNI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHE  469
             LGE  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  + +
Sbjct  82    LGEPAAVFCGAAGNKFLFSNENKLVTAWWPSSVDK--IFPSSLQTSSKEESKKMRKLLPQ  139

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ YI  +D++A+ H A  W    EV V+ L+K YTF LAC+LFLSIE  + V 
Sbjct  140   FLKPEALQRYIGIMDTIAQRHFASGWENKDEVVVFPLAKRYTFWLACRLFLSIEDPNHVA  199

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +   P  +++SG+ SLP++ PGT +NR +K  + +R++LV++IK+RK +    + GK  +
Sbjct  200   KFEGPFHLLASGIISLPIDLPGTPFNRGIKASNFIRKELVKIIKQRKVDL---AEGKA-S  255

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L  +DE GQ +NE +I   I+G+L+  + + SAA TF++K+LAELPH+Y++
Sbjct  256   PTQDILSHMLLTSDENGQFMNEMDIADKILGLLIGGHDTASAACTFIVKYLAELPHMYEE  315

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQIEIA SK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F + GF+
Sbjct  316   VYKEQIEIANSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREAINDFIFNGFS  375

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STH+NP+ F +P KFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHRNPECFPDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK EKL+PDEKI+  +  P P  GLPV L PH+
Sbjct  436   EILVFMHNLVKRFKWEKLLPDEKIIV-DPMPMPAKGLPVHLYPHK  479



>ref|XP_002279608.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=481

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/465 (54%), Positives = 346/465 (74%), Gaps = 17/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +++ + +  ++   LPPG+ GWP+IGE++   +      P ++I +RM KYSP+VF+TS+
Sbjct  19    VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMF--PTQNTLRKISTLNRNNIHE  469
             +GEKVAVFCG AGNKF F+N N L+ TW P+S+ K L+F  P +   R +    R+ + E
Sbjct  79    VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSMEKILLFESPPKVEPRGL----RSYVLE  134

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               +P+ L+ YI  +DSMA+EHI  +WAP REVKVY LSK YTF LAC+LF+SI+  ++V 
Sbjct  135   FLRPDVLQRYIQIMDSMAREHIEMDWAPNREVKVYPLSKKYTFALACRLFMSIKDPEQVA  194

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             ++  P  +++SG+ S+P++FPGT +NRA KGG M+R +LV +IK+R+ E  +S  G  E 
Sbjct  195   KVAHPFHLITSGLVSVPIDFPGTPFNRAKKGGKMLRDELVAIIKQRRNE--LSDEG--EP  250

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E +D+L  LL  +DE G+ LN+ EI   I+G+ L ++ S SA +TFVL +LAE P +Y +
Sbjct  251   EVQDLLSSLLLQSDENGKGLNDMEISDKIVGLFLASFDSTSATLTFVLNYLAEFPDVYDK  310

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V KEQ+EIAKSK P E L W D+QKMKY+W+V  E +RL PP QG FRE +++FTY GFT
Sbjct  311   VLKEQMEIAKSKDPGEFLKWNDIQKMKYTWSVANETMRLAPPAQGTFREVITDFTYEGFT  370

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWKT+W+V++T++NPK+F +PEKFDPSRFEG GPAP+TFVPFG GPR+CPGKEY+RL
Sbjct  371   IPKGWKTYWSVHTTNRNPKHFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYSRL  430

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +ILVF+HN+VT FK EK+ P+EK++Y N +P PVNGLP+RL P +
Sbjct  431   QILVFIHNMVTRFKWEKVDPNEKVIY-NPSPIPVNGLPIRLHPRE  474



>ref|XP_010048517.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80785.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
 gb|KCW80786.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
Length=480

 Score =   493 bits (1268),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/463 (52%), Positives = 331/463 (71%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
              +++  +++ + PNLPPGS G P IGES+D +       P+++I DR+ +YS  VFKTS+
Sbjct  22    FLFYKHRSHYAGPNLPPGSIGLPFIGESLDFLSTGWKGHPERFIFDRIARYSSHVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  A+FCGAAGNKF F+NEN L+ +WWP SV K     TQ + ++ +   R  +   F
Sbjct  82    LGEPAAIFCGAAGNKFLFSNENKLVVSWWPNSVNKVFPSSTQTSSKEEAKKMRKMLPNFF  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D +A+ H A  W    EV V+ L+K YTF LA +LFLS+E    V R 
Sbjct  142   KPEALQRYIGIMDDIARRHFAMGWEGKDEVTVFPLAKRYTFWLAARLFLSVEDPSHVARF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  +++SG+ S+P++ PGT +NRA+K  + + ++L  +IK+RK +    + GK  +  
Sbjct  202   ADPFHLLASGIISIPIDLPGTPFNRAIKASNFIGKELRVIIKQRKVDL---AEGKASST-  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  TDE+G+H+ E +I   I+G+L+  + + SAA TFV+K+LAELP IY+QVY
Sbjct  258   QDILSHMLLATDEDGKHMTELDIADKILGLLIGGHDTASAACTFVVKYLAELPEIYEQVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIAKSK P E L+W+D+QKMKYSWNV CE +RL PP QGGFRE +++F + GF+IP
Sbjct  318   EEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGGFREVINDFIFNGFSIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHK+ +YF EPEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKIYWSANSTHKSAEYFPEPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHN+V  F+ EKL+PDEKIV  +  P P  GLPVRL  H+
Sbjct  438   LVFMHNLVKRFRWEKLLPDEKIVV-DPMPMPAKGLPVRLYAHK  479



>ref|NP_001268115.1| cytochrome P450 CYP716A15 [Vitis vinifera]
 dbj|BAJ84106.1| cytochrome P450 [Vitis vinifera]
Length=480

 Score =   491 bits (1265),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 335/463 (72%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  +++ + PNLPPG  GWP++GES++ +       P+K+I DR+ KYS EVFKTS+
Sbjct  22    LLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  + + F
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFF  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIE    V + 
Sbjct  142   KPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVAKF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  +++SG+ ++P++ PGT ++RA+K  + +R++L  +IK+RK +    + GK  ++ 
Sbjct  202   EKPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKA-SQN  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  TDE+G H+NE EI   I+G+L+  + + SAAITF++K++AELPHIY++VY
Sbjct  258   QDILSHMLLATDEDGCHMNEMEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEKVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIA SK P E L+W+DVQ M+YSWNV CE +RL PP QG FRE +++F + GF+IP
Sbjct  318   EEQMEIANSKAPGELLNWDDVQNMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHK+P+ F +PE FDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKSPECFPQPENFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHNVV  FK +KL+PDEKI+  +  P P  GLPVRL PH+
Sbjct  438   LVFMHNVVKRFKWDKLLPDEKIIV-DPMPMPAKGLPVRLHPHK  479



>ref|XP_002513183.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF49174.1| cytochrome P450, putative [Ricinus communis]
Length=477

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 325/452 (72%), Gaps = 15/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG TG P IGES++ +       P+K++SDRM+K+S +VF+TSILGE+ AV CGA G
Sbjct  31    NLPPGKTGLPYIGESLEFLSTGRKGHPEKFLSDRMEKFSRQVFRTSILGEQTAVVCGAQG  90

Query  335   NKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPT  508
             NKF F+NEN L+T WWP+S+++  +FP+  Q+T+       R  +    KPE L+ YI  
Sbjct  91    NKFLFSNENKLVTAWWPKSILR--LFPSSNQSTILAEGMRMRKMLPHFLKPEALQRYIGV  148

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D MA+ H  + W   +EV VY L+K YTF++ACK+FLS++   EV +   P   ++SG+
Sbjct  149   MDHMAQVHFQDSWENKQEVTVYPLAKMYTFSVACKVFLSMDDPKEVAKFAAPFNDMASGI  208

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              S+P+NFPGT++NR +K   ++R +++ +IK+R+ +   + +  ++    D+L  +L  T
Sbjct  209   ISIPINFPGTSFNRGLKASKIIRNEMLRMIKQRRKDLAENKATPMQ----DILSHMLVAT  264

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DEEGQ L E  I   II +L+  + + SA ITFV+KFLAELP IY QV KEQ+EIAKSK 
Sbjct  265   DEEGQRLGEVGIADKIISLLIGGHDTASATITFVVKFLAELPDIYDQVLKEQLEIAKSKE  324

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
             P E L+WED+QKMKYSWNV CE +RL PP QG FRE + +F YAGF+IPKGWK +W+ ++
Sbjct  325   PGELLTWEDIQKMKYSWNVACEVMRLAPPLQGSFREALHDFDYAGFSIPKGWKLYWSTHT  384

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             THKNP+YF++PEKFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEILVFMHN+   F
Sbjct  385   THKNPEYFSDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNIAKRF  444

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K  K++PDEKIV  +  P P  GLPV L P +
Sbjct  445   KWNKVIPDEKIVV-DPMPIPAKGLPVHLYPQK  475



>ref|XP_002528002.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34414.1| cytochrome P450, putative [Ricinus communis]
Length=471

 Score =   488 bits (1257),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 338/464 (73%), Gaps = 19/464 (4%)
 Frame = +2

Query  137   IYFITKAN-TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             + F  K+N +S+ NLPPG+TGWP+IGESI+ +       P+K+I DRM+K+S +VFKTS+
Sbjct  16    LIFKHKSNASSRKNLPPGNTGWPLIGESIEFLSTGRKGHPEKFIFDRMEKFSSKVFKTSL  75

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHE  469
             L E  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  + +
Sbjct  76    LLEPAAVFCGAAGNKFLFSNENKLVTAWWPNSVNK--IFPSSLQTSSQEESKRMRKLLPQ  133

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ YI  +D +A+ H A  W   ++V V+ L+K YTF LAC+LFLS+E R+EV+
Sbjct  134   FLKPEALQRYISIMDVIAQRHFAFGWNNKQQVTVFPLAKMYTFWLACRLFLSMEDREEVE  193

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +   P  +++SG+ S+P++FPGT +NR +K  + VRR+L+++I++RK +   + +   + 
Sbjct  194   KFAKPFDVLASGIISIPIDFPGTPFNRGIKASNEVRRELIKMIEQRKIDLAENKASPTQ-  252

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L   DE   ++NE +I   I+G+L+  + + SAAITFV+K+LAE+P +Y +
Sbjct  253   ---DILSHMLTTADE---YMNEMDIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYNK  306

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V +EQ+EIAK+K   E L+WED+QKM+YSWNV CE +RL PP QG FRE +++FTYAGFT
Sbjct  307   VLEEQMEIAKAKAAGELLNWEDIQKMRYSWNVACEVMRLAPPLQGAFREAMTDFTYAGFT  366

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W   STH+NP+ F EPEKFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  367   IPKGWKLYWGANSTHRNPECFPEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARL  426

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EILVFMHN+V  F+ EKL+P+EKI+  +  P P  GLP+RL PH
Sbjct  427   EILVFMHNIVKKFRWEKLLPEEKIIV-DPLPIPAKGLPLRLHPH  469



>ref|XP_010696134.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
 dbj|BAP59950.1| cytochrome P450 monooxygenase CYP716A49 [Beta vulgaris]
Length=483

 Score =   488 bits (1257),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 323/449 (72%), Gaps = 12/449 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP-EVFKTSILGEKVAVFCGAAG  334
             +PPG+ GWPV+GES++ +       P+K+I DR+ KY+P ++FKTSILGEKVAV CGAAG
Sbjct  34    VPPGTMGWPVVGESLEFLSTGWKGYPEKFIFDRLSKYAPNQIFKTSILGEKVAVICGAAG  93

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF ++NEN L+  WWP SV K     TQ + ++ S   R  +    KPE L+ YIP +D
Sbjct  94    NKFLYSNENKLVQAWWPSSVDKIFPSSTQTSSKEESKKMRKLLPNFLKPEALQRYIPIMD  153

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
             ++A  H+   W    +V+V+ L+K YTF LAC+LFLSIE  D V +  +P   +++G+ S
Sbjct  154   TIAIRHMESGWDGKDKVEVFPLAKRYTFWLACRLFLSIEDPDHVAKFAEPFNDIAAGIIS  213

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             LP+N PGT +NR +K  ++VR++L  +IK+RK +    + GK     +D+L  +L   DE
Sbjct  214   LPVNLPGTPFNRGIKSSNVVRKELRAIIKQRKLDL---ADGKASTT-QDILSHMLLTADE  269

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
             +G+ + E +I   I+G+L+  + + SAA TFV+K+LAELPH+Y+ V KEQ+EIAKSK   
Sbjct  270   DGRFMTEMDIADKILGLLIGGHDTASAACTFVVKYLAELPHVYEAVCKEQMEIAKSKAEG  329

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTH  1234
             E L+WED+QKMKYSWNV CE +RL PP QGGFRE +S+F Y GF +PKGWK +W+  STH
Sbjct  330   ELLNWEDIQKMKYSWNVACEVMRLAPPLQGGFREAISDFMYGGFQVPKGWKLYWSANSTH  389

Query  1235  KNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKM  1414
             +NP+ F EPEKFDPSRFEG GPAP+T+VPFG GPRMCPGKEYARLEILVFMHNVV  FK 
Sbjct  390   RNPECFPEPEKFDPSRFEGKGPAPYTYVPFGGGPRMCPGKEYARLEILVFMHNVVKRFKW  449

Query  1415  EKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EK++P+EK++  N  P P NGLPVRL PH
Sbjct  450   EKVLPNEKVIV-NPMPIPENGLPVRLFPH  477



>ref|XP_006338129.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=476

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/455 (53%), Positives = 320/455 (70%), Gaps = 11/455 (2%)
 Frame = +2

Query  158   NTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVF  319
             N S   LPPG TGWPV GES++ +       P+K+I DR+ KYS  VFKT +LGE+ AVF
Sbjct  24    NKSGEGLPPGKTGWPVFGESLEFLSTGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVF  83

Query  320   CGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHY  499
             CGA+GNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +   FKPE L+ Y
Sbjct  84    CGASGNKFLFSNENKLVQAWWPNSVNKVFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRY  143

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             +  +D + + H A  W    +V V+ L+K YTF LAC+LFLS+E  + V +  DP  +++
Sbjct  144   VGIMDHITQRHFASGWENKEQVVVFPLTKRYTFWLACRLFLSVEDPNHVAKFADPFDVLA  203

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
             SG+ S+P++ PGT +NRA+K    +R++LV +IK+RK +      GK  +  +D+L  +L
Sbjct  204   SGLISIPIDLPGTPFNRAIKASIFIRKELVRIIKQRKIDL---GEGKASST-QDILSHML  259

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
                DE G+ + + +I   I+G+L+  + + S+A  F++K+LAELPHIYQ+VY EQ+EIAK
Sbjct  260   LTCDENGKFMGDLDIADKILGLLIGGHDTASSACAFIVKYLAELPHIYQRVYTEQMEIAK  319

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKGP E L WED+QKMKYSWNV CE LRL PP QG FRE +S+F + GF+IPKGWK +W+
Sbjct  320   SKGPGELLRWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFIFNGFSIPKGWKIYWS  379

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
               STHK+ ++F +PEKFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V
Sbjct  380   ANSTHKSGEFFPDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLV  439

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
               FK EK++PDEKI+  N  P P  GLPVRL PH 
Sbjct  440   KRFKFEKIIPDEKIIV-NPMPIPAKGLPVRLYPHH  473



>gb|AGN04219.1| cytochrome P450 [Salvia miltiorrhiza]
Length=474

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/462 (52%), Positives = 328/462 (71%), Gaps = 11/462 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +YF+     +   LPPG TGWPVIGES++ +       P+K+I DRM KYSP VF+T +L
Sbjct  17    LYFLFYKTKAGARLPPGRTGWPVIGESLEFLSIGWKGHPEKFIFDRMAKYSPTVFRTHLL  76

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GE+ AVFCGAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +  I K
Sbjct  77    GERAAVFCGAAGNKFLFSNENKLVQAWWPASVDKIFPSSTQTSSKEEAIKMRKMLPNILK  136

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L  Y+  +D +A+ H A+ W   +EV V+ L+K YTF LAC+LF+SIE   +V++  
Sbjct  137   PEALHRYVEIMDHIARRHFADGWDNKKEVVVFPLAKNYTFWLACRLFVSIEDPAQVQKFA  196

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             +P  +++SG+ S+P++ PGT +N+ +K  + VR++LV +IK+RK +    + GK  +  +
Sbjct  197   EPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKELVAIIKQRKLDL---ADGKA-SPTQ  252

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L  TD+ G+ ++E +I   I+G+L+  + + S+A  F++K+LAELPHIY +VY 
Sbjct  253   DILSHMLLATDDSGKSMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPHIYDRVYH  312

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+ IA+SK   E L WEDVQKMKYSWNV CE +R+ PP QG FRE +++FTY GF+IPK
Sbjct  313   EQMGIARSKAAGELLKWEDVQKMKYSWNVACEVMRMAPPLQGAFREALTDFTYNGFSIPK  372

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STHKNP++F EP KF+P+RFEGSGPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  373   GWKLYWSANSTHKNPEFFAEPMKFEPARFEGSGPAPYTFVPFGGGPRMCPGKEYARLEIL  432

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMH++VT FK E L+P+E IV  +  P P  GLPVRL PH+
Sbjct  433   VFMHHLVTRFKWEMLIPNETIVV-DPMPIPAKGLPVRLFPHR  473



>ref|XP_011078182.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 329/462 (71%), Gaps = 13/462 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I++ TK  +    LPPG TGWPVIGES++ +       P+K+I DRM +YS  VFKT +
Sbjct  22    LIFYKTKPASGA--LPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMVRYSSYVFKTHL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE+ AVFCGAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    
Sbjct  80    LGEQAAVFCGAAGNKFLFSNENKLVQAWWPSSVDKIFPSSTQTSSKEEAIKMRKMLPNFL  139

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L  Y+  +D +A+ H A+ W    EV V+ L+K YTF LAC+LF+SIE   +V + 
Sbjct  140   KPEALHRYVGIMDHIARRHFADGWENKEEVVVFPLAKNYTFWLACRLFVSIEDPQQVDKF  199

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              +P  +++SG+ S+P++ PGT +N+ +K  + +R++LV +IK+RK +    + GK  +  
Sbjct  200   AEPFNLLASGLISIPIDLPGTPFNKGIKASNYIRKELVSIIKQRKVDL---AEGKA-SPT  255

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY  VY
Sbjct  256   QDILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYDGVY  315

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIAKSKGP E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F+Y GF+IP
Sbjct  316   KEQMEIAKSKGPGELLNWDDLQKMKYSWNVACEVLRLAPPLQGAFREAIADFSYNGFSIP  375

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKNP+ F EP+KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  376   KGWKLYWSANSTHKNPECFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEI  435

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LVFMH++V  F+ EK MPDEKIV  +  P P  GLPVRL PH
Sbjct  436   LVFMHHLVKRFRWEKTMPDEKIVV-DPMPIPAKGLPVRLYPH  476



>ref|XP_002266024.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=480

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 332/462 (72%), Gaps = 11/462 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  +++ + PNLPPG  GWP++GES++ +       P+K+I DR+ KYS EVFKTS+L
Sbjct  23    LFYKHRSHFTGPNLPPGRIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSLL  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GE  AVF GAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    K
Sbjct  83    GEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPRFLK  142

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D +A+ H A+ W    EV V+ LSK +TF LAC+LF+SIE  D + +  
Sbjct  143   PEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLSKRFTFWLACRLFMSIEDPDHIAKFE  202

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
              P  +++SG+ ++P++ PGT ++RA+K  + +R++L  +IK+RK +    + GK  +  +
Sbjct  203   KPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKA-SPTQ  258

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  LL  TDE+G+H+NE  I   I+G+L+  + + S+AITF++K++AELPH+Y++VY+
Sbjct  259   DILSDLLLATDEDGRHMNEINIADKILGLLIGGHDTASSAITFIVKYMAELPHMYEKVYE  318

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EIA SK P E L+W+DVQKM+YSWNV CE +RL PP QG FRE +++F + GF+IPK
Sbjct  319   EQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIPK  378

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STHK+PK F EPEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  379   GWKLYWSTSSTHKSPKCFPEPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARLEIL  438

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMHNVV  FK +KL+PDEKI+ +     P  GLPVRL  H+
Sbjct  439   VFMHNVVKRFKWDKLLPDEKIIIDPMR-MPAKGLPVRLRLHK  479



>ref|XP_011031513.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=476

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 331/462 (72%), Gaps = 18/462 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             I F  +   S   LPPG+ GWP+IGE+++  +      P+ ++ DRM KYSPEVFKTS+ 
Sbjct  18    IMFFRRRKLSGLRLPPGNKGWPIIGETLEFAMNHRRGCPENFVIDRMCKYSPEVFKTSLF  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP-TQNTLRKISTLNRNNIHEIF  475
             GEK+ VFCGA+GNKF FTN N  +T+WWP S+ K   FP  Q    ++    R+ + E  
Sbjct  78    GEKIVVFCGASGNKFLFTNHNKYVTSWWPPSMAKVWYFPENQENTVEVCNKMRSVLPEFL  137

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KP+ L+ YIP +DSMAKE +  +W+P ++V+V++LSK YTF  ACK+F+++   +++ RL
Sbjct  138   KPDALQDYIPVMDSMAKEQLETDWSPHKQVRVFSLSKKYTFASACKVFMNLIDPEQLTRL  197

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              +P   + +G+ S+P+  PGTA++RA++GG +VR +L+ +I++RK E +       EN+G
Sbjct  198   SNPFTQIVAGLISIPIKIPGTAFSRAVEGGRIVREELLAIIRQRKRELL-------ENKG  250

Query  836   R---DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
                 D+L RLL  + E G+  +E +I + IIG+L+ ++ ++S A+T +L +LAE P +Y+
Sbjct  251   LKSIDLLTRLLLASYENGETNDEKQIANKIIGLLVASHDTMSTALTCILNYLAEYPKVYE  310

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              V +EQIEIAKSK P E L+W+DV+KMKYSW V CEA+RL PP  G FRE +++FTYAGF
Sbjct  311   DVLQEQIEIAKSKSPGELLNWDDVKKMKYSWCVACEAMRLSPPVPGTFREAITDFTYAGF  370

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIPKGWKTFW  YST++NP YF +PEKFDPSRFEG GPAP++FVPFG GPRMCPGKEYAR
Sbjct  371   TIPKGWKTFWTSYSTNRNPNYFPDPEKFDPSRFEGRGPAPYSFVPFGGGPRMCPGKEYAR  430

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             L  LVFMHNVVT FK  K+ PDEKI+Y N  P+P NGL + L
Sbjct  431   LATLVFMHNVVTKFKWRKVNPDEKIIY-NPTPTPANGLLIHL  471



>ref|XP_007011469.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY29088.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score =   487 bits (1253),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/467 (52%), Positives = 331/467 (71%), Gaps = 17/467 (4%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKT  289
             ++Y I +  A  +  NLPPG+TG P +GESI  +       P+K++ DRM K+S +VFKT
Sbjct  23    LVYLIHRRIAPVASKNLPPGTTGLPFLGESIQFLRAGQKGHPEKFVYDRMTKFSSKVFKT  82

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNI  463
             S+LGE  AVFCG+ GNKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  +
Sbjct  83    SLLGETAAVFCGSTGNKFLFSNENKLVTAWWPNSVNK--IFPSSLQTSSKQESIKMRKLL  140

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
                 KPE L+ Y+  +D +A+ H+A  W   +EV V+ L+K +TF LAC+LFLSIE    
Sbjct  141   PNFLKPEALQRYVSVMDMIAQRHLASSWDNEQEVTVFPLAKRFTFWLACRLFLSIEDPQH  200

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V +  +P   ++SG+ S+P++FPGT +NRA+K  +++R++L ++I+ RK +   + +   
Sbjct  201   VAKFSEPFNALASGIISIPIDFPGTPFNRAIKASNLIRKELRDIIRRRKVDLAENKASPT  260

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
             +    D+L  +L   DE GQ++NE EI   I+G+L+  + + S AITFV+K+LAELP +Y
Sbjct  261   Q----DILSHMLLTADENGQYMNEMEIADKILGLLIGGHDTASTAITFVVKYLAELPQVY  316

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +V KEQ+EIAKSK P E L+W+D+QKM+YSWNV CE +RL PP QG FRE +++F YAG
Sbjct  317   SEVLKEQMEIAKSKEPGELLNWDDIQKMRYSWNVACEVMRLAPPLQGAFREAMTDFIYAG  376

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             F+IPKGWK +W+  STH+NP+ F EPEKFDP RFEGSGPAP+TFVPFG GPRMCPGKEYA
Sbjct  377   FSIPKGWKLYWSANSTHRNPECFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             RLEILVFMHN+V  FK EKL+P EKI+  +  P P  GLPVRL PH+
Sbjct  437   RLEILVFMHNLVRRFKWEKLVPKEKIIV-DPMPMPEKGLPVRLLPHK  482



>gb|AHL46848.1| cytochrome P450, partial [Betula platyphylla]
Length=481

 Score =   486 bits (1251),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 329/463 (71%), Gaps = 12/463 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  +++ + PNLPPG TG+P+IGES++ +       P+K+I DRM K+S EVFKTS+L
Sbjct  23    LFYKHRSHFTGPNLPPGKTGYPMIGESLEFLSTGWKGHPEKFIFDRMTKFSSEVFKTSLL  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-RNNIHEIF  475
             G+  AVFCGAA NKF F+NEN L+T WWP SV K     TQ +  K      R  + +  
Sbjct  83    GQPAAVFCGAACNKFLFSNENKLVTAWWPDSVNKIFPSSTQTSNSKEEAKKMRKLLPQFL  142

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H A  W   +EV V+ L+K YTF LAC+LFLS+E  + + R 
Sbjct  143   KPEALQKYISIMDTIAQRHFASGWEGQKEVTVFPLAKRYTFWLACRLFLSLEDPNHIARF  202

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP   V+SG+ S+P++ PGT +NR +K  + +R++L  +IK+R+ +      GK  +  
Sbjct  203   ADPFHSVASGIISIPIDLPGTPFNRGIKASNFIRKELSLIIKQRRVDL---GEGKA-SPT  258

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  +DE GQ++ E +I   I+G+L+  + + SAA TF++K+LAELPHIY+ VY
Sbjct  259   QDILSHMLLTSDESGQYMTELDIADKILGLLIGGHDTASAACTFIVKYLAELPHIYEGVY  318

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQ+EIA SK P E L+WED+QKM+YSWNV CE LRL PP QG FRE +++F + GF+IP
Sbjct  319   NEQMEIANSKAPGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREAINDFIFNGFSIP  378

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STH++ +YF EPEKFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  379   KGWKLYWSANSTHRSAEYFPEPEKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYARLEI  438

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHN+V  F+ EK++PDEKIV  +  P P  GLPVRL PH+
Sbjct  439   LVFMHNLVKRFRWEKMIPDEKIVV-DPMPMPAKGLPVRLYPHK  480



>gb|KDP42281.1| hypothetical protein JCGZ_01605 [Jatropha curcas]
Length=474

 Score =   486 bits (1250),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 333/451 (74%), Gaps = 15/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPGSTGWP+IGESI+ +       P+K+I DRM K+S +VFKTS+  E  AVFCGAAG
Sbjct  29    NLPPGSTGWPLIGESIEFLTTGRKGQPEKFIFDRMVKFSNKVFKTSLFCEPAAVFCGAAG  88

Query  335   NKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPT  508
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  + +  KPE L+ YI  
Sbjct  89    NKFLFSNENKLVTAWWPSSVNK--IFPSSKQTSSQEESMRMRKLLPQFLKPEALQRYIGI  146

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D +A+ H A +W   ++V V+ L+K YTF+LAC+LFLS+E R++V++   P  +++S +
Sbjct  147   MDVVAQSHFAFDWDNKQQVTVFPLAKMYTFSLACRLFLSMEDREQVEKFAKPFDVLASAI  206

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              ++P++FPGT++NR +K  ++VR++L+++IK+RK +   + + + +    D+L  +L   
Sbjct  207   IAIPIDFPGTSFNRGIKASNLVRKELLKIIKQRKNDLGENKASQTQ----DILSHMLTTA  262

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             D++GQ ++E EI   I+G+L+  + + SAAITFV+K+LAE+P +Y++V++EQ+ IAK+K 
Sbjct  263   DDKGQFMSEIEIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYEKVFEEQMRIAKAKV  322

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
               E L+WED+QKMKYSWNV CE +RL PP QG FRE +++FTYA +TIPKGWK +W+  S
Sbjct  323   AGELLNWEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTYADYTIPKGWKLYWSANS  382

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             TH+NP+ F +PEKFDPSRF+G+GPAP+TFVPFG GPRMCPGKEYARLEIL+FMHN+V  F
Sbjct  383   THRNPECFHDPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILIFMHNIVKKF  442

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             K EKL+P E I+  +  P P  GLP+ L PH
Sbjct  443   KWEKLLPQENIIV-DPLPIPAKGLPIVLHPH  472



>emb|CAN72302.1| hypothetical protein VITISV_041935 [Vitis vinifera]
Length=480

 Score =   485 bits (1248),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 330/463 (71%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GES++ +       P+K+I DR+ KYS EVFKTS+
Sbjct  22    LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  + +  
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFL  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ Y   +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIE    V + 
Sbjct  142   KPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVAKF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  +++SG+ ++P++ PGT ++RA+K  + +R++L  +IK+RK +   S + K +   
Sbjct  202   EKPFHVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQ---  258

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  +L  TDE+G H+NE  I   I+G+L+  + + S+AITF++K++AELPHIY++VY
Sbjct  259   -DILSHMLLATDEDGCHMNEMXIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEKVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIA SK P E L+W+DVQKM+YSWNV CE +RL PP QG FRE +++F + GF+IP
Sbjct  318   KEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHK+ + F +PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKSLECFPQPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             L+FMHN+V  FK +KL+PDEKI+  +  P P  GLPVRL PH+
Sbjct  438   LIFMHNLVKRFKWDKLLPDEKIIV-DPMPMPAKGLPVRLHPHK  479



>ref|NP_001268076.1| cytochrome P450 CYP716A17 [Vitis vinifera]
 dbj|BAJ84107.1| Cytochrome P450 [Vitis vinifera]
Length=480

 Score =   485 bits (1248),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 330/463 (71%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GES++ +       P+K+I DR+ KYS EVFKTS+
Sbjct  22    LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  + +  
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFL  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ Y   +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIE    V + 
Sbjct  142   KPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVAKF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  +++SG+ ++P++ PGT ++RA+K  + +R++L  +IK+RK +   S + K +   
Sbjct  202   EKPFHVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQ---  258

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  +L  TDE+G H+NE  I   I+G+L+  + + S+AITF++K++AELPHIY++VY
Sbjct  259   -DILSHMLLATDEDGCHMNEMSIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEKVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIA SK P E L+W+DVQKM+YSWNV CE +RL PP QG FRE +++F + GF+IP
Sbjct  318   KEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHK+ + F +PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKSLECFPQPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             L+FMHN+V  FK +KL+PDEKI+  +  P P  GLPVRL PH+
Sbjct  438   LIFMHNLVKRFKWDKLLPDEKIIV-DPMPMPAKGLPVRLHPHK  479



>ref|XP_003530525.1| PREDICTED: cytochrome P450 716B2 [Glycine max]
Length=482

 Score =   484 bits (1247),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 235/465 (51%), Positives = 337/465 (72%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGES++ +       P+K+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNIHE  469
             LGE   +FCGA  NKF F+NEN L+  WWP SV K  +FPT   +  ++ S   R  + +
Sbjct  84    LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  141

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIE  + V 
Sbjct  142   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  201

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  +P  +++SG+ S+P++ PGT +N+A+K  + +R++L+++I++RK +    + GK  +
Sbjct  202   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKA-S  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  258   PTQDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  317

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAK K P E L+W+DV +M+YSWNV CE +R+ PP QGGFRE +++F + GF+
Sbjct  318   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  377

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHK+P+YF EPEKFDP+RFEG GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  378   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  437

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK +KL+PDEKI+  +  P P   LP+RL PH+
Sbjct  438   EILVFMHNLVKRFKWQKLIPDEKIIV-DPLPIPAKNLPIRLHPHK  481



>ref|XP_004239296.1| PREDICTED: beta-amyrin 28-oxidase [Solanum lycopersicum]
Length=476

 Score =   483 bits (1244),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 318/453 (70%), Gaps = 11/453 (2%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             S   LPPG TGWPV GES++ +       P+K+I DR+ KYS  VFKT +LGE+ AVFCG
Sbjct  26    SGEGLPPGKTGWPVFGESLEFLSSGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVFCG  85

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIP  505
             A+ NKF F+NEN L+  WWP SV K     TQ + ++ +   R  +   FKPE L+ Y+ 
Sbjct  86    ASANKFLFSNENKLVQAWWPNSVNKVFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYVG  145

Query  506   TIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSG  685
              +D + + H A  W    +V V+ L+K YTF LAC+LFLS+E    V +  DP  +++SG
Sbjct  146   IMDHITQRHFATGWENKEQVVVFPLTKRYTFWLACRLFLSVEDPKHVAKFADPFDVLASG  205

Query  686   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNL  865
             + S+P++ PGT +NRA+K  + +R++LV +IK+RK +      GKV +  +D+L  +L  
Sbjct  206   LISIPIDLPGTPFNRAIKASNFIRKELVRIIKQRKIDL---GEGKVSST-QDILSHMLLT  261

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
              DE G+ L + +I   I+G+L+  + + S+A +F++K+LAELPHIYQ+VY EQ+EIAKSK
Sbjct  262   CDENGKFLGDLDIADKILGLLIGGHDTASSACSFIVKYLAELPHIYQRVYTEQMEIAKSK  321

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
             GP E L WED+QKMKYSWNV CE LRL PP QG FRE +S+F + GF IPKGWK +W+  
Sbjct  322   GPGELLRWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMFNGFYIPKGWKIYWSAN  381

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STHK  ++F +PEKFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  
Sbjct  382   STHKREEFFPDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKR  441

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             FK EK++P EKI+  N  P P NGLP+RL PH 
Sbjct  442   FKFEKIIPHEKIIV-NPMPIPANGLPLRLYPHH  473



>ref|XP_002325964.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
 gb|EEF00346.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
Length=476

 Score =   483 bits (1243),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 329/459 (72%), Gaps = 12/459 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             I F  +   S   LPPG+TGWP+IGE+++  +      P+K++ DRM K+SPEVFKTS+ 
Sbjct  18    IIFFHRRKLSGFRLPPGNTGWPIIGETLEFAMNHRRGCPEKFVIDRMCKFSPEVFKTSLF  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP-TQNTLRKISTLNRNNIHEIF  475
             GEK+ VFCGA+GNKF FT+ N  +T+WWP S+ K   FP  Q    ++    R+ + E  
Sbjct  78    GEKIVVFCGASGNKFLFTSHNKSVTSWWPPSMAKVWFFPENQENTVEVCNKMRSVLPEFL  137

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KP+ L+ YIP +DSMAKE +  +W+P ++V+V++LSK YTF  ACK+F+++   +++ RL
Sbjct  138   KPDALQDYIPVMDSMAKEQLETDWSPHKQVQVFSLSKKYTFASACKVFMNLIDPEQLTRL  197

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              +P   + +G+ S+P+  PGTA++R ++GG + R +L+ +I++RK E + +     E + 
Sbjct  198   SNPFTHIVAGLISIPIKIPGTAFSRGVEGGKIAREELLAIIRQRKRELLENK----ELKS  253

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L RLL  + E G+  +E +I + IIG+L+ ++ ++S A+T +L +LAE P +Y+ V 
Sbjct  254   IDLLTRLLLASYENGETNDEKQIANKIIGLLVASHDTMSTALTCILNYLAEYPRVYEDVL  313

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQ+EIAKSK P E L+W+DV+KMKYSW V CEA+RL PP  G FRE +++FTYAGFTIP
Sbjct  314   HEQMEIAKSKNPGELLNWDDVKKMKYSWCVACEAMRLSPPVPGTFREAITDFTYAGFTIP  373

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK FW  YST++NPKYF +PEKFDPSRFEG GPAP++FVPFG GPRMCPGKEYARL  
Sbjct  374   KGWKAFWTTYSTNRNPKYFPDPEKFDPSRFEGRGPAPYSFVPFGGGPRMCPGKEYARLAT  433

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             LVFMHNVVT FK  K+ PDEKI+Y N  P+P NGL + L
Sbjct  434   LVFMHNVVTKFKWRKVNPDEKIIY-NPTPTPENGLLIHL  471



>ref|XP_007222742.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
 gb|EMJ23941.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
Length=482

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 326/463 (70%), Gaps = 11/463 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  +A  +  NLPPG  G+PVIGES + +       P+K+I DRM KYS +VFKTSI 
Sbjct  23    LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GEK A+FCGAA NKF F+NEN L+T WWP SV K      + + ++ +   R  +    K
Sbjct  83    GEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSQETSAKEEAKKMRKMLPNFMK  142

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D++A+ H A+ W   +EV+V+ L+K YTF LA +LF+S+E   E+ RL 
Sbjct  143   PEALQRYIGIMDTVAQRHFADGWENRKEVEVFPLAKNYTFWLAARLFVSLEDATEIARLG  202

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             DP  +++SG+ S+PL+FPGT + +A+K  + +R +L ++IK+RK +    + GK  +  +
Sbjct  203   DPFALLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKA-SPTQ  258

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L L DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +VYK
Sbjct  259   DILSHMLLLCDEHGTHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEVYK  318

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EI   K P E L+W+D+QKMKYSWNV  E LRL PP QG FRE +++F + GFTIPK
Sbjct  319   EQMEILSCKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALADFVFNGFTIPK  378

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STHKN  YF EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  379   GWKLYWSANSTHKNADYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEIL  438

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             VFMHN+V  FK EK++PDEKIV  +  P P  GLPVRL PH+K
Sbjct  439   VFMHNLVKRFKWEKILPDEKIVV-DPLPMPAKGLPVRLFPHKK  480



>ref|XP_010058451.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=474

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 332/455 (73%), Gaps = 17/455 (4%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+L PG+ GWPV+GE+++ M       P+K++ DR   +S +VF+T++ G  +AVFCGA+
Sbjct  27    PHLLPGTKGWPVVGETLEYMTAGRSGRPEKFVKDRAAWHSSDVFRTNLYGADMAVFCGAS  86

Query  332   GNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNIHEIFKPENLKHY  499
             GNKF F++EN  ++ WWP S+ K  MFP    L K+   +    R+ + E  KPE L+HY
Sbjct  87    GNKFLFSSENKHVSPWWPDSMKKIFMFP--EALGKLKNEDAKKRRSFMLEFLKPEALRHY  144

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             IP +DS+ ++H+A +W+P +EV+V+ L K YT  LAC+LF++I   + V++  DP   V+
Sbjct  145   IPVMDSVTRDHLATDWSPHKEVRVFPLLKSYTLALACRLFMNIRDPEIVRKFADPFARVA  204

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
              G  ++P+N PGT +NRA++GG ++R++L+++++ RK E    S GK  N  RD L RLL
Sbjct  205   PGFVTVPINIPGTPFNRAVEGGKVLRQELLDLVRRRKMEI---SEGKDAN-ARDFLSRLL  260

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
                 ++G  L E +    I+G+L  ++ + S +IT ++ +LA+ PH+Y++V++EQ+EIA+
Sbjct  261   LEGGDDGTALYEMDTSTKIMGLLNASHDTTSTSITAIVNYLAQFPHVYERVHQEQLEIAR  320

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKGP+E L+W+DVQKMKYSWNV CE++RL PP QG +R  +++F++AG+TIPKGWKTFW 
Sbjct  321   SKGPDEFLNWDDVQKMKYSWNVACESMRLLPPAQGAYRVAMTDFSFAGYTIPKGWKTFWT  380

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
             V+ST+KNPKYF +PEKFDPSRFEG+GPAPF +VPFG GP MCPGKEYARLEILVFMHN+V
Sbjct  381   VHSTNKNPKYFPDPEKFDPSRFEGNGPAPFIYVPFGGGPHMCPGKEYARLEILVFMHNLV  440

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             T FK+ K++P+EK +Y   +P PV GL +RL PH 
Sbjct  441   TKFKLMKVIPNEKFIY-TPSPVPVEGLHIRLLPHN  474



>ref|XP_011093941.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 328/462 (71%), Gaps = 12/462 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  K+ +  P LPPG TGWPV+GES++ +       P+K+I DR+ KYS  VF+T +L
Sbjct  23    LFYKNKSASGGP-LPPGRTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSSVFRTHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GEK  VFCGA+GNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    K
Sbjct  82    GEKAVVFCGASGNKFLFSNENKLVQAWWPSSVDKVFPSSTQTSSKEEAIKMRKMLPNFLK  141

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ Y+  +D +A+ H A+ W    E+ V+ L+K YTF LAC+LF+S+E  D V +  
Sbjct  142   PEALQRYVGIMDHIARRHFADGWENKDEIVVFPLAKNYTFWLACRLFISVEDPDHVNKFA  201

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             +P  +++SG+ S+P++ PGT + +A+K  + +R++LV +IK+RK +    + GK     +
Sbjct  202   EPFNLLASGLISIPIDLPGTPFYKAIKASNFIRKELVSIIKQRKIDL---AEGKA-TPTQ  257

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY+ VYK
Sbjct  258   DILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYEGVYK  317

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EIA SK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +S+F Y GF+IPK
Sbjct  318   EQMEIANSKKPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMYNGFSIPK  377

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STH+NP++F EPEKFDPSRFEGSGPAP++FVPFG GPRMCPGKEYARLEIL
Sbjct  378   GWKIYWSANSTHRNPEFFREPEKFDPSRFEGSGPAPYSFVPFGGGPRMCPGKEYARLEIL  437

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMH++V  F+ EK++PDEKIV  N  P P  GLPVRL PH 
Sbjct  438   VFMHHLVKRFRWEKIIPDEKIVV-NPMPIPAKGLPVRLHPHN  478



>emb|CBI39273.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   498 bits (1283),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/450 (56%), Positives = 328/450 (73%), Gaps = 12/450 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  GWP+IGE+ +  +      P+++I+DRMKKYSP VF+TS+LGEKVAVFCG AGN
Sbjct  490   LPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSLLGEKVAVFCGPAGN  549

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+N N L+TTW P S+ K L+F +     +   + R+ + E  +P+ L+  I  +DS
Sbjct  550   KFLFSNHNKLITTWKPPSMEKALLFQSSPPKAEPRGM-RSFVLEFLRPDALQRNIHIMDS  608

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA ++I  +WAP +EV VY LSK YTFTLAC LF+SI+  + + R+  P   + SG+ SL
Sbjct  609   MAHQNINTDWAPHKEVNVYPLSKKYTFTLACHLFISIKDPEHIARIARPFHQMLSGLVSL  668

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++FPGTA+N A KGG M+R +LV +IK+R+ E     S K E+  RD+L  LL  TDE 
Sbjct  669   PIDFPGTAFNSAKKGGKMLRHELVAIIKQRRKEL----SEKEESVARDLLSSLLLATDEN  724

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G  LN+ EI   I+GI L ++ S S  +TF+  +LAE PH Y +V KEQ+EIA SK P E
Sbjct  725   GAVLNDMEISDKIVGIFLASFDSTSTTLTFIFNYLAEFPHAYDKVLKEQMEIAMSKDPEE  784

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L W D+QKMKY+W VV E +RL PP QG FRE +++FT+ GFTIPKGWKT+W+V+ST+K
Sbjct  785   FLKWNDIQKMKYTWCVVKETMRLAPPAQGTFREAITDFTFEGFTIPKGWKTYWSVHSTNK  844

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NPKYF +PEKFDPSRFEG GPAP+TFVPFG GPR+CPGKEY RL ILVF+HN+VT FK  
Sbjct  845   NPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYVRLVILVFIHNMVTRFKWA  904

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             K++P+EKI+Y N +P PVNGLP+RL PH+K
Sbjct  905   KVVPNEKIIY-NPSPFPVNGLPIRLQPHEK  933


 Score =   493 bits (1270),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 249/465 (54%), Positives = 346/465 (74%), Gaps = 17/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +++ + +  ++   LPPG+ GWP+IGE++   +      P ++I +RM KYSP+VF+TS+
Sbjct  19    VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMF--PTQNTLRKISTLNRNNIHE  469
             +GEKVAVFCG AGNKF F+N N L+ TW P+S+ K L+F  P +   R +    R+ + E
Sbjct  79    VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSMEKILLFESPPKVEPRGL----RSYVLE  134

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               +P+ L+ YI  +DSMA+EHI  +WAP REVKVY LSK YTF LAC+LF+SI+  ++V 
Sbjct  135   FLRPDVLQRYIQIMDSMAREHIEMDWAPNREVKVYPLSKKYTFALACRLFMSIKDPEQVA  194

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             ++  P  +++SG+ S+P++FPGT +NRA KGG M+R +LV +IK+R+ E  +S  G  E 
Sbjct  195   KVAHPFHLITSGLVSVPIDFPGTPFNRAKKGGKMLRDELVAIIKQRRNE--LSDEG--EP  250

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             E +D+L  LL  +DE G+ LN+ EI   I+G+ L ++ S SA +TFVL +LAE P +Y +
Sbjct  251   EVQDLLSSLLLQSDENGKGLNDMEISDKIVGLFLASFDSTSATLTFVLNYLAEFPDVYDK  310

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V KEQ+EIAKSK P E L W D+QKMKY+W+V  E +RL PP QG FRE +++FTY GFT
Sbjct  311   VLKEQMEIAKSKDPGEFLKWNDIQKMKYTWSVANETMRLAPPAQGTFREVITDFTYEGFT  370

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWKT+W+V++T++NPK+F +PEKFDPSRFEG GPAP+TFVPFG GPR+CPGKEY+RL
Sbjct  371   IPKGWKTYWSVHTTNRNPKHFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYSRL  430

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +ILVF+HN+VT FK EK+ P+EK++Y N +P PVNGLP+RL P +
Sbjct  431   QILVFIHNMVTRFKWEKVDPNEKVIY-NPSPIPVNGLPIRLHPRE  474



>dbj|BAP59951.1| cytochrome P450 monooxygenase CYP716A50 [Coffea arabica]
Length=479

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 328/462 (71%), Gaps = 12/462 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++ +++  S P LPPG TGWP++GES++ +       P+K++ DRM KYS  VFKT +L
Sbjct  23    LFYKSRSALSGP-LPPGKTGWPMVGESLEFLSCGWKGHPEKFVFDRMAKYSSHVFKTHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GEK AVFCGA GNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    K
Sbjct  82    GEKAAVFCGAPGNKFLFSNENKLVQAWWPASVDKVFPSSTQTSSKEEAIKMRKMLPNFLK  141

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D +A  H +  W    +VKV+ L K YTF +A +LF+S+E   EV +LL
Sbjct  142   PEALQRYIGIMDHIAGRHFSSGWENKDQVKVFPLCKNYTFWIASRLFVSVEEPTEVAKLL  201

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             +P  +++SG+ S+P++ PGT +NRA+K  + +R+ LV +IK+RK +   S +   +    
Sbjct  202   EPFNVLASGLISVPIDLPGTPFNRAVKASNQIRKMLVALIKQRKVDLAESKASPTQ----  257

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D++  +L ++DE G+ ++E ++   I+G+L+  + + S+A TFV+KFLAELP IY+ VYK
Sbjct  258   DIMSHMLTISDENGKFMHELDVADKILGLLIGGHDTASSACTFVIKFLAELPEIYEGVYK  317

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EI KSK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F Y GF+IPK
Sbjct  318   EQMEIVKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALADFMYNGFSIPK  377

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  +TH+NP+ F EP+KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  378   GWKIYWSANTTHRNPECFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEIL  437

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VF+H+VV  F+ EK++PDEKIV  +  P P  GLPVRL PH+
Sbjct  438   VFIHHVVKRFRWEKIIPDEKIVV-DPMPIPAKGLPVRLFPHK  478



>ref|XP_009345334.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
 ref|XP_009351212.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 326/464 (70%), Gaps = 11/464 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE+   +       P+K+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K      + + ++ +   R  +    
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSLETSAKEEAKKMRKMLPNFM  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S+E   E+ +L
Sbjct  142   KPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLEDSVEIAKL  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  +++SG+ S+PL+FPGT + +A+K  + +R +L ++IK+RK +    + GK  +  
Sbjct  202   GDPFAVLASGIISMPLDFPGTPFYKAIKASNFIREELAKIIKQRKIDL---AEGKA-SPT  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L L DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY QVY
Sbjct  258   QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDQVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+E+  SK P E L+W+D+QKMKYSWNV  E LRL PP QG FRE +S+F + GFTIP
Sbjct  318   KEQMEVLSSKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREAMSDFVFNGFTIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKN  YF EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKNEAYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             LVFMHN+V  FK EK++PDE+IV  +  P P  GLPVRL PH K
Sbjct  438   LVFMHNLVKRFKWEKVLPDEQIVV-DPLPMPAKGLPVRLFPHPK  480



>ref|XP_008224572.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=482

 Score =   482 bits (1240),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 241/463 (52%), Positives = 326/463 (70%), Gaps = 11/463 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  +A  +  NLPPG  G+PVIGES + +       P+K+I DRM KYS +VFKTSI 
Sbjct  23    LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GEK A+FCGAA NKF F+NEN L+T WWP SV K      + + ++ +   R  +    K
Sbjct  83    GEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSQETSAKEEAKKMRKMLPNFMK  142

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D++A+ H A+ W   +EV+V+ L+K YTF LA +LF+S+E   E+ RL 
Sbjct  143   PEALQRYIGIMDTVAQRHFADGWENRKEVEVFPLAKNYTFWLAARLFVSLEDATEIARLG  202

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             DP  +++SG+ S+PL+FPGT + +A+K  + +R +L ++IK+RK +    + GK  +  +
Sbjct  203   DPFALLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKVDL---AEGKA-SPTQ  258

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L L DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +VYK
Sbjct  259   DILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEVYK  318

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EI   K P E L+W+D+QKMKYSWNV  E LRL PP QG FRE +++F + GFTIPK
Sbjct  319   EQMEILSCKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALADFVFNGFTIPK  378

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STHKN  YF EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  379   GWKLYWSANSTHKNADYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEIL  438

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             VF+HN+V  FK EK++PDEKIV  +  P P  GLPVRL PH+K
Sbjct  439   VFIHNLVKRFKWEKILPDEKIVV-DPLPMPAKGLPVRLFPHKK  480



>ref|XP_006372247.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP50044.1| cytochrome P450 family protein [Populus trichocarpa]
Length=481

 Score =   481 bits (1239),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 329/465 (71%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I++  ++  S PNLPPG  G P++GES + +       P+K+I DR+ KYS  +FKT+I
Sbjct  23    LIFYNHRSQNSHPNLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIAKYSSHIFKTNI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHE  469
             LG+   VFCG A NKF F+NEN L+ +WWP SV K  +FP+  Q + ++ +   R  + +
Sbjct  83    LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSVNK--IFPSSLQTSSKEEAKKMRKLLPQ  140

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ YI  +D++A+ H A EW    +V V+ LSK YTF LAC+LFLSIE    V 
Sbjct  141   FLKPEALQGYIGIMDTIAQRHFASEWEHKEQVLVFPLSKNYTFRLACRLFLSIEDPSHVA  200

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  +++SG+ S+P++ PGT +NRA+K  + +R +L+  I++RK +    + GK  +
Sbjct  201   KFSDPFNLLASGIISIPIDLPGTPFNRAIKASNFIRTELLAFIRQRKKDL---AEGKA-S  256

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L   DE G+ +NE +I   IIG+L+  + + SAA TF++K+LAELPHIY++
Sbjct  257   PTQDILSHMLLTCDENGKCMNELDIADKIIGLLIGGHDTASAACTFIVKYLAELPHIYEE  316

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQ+EIAKSK P E L+W+D+QKMKYSW V CE +R+ PP QG FRE +++F + GFT
Sbjct  317   VYKEQMEIAKSKTPGEFLNWDDIQKMKYSWKVACEVMRISPPLQGAFREALNDFIFNGFT  376

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STH++P YF EPEKFDP RFEGSGPAP+TFVPFG GPRMCPGKEYARL
Sbjct  377   IPKGWKLYWSTNSTHRDPVYFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK +KL+ DEKIV  N  P P  GLPVRL PH+
Sbjct  437   EILVFMHNLVRRFKFDKLIQDEKIVV-NPLPIPDKGLPVRLHPHK  480



>ref|XP_010048515.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80784.1| hypothetical protein EUGRSUZ_C02161 [Eucalyptus grandis]
Length=480

 Score =   481 bits (1239),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 240/466 (52%), Positives = 325/466 (70%), Gaps = 14/466 (3%)
 Frame = +2

Query  134   IIYFITK---ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFK  286
              +++IT    A+ +  NLPPG TG P IGE+++ +       P+K+I DR+ +YS EVFK
Sbjct  19    FLFYITYKHIAHFTGANLPPGKTGLPFIGETLEFLSSGWKGHPEKFIFDRIARYSSEVFK  78

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH  466
             TSIL E  AV CGAAGNKF F+NEN L+T WWP S+ K     TQ + ++ +   R  + 
Sbjct  79    TSILAEPTAVLCGAAGNKFLFSNENKLVTAWWPDSINKVFPSSTQTSSKEEAKKMRKMLP  138

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                KPE L+ YI  +D +A+ H A  W    E+ V+ L+K YTF LAC+LF+S+E  D V
Sbjct  139   NFMKPEALQRYIGIMDHIAQRHFAMGWEGRDEIIVFPLAKRYTFWLACRLFMSVEDPDHV  198

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +  DP  +++SGMFS+P++ PG   NRA    + +R++L  +IK+RK +    + GK  
Sbjct  199   AKFADPFNVLASGMFSVPIDLPGMPLNRAKHASNFIRKELRVIIKQRKIDL---AEGKA-  254

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  +L  TDEEG+H+NE  I   I+G+L+  + + SAA TF++K+LAELP +Y 
Sbjct  255   SATQDILSHMLLATDEEGKHMNELNIADKILGLLVGGHDTASAACTFIVKYLAELPDVYD  314

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              VY EQ+EIAKSK P E L+W+D+QKM+YSWNV CE +RL PP QG FRE +++F + GF
Sbjct  315   GVYSEQMEIAKSKAPGELLNWDDIQKMRYSWNVACEVMRLAPPLQGAFREALNDFVFNGF  374

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             +IPKGWK +W+ +S H+NP+YF EPEKFDPSRF+G GPAP+T+VPFG GPRMCPGKEYAR
Sbjct  375   SIPKGWKLYWSAHSAHRNPEYFPEPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEYAR  434

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LEILVFMHN+V  FK EKL+ DEKI+  +  P P  GLPVRL PH+
Sbjct  435   LEILVFMHNLVKRFKWEKLLADEKIIV-DPMPMPAKGLPVRLHPHK  479



>ref|XP_009609682.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=480

 Score =   481 bits (1238),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 323/465 (69%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFI-TKANTSK--PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKT  289
             IYFI  K N+S     LPPG TGWP IGES + +       P+K+I DRM KYS  VFKT
Sbjct  20    IYFIFYKRNSSSLIGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFIFDRMSKYSSSVFKT  79

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE  469
              +LGEK AVFCG   NKF F+NEN L+  WWP SV K     TQ + ++ +   R  +  
Sbjct  80    HLLGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEEAIKMRKMLPN  139

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H A  W    +++V+ L+K YTF LAC+LF+S+E  + V 
Sbjct  140   FFKPEALQRYVGIMDHIAQRHFASSWENKSQIEVFPLAKRYTFWLACRLFVSVENPNHVA  199

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  +++SG+ S+P++ PGT +NRA+K  + +R++L+  IK+RK +  +  +   + 
Sbjct  200   KFADPFNVLASGLISIPIDLPGTPFNRAIKASNFIRKELLLNIKQRKVDLALGKASPTQ-  258

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE +I   I+G+L+  + + S+A TF++K+LAELP IY+ 
Sbjct  259   ---DILSHMLLTSDENGKFMNELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYEG  315

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQ+EIAKSK   E L W+D+QKMKYSWNV CE LRL  P QG FRE +++F + GF 
Sbjct  316   VYKEQMEIAKSKAAGELLRWDDIQKMKYSWNVACEVLRLASPLQGAFREAINDFMFNGFY  375

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKNP+YF EP+KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKNPEYFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMH++V  FK EK++P+EKIV  +  P P  GLPVRL PHQ
Sbjct  436   EILVFMHHLVKRFKWEKVIPNEKIVV-DPMPIPAKGLPVRLYPHQ  479



>gb|AJD25248.1| cytochrome P450 CYP716A89 [Salvia miltiorrhiza]
Length=479

 Score =   481 bits (1238),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 332/465 (71%), Gaps = 18/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++ TK  +    LPPG TGWPVIGES++ +       P+K+I DRM +YS  VF+T +
Sbjct  22    LLFYKTKPASG--GLPPGKTGWPVIGESLEFLSTGWKGHPEKFIFDRMARYSSHVFRTHL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQN---TLRKISTLNRNNIH  466
             LGE  AV CG+AGNKF F+NEN L+  WWP SV K  +FP  N   + ++ +   R  + 
Sbjct  80    LGEPAAVLCGSAGNKFLFSNENKLVQAWWPSSVDK--IFPNDNAQTSSKEEAIKMRRMLP  137

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
               FKPE L  Y+  +D +A+ H A+ W    EV V+ L+K YTF LAC+LFLS+E   +V
Sbjct  138   TFFKPEALHRYVGIMDHIARRHFADGWDNKSEVVVFPLAKNYTFWLACRLFLSVEDPAQV  197

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +   P  +++SG+ S+P++ PGT +N+ +K  + +R++LV +IK+RKA+    + GK  
Sbjct  198   DKFAAPFNLLASGLISIPIDLPGTPFNKGIKASAYIRKELVAIIKQRKADL---ADGKA-  253

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  +L  ++E+G+ + E +I + I+G+L+  + + S+A TF++KFLAELP +Y+
Sbjct  254   SPTQDILSHMLLTSNEDGKFMQESDIANKILGLLIGGHDTASSACTFIVKFLAELPQVYE  313

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              VYKEQ+EIAKSKG  E LSWED+QKMKYSWNV CE LRL PP QG FRE +++F++ GF
Sbjct  314   GVYKEQMEIAKSKGEGELLSWEDLQKMKYSWNVACEVLRLAPPLQGAFREALADFSFNGF  373

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             +IPKGWK +W+  STHKN ++F EPEKFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYAR
Sbjct  374   SIPKGWKLYWSANSTHKNKEFFPEPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYAR  433

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LEILVFMH++V  FK EK++PDEKIV  +  P P  GLPVRL PH
Sbjct  434   LEILVFMHHLVKRFKWEKMIPDEKIVV-DPMPIPAKGLPVRLYPH  477



>ref|XP_003525322.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=482

 Score =   481 bits (1238),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 324/451 (72%), Gaps = 11/451 (2%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             PNLPPG+TG+PVIGES++ +       P+K+I DRM +YS ++FKTSI GE   +FCGA 
Sbjct  36    PNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSIFGEPAVIFCGAT  95

Query  332   GNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTI  511
              NKF F+NEN L+  WWP SV K      Q+  ++ S   R  + +  KPE L+ Y+  +
Sbjct  96    CNKFLFSNENKLVAAWWPNSVNKVFPSTLQSNSKEESKKMRKLLPQFLKPEALQRYVGIM  155

Query  512   DSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMF  691
             D++A+ H A  W    E+ VY L+K YTF LAC+LF+S+E  + V +  +P  +++SG+ 
Sbjct  156   DTIAQNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSVEDVNHVAKFENPFHLLASGII  215

Query  692   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTD  871
             S+P++ PGT +N+A+K  + +R++L+++I++RK +    + GK  +  +D+L  +L   +
Sbjct  216   SVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKA-SPTQDILSHMLLTCN  271

Query  872   EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1051
             E GQ +NE +I   I+G+L+  + + SAA TF++K+LAELPHIY  VY+EQ+EIAKSK P
Sbjct  272   ENGQFMNELDIADKILGLLIGGHDTASAACTFIVKYLAELPHIYDSVYQEQMEIAKSKLP  331

Query  1052  NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYST  1231
              E L+W+D+ +MKYSWNV CE +R+ PP QGGFRE +++F + GF+IPKGWK +W+  ST
Sbjct  332   GELLNWDDINRMKYSWNVACEVMRIAPPLQGGFREAINDFIFNGFSIPKGWKLYWSANST  391

Query  1232  HKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFK  1411
             HKNP+YF EPEKFDP+RFEG GPAPFTFVPFG GPRMCPGKEYARLEILVFMHN+V  FK
Sbjct  392   HKNPEYFPEPEKFDPTRFEGQGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRFK  451

Query  1412  MEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              EKL+PDEKI+  +  P P   LP+RL PH+
Sbjct  452   WEKLIPDEKIIV-DPLPVPAKNLPIRLHPHK  481



>ref|XP_007160209.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
 gb|ESW32203.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
Length=480

 Score =   481 bits (1237),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 235/463 (51%), Positives = 326/463 (70%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             I++   ++  S PNLPPG+TG PVIGES+  +       P+K+I DRM KYS ++FKTSI
Sbjct  22    ILFHKHRSPFSAPNLPPGATGLPVIGESLQFLSTGWKGHPEKFIFDRMIKYSSDLFKTSI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE   VFCGAA NKF F+NEN L+T WWP SV K      Q+  ++ S   R  + +  
Sbjct  82    LGEPAVVFCGAASNKFLFSNENKLVTAWWPDSVNKVFPSTLQSNSKEESKKMRKLLPQFL  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KP+ L+ Y+P +D++A+ H A  W     + V+ L+K YTF LAC+LF+S+E  + V + 
Sbjct  142   KPQALQGYVPIMDAIAQTHFASHWDNHTHLTVFPLAKRYTFLLACRLFMSVEDENHVAKF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  ++++G+ S+P++ PGT +N+A+K    +R++L+++I+ERK +      GK     
Sbjct  202   EKPFQLLAAGIISVPIDVPGTPFNKAIKAAKDIRKELLKIIRERKVDL---GEGKATAR-  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L   DE G+ +NE +I   I+G+L+  + + SAA TF++K+LAELPHIY  VY
Sbjct  258   QDILSHMLLTCDENGEFMNELDIADKILGLLIGGHDTASAACTFLVKYLAELPHIYDAVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIAKSK   E L+W+D+ KMKYSWNV CE +R+ PP QGGFRE +++F + GF+IP
Sbjct  318   QEQMEIAKSKSAGELLNWDDINKMKYSWNVACEVMRIAPPLQGGFREAINDFVFNGFSIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  +THKNP+YF EPEKFDPSRFEG GP P++FVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANATHKNPEYFGEPEKFDPSRFEGQGPVPYSFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHN+V  FK EK++PDEKI+  N  P P + LP+RL PH+
Sbjct  438   LVFMHNLVKRFKWEKMIPDEKIIV-NPLPIPAHNLPIRLYPHK  479



>ref|XP_009759030.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score =   481 bits (1237),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 326/463 (70%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
              I++   + +    LPPG TGWP IGES + +       P+K++ DRM KYS  VFKT +
Sbjct  22    FIFYKRNSGSLTGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFVFDRMTKYSSSVFKTHL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGEK AVFCG   NKF F+NEN L+  WWP SV K     TQ + ++ +   R  +   F
Sbjct  82    LGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEEAIKMRKMLPNFF  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ Y+  +D +A+ H A  W    +++V+ L+K YTF LAC+LF+S+E  + V + 
Sbjct  142   KPEALQRYVGIMDHIAQRHFASSWENKNQIEVFPLAKRYTFWLACRLFVSVEDPNHVAKF  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  +++SG+ S+P++ PGT +NRA+K  +++R++L+ +IK+RK +    + GK  +  
Sbjct  202   ADPFNVLASGLISIPIDLPGTPFNRAIKASNLIRKELLLIIKQRKVDL---AEGKA-SPT  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  +DE G++++E +I   I+G+L+  + + S+A TF+LK+LAELP IY+ VY
Sbjct  258   QDILSHMLLTSDENGKYMHELDIADKILGLLIGGHDTASSACTFILKYLAELPEIYEGVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIA SK P E L+W+D+QKMKYSWNV CE LRL  P QG FRE +++F + GF IP
Sbjct  318   KEQMEIAMSKSPGELLNWDDIQKMKYSWNVACEVLRLASPLQGAFREAINDFIFNGFYIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKNP+YF EP+KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKNPEYFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMH++V  FK EK++P+EKIV  +  P P  GLPVRL PH+
Sbjct  438   LVFMHHLVKRFKWEKVIPNEKIVV-DPMPIPAKGLPVRLYPHK  479



>ref|XP_004243906.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=482

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/449 (53%), Positives = 323/449 (72%), Gaps = 12/449 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG++GWPVIGE+++ +       P+K+I DR+ KY   +FKT +LGEK  VFCGA+ N
Sbjct  37    LPPGNSGWPVIGETLEFLSTGWKGHPEKFIFDRISKYKSSIFKTHLLGEKAVVFCGASSN  96

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+ TWWP SV K     TQ + ++ +   R  +    KPE L+ YI  +D 
Sbjct  97    KFLFSNENKLVQTWWPSSVDKVFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRYIRIMDH  156

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A++H  + W   +EV V+ L+K YTF LAC+LF+S+E  + V RL DP  +++SG+ S+
Sbjct  157   IAQKHF-QSWENQQEVVVFPLAKRYTFWLACRLFVSVEDPNHVARLADPFDVLASGLISI  215

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P+N PGT +NRA+K  + +R++LV +IK+RK +    + GK  ++ +D+L  +L  +DE 
Sbjct  216   PINLPGTPFNRAIKASNFIRKELVAIIKQRKIDL---TEGKA-SDSQDILSHMLLTSDEN  271

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY QVYKEQIEIAKSKGP E
Sbjct  272   GKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDQVYKEQIEIAKSKGPGE  331

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              LSWED++KMKYSWNV CE LRL PP QG FRE + +FT+ GF+IPKGWK +W+  STH 
Sbjct  332   LLSWEDIKKMKYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWKIYWSANSTHI  391

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F +P KFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  F  +
Sbjct  392   NPEVFVDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFSWK  451

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++ DEKIV  N  P P NGLP+RL PH 
Sbjct  452   KIIRDEKIVV-NPMPIPANGLPIRLYPHH  479



>ref|XP_011031249.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 326/464 (70%), Gaps = 11/464 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             ++  + K+N S PNLPPG  G+P+IGES++ +       P+K+I DR+ KYS +VFKT I
Sbjct  21    LLICVHKSNVSHPNLPPGKMGFPIIGESLEFLSAGRKGYPEKFIYDRIAKYSSQVFKTCI  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LG+   V CGAAGNKF F+NEN L+ +WWP SV K     TQ + ++ S   R  +   F
Sbjct  81    LGQPTTVVCGAAGNKFLFSNENKLVASWWPDSVNKIFPSSTQTSSKEESKKMRKLLPNFF  140

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE+L+ Y+  +D++A+ H+ + W   +EV V  L+K YTF +ACK+FLSI+      +L
Sbjct  141   KPESLQRYVGMMDTIAQRHLEDSWEGKQEVTVLPLAKTYTFGIACKVFLSIDDPKHAAKL  200

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P   ++SG+ S+P++ PGT++NR +K    +R++LV +IK+RK +   + +   +   
Sbjct  201   AHPFNDLASGIISIPIDLPGTSFNRGIKASKWIRKELVSIIKQRKVDLAENRALHTQ---  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  +L  TDE+GQ++ E +I   I+G+L+  + + SA ITF++K+LAELPHIYQ+V 
Sbjct  258   -DMLSHMLLTTDEDGQYMKETDIADKILGLLIGGHDTASAVITFIVKYLAELPHIYQEVL  316

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIAK K P E L+W D+QKMKYSWNV CE LRL PP QG FRE +++F +AGF IP
Sbjct  317   KEQMEIAKWKRPRELLNWNDIQKMKYSWNVACEVLRLAPPLQGAFREAINDFNFAGFHIP  376

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STH+NP+ F +PEKF P+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  377   KGWKLYWSASSTHRNPECFPDPEKFQPARFEGTGPAPYTFVPFGGGPRMCPGKEYARLEI  436

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             LVFMHN+V  F+ EKL+PDEKI+ +     P   LP+RL  HQK
Sbjct  437   LVFMHNLVRRFRWEKLIPDEKIIVDPIL-IPAKQLPIRLFHHQK  479



>ref|XP_010245748.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=484

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 320/462 (69%), Gaps = 11/462 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSIL  298
             + +  K+N S   LPPG  G P +GESI  +       P+K++ DRM K+S EVF+TS+ 
Sbjct  28    LVYKRKSNPSGGKLPPGKMGLPFVGESIQFLSLGRKGTPEKFMYDRMAKFSKEVFRTSLF  87

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GE  AVFCG +GNKF F+NEN L+T WWP+SV K     TQ + ++ +   R  + +  K
Sbjct  88    GENTAVFCGPSGNKFLFSNENKLVTAWWPRSVEKIFPSSTQTSSKEEAKKMRKLLPQFLK  147

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +DS+A+ H    W    EV V+ L+K YTF LAC+LFLSIE  D V +  
Sbjct  148   PEALQRYIGIMDSIAQRHFKAGWDDRDEVTVFPLAKRYTFWLACRLFLSIEDPDHVAKFA  207

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             DP   ++SG+FS+P++ PGT++N+ +K    +R++L+ +IK+RK +   + +   +    
Sbjct  208   DPFNALASGIFSIPIDLPGTSFNKGIKASDEIRKELLAIIKQRKIDLAENRASPTQ----  263

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L  TDE+G  +NE +I   I+G+L+  + + SAAITFV+K+LAELP IY QV +
Sbjct  264   DILSHMLLYTDEDGHFMNERDIADKILGLLIGGHDTASAAITFVMKYLAELPDIYNQVLQ  323

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EIAK K P ERL+W+D+QKM+YSWNV  E +RL PP QG FRE + +FT+AGF IPK
Sbjct  324   EQMEIAKCKAPGERLNWDDMQKMRYSWNVASEVMRLAPPLQGAFREALMDFTFAGFCIPK  383

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W   STH+NP+YF EPEKFDPSRF+G+GP P+T+VPFG GPRMCPGKEYARLEIL
Sbjct  384   GWKLYWAANSTHRNPEYFPEPEKFDPSRFDGTGPVPYTYVPFGGGPRMCPGKEYARLEIL  443

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMHNVV  F+ EK++ DEKI+  N  P P  G PVRL  H+
Sbjct  444   VFMHNVVKRFRWEKILSDEKIIV-NPMPMPAKGFPVRLHAHK  484



>ref|XP_008391096.1| PREDICTED: beta-amyrin 28-oxidase [Malus domestica]
Length=484

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 326/464 (70%), Gaps = 11/464 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE+   +       P+K+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K      + + ++ +   R  +    
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSLETSAKEEAKKMRKMLPNFM  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S+E   E+ +L
Sbjct  142   KPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLEDSVEIAKL  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  +++SG+ S+PL+FPGT + +A+K  + +R +L ++IK+RK +    + GK  +  
Sbjct  202   GDPFAVLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKA-SPT  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L L DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +VY
Sbjct  258   QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+E+  +K P + L+W+D+QKMKYSWNV  E LRL PP QG FRE +S+F + GFTIP
Sbjct  318   KEQMEVLSAKAPGDLLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALSDFVFNGFTIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKN  YF EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKNAAYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             LVFMHN+V  FK EK++PDE+IV  +  P P  GLPVRL PH K
Sbjct  438   LVFMHNLVKRFKWEKVLPDEQIVV-DPLPMPAKGLPVRLFPHPK  480



>ref|XP_009787233.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=482

 Score =   478 bits (1231),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 239/459 (52%), Positives = 325/459 (71%), Gaps = 12/459 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKV  310
              K+  S   LPPG++GW VIGES++ +       P+ +I DR+ KYS  VFKT + GEK 
Sbjct  29    NKSTFSGGQLPPGNSGWAVIGESLEFLSTGWKGHPENFIFDRISKYSSNVFKTHLFGEKA  88

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AVFCGA+GNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L
Sbjct  89    AVFCGASGNKFLFSNENKLVQAWWPSSVDKIFPSSTQTSSKEEAIKMRKMLPNFLKPEAL  148

Query  491   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPII  670
             + YI  +D +A+ H  + W    EV V+ L+K YTF LAC+LF+S+E  + V +L DP  
Sbjct  149   QRYIGIMDHIAQRHF-KSWENQEEVIVFPLAKRYTFWLACRLFVSVEDPNHVAKLADPFD  207

Query  671   IVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLG  850
             +++SG+ S+P++ PGT +NRA+K  + +R++LVE+IK+RK +  ++    + N+  D+L 
Sbjct  208   VLASGLISIPIDLPGTPFNRAIKASNFIRKELVEIIKQRKID--LAEGKALPNQ--DILS  263

Query  851   RLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIE  1030
              +L  +DE G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY+ VYKEQ+E
Sbjct  264   HMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYEGVYKEQME  323

Query  1031  IAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             IAKSK   E L+WED+QKM+YSWNV CE LRL PP QG FRE +++FT+ GF+IPKGWK 
Sbjct  324   IAKSKAAGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREALADFTFNGFSIPKGWKI  383

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +W+  STH+NP+ F EP KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH
Sbjct  384   YWSANSTHRNPEVFPEPLKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMH  443

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             ++V  FK EK++PDEKIV  N  P P  GLPV+L PH K
Sbjct  444   HLVKRFKWEKIIPDEKIVV-NPMPIPAKGLPVKLYPHNK  481



>ref|XP_007020143.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17368.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   478 bits (1231),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 229/463 (49%), Positives = 330/463 (71%), Gaps = 21/463 (5%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKT  289
             +IY + K  +  + P LPPG  G P IGE++D ++      P+K+++DR  KYS +VF+T
Sbjct  22    VIYLVYKYKSRAATPKLPPGRKGLPYIGETLDYVLASRRGTPEKFVTDRNTKYSSDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNI  463
             S+LGE +AVFCGAAGNKF F+ +N  +T+WWP+ + K  + P+   N+  + ST  R  +
Sbjct  82    SLLGEDMAVFCGAAGNKFLFSGQNKYVTSWWPRPMKKAFLDPSSVDNSSAEESTKLRAYL  141

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
               + KPE+L+HY+P +D MAKEH+ + W+P+ +V+V+ LSK YTF+LAC+LF+S+  R+E
Sbjct  142   PSLLKPESLQHYVPVMDRMAKEHLDQHWSPYNQVQVFPLSKKYTFSLACRLFMSVRDREE  201

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             +++   P  I ++G+ S+P++ PGT +NRA+K G ++R++L  +I ++K E +       
Sbjct  202   IEKFAKPFSIATAGLVSVPIDLPGTTFNRAVKAGRVIRQELFALITKKKNELL-------  254

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
               + R V   L++    +G  + E EI + I+G  + ++ + S AITF + +L++ P +Y
Sbjct  255   -EKRRTVASDLVDNMLLDG--MTEIEIGNKIVGFFIASHDTTSTAITFTVSYLSDYPDVY  311

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +V +EQ++I +SKGP E L WED+QKMKY+W V CEA+RL PP  G FRE +++FTYAG
Sbjct  312   NKVLEEQMDILRSKGPEEPLRWEDIQKMKYTWCVACEAMRLAPPANGAFREAITDFTYAG  371

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWK FW V+STHKNP YF +PEKFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTHKNPNYFPDPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYA  431

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             RLEIL F+HN+VT FK EKL P+EKI Y   +P P  GLP++L
Sbjct  432   RLEILTFIHNLVTKFKWEKLNPNEKISY-IPSPIPEEGLPIKL  473



>ref|XP_007020151.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17376.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   478 bits (1230),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 227/463 (49%), Positives = 332/463 (72%), Gaps = 21/463 (5%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKT  289
             +IY + K  +  + PN PPG  G P +GE++D ++      P+K+++DR  KYSP+VF+T
Sbjct  22    VIYLVYKYKSRPATPNFPPGRKGLPYLGETLDYVLASRRGTPEKFVTDRTTKYSPDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNI  463
             S+LGE +A+FCGAAGNKF F+ +N  +T+WWP S+ K LM P+   N+ ++ ST  R  +
Sbjct  82    SLLGEDMAIFCGAAGNKFLFSGQNKYVTSWWPHSIKKALMDPSSVDNSSKEESTKLRAYL  141

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
                 KPE+L+HYIP +D MAKEH+ + W+P+ +V+V+ LSK YTF+LAC+LF+S+  ++E
Sbjct  142   PPFLKPESLQHYIPVMDIMAKEHLDQHWSPYNQVQVFPLSKKYTFSLACRLFMSVHDQEE  201

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             +++   P  + ++G+ S+P++ PG+ +NRA+K G ++R++L+ +I ++K E        +
Sbjct  202   IEKFAKPFALATAGLISVPIDLPGSTFNRAVKAGKLIRQELLALITKKKNE--------L  253

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
               +G  V   L++    +G  + E EI + I+G  + ++ + S AITF++ +L +   IY
Sbjct  254   SEKGLTVASDLVDSMLMDG--MTEIEIGNKIVGFFIASHDTTSTAITFIVSYLTDYRDIY  311

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +V +EQ++I ++KGP E L WED+QKMKY+W V CEA+RL PP  G FRE +++FTYAG
Sbjct  312   NRVLEEQMDILRTKGPGEPLRWEDIQKMKYTWCVACEAMRLAPPANGAFREAITDFTYAG  371

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWK FW V+ST+KNP YF +PEKFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTNKNPNYFPDPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYA  431

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             RLEIL F+HN+VT FK EKL P+EKI Y   +P P  GLP++L
Sbjct  432   RLEILTFIHNLVTRFKWEKLNPNEKISY-IPSPIPEEGLPIKL  473



>ref|XP_007020144.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17369.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   478 bits (1230),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 330/463 (71%), Gaps = 21/463 (5%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKT  289
             +IY + K  +  + PNLPPG  G P IGE++D ++      P K+I+DR  KYSP+VF+T
Sbjct  22    VIYLVYKYKSRAATPNLPPGRKGLPYIGETLDYVLGLRRGTPVKFINDRSTKYSPDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNI  463
             S+LGE +AVFCGAAGNKF F+  N  +T WWP+S+ K L+ P+   N+  + ST+ R  +
Sbjct  82    SLLGEDMAVFCGAAGNKFLFSGHNKYVTAWWPRSMKKALLDPSSVDNSSEEESTILRTYL  141

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
               + KPE+L+ Y+P +D MAKEH+ + W+P+ +V+V  LSK Y F+LAC+LF+S++ ++E
Sbjct  142   LPLLKPESLQRYVPVMDVMAKEHLDQYWSPYNQVQVSPLSKKYGFSLACRLFMSVQQKEE  201

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             ++    P    ++G+ S+P++ PGT +NRA+K G ++RR+L+  I ++K E +       
Sbjct  202   IENFAKPFAFATAGLISVPIDLPGTTFNRAVKAGKVIRRELLAFITKKKNELL-------  254

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
               +G  V   +++    +G  + E EI + I+G  + ++ + S AITF + +L++ P +Y
Sbjct  255   -KKGMTVASDIVDSMLMDG--MTEIEILNKIVGFFIASHDTTSTAITFTVSYLSDYPDVY  311

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
              +V +EQ +I +SKGP E L WED+QKMKY+W VVCEA+RL PP  G FRE +++FTYAG
Sbjct  312   NRVLEEQKDILRSKGPGEPLGWEDIQKMKYTWCVVCEAMRLAPPANGAFREAITDFTYAG  371

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWK FW V+ST+KNPKYF +PEKFDPSRFEG+GPAP+T+VPFG GPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTNKNPKYFPDPEKFDPSRFEGNGPAPYTYVPFGGGPRMCPGKEYA  431

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             RLEIL F+HN+VT FK EKL P+EKI Y + +P P  GLP++L
Sbjct  432   RLEILTFIHNLVTRFKWEKLNPNEKIFY-SPSPIPEEGLPIKL  473



>ref|XP_011017588.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score =   477 bits (1228),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/465 (51%), Positives = 326/465 (70%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I++  ++  S P LPPG  G P++GES + +       P+K+I DR+ +YS  VFKT+I
Sbjct  23    LIFYNHRSQNSHPKLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIARYSSHVFKTNI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHE  469
             LG+   VFCG A NKF F+NEN L+ +WWP SV K  +FP+      I      R  + +
Sbjct  83    LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSVNK--IFPSSLQTSSIEEAKKMRKLLPQ  140

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ YI  +D++A+ H A EW    +V V+ L+K YTF LAC+LFLSIE    V 
Sbjct  141   FLKPEALQGYIGIMDTIAQRHFASEWEHKEQVLVFPLAKNYTFRLACRLFLSIEDPSHVA  200

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  +++SG+ S+P++ PGT +NRA+K  + +R +L+ +I++RK +    + GK  +
Sbjct  201   KFSDPFNLLASGIISIPVDLPGTPFNRAIKASNFIRTELLAIIRQRKKDL---AEGKA-S  256

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L   DE G+ +NE +I   IIG+L+  + + SAA TF++K+LAELPHIY++
Sbjct  257   PTQDILSHMLLTCDENGKCMNELDIADKIIGLLIGGHDTASAACTFIVKYLAELPHIYEE  316

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQ++IAKSK P E L+W+D+QKMKYSWNV CE +R+ PP QG FRE +++F + GFT
Sbjct  317   VYKEQMKIAKSKTPGELLNWDDIQKMKYSWNVACEVMRISPPLQGAFREALNDFIFNGFT  376

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STH++P YF EPEKFDP RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  377   IPKGWKLYWSTNSTHRDPVYFPEPEKFDPRRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK +KL+ DEKIV  N  P P  GLPVRL PH+
Sbjct  437   EILVFMHNLVKRFKFDKLIQDEKIVV-NPLPIPDKGLPVRLHPHK  480



>ref|XP_010252179.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=485

 Score =   477 bits (1227),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 322/463 (70%), Gaps = 13/463 (3%)
 Frame = +2

Query  140   YFITKANTSKPN--LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             Y + K  +  P   LPPG  G P +GESI+        +P+K+  DRM K+S E+FKTS+
Sbjct  27    YLVYKHTSHAPGKKLPPGRMGLPFVGESIEFFSLGRKGIPEKFFFDRMAKFSKEIFKTSL  86

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AV CG  GNKF F+NEN L+T WWP+SV K     TQ + ++ +   R  + +  
Sbjct  87    LGENTAVVCGPNGNKFLFSNENKLVTAWWPRSVDKIFPSSTQTSSKEEAKKMRKLLPQFL  146

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L  YI  +D++A+ H    W    EV V+ L+K +TF LAC+LFLSIE  D V + 
Sbjct  147   KPEALHRYIGIMDTIAQRHFKASWDDRDEVTVFPLAKRFTFWLACRLFLSIEDPDHVAKF  206

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP   ++SG+ S+P+N PGT +N+ +K  + +R++L+ +IK+RK +   + +   +   
Sbjct  207   ADPFNALASGIISIPINLPGTPFNKGIKASNEIRKELLAIIKQRKIDLAENRASPTQ---  263

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  +L  TDE+GQ +NE +I   I+G+L+  + + SAAITFV+K+LAELP IY +VY
Sbjct  264   -DILSHMLLYTDEDGQFMNERDIADKILGLLIGGHDTASAAITFVMKYLAELPEIYNEVY  322

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EI+KSK P ERL+W+D+QKM+YSWNV  E +RL PP QG FRE + +FT+ GF++P
Sbjct  323   KEQMEISKSKPPGERLNWDDLQKMRYSWNVASEVMRLAPPLQGAFREALMDFTFQGFSVP  382

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W   STH+NP+YF EPEKFDPSRF+GSGPAP+T+VPFG GPRMCPGKEYARLEI
Sbjct  383   KGWKLYWAANSTHRNPEYFPEPEKFDPSRFDGSGPAPYTYVPFGGGPRMCPGKEYARLEI  442

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHNVV  FK +K++P+EKI+  +  P P  GLP+RL  H+
Sbjct  443   LVFMHNVVKRFKWDKILPNEKIIV-DPMPMPAQGLPIRLHAHK  484



>gb|AIT93302.1| cytochrome P450 monooxygenase CYP716A12 [Medicago sativa]
Length=479

 Score =   476 bits (1225),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 329/465 (71%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             ++FI   + S  NLPPG  G+P+IGES++ +       P+K+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKHKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIHE  469
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT    ++L++ S   R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSSLKEESIKMRKLLPQ  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+E  + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVSHWENKDEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  ++++G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+ +    ++   + 
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRIDLAQGTASPTQ-  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  258   ---DILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNV CE +RL PP QGGFRE +++F + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKN + F  PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK EK++PDEKI+  +  P P   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIV-DPFPIPAKDLPIRLYPHK  478



>ref|XP_009376339.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score =   476 bits (1225),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 325/464 (70%), Gaps = 11/464 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE+   +       P+K+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K      + + ++ +   R  +    
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSMETSAKEEAKKMRKMLPNFM  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S++   E+ +L
Sbjct  142   KPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLDDSVEIAKL  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  ++++G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK +    + GK  +  
Sbjct  202   GDPFAVLAAGLLSMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKA-SPT  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L L DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +VY
Sbjct  258   QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+++  +K P E L+W+D+QKMKYSWNV  E LRL PP QG FRE +S+F + GFTIP
Sbjct  318   KEQMDVLSAKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALSDFVFNGFTIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKN  YF EP KFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  378   KGWKLYWSANSTHKNAAYFPEPFKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARLEI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             LVFMHN+V  FK EK++P+E++V  +  P P  GLPVRL PH K
Sbjct  438   LVFMHNLVKRFKWEKVIPNEQMVV-DPMPVPAKGLPVRLFPHPK  480



>gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula]
 gb|KEH21305.1| cytochrome P450 family protein [Medicago truncatula]
Length=479

 Score =   476 bits (1225),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 327/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGES++ +       P+K+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIHE  469
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT    + L++ S   R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+E  + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  ++++G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+ +    ++   + 
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQ-  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  258   ---DILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNV CE +RL PP QGGFRE +++F + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKN + F  PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK EK++PDEKI+  +  P P   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIV-DPFPIPAKDLPIRLYPHK  478



>ref|XP_010046875.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW78586.1| hypothetical protein EUGRSUZ_C00059 [Eucalyptus grandis]
Length=482

 Score =   476 bits (1225),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 314/450 (70%), Gaps = 11/450 (2%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG  G P IGE++  +       P+K+I DRM  YSP VFKTSIL E  AVFCGA G
Sbjct  37    NLPPGRFGLPFIGETLHFLRSGWNGHPEKFIFDRMSAYSPRVFKTSILAEPTAVFCGAPG  96

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F+NEN L+T WWP SV K      Q + ++ +   R  +   FKPE L+ YI  +D
Sbjct  97    NKFLFSNENKLVTAWWPDSVNKVFPSSLQTSSKEEAKKMRKMLPNFFKPEALQRYIGMMD  156

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
              +A  H    W    EV V+ L+K +TF LAC++F+S++  D V +  DP   ++SG+FS
Sbjct  157   EIAHRHFTTSWENKDEVVVFPLAKRFTFWLACRVFVSVQDPDHVAKFADPFNDIASGIFS  216

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             +P++ PGT  N+A    + +R++L  +IK+RK +     +   +    D+L  +L  TDE
Sbjct  217   IPIDLPGTPLNKAKHASNFIRKELRAIIKQRKLDLAEGRASATQ----DILSHMLLATDE  272

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
             +G+H+NE +I   I+G+L+  + + SAA TF++K+LA+LP +Y+ VYKEQ+EIAKSK P 
Sbjct  273   DGKHMNEMDIADKILGLLIGGHDTASAACTFIVKYLADLPQVYEGVYKEQMEIAKSKAPG  332

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTH  1234
             E L+W+D+QKM+YSWNV CE LRL PP QG FRE +++F + GF+IPKGWK +W+ +STH
Sbjct  333   ELLNWDDIQKMRYSWNVACEVLRLAPPLQGAFREVLNDFIFNGFSIPKGWKIYWSTHSTH  392

Query  1235  KNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKM  1414
             ++P+YF EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPGKEYARLEILVFMHN+V  FK 
Sbjct  393   RSPEYFPEPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRFKW  452

Query  1415  EKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             E L+PDEKIV  +  P P  GLPVRL PH+
Sbjct  453   ESLIPDEKIVV-DPMPMPAKGLPVRLFPHK  481



>ref|XP_009591188.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=483

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/456 (52%), Positives = 322/456 (71%), Gaps = 12/456 (3%)
 Frame = +2

Query  158   NTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVF  319
             +T    LPPG +GWPVIGES++ +       P+K+I DR+ KYS  VFKT +LGEK AVF
Sbjct  33    STFSGQLPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRISKYSSNVFKTHLLGEKAAVF  92

Query  320   CGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHY  499
             CG +GNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L+ Y
Sbjct  93    CGDSGNKFLFSNENKLVQAWWPSSVDKIFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRY  152

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             I  +D +A+ H  + W    +V V+ L+K YTF LAC+LF+S+E  + V +L DP  +++
Sbjct  153   IGIMDDIAQRHF-KSWENQEQVFVFPLAKRYTFWLACRLFVSVEDSNHVAKLADPFDVLA  211

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
             SG+ S+P++ PGT +NRA+K  + +R++LV +IK+RK +  ++    + N+  D+L  +L
Sbjct  212   SGLISIPIDLPGTPFNRAIKASNFIRKELVAIIKQRKID--LAEGKALPNQ--DILSHML  267

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
               +DE G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY+ VYKEQ+EIAK
Sbjct  268   LTSDENGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYEGVYKEQMEIAK  327

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SK   E L+WED+QKM+YSWNV CE LRL PP QG FRE + +FT+ GF+IPKGWK +W+
Sbjct  328   SKAKGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWKIYWS  387

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
               STH+NP+ F EP KFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V
Sbjct  388   ANSTHRNPEVFPEPLKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLV  447

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
               FK EK++PDEKIV  N  P P  GLPV+L PH K
Sbjct  448   KRFKWEKIIPDEKIVV-NPMPIPAKGLPVKLYPHNK  482



>emb|CBN88268.1| cytochrome P450 monoxygenase [Medicago truncatula]
 emb|CBN88269.1| cytochrome P450 monoxygenase [Medicago truncatula]
Length=479

 Score =   474 bits (1221),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 327/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGES++ +       P+K+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIHE  469
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT    + L++ S   R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+E  + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  ++++G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+ +    ++   + 
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRIDLAEGTASPTQ-  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  258   ---DILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNV CE +RL PP QGGFRE +++F + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKN + F  PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK EK++PDEKI+  +  P P   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIV-DPFPIPAKDLPIRLYPHK  478



>ref|XP_002263499.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Vitis vinifera]
 emb|CAN67793.1| hypothetical protein VITISV_001314 [Vitis vinifera]
Length=483

 Score =   474 bits (1221),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 325/470 (69%), Gaps = 22/470 (5%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE+++  +      P+++++DRM KYSP+VFKTS
Sbjct  19    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH--  466
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+        TL R+N    
Sbjct  79    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFN----ETLTRDNFRPP  134

Query  467   ----EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE L+HYI T+DSMA EHI   W+P REV V+ L++ Y+F LA +LF+SI  
Sbjct  135   TFLPEFLKPEALQHYIVTMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIAD  194

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
              + V+ +     I++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK E      
Sbjct  195   PEYVEMICHHFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRKMEL----E  250

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K ++  RD+L  +L  +DE     +E EI   +I +L  T+H+ S+ ITF+LK+LAE P
Sbjct  251   QKGDSATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFP  310

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              +Y +V KEQ+EIA+SKGP   L W+D+QKMKY+WNV  E +RL PP QG FRE +++FT
Sbjct  311   DVYSKVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFT  370

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFTIPKGWK  WNV +TH++PKYF +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  371   YAGFTIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGR  430

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EYAR ++L F+HNVVT FK EK+ P EK+ Y N +P P  G P+RL P Q
Sbjct  431   EYARAQVLAFIHNVVTRFKWEKVDPCEKVAY-NPSPIPSKGFPIRLQPLQ  479



>emb|CBI39948.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 325/470 (69%), Gaps = 22/470 (5%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE+++  +      P+++++DRM KYSP+VFKTS
Sbjct  24    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  83

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH--  466
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+        TL R+N    
Sbjct  84    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFN----ETLTRDNFRPP  139

Query  467   ----EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE L+HYI T+DSMA EHI   W+P REV V+ L++ Y+F LA +LF+SI  
Sbjct  140   TFLPEFLKPEALQHYIVTMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIAD  199

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
              + V+ +     I++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK E      
Sbjct  200   PEYVEMICHHFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRKMEL----E  255

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K ++  RD+L  +L  +DE     +E EI   +I +L  T+H+ S+ ITF+LK+LAE P
Sbjct  256   QKGDSATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFP  315

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              +Y +V KEQ+EIA+SKGP   L W+D+QKMKY+WNV  E +RL PP QG FRE +++FT
Sbjct  316   DVYSKVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFT  375

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFTIPKGWK  WNV +TH++PKYF +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  376   YAGFTIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGR  435

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EYAR ++L F+HNVVT FK EK+ P EK+ Y N +P P  G P+RL P Q
Sbjct  436   EYARAQVLAFIHNVVTRFKWEKVDPCEKVAY-NPSPIPSKGFPIRLQPLQ  484



>ref|XP_002522937.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39448.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 322/459 (70%), Gaps = 15/459 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  + P+LPPG  G P +GES++ +       P+K++ DR  KYS E+FKT++LG+  A
Sbjct  28    KSQYNYPSLPPGKPGLPFVGESLEFLSSGWKGHPEKFVFDRTSKYSSEIFKTNLLGQPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPEN  487
             VFCGA+ NKF F+NEN L+  WWP SV K  +FP+  Q + ++ +   R  + +  KPE 
Sbjct  88    VFCGASANKFLFSNENKLVQAWWPDSVNK--IFPSSLQTSSKEEAIKMRKLLPQFMKPEA  145

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L+ YI  +D++A+ H A  W    EV V+ L+K YTF LAC+LF+S+E  D + +  DP 
Sbjct  146   LQRYIGIMDTIAQRHFASGWEKKNEVVVFPLAKNYTFWLACRLFVSLEDPDHIAKFADPF  205

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               ++SG+ S+P++ PGT + RA+K  + +R++L+ +IK+RK +    + GK     +D+L
Sbjct  206   QELASGIISVPIDLPGTPFRRAIKASNFIRKELISIIKQRKIDL---AEGKASGT-QDIL  261

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               +L  +DE+G+ +NE +I   I+G+L+  + + SAA TF++K+LAELP IY  VYKEQ+
Sbjct  262   SHMLLTSDEDGKFMNEMDIADKILGLLIGGHDTASAACTFIIKYLAELPQIYDAVYKEQM  321

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIAKSKG  E L+WED+QKMKYSWNV CE +R+ PP QG FRE +++F + GF IPKGWK
Sbjct  322   EIAKSKGEGELLNWEDIQKMKYSWNVACEVMRVAPPLQGAFREAINDFIFNGFYIPKGWK  381

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
              +W+  STHK+  YF EPEKFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARLEILVFM
Sbjct  382   LYWSANSTHKSATYFEEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARLEILVFM  441

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             HN+V  F  +K++PDE I+  N  P P  GLPVRL PHQ
Sbjct  442   HNLVKRFNFQKIIPDENIIV-NPLPIPAKGLPVRLLPHQ  479



>sp|I7C6E8.1|C7A52_PANGI RecName: Full=Beta-amyrin 28-oxidase; AltName: Full=Cytochrome 
P450 CYP716A52v2 [Panax ginseng]
 gb|AFO63032.1| cytochrome P450 CYP716A52v2 [Panax ginseng]
Length=481

 Score =   473 bits (1218),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 312/449 (69%), Gaps = 11/449 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWP+IGES + +       P+K+I DRM KYS  VFKTSI GE  AVFCGAA N
Sbjct  37    LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAACN  96

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +   FKPE L+ YI  +D 
Sbjct  97    KFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYIGLMDQ  156

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A  H    W    EV V+ L+K YTF +ACK+F+S+E   +V  LL+P   ++SG+ S+
Sbjct  157   IAANHFESGWENKNEVVVFPLAKSYTFWIACKVFVSVEEPAQVAELLEPFSAIASGIISV  216

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N A+K   +VRR+LV +IK+RK +      GK  +  +D+L  +L  +DE 
Sbjct  217   PIDLPGTPFNSAIKSSKIVRRKLVGIIKQRKIDL---GEGKA-SATQDILSHMLLTSDES  272

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ + E +I   I+G+L+  + + S+A TFV+KFLAELP IY+ VY+EQ+EI KSK   E
Sbjct  273   GKFMGEGDIADKILGLLIGGHDTASSACTFVVKFLAELPQIYEGVYQEQMEIVKSKKAGE  332

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L WED+QKMKYSWNV CE LRL PP QG FRE +S+FTY GF+IPKGWK +W+  STH 
Sbjct  333   LLKWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANSTHI  392

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             N + F EP KFDPSRF+G+GP PF+FVPFG GPRMCPGKEYARLEILVFMH++V  FK E
Sbjct  393   NSEVFPEPLKFDPSRFDGAGPPPFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKWE  452

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++PDEKIV  N  P P NGLPVRL PH+
Sbjct  453   KVIPDEKIVV-NPMPIPANGLPVRLFPHK  480



>ref|XP_002280969.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=482

 Score =   473 bits (1218),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 234/452 (52%), Positives = 326/452 (72%), Gaps = 15/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLP G+TG P IGESI  +       P+K+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37    NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  335   NKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPT  508
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  +    KPE L+ YI  
Sbjct  97    NKFLFSNENKLVTAWWPSSVNK--IFPSSLQTSSQEESKKMRKLLPGFLKPEALQRYISI  154

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D +A+ H    W    EV V+ L+K +TF LAC+LFLS+E  D V++L +P   +++G+
Sbjct  155   MDVIAQRHFESSWNNKEEVTVFPLAKMFTFWLACRLFLSVEDPDHVEKLAEPFNELAAGI  214

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              +LP++ PGT++N+ +K  ++VR++L  +IK+RK    M+ +    +  +D+L  +L   
Sbjct  215   IALPIDLPGTSFNKGIKASNLVRKELHAIIKKRK----MNLADNKASTTQDILSHMLLTC  270

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE G+++NE +I   I+G+L+  + + SA ITF++KFLAELPH+Y +V+KEQ+EIAKSK 
Sbjct  271   DENGEYMNEEDIADKILGLLVGGHDTASATITFIVKFLAELPHVYDEVFKEQMEIAKSKA  330

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
             P E L+WED+ KM+YSWNV CE +RL PP QG FRE +++F + GF+IPKGWK +W+ +S
Sbjct  331   PGELLNWEDIPKMRYSWNVACEVMRLAPPVQGAFREAMNDFIFEGFSIPKGWKLYWSTHS  390

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             TH+NP++F +PEKFDPSRF+G GPAP+T+VPFG GPRMCPGKEYARLE+LVFMHN+V  F
Sbjct  391   THRNPEFFPKPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEYARLEVLVFMHNLVRRF  450

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K EKL+PDEKI+  +  P P  GLP+RL  HQ
Sbjct  451   KWEKLLPDEKIIV-DPMPIPAKGLPIRLHHHQ  481



>gb|AFK47215.1| unknown [Medicago truncatula]
Length=479

 Score =   473 bits (1218),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 232/465 (50%), Positives = 325/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGES++ +       P+K+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIHE  469
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT    + L++ S   R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H    W    E  VY L+K YTF LAC+LF+S+E  + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNETTVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  ++++G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+ +    ++   + 
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQ-  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  258   ---DILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNV CE +RL PP QGGFRE +++F + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKN + F  PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+   FK EK++PDEKI+  +  P P   LP+RL PH+
Sbjct  435   EILVFMHNLAKRFKWEKVIPDEKIIV-DPFPIPAKDLPIRLYPHK  478



>gb|EYU25770.1| hypothetical protein MIMGU_mgv1a005482mg [Erythranthe guttata]
Length=482

 Score =   473 bits (1217),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 317/449 (71%), Gaps = 11/449 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPV+GES++ +       P+K+I DR+ KYS  VF+T +LGEK AVFCGA GN
Sbjct  38    LPPGKTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSTVFRTHLLGEKAAVFCGAGGN  97

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K      Q + ++ +   R  +   FKPE L+ Y+  +D 
Sbjct  98    KFLFSNENKLVQAWWPSSVDKVFPSSNQTSSKEEAIKMRKMLPNFFKPEALQRYVGIMDH  157

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A+ H A+ W    EV V+ L+K YTF LAC+LF+S+E    V    +P  +++SG+ S+
Sbjct  158   IARRHFADGWENKSEVVVFPLAKNYTFWLACRLFVSVEDPHLVDEFAEPFNLLASGLISI  217

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N+A+K  + +R++L+ +IK+RK +    + GK  +  +D+L  +L   DE 
Sbjct  218   PVDLPGTPFNKAIKASNFIRKKLITIIKQRKVDL---AEGKA-SPTQDILSHMLLTCDES  273

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY  VYKEQ+EIAKSK   E
Sbjct  274   GKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDGVYKEQMEIAKSKKEGE  333

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+W+D+QKMKYSWNV CE LRL PP QG FRE +S+F Y GF+IPKGWK +W+  STH 
Sbjct  334   LLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMYNGFSIPKGWKIYWSANSTHI  393

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F +P+KFDPSRF+GSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  FK E
Sbjct  394   NPECFPDPKKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKFE  453

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++PDEKIV  N  P P  GLPVRL PH+
Sbjct  454   KMIPDEKIVV-NPMPIPAKGLPVRLFPHK  481



>ref|XP_011019870.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=484

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 332/466 (71%), Gaps = 18/466 (4%)
 Frame = +2

Query  140   YFITKAN---TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             Y I K     +S  NLPPG+TG P+IGES++ +       P+K+I DRM K+S +VFKTS
Sbjct  24    YLINKHRYSLSSLNNLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTS  83

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIH  466
             +  E  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R    
Sbjct  84    LFCEPTAVFCGAAGNKFLFSNENKLVTAWWPDSVNK--IFPSSQQTSSQEESKKMRKLFP  141

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
               FKPE+L+ YI  +D +A+ H+A +W   +EV V+ L+K YTF LAC+LFLS+E  +EV
Sbjct  142   LFFKPESLQRYISVMDVIAQRHLASDWEGKQEVSVFPLAKTYTFWLACRLFLSMEDPEEV  201

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
             ++   P   +++G+ S+P++ P T +NR +K  ++V ++L+++IK+RK +   + +   +
Sbjct  202   QKFAKPFNDLAAGIISIPIDLPWTPFNRGVKASNVVHKELLKIIKQRKIDLAENKASPTQ  261

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
                 D+L  +L   D++GQ + E +I   I+G+L+  + + SAAITF++K+LAELPH+Y 
Sbjct  262   ----DILSHMLTTADDDGQCMEEIDIADKILGLLVGGHDTASAAITFIVKYLAELPHVYS  317

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             ++ +EQ EIAK+K P E L+WED+Q+M+YSWNV CE +R+ PP QG FRE ++EF YAGF
Sbjct  318   KLLEEQREIAKTKTPGELLNWEDIQRMRYSWNVACEVMRVAPPLQGAFREAMTEFNYAGF  377

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIPKGWK +W+  +THKNP+ F EPE FDPSRFEG+GPAP+TFVPFG GPRMCPGKEYAR
Sbjct  378   TIPKGWKLYWSANTTHKNPECFPEPENFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYAR  437

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LEILVF+HN+V  F+ EKL+P E+I+  +  P P  GLP+RL PH+
Sbjct  438   LEILVFLHNLVKKFRWEKLLPKERIIV-DPLPIPSKGLPIRLHPHK  482



>gb|KCW72928.1| hypothetical protein EUGRSUZ_E01367, partial [Eucalyptus grandis]
Length=464

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 325/444 (73%), Gaps = 19/444 (4%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+L PG+ GWPV+GE+++ M       P+K++ DR   +S +VF+T++ G  +AVFCGA+
Sbjct  27    PHLLPGTKGWPVVGETLEYMTAGRSGRPEKFVKDRAAWHSSDVFRTNLYGADMAVFCGAS  86

Query  332   GNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN----RNNIHEIFKPENLKHY  499
             GNKF F++EN  ++ WWP S+ K  MFP    L K+   +    R+ + E  KPE L+HY
Sbjct  87    GNKFLFSSENKHVSPWWPDSMKKIFMFP--EALGKLKNEDAKKRRSFMLEFLKPEALRHY  144

Query  500   IPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVS  679
             IP +DS+ ++H+A +W+P +EV+V+ L K YT  LAC+LF++I   + V++  DP   V+
Sbjct  145   IPVMDSVTRDHLATDWSPHKEVRVFPLLKSYTLALACRLFMNIRDPEIVRKFADPFARVA  204

Query  680   SGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLL  859
              G  ++P+N PGT +NRA++GG ++R++L+++++ RK E    S GK  N  RD L RLL
Sbjct  205   PGFVTVPINIPGTPFNRAVEGGKVLRQELLDLVRRRKMEI---SEGKDAN-ARDFLSRLL  260

Query  860   NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAK  1039
                 ++G  L E +    I+G+L  ++ + S +IT ++ +LA+ PH+Y++V++EQ+EIA+
Sbjct  261   LEGGDDGTALYEMDTSTKIMGLLNASHDTTSTSITAIVNYLAQFPHVYERVHQEQLEIAR  320

Query  1040  SKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWN  1219
             SKGP+E L+W+DVQKMKYSWNV CE++RL PP QG +R  +++F++AG+TIPKGWKTFW 
Sbjct  321   SKGPDEFLNWDDVQKMKYSWNVACESMRLLPPAQGAYRVAMTDFSFAGYTIPKGWKTFWT  380

Query  1220  VYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
             V+ST+KNPKYF +PEKFDPSRFEG+GPAPF +VPFG GP MCPGKEYARLEILVFMHN+V
Sbjct  381   VHSTNKNPKYFPDPEKFDPSRFEGNGPAPFIYVPFGGGPHMCPGKEYARLEILVFMHNLV  440

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPV  1471
             T FK+ K++P+EK +Y    PSPV
Sbjct  441   TKFKLMKVIPNEKFIYT---PSPV  461



>gb|EYU26567.1| hypothetical protein MIMGU_mgv1a005379mg [Erythranthe guttata]
Length=486

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 314/453 (69%), Gaps = 17/453 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +LPPG TGWPVIGES++ +       P+K++ DRM KYS +VF+T +LGEK AVFCGA G
Sbjct  41    SLPPGKTGWPVIGESLEFLSTGWKGHPEKFVFDRMAKYSSQVFRTHLLGEKAAVFCGANG  100

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F+NEN L+ +WWP SV K     TQ + ++ +   R  +    KPE L+ YI T+D
Sbjct  101   NKFLFSNENKLVQSWWPVSVNKVFPSSTQTSSKEEAIRMRKMLPNFLKPEALRRYIGTMD  160

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
              +A+ H  ++W   +E+ V+ L+K YTF LAC++FLS+E    V R  DP   ++SG+  
Sbjct  161   RIAQRHFTDQWENKKEIIVFDLAKSYTFWLACRVFLSVEDPKHVARFADPFNALASGLIG  220

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG---RDVLGRLLNL  865
             +P++ P T +NRA+K    +R++LV +I+ RK E         E E    +D+L  +L  
Sbjct  221   IPVDLPWTPFNRAIKASKYIRKELVLIIRRRKIEL-------AEGEALPSQDILSHMLVT  273

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
              DE+G+ ++E EI   I+G+L+  + + S+  T ++K+LAELP IY  VY EQ+EIA  K
Sbjct  274   GDEDGKFMDEMEIADKILGLLVGGHDTASSTCTLIVKYLAELPEIYVGVYNEQMEIANGK  333

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
              P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F Y GF+IPKGWK +W+  
Sbjct  334   TPGELLNWDDIQKMKYSWNVACEVLRLSPPLQGAFREALADFVYNGFSIPKGWKIYWSAS  393

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STH+NP+ F EPEK DPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  
Sbjct  394   STHRNPEIFPEPEKLDPSRFEGTGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKR  453

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             F+ EK++PDEKIV  N  P P  GLPVRL PH+
Sbjct  454   FRCEKIIPDEKIVV-NPMPIPAKGLPVRLYPHK  485



>gb|ACJ84447.1| unknown [Medicago truncatula]
Length=479

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/465 (50%), Positives = 324/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGES++ +       P+K+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIHE  469
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT    + L++ S   R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
              FKPE L+ Y+  +D +A+ H    W    E  VY L+K YTF LAC+LF+S+E  + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNETTVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  DP  ++++G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+ +    ++   + 
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQ-  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  +L  +DE G+ +NE  I   I+G+L   + + S A TF++K+L ELPHIY +
Sbjct  258   ---DILSHMLLTSDENGKSMNELNIADKILGLLTGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNV CE +RL PP QGGFRE +++F + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHKN + F  PEKFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+   FK EK++PDEKI+  +  P P   LP+RL PH+
Sbjct  435   EILVFMHNLAKRFKWEKVIPDEKIIV-DPFPIPAKDLPIRLYPHK  478



>ref|XP_006353745.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score =   472 bits (1215),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 321/449 (71%), Gaps = 12/449 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG +GWPVIGES++ +       P+K+I DR+ KYS  +FKT +LGEK  VFCGA+ N
Sbjct  36    LPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRIFKYSSNIFKTHLLGEKAIVFCGASSN  95

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L+ YI  +D 
Sbjct  96    KFLFSNENKLVQAWWPSSVDKVFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRYIGIMDH  155

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A++H  + W    EV V+ L+K YTF LAC+LF+S+E  + V +L DP  +++SG+ S+
Sbjct  156   IAQKHF-QSWENQEEVLVFPLAKRYTFWLACRLFVSVEDPNHVAKLADPFDVLASGLISI  214

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P+N PGT +NRA+K  + +R++LV +IK+RK +    + GK  ++ +D+L  +L  +DE 
Sbjct  215   PINLPGTPFNRAIKASNFIRKELVAIIKQRKIDL---TEGKA-SDSQDILSHMLLTSDEN  270

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY  VYKEQIEIAKSKGP E
Sbjct  271   GKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPDIYDGVYKEQIEIAKSKGPGE  330

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+ ED++KMKYSWNV CE LRL PP QG FRE + +FT+ GF+IPKGWK +W+  STH+
Sbjct  331   LLNREDIKKMKYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWKIYWSANSTHR  390

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F +P KFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  F  +
Sbjct  391   NPEVFLDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFSWK  450

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++ DEKI+  N  P P NGLP+RL PH 
Sbjct  451   KIIHDEKIIV-NPMPIPANGLPIRLYPHH  478



>gb|AED99868.1| cytochrome P450 [Panax notoginseng]
Length=481

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 311/449 (69%), Gaps = 11/449 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWP+IGES + +       P+K+I DRM KYS  VFKTSI GE  AVFCGA  N
Sbjct  37    LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAXCN  96

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +   FKPE L+ YI  +D 
Sbjct  97    KFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYIGLMDQ  156

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A +H    W    EV V+ L+K YTF +ACK+F+S+E   +V  LL+P   ++SG+ S+
Sbjct  157   IAAKHFESGWENKDEVVVFPLAKSYTFWIACKVFVSVEEPAQVAELLEPFSAIASGIISV  216

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N A+K   +VRR+LV +I +RK +      GK  +  +D+L  +L  +DE 
Sbjct  217   PIDLPGTPFNSAIKSSKIVRRKLVGIINQRKIDL---GEGKA-SPTQDILSHMLLTSDES  272

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ + E EI   I+G+L+  + + S+A TFV+KFLAELP IY  VY+EQ+EI KSK   E
Sbjct  273   GKFMGEGEIADKILGLLIGGHDTASSACTFVVKFLAELPQIYXGVYQEQMEIVKSKKAGE  332

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L WED+QKMKYSWNV CE LRL PP QG FRE +S+FTY GF+IPKGWK +W+  STH+
Sbjct  333   LLKWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANSTHR  392

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             N + F EP KFDPSRF+G+GP PF+FVPFG GPRMCPGKEYARLEILVFMH++V  FK E
Sbjct  393   NSEVFPEPLKFDPSRFDGAGPPPFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKWE  452

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++PDEKIV  N  P P NGLPVRL PH+
Sbjct  453   KVIPDEKIVV-NPMPIPANGLPVRLFPHK  480



>ref|XP_003531849.1| PREDICTED: cytochrome P450 716B2 isoform X1 [Glycine max]
 gb|KHN17287.1| Cytochrome P450 716B2 [Glycine soja]
Length=482

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 328/466 (70%), Gaps = 16/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSI  295
             II++  ++  S PNLPPG  G+PVIGES++ +      +P+K+ SDRM +YS +VFKTSI
Sbjct  23    IIFYRHRSPFSVPNLPPGKAGFPVIGESLEFLSAGRKGLPEKFFSDRMTEYSSKVFKTSI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHE  469
             LGE   +FCGAA NKF F+NEN  + +WWP++V K  +FPT  Q   ++ +   RN + +
Sbjct  83    LGEPTVIFCGAACNKFLFSNENKHVISWWPENVKK--LFPTNIQTNSKEEAKKLRNILPQ  140

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
                 + ++ Y+  +D++A+ H A EW    +V V  L+K YTF +A ++F+SI+  ++V 
Sbjct  141   FLSAKAIQRYVGIMDTVAQRHFALEWENNTQVTVLPLAKRYTFGVASRVFMSIDDLNQVA  200

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +L +P+  V++G+ S+P+NFPGT +NR +K    +RR+L+ ++K+RK E     S   + 
Sbjct  201   KLAEPLNQVNAGIISMPINFPGTVFNRGIKASKFIRRELLRIVKQRKVELANGMSTPTQ-  259

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP-HIYQ  1006
                D+L  +L   DE GQ+L E +I + I+G+L+ ++ + S   TFV+K+LAELP +IY+
Sbjct  260   ---DILSHMLIYCDENGQYLAEHDIVNKILGLLIGSHETTSTVCTFVVKYLAELPQNIYE  316

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              VY+EQ+ IAKSK P E L+W+D+QKMKYSWNV CE +RL PP QG FRE +++F + GF
Sbjct  317   NVYQEQMAIAKSKAPGELLNWDDIQKMKYSWNVACEVIRLNPPAQGAFREAINDFIFDGF  376

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             +IPKGWK +W+  STHKNP+YF EPEKFDPSRFEG+GPAP+T+VPFG GP MCPGKEYAR
Sbjct  377   SIPKGWKLYWSANSTHKNPEYFPEPEKFDPSRFEGTGPAPYTYVPFGGGPSMCPGKEYAR  436

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +E+LVFMHN+V  FK E L P+  + Y N  P P  GLPVRL PH+
Sbjct  437   MELLVFMHNLVKRFKCETLFPNGNVTY-NPTPIPAKGLPVRLIPHR  481



>ref|XP_002264643.3| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=509

 Score =   472 bits (1215),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/465 (51%), Positives = 321/465 (69%), Gaps = 15/465 (3%)
 Frame = +2

Query  134   IIYFITK-ANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTS  292
             I +F+ K   +S  NLPPG  G+P IGES++ +       P+++I DRM KYS ++FKT 
Sbjct  51    IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  110

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIH  466
             +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV K  +FP+  Q + ++ S   R  + 
Sbjct  111   LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSVEK--IFPSSLQTSTKEESMKTRKLLP  168

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                KPE L+ Y+  +DS+AK H+   W     V V+ L+K YTF +AC+LFLSI+    +
Sbjct  169   AFLKPEALQKYVGIMDSIAKWHLDNHWDLNETVTVFPLAKQYTFMVACRLFLSIDDPKHI  228

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +  +P  I+++G+ S+P+NFPGT +NRA+K    VR++L  +IK+RK + +   +GK  
Sbjct  229   AKFANPFHILAAGVMSIPINFPGTPFNRAIKAADSVRKELRAIIKQRKIQVL---AGKSS  285

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +   D+L  +L  TDE GQ LNE +I   I+G+L+  + + SA ITF++K+LAELP +Y 
Sbjct  286   SSKHDILSHMLTTTDENGQFLNEMDIADKILGLLIGGHDTASAVITFIIKYLAELPQVYN  345

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KEQ+E+A  K   E L WED+QKMKYSWNV  E +RL PP QG FRE +++FTYAGF
Sbjct  346   EVLKEQMEVAAGKKSGEMLDWEDIQKMKYSWNVANEVMRLAPPLQGSFREAITDFTYAGF  405

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             +IPKGWK +W+  +THKNP YF +PEKFDPSRFEG+GP P+T+VPFG GPRMCPGKEYAR
Sbjct  406   SIPKGWKLYWSTNATHKNPDYFPDPEKFDPSRFEGNGPIPYTYVPFGGGPRMCPGKEYAR  465

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LEILVF+HNVV  F   KL P+E ++  +  P P  GLP+RL  H
Sbjct  466   LEILVFIHNVVRRFSWYKLHPNEDVIV-DPMPMPAKGLPIRLRHH  509



>gb|AEX07772.1| cytochrome P450 [Catharanthus roseus]
 gb|AEX07773.1| cytochrome P450 [Catharanthus roseus]
Length=480

 Score =   471 bits (1212),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 325/461 (70%), Gaps = 12/461 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++  K+    P LPPG TGWP++GES+  +       P+K+I DRM KYS  VF++ +L
Sbjct  23    LFYKNKSTLPGP-LPPGRTGWPMVGESLQFLSAGWKGHPEKFIFDRMAKYSSNVFRSHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GE  AVFCGA GNKF F+NEN L+  WWP SV K      Q + ++ +   R  +    K
Sbjct  82    GEPAAVFCGAIGNKFLFSNENKLVQAWWPDSVNKVFPSSNQTSSKEEAIKMRKMLPNFLK  141

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D +A++H +  W    +V+V+ L+K YTF LA +LF+S+E   EV +LL
Sbjct  142   PEALQRYIGLMDQIAQKHFSSGWENREQVEVFPLAKNYTFWLASRLFVSVEDPIEVAKLL  201

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             +P  +++SG+ S+P++ PGT +NRA+K  + VR+ L+ +IK+RK +    + GK  +  +
Sbjct  202   EPFNVLASGLISVPIDLPGTPFNRAIKASNQVRKMLISIIKQRKIDL---AEGKA-SPTQ  257

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++KFL ELP IY+ VYK
Sbjct  258   DILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKFLGELPEIYEGVYK  317

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EIA SK P E L+WED+QKMKYSWNV CE LRL PP QG FRE +++F + GF+IPK
Sbjct  318   EQMEIANSKAPGEFLNWEDIQKMKYSWNVACEVLRLAPPLQGAFREALNDFMFHGFSIPK  377

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+V STH+NP+ F +P KFDPSRF+GSGPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  378   GWKIYWSVNSTHRNPECFPDPLKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLEIL  437

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             VFMHN+V  FK EK++P+EKIV  +  P P  GLPVRL PH
Sbjct  438   VFMHNLVKRFKWEKIIPNEKIVV-DPMPIPEKGLPVRLYPH  477



>ref|XP_002309057.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
 gb|EEE92580.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
Length=484

 Score =   471 bits (1212),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 327/461 (71%), Gaps = 15/461 (3%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILG  301
             Y+++  N    NLPPG+TG P+IGES++ +       P+K+I DRM K+S +VFKTS+  
Sbjct  31    YYLSSLN----NLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTSLFC  86

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKP  481
             E  AVFCGAAGNKF F+NEN L+T WWP SV K      Q + ++ S   R      FKP
Sbjct  87    EPTAVFCGAAGNKFLFSNENKLVTAWWPDSVNKIFPSSQQTSSQEESKKMRKLFPLFFKP  146

Query  482   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
             E+L+ YI  +D +A+ H+A +W   +EV V+ L+K YTF LAC+LFLS+E  +EV++   
Sbjct  147   ESLQRYISVMDVIAQRHLASDWEGKQEVSVFPLAKTYTFWLACRLFLSMEDPEEVQKFAK  206

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P   +++G+ S+P++ P T +NR +K  ++V ++L+++IK+RK +   + +   +    D
Sbjct  207   PFNDLAAGIISIPIDLPWTPFNRGVKASNVVHKELLKIIKQRKIDLAENKASPTQ----D  262

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L  +L   D+ GQ + + +I   I+G+L+  + + SAAITF++K+LAELPH+Y ++ +E
Sbjct  263   ILSHMLTTADDNGQCMKKIDIADKILGLLVGGHDTASAAITFIVKYLAELPHVYNKLLEE  322

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q EIAK+K P E L+WED+Q+M+YSWNV CE +R+ PP QG FRE ++EF YAGFTIPKG
Sbjct  323   QREIAKTKTPGELLNWEDIQRMRYSWNVACEVMRVAPPLQGAFREAMTEFNYAGFTIPKG  382

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WK +W+  +THKNP+ F EPE FDPSRFEG+GPAP+TFVPFG GPRMCPGKEYARLEILV
Sbjct  383   WKLYWSANTTHKNPECFPEPENFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILV  442

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             F+HN+V  F+ EKL+P E+I+  +  P P  GLP+RL PH+
Sbjct  443   FLHNLVKKFRWEKLLPKERIIV-DPMPIPSKGLPIRLHPHE  482



>emb|CBI39253.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   470 bits (1209),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 239/468 (51%), Positives = 318/468 (68%), Gaps = 40/468 (9%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             +I F+     S   LPPG  G P+IGESI+  +      P  +I+DRM +YSP+VF+TS+
Sbjct  20    LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-----RNN  460
             +GE +AV CGAAGNKF F+NEN L+ +WWP+SV K L FP+ N        +     ++ 
Sbjct  80    MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSVYKVLYFPSPNDKDSSGAADLMMNMKSY  139

Query  461   IHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRD  640
             + E  KP+ L+ YIP +DSMA+EHI  +WAP REVKV+ L + YTF LAC+LF+ I+G +
Sbjct  140   LIEFVKPDALQQYIPVMDSMAREHIDMDWAPNREVKVFQLVQKYTFALACRLFMYIQGEE  199

Query  641   EVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGK  820
              + ++  P  ++  G  S+P++ PGT +NR  KG S V                      
Sbjct  200   NIAKIAHPFHLIVQGFMSVPIDLPGTGFNRE-KGVSKV----------------------  236

Query  821   VENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHI  1000
                   D+L R+L   DE+G+HLN+ EI  Y++G+LL ++ + S+AITF LK+LA  P +
Sbjct  237   -----PDLLSRMLLSPDEKGRHLNDIEINSYMVGLLLASHDTTSSAITFTLKYLALFPDV  291

Query  1001  YQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYA  1180
             + +V KEQ+EIA+SKGP E L+W D+QKMKY+W V  E++RL PP QG FRE  ++FT+A
Sbjct  292   HNKVLKEQMEIAQSKGPGELLNWSDIQKMKYTWCVARESMRLAPPAQGAFREATTDFTFA  351

Query  1181  GFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEY  1360
             GFTIPKGWKT W V+STHKNPKYF  PEKFDPSRFEG GP P+TFVPFG GPRMC GKEY
Sbjct  352   GFTIPKGWKTHWCVHSTHKNPKYFPNPEKFDPSRFEGKGPEPYTFVPFGGGPRMCVGKEY  411

Query  1361  ARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ARLEILVF+HNVVT FK+E ++ +EKI++  +A  P  GLP+RL PHQ
Sbjct  412   ARLEILVFIHNVVTKFKLETVLENEKILFGLSA-LPAKGLPIRLQPHQ  458



>emb|CDP14237.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   470 bits (1210),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 325/462 (70%), Gaps = 12/462 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSIL  298
             ++F +K+ +S   LPPG +GWPVIGES + +       P+K+I DR+ KYS  VF+T +L
Sbjct  23    LFFKSKSGSSG-RLPPGKSGWPVIGESYEFLSTGWKGYPEKFILDRIAKYSSNVFRTHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GEK AVFCGAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  +    K
Sbjct  82    GEKAAVFCGAAGNKFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEEAIKMRKMLPNFLK  141

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ YI  +D +A  H +  W    +V+V+ L K YTF +A +LF+S+E   EV +LL
Sbjct  142   PEALQRYIGIMDHIAGRHFSSGWENKDQVEVFPLCKNYTFWIASRLFVSVEEPTEVAKLL  201

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             +P  +++SG+ S+P++ PGT +N+A+K  + +R+ LV +IK+R+ +    + GK  +  +
Sbjct  202   EPFNVLASGLISVPVDLPGTPFNKAIKASNEIRKMLVSIIKQRQIDL---ADGKA-SPTQ  257

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D++  +L  +DE G+ + E ++   I+G+L+  + + S+A TF++K+LAELP IY+ VYK
Sbjct  258   DIMSHMLTTSDENGKFMQELDVADKILGLLIGGHDTASSACTFIVKYLAELPEIYEGVYK  317

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EIA SK P E L+WED+QKMKYSWNV CE LRL PP QG FRE +++F + GF+IPK
Sbjct  318   EQMEIANSKAPGELLNWEDIQKMKYSWNVACEVLRLAPPLQGAFREALNDFMFNGFSIPK  377

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W+  STH+NP+ F EP KFDP+RF GSGPAP+TFVPFG GPRMCPGKEYARLEIL
Sbjct  378   GWKIYWSANSTHRNPECFPEPLKFDPTRFVGSGPAPYTFVPFGGGPRMCPGKEYARLEIL  437

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMH+VV  FK EK++ DEKIV  +  P P  GLPVRL PH+
Sbjct  438   VFMHHVVKRFKWEKIIADEKIVV-DPMPIPAKGLPVRLYPHR  478



>ref|XP_002279472.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score =   470 bits (1209),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/468 (51%), Positives = 322/468 (69%), Gaps = 23/468 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE++   +      P+++I+DRM KYSPEVF+ S+
Sbjct  21    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP-------TQNTLRKISTLNR  454
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP       TQ+ ++  S L  
Sbjct  81    MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLP-  139

Query  455   NNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE LKHY+  +D MA  HI  +WAP+REVKV+ L K Y F L+C+LF+ ++ 
Sbjct  140   ----EFLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDD  195

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
                V R+  P  ++ +G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK E      
Sbjct  196   PQCVARISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRKMEL----G  251

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K  +  RD L  +L   ++ G+ ++E EI  ++I +LL T+ S SA ITFVLK+LAE P
Sbjct  252   QKGNSAARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFP  311

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY +V+KEQ+EIAK KG  E L+W+D+QKM+YSWNV  E +RL PP QG FRE +  FT
Sbjct  312   SIYNEVFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFT  371

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFT+PKGWKT WNV +TH+NPKYF + EKFDPSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  372   YAGFTMPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGR  431

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             EYAR ++LVF+HN+VT FK E++ P+EKI Y N +P P  G P+ L P
Sbjct  432   EYARAQVLVFIHNIVTKFKWERVDPNEKISY-NPSPIPEKGFPICLQP  478



>ref|XP_010095208.1| Cytochrome P450 [Morus notabilis]
 gb|EXB58669.1| Cytochrome P450 [Morus notabilis]
Length=490

 Score =   469 bits (1207),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 232/461 (50%), Positives = 327/461 (71%), Gaps = 11/461 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  +++ S  NLPPG  G+PVIGE+++ +       P+K+I DRM K+S EVFKTS+
Sbjct  25    VVFYKHRSHYSGANLPPGKIGYPVIGETMEFLSTGWRGHPEKFIFDRMTKFSTEVFKTSL  84

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             +GE  AVFCGAA NKF F+NEN L+T WWP SV K      Q + +  +   R  +    
Sbjct  85    VGEPAAVFCGAACNKFLFSNENKLVTAWWPSSVNKVFPSSMQTSSQDEAKKMRKLLPGFM  144

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D++A+ H A +W     +  + L+K YTF LA KLF+S++   E+++ 
Sbjct  145   KPEALQRYIGVMDTIAQRHFAADWDNHNHILTFPLAKRYTFWLAAKLFVSLDDPKEIRKF  204

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              +P  +++SG+ S+P++FPGT ++RA+K  + +R++L+++IK+RK +    + GK  +  
Sbjct  205   EEPFQLLASGIISMPIDFPGTPFHRAIKASNFIRKELLKIIKQRKIDL---AEGKA-SPT  260

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L    ++GQ++NE +I   I+G+L+  + + SAA TF++K+LAELPHIY  VY
Sbjct  261   QDILSHMLLTCTDDGQYMNELDIADKILGLLVGGHDTASAACTFIVKYLAELPHIYDAVY  320

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIAKSK   E L+W+DVQKMKYSWNV  E LRL PP QG FRE +++F + GF+IP
Sbjct  321   QEQMEIAKSKAEGELLNWDDVQKMKYSWNVAQEVLRLAPPLQGAFREAMTDFVFNGFSIP  380

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKNP YF EPEKFDPSRFEG GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  381   KGWKLYWSANSTHKNPSYFPEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARLEI  440

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LVFMHN+V  +K EK++P+E I+  +  P P  GLPVRL P
Sbjct  441   LVFMHNLVKRYKWEKILPEENIIV-DPMPMPAKGLPVRLFP  480



>gb|AHF22088.1| CYP716A75 [Maesa lanceolata]
Length=487

 Score =   468 bits (1205),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 317/454 (70%), Gaps = 11/454 (2%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKV  310
             T+AN +  NLPPG TGWPV+GES   +       P+K+I DR+ KYS  V+KT+++ E+ 
Sbjct  34    TEANKNSANLPPGLTGWPVVGESFQFLAAGWRGNPEKFIFDRIAKYSSYVYKTNLMLERT  93

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AVFCGA  +KF F+NEN L+ +WWP SV K      Q + ++ +   R  +   FKPE L
Sbjct  94    AVFCGAPAHKFLFSNENKLVQSWWPSSVNKIFPSSNQTSSKEEAMKMRKMLPNFFKPEAL  153

Query  491   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPII  670
             + YI  +D++A+ H A +W     + V+ L K YTF LACK+F+SIE   +V R L    
Sbjct  154   QGYIGIMDTIAQRHFAADWDNKDYIVVFPLCKRYTFWLACKIFMSIEDPKDVDRFLARFN  213

Query  671   IVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLG  850
             +V+ G+ S+P++ PGT ++ ++K    +R  LV +IK+RK +    + GK  +  +D++ 
Sbjct  214   LVAEGLLSIPIDLPGTPFHHSIKAAEFIREHLVAIIKQRKIDL---AEGKA-SPTQDIMS  269

Query  851   RLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIE  1030
              +L   DE+G+ + E++I   I+G+L+  + + S+A  F++K+LAELP +YQ VYKEQ+E
Sbjct  270   YMLLTPDEDGKFMKEYDIADKILGLLVGGHDTASSACAFIVKYLAELPQVYQGVYKEQME  329

Query  1031  IAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             IAKSKGP E L+W+D+QKMKYSWNV CE LRL PP QG FR+ + +F Y GF IPKGWK 
Sbjct  330   IAKSKGPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFRDVLKDFMYEGFYIPKGWKV  389

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +W+ +STHKNP+YF EP KFDPSRF+GSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH
Sbjct  390   YWSAHSTHKNPEYFPEPYKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMH  449

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             N+V  F+ EKL+PDEKIV  N  P P  GLP+RL
Sbjct  450   NLVKRFRWEKLIPDEKIVV-NPMPVPEKGLPIRL  482



>dbj|BAP59949.1| cytochrome P450 monooxygenase CYP716A48 [Olea europaea]
Length=479

 Score =   468 bits (1204),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 323/462 (70%), Gaps = 13/462 (3%)
 Frame = +2

Query  137   IYFITKANTSK--PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             ++F+   N S     +PPG TGWPVIGES++ +       P+K+I DR+ KYS  VF+T 
Sbjct  20    LHFLFYKNKSSFSGQIPPGKTGWPVIGESLEFLSNGWKGHPEKFIFDRIAKYSSYVFRTH  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEI  472
             + GE  AVFCGA GNKF F+NEN L+  WWP SV K      Q + ++ +   R  +   
Sbjct  80    LFGEPAAVFCGANGNKFLFSNENKLVQAWWPASVDKVFPSSNQTSSKEEAVKMRKMLPTF  139

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
             FKPE L+ Y+  +D +A+ H ++ W    EV V+ L+K YTF LAC+LF+S+E    V +
Sbjct  140   FKPEALQRYVGIMDHIAQRHFSDGWDNKNEVVVFPLAKRYTFWLACRLFVSVEDPAHVAK  199

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
               DP   ++SG+ S+P++ PGT ++RA+K  + +R++LV +IK+RK +    + GK  + 
Sbjct  200   FADPFNELASGLISIPIDLPGTPFHRAIKSSNFIRKELVSIIKQRKIDL---AEGKA-SP  255

Query  833   GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQV  1012
              +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TFV+K+LAELP IY+ V
Sbjct  256   TQDILSHMLLTSDESGKFMHELDIADKILGLLVGGHDTASSACTFVVKYLAELPEIYEGV  315

Query  1013  YKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTI  1192
             Y+EQ+EIAKSK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F + GF+I
Sbjct  316   YQEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREAITDFMFNGFSI  375

Query  1193  PKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLE  1372
             PKGWK +W+  STH+N ++F EP KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLE
Sbjct  376   PKGWKLYWSANSTHRNSEFFPEPLKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLE  435

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             ILVFMH++V  FK EKL+PDEKIV  +  P P  GLP+RL P
Sbjct  436   ILVFMHHLVKRFKWEKLIPDEKIVV-DPMPIPAKGLPIRLYP  476



>ref|XP_006353795.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=486

 Score =   468 bits (1204),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 323/470 (69%), Gaps = 24/470 (5%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILG  301
             YF   ++     LPPG TGWP IGE+++ +       P+K+I DRM KYS  VF+T +L 
Sbjct  24    YFNKNSSVLPGTLPPGKTGWPFIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFRTHLLL  83

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT---QNTLRKISTLNRNNIH--  466
             E  AVFCGA+GNKF F+NEN L+  WWP S+ K  +FP+   QNT  K +++N   I   
Sbjct  84    ENSAVFCGASGNKFLFSNENKLVQVWWPDSINK--IFPSSVDQNT--KTTSINEQGIRMR  139

Query  467   ----EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                   FKPE L+ Y+  +DS+A+ H    W    +V+VY L+K YTF LAC+LF+SIE 
Sbjct  140   RLLPNFFKPEALQRYVGIMDSIAQRHFESFWEKKSQVQVYPLAKSYTFWLACRLFVSIED  199

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
                V +   P  ++++G+ S+P+N PGT+YNR++K  +++R++L+ +IK+RK +     +
Sbjct  200   PKHVAKFAKPFDVLAAGLISIPINLPGTSYNRSIKASNLIRKELLMIIKQRKVDLCEGKA  259

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
                +    D+L  +L  +DE G+ + + +I   I+G+L+  + + S+A T ++K+LAELP
Sbjct  260   SATQ----DILSHMLLTSDENGKFMPDLDIACKILGLLVGGHDTASSACTSIVKYLAELP  315

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
             H+YQ VY EQ+EI+KSK   E L+W+D+QKMKYSWNVVCE LRL PP QG FRE + +F 
Sbjct  316   HVYQAVYNEQMEISKSKAAGELLTWDDLQKMKYSWNVVCEVLRLAPPLQGAFREAIVDFI  375

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             + GF+IPKGWK +WN  +TH+NP+YF EP  FDPSRFEGSGPAP+TFVPFG GPRMCPGK
Sbjct  376   FNGFSIPKGWKLYWNSNTTHRNPEYFPEPLNFDPSRFEGSGPAPYTFVPFGGGPRMCPGK  435

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EYARLEILVFMH++V  FK  K++ DEKI+  +  P P  GLP++L PHQ
Sbjct  436   EYARLEILVFMHHIVKRFKWNKVIHDEKIII-DPMPVPAKGLPIKLYPHQ  484



>ref|XP_004503562.1| PREDICTED: cytochrome P450 716B2-like [Cicer arietinum]
Length=478

 Score =   466 bits (1199),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 232/463 (50%), Positives = 328/463 (71%), Gaps = 15/463 (3%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILG  301
             +F+   + S  NLPPG  G+PVIGES++ +       P+K+I DRM KYS E+FKTSILG
Sbjct  22    FFLFYKHKSPWNLPPGKMGYPVIGESLEFLSTGWKGHPEKFIFDRMIKYSSELFKTSILG  81

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIF  475
             +   V CGAA NKF F+NEN L+T WWP+SVIK  +FPT  Q   ++ S   R  I +  
Sbjct  82    QPTVVCCGAACNKFLFSNENKLVTVWWPESVIK--IFPTSLQTNFKEESLKMRKLIPQFL  139

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ Y+  +DS+A++H A  W    EV VY L+K YTF LAC+LF+S+E  + V + 
Sbjct  140   KPEALQRYVGIMDSIAQKHFASLWENKTEVTVYPLAKRYTFLLACRLFMSVEDENHVAKF  199

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              DP  ++++G+ SLP++ PGT +N+A+K  + ++++L+++I++RK    M  +  V +  
Sbjct  200   SDPFHLLAAGIISLPIDLPGTPFNKAIKASNFIKKELLKIIRQRK----MDLAKGVASAT  255

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L   +E G+ ++E +I   I+G+L+  + + S A TF++K+LA+LPHIY  V+
Sbjct  256   QDILSHMLLTCNENGEFMSELDIADKILGLLIGGHDTASVACTFIVKYLADLPHIYDTVF  315

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIAKSK   E L+W+D++KM+YSWNV CE +R+ PP QGGFRE +++F + GF+IP
Sbjct  316   QEQMEIAKSKSQGELLNWDDLKKMRYSWNVACEVMRVAPPLQGGFREAITDFMFNGFSIP  375

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKNP+ F  PEKFDP+RFEG+GP P+T+VPF  GPRMCPGKEYARLEI
Sbjct  376   KGWKLYWSANSTHKNPECFPMPEKFDPTRFEGNGPPPYTYVPFDGGPRMCPGKEYARLEI  435

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHN+V  FK EKL+PDE+IV  +  P P   LP+RL PH 
Sbjct  436   LVFMHNLVKRFKWEKLIPDEEIVV-DPFPIPAKDLPIRLYPHD  477



>gb|KDO67048.1| hypothetical protein CISIN_1g037867mg [Citrus sinensis]
Length=495

 Score =   466 bits (1200),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 317/451 (70%), Gaps = 11/451 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGES++ +       P+K+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  45    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  104

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L  Y+  +DS
Sbjct  105   KFLFSNENKLVQAWWPDSVNKIFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMMDS  164

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A++H    W   ++V V+AL+K +TF++ACK+FLSIE    V +L  P   ++SG+ S+
Sbjct  165   IAQKHFESGWEGKQQVAVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGIISV  224

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE---AMMSSSGKVENEGRDVLGRLLNLT  868
             P++ PGT +NRA+K    +R++L+ +IK+RK E   A  SS+    +  +D+L  +L  T
Sbjct  225   PIDLPGTPFNRAIKASKFIRKELIAIIKQRKTELAAAAASSTTPAHHHHQDILSHMLLAT  284

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE GQH++E ++   I+G+L+  + + SAAITF++KFLA LPHIY QV  EQ+EIAK KG
Sbjct  285   DENGQHMSELDVADKILGLLIGGHDTASAAITFIVKFLAGLPHIYNQVLNEQMEIAKRKG  344

Query  1049  PNERL-SWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
               E+L +WED+QKMKYSWNV CE +RL PP QG FRE +++F ++GFTIPKGWK +W+V 
Sbjct  345   EGEQLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWSVN  404

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STH+NP+ F EPEKFDP+RF+G GPAP+T+VPFG GPRMCPGKEYARLEILVF+HN+V  
Sbjct  405   STHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIVRR  464

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             F   +++P EKI+  +  P P +GLPVRL P
Sbjct  465   FSWLQILPHEKIIV-DPLPMPAHGLPVRLFP  494



>ref|XP_006488697.1| PREDICTED: cytochrome P450 716B2-like [Citrus sinensis]
Length=534

 Score =   468 bits (1203),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 318/452 (70%), Gaps = 11/452 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGES++ +       P+K+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  84    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  143

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L  Y+  +DS
Sbjct  144   KFLFSNENKLVQAWWPDSVNKIFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMMDS  203

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A++H    W   ++V V+AL+K +TF++ACK+FLSIE    V +L  P   ++SG+ S+
Sbjct  204   IAQKHFESGWEGKQQVTVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGIISV  263

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE---AMMSSSGKVENEGRDVLGRLLNLT  868
             P++ PGT +NRA+K    +R++L+ +IK+RK E   A  SS+    +  +D+L  +L  T
Sbjct  264   PIDLPGTPFNRAIKASKFIRKELMAIIKQRKTELAAAAASSTTTAHHRHQDILSHMLLAT  323

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE GQH++E ++   I+G+L+  + + SAAITF++KFLA LPHIY QV  EQ+EIAK KG
Sbjct  324   DENGQHMSELDVADKILGLLIGGHDTASAAITFIVKFLAGLPHIYNQVLNEQMEIAKRKG  383

Query  1049  PNERL-SWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
               E+L +WED+QKMKYSWNV CE +RL PP QG FRE +++F ++GFTIPKGWK +W+V 
Sbjct  384   EGEQLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWSVN  443

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STH+NP+ F EPEKFDP+RF+G GPAP+T+VPFG GPRMCPGKEYARLEILVF+HN+V  
Sbjct  444   STHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIVRR  503

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             F   +++P EKI+  +  P P +GLPVRL PH
Sbjct  504   FSWLQILPHEKIIV-DPLPMPAHGLPVRLFPH  534



>gb|KHN16705.1| Cytochrome P450 716B2 [Glycine soja]
Length=472

 Score =   465 bits (1196),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 326/465 (70%), Gaps = 25/465 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGES++ +       P+K+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNIHE  469
             LGE   +F     NK            WWP SV K  +FPT   +  ++ S   R  + +
Sbjct  84    LGEPKFLFSNE--NKLVAA--------WWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  131

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIE  + V 
Sbjct  132   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  191

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  +P  +++SG+ S+P++ PGT +N+A+K  + +R++L+++I++RK +    + GK  +
Sbjct  192   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKA-S  247

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  248   PTQDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  307

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAK K P E L+W+DV +M+YSWNV CE +R+ PP QGGFRE +++F + GF+
Sbjct  308   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  367

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHK+P+YF EPEKFDP+RFEG GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  368   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  427

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK +KL+PDEKI+  +  P P   LP+RL PH+
Sbjct  428   EILVFMHNLVKRFKWQKLIPDEKIIV-DPLPIPAKNLPIRLHPHK  471



>gb|EYU26566.1| hypothetical protein MIMGU_mgv1a021994mg [Erythranthe guttata]
Length=469

 Score =   465 bits (1196),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 314/449 (70%), Gaps = 23/449 (5%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG TGWPVIGES++ +       P+K+I DRM KYS  +F+T +LGE+ AV CGAAG
Sbjct  32    TLPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMAKYSIHIFRTHLLGEQAAVLCGAAG  91

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F+NEN L+  WWP SV K      Q++ ++ +   R  +   FKPE L  Y+  +D
Sbjct  92    NKFLFSNENKLVQAWWPSSVDKIFPSSAQSSSKEEAIKMRKMLPNFFKPEALHRYVGVMD  151

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
              +A+ H ++ W    EV V+ L+K YTF LAC+LF+SIE    V++  +P  ++++G+ S
Sbjct  152   HIAQRHFSDGWENRDEVVVFPLAKNYTFWLACRLFVSIEDPSHVEKFAEPFNLLAAGLIS  211

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             +P++ PG             R +LV++IK+RK +    + GK  +  +D+L  +L  +DE
Sbjct  212   IPVDLPGR------------RSELVKIIKQRKVDL---AEGKA-SPTQDILSHMLLASDE  255

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
              G+ + E +I   I+G+L+  + + S+A TF++K+LAELP IY  VYKEQ+EIAK+KGP 
Sbjct  256   NGKFMQELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYDGVYKEQMEIAKTKGPG  315

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTH  1234
             E L+WED+QKMKYSWNV CE LRL PP QG FRE +++F Y GF+IPKGWK +W+  STH
Sbjct  316   ELLNWEDLQKMKYSWNVACEVLRLAPPLQGAFREAIADFAYNGFSIPKGWKLYWSANSTH  375

Query  1235  KNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKM  1414
             KNP++F EP+KFDPSRFEGSGPAP+TFVPFG GPRMCPGKEYARLEILVFMH++V  FK 
Sbjct  376   KNPEFFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKW  435

Query  1415  EKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EK++PDEKIV  +  P P  GLPVRL PH
Sbjct  436   EKVIPDEKIVV-DPMPIPAKGLPVRLYPH  463



>ref|XP_006425177.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
 gb|ESR38417.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
Length=495

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 318/451 (71%), Gaps = 11/451 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGES++ +       P+K+I DRM KYS +VFKT+ILGE   V CGA  N
Sbjct  45    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTAILGEPTVVVCGAIAN  104

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K     TQ + ++ +   R  +    KPE L  Y+  +DS
Sbjct  105   KFLFSNENKLVQAWWPDSVNKIFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMMDS  164

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             +A++H    W   ++V V+AL+K +TF++ACK+FLSIE    V +L  P   ++SG+ S+
Sbjct  165   IAQKHFESGWEGKQQVTVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGIISV  224

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE---AMMSSSGKVENEGRDVLGRLLNLT  868
             P++ PGT +NRA+K    +R++L+ +IK+RK E   A  SS+    +  +D+L  +L  T
Sbjct  225   PIDLPGTPFNRAIKASKFIRKELIAIIKQRKTELAAAAASSTTPAHHHHQDILSHMLLAT  284

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE GQH++E ++   I+G+L+  + + SAAITF++K+LAELPHIY+QV  EQ+EIAK KG
Sbjct  285   DENGQHMSELDVADKILGLLIGGHDTASAAITFIVKYLAELPHIYKQVLNEQMEIAKRKG  344

Query  1049  PNERL-SWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
               E+L +WED+QKMKYSWNV CE +RL PP QG FRE +++F ++GFTIPKGWK +W+V 
Sbjct  345   EGEKLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWSVN  404

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STH+NP+ F EPEKFDP+RF+G GPAP+T+VPFG GPRMCPGKEYARLEILVF+HN+V  
Sbjct  405   STHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIVRR  464

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             F   +++P EKI+  +  P P +GLPVRL P
Sbjct  465   FSWLQILPHEKIIV-DPLPMPAHGLPVRLFP  494



>ref|XP_004296643.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   464 bits (1193),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 326/468 (70%), Gaps = 17/468 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
              +++  ++  +  NLPPG  G+PVIGES + +       P+K+I DRM K+S EVFKTS+
Sbjct  23    FLFYRHRSQFTGNNLPPGKVGYPVIGESYEFLSTGWKGHPEKFIFDRMNKFSSEVFKTSL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT----QNTLRKISTLNRNNI  463
              GEK  +F GAA NKF F+NEN L+T WWP SV K  +FP+     ++ ++ +   R  +
Sbjct  83    FGEKACIFAGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSVEDNSSAKEEAKKMRKML  140

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
                  P+ L+ YI  +D++A+ H A  W   +EV +Y L+K YTF LA +LF+S+E  ++
Sbjct  141   PNFMNPQALQRYIGIMDTIAQRHFALGWENKKEVVIYPLAKNYTFWLAARLFVSVEDPED  200

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V RL DP  +++SG+ S+P++ PGTA+N+A+K  + +R +L ++IK+RK +    + GK 
Sbjct  201   VDRLGDPFQLLASGLLSMPIDLPGTAFNKAIKASNWIRGELYKIIKQRKIDL---AEGKA  257

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              +  +D+L  +L L+DEEG H+ E +I   I+G+L+  + + SA  TF++K+L ELPHIY
Sbjct  258   -SPTQDILSHMLLLSDEEGAHMKEMDIADKILGLLIGGHDTASATCTFIVKYLGELPHIY  316

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
               VYKEQ+EIA SK P E L+W+D+QKMKYSWNV  E LR+ PP QG FRE + +F + G
Sbjct  317   DAVYKEQMEIANSKPPGELLNWDDLQKMKYSWNVAQEVLRVAPPLQGAFREALQDFVFNG  376

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             FTIPKGWK +W+  STHKN   F EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYA
Sbjct  377   FTIPKGWKLYWSANSTHKNAAVFPEPYKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             RLEILVFMHN+V  FK E ++PDEK+V  +  P P  GLPVRL PH+K
Sbjct  437   RLEILVFMHNLVKRFKWEAVIPDEKVVI-DPMPMPEKGLPVRLFPHKK  483



>ref|XP_009778451.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=483

 Score =   463 bits (1191),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 325/467 (70%), Gaps = 18/467 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++YF  K++     LPPG TGWPVIGE+++ +       P+K+I DRM KYS  VFKT +
Sbjct  24    LLYF-NKSSVLAGTLPPGKTGWPVIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFKTHL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP---TQN-TLRKISTLNRNNI  463
             L EK AVFCGA GNKF F+NEN L+  WWP S+ K  +FP   TQN ++ +     R  +
Sbjct  83    LMEKSAVFCGATGNKFLFSNENKLVQVWWPNSIKK--IFPSNLTQNFSINEQGIKIRRLL  140

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
                 KPE L+ Y+  +D +A+ H A  W    +V+VY L+K YTF LAC+LF+SIE    
Sbjct  141   PNFLKPEALQRYVGIMDKIAQRHFATCWENKGQVQVYPLAKSYTFWLACRLFVSIEDPQH  200

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V     P  ++++G+ S+P++ PGTAYNR++K  +++R++L+ +IK+RK +    + GK 
Sbjct  201   VAEFAKPFSVLAAGLISIPIDLPGTAYNRSIKASNLIRKELLRIIKQRKIDL---AEGKA  257

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              +  +D+L  +L  +DE G+ +++ EI   I+G+L+  + + S+A T ++KFLAELP +Y
Sbjct  258   -SPTQDILSHMLLTSDESGKFIHDLEIASNILGLLVGGHDTASSACTSIVKFLAELPQVY  316

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
             + VY EQ+EIAKSK   E L+W D++KMKYSWNV CE LRL PP QG FRE +S+  + G
Sbjct  317   EAVYNEQMEIAKSKSAGELLTWYDLRKMKYSWNVACEVLRLAPPLQGAFREAISDLNFNG  376

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             F+IPKGWK +W+  +TH+NP+ F EP KFDPSRFEG GPAP+TFVPFG GPRMCPGKEYA
Sbjct  377   FSIPKGWKLYWSSNTTHRNPECFPEPMKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             RLEILVFMH++V  FK +K++P+EKI+  +  P P NG PV+L PHQ
Sbjct  437   RLEILVFMHHLVKRFKWQKIIPNEKIIV-DPMPVPANGFPVKLYPHQ  482



>emb|CAN67939.1| hypothetical protein VITISV_013692 [Vitis vinifera]
Length=484

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 321/466 (69%), Gaps = 14/466 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG+ GWP+IGE+++  +      P ++++DRM KYSP+VFKTS
Sbjct  20    IVFLITYRHKSSNPNLPPGTMGWPIIGETLEFSLACQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIH  466
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+    TL          + 
Sbjct  80    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLP  139

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
             E  KPE L+HY+ T+DSMA EHI   W+  REV V+ L++ Y+F LA +LF+SI+  + V
Sbjct  140   EFLKPEALQHYLATMDSMASEHIELNWSSNREVLVFPLARKYSFALAFRLFMSIDDPEYV  199

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
             + +  P  I++ G  S+P++ PGT +NRA+K    +  +L+ +I++ K E  +   G + 
Sbjct  200   EMISHPFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLAIIRKXKME--LEQKGDLA  257

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
                RD+L  +L  +DE     +E EI   +I +L  T+H+ S+ ITF+LK+LAE P +Y 
Sbjct  258   T--RDLLSHMLLASDENCDVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  315

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KEQ+EIAKSKGP   L W+D+QKMKY+WNV  E +RL PP QG FRE +++ TYAGF
Sbjct  316   KVLKEQMEIAKSKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGF  375

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIP+GWK  WNV +TH++PKYF +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+EYAR
Sbjct  376   TIPRGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  435

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              ++L F+H+VVT FK EK+ P EK+ Y N +P P  G P+RL P Q
Sbjct  436   AQVLAFIHHVVTRFKWEKVDPCEKVAY-NPSPIPSKGFPIRLQPLQ  480



>dbj|BAP59952.1| cytochrome P450 monooxygenase CYP716A51 [Lotus japonicus]
Length=481

 Score =   461 bits (1185),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 315/453 (70%), Gaps = 11/453 (2%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + PNLPPG  G+PVIGES++ +       P+K+I DRM KY   +FKTSI+GE   VFCG
Sbjct  33    TAPNLPPGRMGFPVIGESLEFLSTGWNGHPEKFIFDRMTKYCSHIFKTSIVGEPAVVFCG  92

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIP  505
              A NKF F+NEN L+T WWP SV K      Q + ++ S   R  + +  KP+ L+ Y+ 
Sbjct  93    PACNKFLFSNENKLVTAWWPNSVNKVFPSSLQTSSKEESKKMRKMLPQFLKPQALQRYVG  152

Query  506   TIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSG  685
              +D +A+ H    W    EV VY L+K YTF LA +LF+SIE    V +L D   +++SG
Sbjct  153   IMDDIAQRHFESHWENKTEVTVYPLTKRYTFLLASRLFMSIEDDTHVAKLRDTFHLLASG  212

Query  686   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNL  865
             + S+P++ PGT + +A+   +++R++L+++I++RK +    + GK  +  +D+L  +L  
Sbjct  213   IISVPVDLPGTPFRKAINASNVIRKELLKIIRQRKVDL---NEGKA-SPTQDILSHMLLT  268

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
              +E GQ +NE +I   I+G+L+  + + SA  TF++K+LAELPHIY +VY EQ+EIAK K
Sbjct  269   CNESGQFMNELDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDKVYHEQMEIAKLK  328

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
              P E L+W+DV KM+YSWNV CE +R+ PP QGGFRE + +F + GF+IPKGWK +W+  
Sbjct  329   SPGELLNWDDVNKMRYSWNVACEVMRVAPPLQGGFREALHDFMFNGFSIPKGWKLYWSAN  388

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STHK+P+YF EPEKFDP+RFEG GPAP+TFVPFG GPRMCPGKEYARLEILVFMHN+V  
Sbjct  389   STHKSPEYFPEPEKFDPTRFEGEGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNLVKR  448

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             FK EKL+PDE+I+  +  P P   LPVRL PH+
Sbjct  449   FKWEKLIPDERIIV-DPLPIPAKDLPVRLFPHK  480



>emb|CBI39268.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   461 bits (1185),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 320/466 (69%), Gaps = 14/466 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG+ GWP+IGE+++  +      P ++++DRM KYSP+VFKTS
Sbjct  20    IVFLITYRHKSSYPNLPPGTMGWPIIGETLEFALSCQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIH  466
             +L   +AV CG +GNKF F+NE+ L+ +WW +S+ K L FP+    TL          + 
Sbjct  80    LLEANMAVMCGPSGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLP  139

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
             E  KPE L+HYI T+DSMA EHI   W+P REV V+ L++ Y+F LA +LF+SI+  + V
Sbjct  140   EFLKPEALQHYIATMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIDDPEYV  199

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
             + +  P  I++ G  S+P++ PGT +N A+K    +  +L+ +I++RK E       K +
Sbjct  200   EMISHPFQILNEGFLSVPIDIPGTTFNWALKASKFIHNELLAIIRKRKMEL----EQKGD  255

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  RD+L  +L  +DE     +E EI   +I +L  T+H+ S+ ITF+LK+LAE P +Y 
Sbjct  256   SAARDLLSHMLLASDENCYVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  315

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KEQ EIAKSKGP   L W+D+QKMKY+WNV  E +RL PP QG FRE +++ TYAGF
Sbjct  316   KVLKEQKEIAKSKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGF  375

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIP+GWK  WNV +TH++PKYF +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+EYAR
Sbjct  376   TIPRGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  435

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              ++L F+H+VVT FK EK+ P EK+ Y N +P P  G P+RL P Q
Sbjct  436   AQVLAFIHHVVTRFKWEKVDPCEKVAY-NPSPIPSKGFPIRLQPLQ  480



>emb|CDP19704.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   457 bits (1175),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/462 (50%), Positives = 316/462 (68%), Gaps = 21/462 (5%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVA  313
             YFI ++   K  LPPG++ +P++GE++   +  P+K+I  RMKKYS EVF TS++G+ +A
Sbjct  37    YFIHESKKYK--LPPGASRFPLVGETLHFFLSGPEKFIHHRMKKYSDEVFATSLVGQNMA  94

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMF------PTQNTLRKISTLNRNNIHEIF  475
             V CGAAGNKF     N  ++ W P S+   LMF      P ++     S +   +   I 
Sbjct  95    VICGAAGNKFLLCTANDFVSPWLPDSL---LMFFNWVDSPGKSRKDVFSKIRGFHQAVIM  151

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             +PE LK YIP +DS+ ++H+  +W PF+ VKV+  S+  T  LACKL L +E  ++ +R 
Sbjct  152   RPEALKKYIPIMDSLTRQHLKTDWDPFQVVKVHPASRKITLALACKLVLGLEP-EQTQRF  210

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
              D   +   G+FSLP+N PGT YNRA+K    ++++ + +I +RK   M+  +G  E  G
Sbjct  211   SDSFTVSLQGLFSLPINLPGTTYNRALKEIEKLKQEFLNIILKRKK--MVLENG--EKAG  266

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L R   L DE    L++ EI  Y++ +++P+Y S SAAITFVLK+LAELPHIY  VY
Sbjct  267   SDILSR--TLLDENAHLLSDLEIALYLVSLMMPSYESTSAAITFVLKYLAELPHIYDMVY  324

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EIAKSK P E L+WEDV+KMKYSWNV+CEA+RL PP  G FRE  ++  +AG TIP
Sbjct  325   KEQMEIAKSKDPEELLNWEDVKKMKYSWNVICEAMRLTPPAVGAFREAETDIHFAGVTIP  384

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK  W+ ++T+KNPKYF EPE FDP+RFEG  P P TF+PF +GPRMCPGKEY+R  I
Sbjct  385   KGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDEPTPCTFIPFSTGPRMCPGKEYSRFLI  444

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LV+MHNVV  +K++KL+PDEK++Y +  P P +GLP+RL PH
Sbjct  445   LVYMHNVVRKYKLQKLIPDEKVLY-HGGPYPASGLPMRLQPH  485



>ref|XP_007139495.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
 gb|ESW11489.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
Length=481

 Score =   456 bits (1173),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 229/465 (49%), Positives = 327/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++   A +S PNLPPG+ G+PVIGESI+ +       P+K+I +RM KYS +VFKTS+ 
Sbjct  23    LFYSHHAQSSHPNLPPGNMGFPVIGESIEFLSLGWKGHPEKFIYERMAKYSSKVFKTSLF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ-NTLRKISTLN-RNNIHEI  472
             GEK  +FCGAA NKF F+NEN L+ +WWP SV K  +FP+   T  K+     R  + + 
Sbjct  83    GEKTVMFCGAACNKFLFSNENKLVVSWWPDSVNK--VFPSSLETSSKVEAKKLRQMLPQF  140

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
                + L+ Y+  +D++A+ H A EW     V V+ L+K YTF +AC+LFL+++    V  
Sbjct  141   LSAQALQGYVGIMDTVAQRHFASEWENNTSVIVFPLAKSYTFWVACRLFLNVDDPIHVAN  200

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
             L +   ++  G+ S+P++ PGT +N+A+K   +++ +L+++I++RK E + + +  V   
Sbjct  201   LAESFNVIVPGIMSVPIDLPGTPFNKAIKASVVIKEKLLKIIRQRK-EDLANGTASVT--  257

Query  833   GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP-HIYQQ  1009
              +D+L  +L+  DE GQ++ +  I   I+G+L+  + + S+A TFV+K+LAELP +IY  
Sbjct  258   -QDILSHMLSSCDENGQYMADRYIADKILGLLIGGHDTASSACTFVVKYLAELPPNIYDN  316

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAKSK P E L+W+D+QKMKYSWNV CE +RL PP QG FRE +++F + GF+
Sbjct  317   VYQEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGAFREAMNDFMFNGFS  376

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +WN  STH+NP+ F EPEKFDPSRFEG+GPAP+TFVPFG GPRMCPGKEYAR+
Sbjct  377   IPKGWKLYWNASSTHRNPECFPEPEKFDPSRFEGTGPAPYTFVPFGGGPRMCPGKEYARM  436

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK E ++P+EK++  +  P P  GLPVRL PHQ
Sbjct  437   EILVFMHNLVKRFKWEAIIPNEKVII-DPLPVPAKGLPVRLYPHQ  480



>ref|XP_011017728.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   456 bits (1172),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 307/450 (68%), Gaps = 11/450 (2%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG  G P +GES+D +       P+ +I D ++KYS E FKT++  + V +  G AG
Sbjct  33    NLPPGHLGLPFVGESLDFLSKGWKGCPENFIFDHIRKYSSETFKTNLFLQPVVILNGVAG  92

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F+NEN L+ TWWP+ V K      + + ++ +   R       KP+ L+ YI T+D
Sbjct  93    NKFLFSNENRLVETWWPEFVNKIFPSAVETSPKEEAKRMRRLFPLFLKPDALRRYIGTMD  152

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
              + + H A +W    EV V+ L+K YTF LAC+LFLSIE    + R   P   +SSG+F+
Sbjct  153   IVTRRHFALQWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHISSGIFT  212

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             +P++FPGT +NRA+K   ++R +L+ +I++RK +    + GK  +  +D+L  +L   D 
Sbjct  213   IPIDFPGTPFNRAIKAAKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHMLLSNDA  268

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
             +GQ++NE EI   II +LL  + S   A TF++K+LAE+PHIY+ VYKEQ EI KSK P 
Sbjct  269   DGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEIIKSKAPG  328

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTH  1234
             E L+W+D+Q MKYSWNV CE LRL PP  G F+E + +FT+ GF IPKGWK +W+  STH
Sbjct  329   ELLNWDDIQNMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKLYWSASSTH  388

Query  1235  KNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKM  1414
             +NP+YF+EPEKFDPSRFEG GPAP+TF+PFG GPRMCPG EYARLEILVFMHN+V  FK 
Sbjct  389   RNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMHNLVKRFKF  448

Query  1415  EKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +KL+ DEKIV+ +  P P  GLPVRL PH+
Sbjct  449   DKLILDEKIVF-DPTPKPEMGLPVRLLPHK  477



>ref|XP_002324669.1| hypothetical protein POPTR_0018s13390g [Populus trichocarpa]
 gb|EEF03234.1| hypothetical protein POPTR_0018s13390g [Populus trichocarpa]
Length=484

 Score =   454 bits (1167),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 227/456 (50%), Positives = 313/456 (69%), Gaps = 17/456 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N+PPG+ G P +GES+D +       P+ +I DR++KYS E+FKT++  + V +  G AG
Sbjct  33    NVPPGNLGLPFVGESLDFLSKGWKGCPENFIFDRIRKYSSEIFKTNLFLQPVVMLNGVAG  92

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTID  514
             NKF F+NEN L+ TWWP  V +      + + ++ +   R       KPE L+ YI T+D
Sbjct  93    NKFLFSNENRLVETWWPDFVNRIFPSAVETSPKEEAKRMRRLFPRFLKPEALQRYIGTMD  152

Query  515   SMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFS  694
              + K H A EW    EV V+ L+K YTF LAC+LFLSIE    + R   P   ++SG+F+
Sbjct  153   MVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNQITSGIFT  212

Query  695   LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDE  874
             +P++FPGT +NRA+K   ++R +L+ +I++RK +    + GK  +  +D+L  +L   D 
Sbjct  213   IPIDFPGTPFNRAIKASKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHMLLSNDA  268

Query  875   EGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPN  1054
             +G+++NE +I   I+ +L+  + S +A+ TF++K+LAELPHIY+ VYKEQ EI KSK P 
Sbjct  269   DGKYMNEVQISDKILALLMGGHESTAASCTFIVKYLAELPHIYEAVYKEQAEIIKSKAPG  328

Query  1055  ERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT------FW  1216
             E L+W+D+QKMKYSWNV CE LRL PP  G F+E + +FT+ GF+IPKGWK       +W
Sbjct  329   ELLNWDDIQKMKYSWNVACETLRLSPPLIGNFKEAIKDFTFNGFSIPKGWKASHFLTLYW  388

Query  1217  NVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNV  1396
             +  STHKNP+YF+EPEKFDPSRFEG GPAP+TF+PFG GPRMCPG EYARLEILVFMHN+
Sbjct  389   SASSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMHNL  448

Query  1397  VTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             V  FK E+L+ DEKIV+ +  P P  GLPVRL PH+
Sbjct  449   VKRFKFERLILDEKIVF-DPTPKPEMGLPVRLLPHK  483



>gb|AFK79029.1| cytochrome P450 CYP716A41 [Bupleurum chinense]
Length=482

 Score =   453 bits (1166),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 224/453 (49%), Positives = 314/453 (69%), Gaps = 11/453 (2%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             S  +LPPG TG+ +IGES++ +       P+K+I DRM KY+ ++FK+S+ GEK  VFCG
Sbjct  34    SYKSLPPGETGYFLIGESLEFLSTGRKGHPEKFIFDRMTKYASKIFKSSLFGEKTIVFCG  93

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIP  505
             AA NKF F++EN L+ +WWP SV K     TQ + ++ +   R  +   FKPE L+ Y+ 
Sbjct  94    AANNKFLFSDENKLVQSWWPNSVNKLFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYVG  153

Query  506   TIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSG  685
              +D +A++H    W     V V  L+K +TF LAC+LF+S+E   +V +  +P  +++SG
Sbjct  154   VMDEIAQKHFDSCWENKHTVIVAPLTKRFTFWLACRLFVSLEDPTQVAKFAEPFNLLASG  213

Query  686   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNL  865
             +FS+P++ PGTA+NRA+K  + +R+ L+ +IK+RK +    ++   +    D+L  +L  
Sbjct  214   VFSIPIDLPGTAFNRAIKASNFIRKTLIGIIKKRKVDLEDGTASATQ----DILSHMLLT  269

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
             +DE G+ + E +I   I+G+L+  + + S+A   ++K+LAELPHIY  VY+EQ+EIAKSK
Sbjct  270   SDETGKFMTEADIADKILGLLIGGHDTASSACALIVKYLAELPHIYDGVYREQMEIAKSK  329

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
              P E L+W+DVQKMKYSWNV CE LRL PP QG FRE +S+F + GF+IPKGWK +W+  
Sbjct  330   SPGELLNWDDVQKMKYSWNVACEVLRLAPPLQGSFREVLSDFMHNGFSIPKGWKIYWSAN  389

Query  1226  STHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTN  1405
             STHK+ +YF EPEKFDP RFEGSGPAP+TFVPFG GPRMCPGKEY RLEILVFMH++V  
Sbjct  390   STHKSSEYFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYGRLEILVFMHHLVKR  449

Query  1406  FKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             F+ +K+ P EKI   N  P P   LP+RL PH+
Sbjct  450   FRWQKIYPLEKITV-NPMPFPDKDLPIRLFPHK  481



>emb|CBI39252.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   455 bits (1171),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 229/430 (53%), Positives = 309/430 (72%), Gaps = 19/430 (4%)
 Frame = +2

Query  272   PEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN  451
             P+VF+TS++GE +AV CGA+GNKF F+NE+ L+T+WWP  + K L FP        S LN
Sbjct  24    PKVFRTSLMGENMAVMCGASGNKFLFSNEDKLVTSWWPNLIKKILYFP--------SLLN  75

Query  452   RNNIHEIFKPEN-----LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKL  616
               +  ++ KP       LK Y+  +D MA +HI  +WAP ++VKVY LSK YTF L+C+L
Sbjct  76    DASTRDLTKPHRALLQFLKQYVEIMDLMAHKHIDMDWAPNKKVKVYLLSKKYTFALSCRL  135

Query  617   FLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE  796
             FL IE  + V R+ +    + +G  SLP++ PGT +NRA+K  +++ ++L+E+IK+RK E
Sbjct  136   FLKIEDSEWVARISNDFDHIMAGFISLPIDIPGTTFNRAIKAKNILHKELIEIIKKRKKE  195

Query  797   AMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLK  976
                  + K +   +D+L  +L + DE G+ LNE EI  YI+G+LL ++ + S AITFVLK
Sbjct  196   L----TEKRDLAAQDLLSHMLLVPDENGKVLNEMEISTYILGVLLASHETTSTAITFVLK  251

Query  977   FLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRE  1156
             +L+E P +Y  V KEQ+EIAKSKGP E L+W D+Q MK+SWNV  E++RL PPG GGFRE
Sbjct  252   YLSEFPDVYDAVLKEQMEIAKSKGPEEFLNWNDIQNMKHSWNVARESMRLSPPGIGGFRE  311

Query  1157  TVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGP  1336
              +++FTY GFT+PKGWKT W V+STHKNP+YF +PEKFDPSRFEG GP P+TFVPFG GP
Sbjct  312   ALTDFTYEGFTVPKGWKTHWTVHSTHKNPEYFPDPEKFDPSRFEGEGPVPYTFVPFGGGP  371

Query  1337  RMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ-K*L  1513
              MC GKEYARLE+LVFM+NVV+ FK+EK++P+EKI Y N +P P NGLP+RL PH+   L
Sbjct  372   HMCHGKEYARLELLVFMYNVVSRFKLEKVVPNEKITY-NPSPIPANGLPMRLQPHKISKL  430

Query  1514  FIALQHISNI  1543
              +    ISN+
Sbjct  431   ILLFYFISNM  440



>gb|KCW72929.1| hypothetical protein EUGRSUZ_E01368, partial [Eucalyptus grandis]
Length=441

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 312/467 (67%), Gaps = 56/467 (12%)
 Frame = +2

Query  194   GWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWPV+GE+++ M       P+++++DR  +YS +VF+T++ GE +AVFCGA+GNK     
Sbjct  1     GWPVVGETLEYMAAGRGGCPERFMNDRATRYSSDVFRTNLYGEDMAVFCGASGNK-----  55

Query  356   entllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKEHI  535
                              +F   N  +      R+ + E  KPE L+HYIP ++++ ++H+
Sbjct  56    ----------------FLFSGDNKYKLDRKKKRSFLLEFLKPEALQHYIPVMETVTRDHL  99

Query  536   AEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPG  715
             A +W+P ++V+V+ LSK YTF LAC+LF++I   + V +  +    V+ G  +LP+N PG
Sbjct  100   AMDWSPHKKVQVFPLSKSYTFALACRLFMNIRDPEIVSKFANSFARVAPGFVALPINIPG  159

Query  716   TAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNE  895
             T +NRAM+ G ++R++L+ +I+ RK E    + GK  N   D+L RLL   D++G    E
Sbjct  160   TPFNRAMEAGKVMRQELLNIIRRRKMEI---AEGKDAN-ATDLLSRLLLEGDDDGSVFYE  215

Query  896   FEIYHYIIGILLPTYHSISAAITFVLKFLAE-----------------LP--HIYQQVYK  1018
              ++ + I+G+L+ ++ + S +IT V+ +LA                  LP   +Y Q Y 
Sbjct  216   MDVANKIMGLLIASHDTTSTSITAVVNYLARGFIKVMNFEFDFANTPGLPVKSVYSQQYT  275

Query  1019  -----EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
                  EQ+EIAKSKGP+E L+WEDVQKMKYSWNV CE++RL PP QG +RE ++ FT+AG
Sbjct  276   CLMSIEQMEIAKSKGPDEFLNWEDVQKMKYSWNVACESIRLLPPAQGAYREAMTNFTFAG  335

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             +TIPKGWKTFW V+STHKNPKYF +PEKFDPSRFEG+GPAPFTFVPFG GPRMCPGKEYA
Sbjct  336   YTIPKGWKTFWTVHSTHKNPKYFPDPEKFDPSRFEGNGPAPFTFVPFGGGPRMCPGKEYA  395

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             RLEIL+FMHN+V  FK+EK++ DEK +Y N +P PV GL +RL PH+
Sbjct  396   RLEILIFMHNLVNKFKLEKVILDEKFIY-NPSPVPVEGLRIRLLPHK  441



>ref|XP_004296583.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 323/470 (69%), Gaps = 21/470 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
              +++  ++  +  NLPPG  G+PVIGES + +       P+K+I DRM K+S +VFKTS+
Sbjct  23    FLFYKHRSQFTGNNLPPGKVGYPVIGESYEFLSSGWKGHPEKFIFDRMNKFSSQVFKTSL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT----QNTLRKISTLNRNNI  463
              GEK  +F GAA NKF F+NEN L+T WWP SV K  +FP+     +  ++ +   R  +
Sbjct  83    FGEKACIFTGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSVEDNSNAKEEAKKMRKML  140

Query  464   HEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDE  643
                  P+ L+ YI  +D++A+ H A  W   +EV +Y L+K YTF LA +LF+S+E  ++
Sbjct  141   PSFMNPQALQRYIGIMDTIAQRHFALGWENKKEVVIYPLAKNYTFWLAARLFVSLEDPED  200

Query  644   VKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKV  823
             V RL  P  +++SG+ S+P++ PGT +N+A+K  + +R +L ++IK+RK +    + GK 
Sbjct  201   VDRLGGPFQLLASGIMSMPIDLPGTPFNKAIKASNWIRGELYKIIKQRKIDL---AEGKA  257

Query  824   ENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIY  1003
              +  +D+L  +L L+DEEG H+ E +I   I+G+L+  + + SA  TF++K+L ELPHIY
Sbjct  258   -SPTQDILSHMLLLSDEEGTHMKEMDIADKILGLLIGGHDTASATCTFIVKYLGELPHIY  316

Query  1004  QQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAG  1183
               VYKEQ+EIA  K P E L+W+D+QKMKYSWNV  E LR+ PP QG FRE + +F + G
Sbjct  317   DAVYKEQMEIANLKAPGELLNWDDLQKMKYSWNVAQEVLRVAPPLQGAFREALQDFVFNG  376

Query  1184  FTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYA  1363
             FTIPKGWK +W+  STHKN   F EP KFDP+RFEG+GPAP+TFVPFG GPRMCPGKEYA
Sbjct  377   FTIPKGWKLYWSANSTHKNAAVFPEPYKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1364  RLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPV--NGLPVRLTPHQK  1507
             RLEILVFMHN+V  FK E ++PDEK+V +   P P+   GLPVRL PH+K
Sbjct  437   RLEILVFMHNLVKRFKWEAVIPDEKVVID---PMPMLEKGLPVRLFPHKK  483



>gb|KDP43440.1| hypothetical protein JCGZ_16727 [Jatropha curcas]
Length=462

 Score =   449 bits (1156),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/451 (49%), Positives = 315/451 (70%), Gaps = 32/451 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TG P +GES++ +       P+K+I +RM KYS ++F+TSILGE+ A+ CG  GN
Sbjct  34    LPPGKTGLPYVGESLEFLSTGRKGHPEKFILERMTKYSCQIFRTSILGEQTAILCGPQGN  93

Query  338   KffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPTI  511
             KF F+NEN L+T WWP+SV+K  +FP+  Q+T+       R  +    KPE L+ YI  +
Sbjct  94    KFLFSNENKLVTAWWPKSVLK--LFPSSQQSTISAEGIRIRKMLPMFLKPEALQRYIGVM  151

Query  512   DSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMF  691
             DS+A+EH  ++W                  +ACK+FLS+E +++V +   P   ++SG+ 
Sbjct  152   DSIAREHFQDKW-----------------EVACKVFLSLEDKEQVAKFATPFNDMASGII  194

Query  692   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTD  871
             S+P++ PGT+++R MK   ++R++++ +I+ R+ E   + +  ++    D+L  +L  TD
Sbjct  195   SIPVDLPGTSFHRGMKASKVIRKEMLGMIERRRKEIAENKASPMQ----DILSHMLVATD  250

Query  872   EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1051
             E+G+ L +  I   II +L+  + + SA+ITFV+K L+ELP IY++V KEQ+EIA SK P
Sbjct  251   EDGKRLGDIGIADKIISLLIGGHDTASASITFVVKVLSELPEIYKKVLKEQMEIANSKAP  310

Query  1052  NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYST  1231
              E L+WED+QKMKYSWNV CE +R+ PP QG FRE + +F YAGF+IPKGWK +W+ +ST
Sbjct  311   GELLNWEDIQKMKYSWNVACEVMRIAPPLQGSFREALYDFNYAGFSIPKGWKLYWSTHST  370

Query  1232  HKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFK  1411
             HKNP+YF EPEKFDPSRFEGSGPAP+T+VPFG GPRMCPGKEYARLEILVF+HN+V  FK
Sbjct  371   HKNPEYFPEPEKFDPSRFEGSGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIVKRFK  430

Query  1412  MEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              EK++PDEKI+  +  P P  GLP+ L PH+
Sbjct  431   WEKMLPDEKIIV-DPIPMPAKGLPIYLYPHK  460



>gb|ACU20818.1| unknown [Glycine max]
Length=445

 Score =   449 bits (1154),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 216/428 (50%), Positives = 312/428 (73%), Gaps = 14/428 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGES++ +       P+K+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ--NTLRKISTLNRNNIHE  469
             LGE   +FCGA  NKF F+NEN L+  WWP SV K  +FPT   +  ++ S   R  + +
Sbjct  84    LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  141

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIE  + V 
Sbjct  142   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  201

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +  +P  +++SG+ S+P++ PGT +N+A+K  + +R++L+++I++RK +    + GK  +
Sbjct  202   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKA-S  257

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  258   PTQDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  317

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VY+EQ+EIAK K P E L+W+DV +M+YSWNV CE +R+ PP QGGFRE +++F + GF+
Sbjct  318   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  377

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  STHK+P+YF EPEKFDP+RFEG GPAP+TFVPFG GPRMCPGKEYARL
Sbjct  378   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  437

Query  1370  EILVFMHN  1393
             EILVFM+N
Sbjct  438   EILVFMYN  445



>gb|AHF22083.1| CYP716A14v2 [Artemisia annua]
Length=474

 Score =   449 bits (1156),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 314/447 (70%), Gaps = 19/447 (4%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPVIGE+++ +       P+K+I DRM ++SP VFKTS++ E  AVFCG+AGN
Sbjct  38    LPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFKTSLMLEDAAVFCGSAGN  97

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K  + P+     K +T  R  +   F+PE+L+ Y+P +D 
Sbjct  98    KFLFSNENKLVKAWWPASVEK--ILPSA----KETTNQRKMLSRSFRPESLRQYVPVMDM  151

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA+ H   EW    ++  + +++ +TF+LACK+F+SIE  +EVK L  P    + G+FS+
Sbjct  152   MAQRHFKTEWDGMDQIVTHEVTQNFTFSLACKIFVSIEDPEEVKHLSGPFEKFAPGIFSI  211

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ P T   RA+  G+ +R++++ +IK+RK +    + GK  +  +D+L ++L   DEE
Sbjct  212   PIDLPWTPLRRAIHAGNFIRKEIIAIIKQRKIDL---ADGKA-SPTQDILSQML--CDEE  265

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
              Q++ E +I   IIG+L+  + + S+   F++KFLA+LP IY+ V KEQ+EIAKSK P E
Sbjct  266   SQNIAEADIADVIIGLLIGGHDNASSTCAFIVKFLADLPEIYEGVLKEQLEIAKSKAPGE  325

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+WED+ KMKYSWNV CE LRL PP QG FRE +++F Y G++IPKGWK +W+  STHK
Sbjct  326   LLNWEDLSKMKYSWNVACEVLRLAPPLQGSFREAMTDFVYNGYSIPKGWKLYWSALSTHK  385

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ FTEP+K DPSRF+G GPAP+TFVPFG GP MCPG+EYARLEILVFMH++V  +K E
Sbjct  386   NPEVFTEPQKLDPSRFDGKGPAPYTFVPFGGGPHMCPGREYARLEILVFMHHLVIKYKWE  445

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             K++P+E+I+  N  P    GLP+RL P
Sbjct  446   KVIPNEQIIV-NPMPKLAKGLPLRLYP  471



>emb|CBI24045.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 315/463 (68%), Gaps = 44/463 (10%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GES++ +       P+K+I DR+ KYS EVFKTS+
Sbjct  1     MLRYEIESHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  60

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K     TQ + ++ +   R  + + F
Sbjct  61    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFF  120

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D +A+ H A+ W                           + RDE    
Sbjct  121   KPEALQRYIGIMDHIAQRHFADSW---------------------------DNRDE----  149

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  +++SG+ ++P++ PGT ++RA+K  + +R++L  +IK+RK +    + GK  ++ 
Sbjct  150   --PFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKA-SQN  203

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  TDE+G H+NE EI   I+G+L+  + + SAAITF++K++AELPHIY++VY
Sbjct  204   QDILSHMLLATDEDGCHMNEMEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEKVY  263

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             +EQ+EIA SK P E L+W+DVQKM+YSWNV CE +RL PP QG FRE +++F + GF+IP
Sbjct  264   EEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIP  323

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHK+P+ F +PE FDP+RFEG GPAP+TFVPFG GPRMCPGKEYARLEI
Sbjct  324   KGWKLYWSANSTHKSPECFPQPENFDPTRFEGDGPAPYTFVPFGGGPRMCPGKEYARLEI  383

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHNVV  FK +KL+PDEKI+  +  P P  GLPVRL P +
Sbjct  384   LVFMHNVVKRFKWDKLLPDEKIIV-DPMPMPAKGLPVRLHPRK  425



>sp|I7CT85.1|C7A53_PANGI RecName: Full=Protopanaxadiol 6-hydroxylase; Short=P6H; AltName: 
Full=Cytochrome P450 CYP716A53v2; AltName: Full=Protopanaxatriol 
synthase [Panax ginseng]
 gb|AFO63031.1| cytochrome P450 CYP716A53v2 [Panax ginseng]
Length=469

 Score =   448 bits (1152),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 222/452 (49%), Positives = 316/452 (70%), Gaps = 17/452 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE+++ +       P+K+++ RM KYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMNKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             GA+GNKF F+NEN L+ +WWP ++ K ++  T  ++ K   L R+ I E  KPE L  +I
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISK-ILTATIPSVEKSKAL-RSLIVEFLKPEALHKFI  143

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +D   ++H  ++W    EVK +A+S+  TF LAC L  SI    +V++L      V +
Sbjct  144   SVMDRTTRQHFEDKWNGSTEVKAFAMSESLTFELACWLLFSINDPVQVQKLSHLFEKVKA  203

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R+++ + +         +D+L  ++ 
Sbjct  204   GLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSDKLQTR--------KDLLSHVML  255

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
                E  +  +E +I   ++ +L+ ++ + S+A+  V+ FLA+ PHIY +V  EQ+EIAKS
Sbjct  256   SNGEGEKFFSEMDIADVVLNLLIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIAKS  315

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             KG  E LSWED+++MKYS NV+ EA+RL PP QGGF+   S+F+YA F IPKGWK FW+V
Sbjct  316   KGAEELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFWSV  375

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             YSTHK+PKYF  PE+FDPSRFEG GP PFTF+PFG GPRMCPG E+ARLE+L+FMH++VT
Sbjct  376   YSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHLVT  435

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             NFK EK+ P+EKI+Y    P P NGLP+RL+P
Sbjct  436   NFKWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>gb|AHK23636.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score =   447 bits (1149),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 225/452 (50%), Positives = 316/452 (70%), Gaps = 17/452 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE+++ +       P+K+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISWGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             GA+GNKF F+NEN L+ +WWP ++ K ++  T  ++ K   L R+ I E  KPE L  +I
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISK-ILTATIPSVEKSKAL-RSLIVEFLKPEALHKFI  143

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +D   ++H   +W    EVK +A+S+  TF LAC L  SI    +V++L      V +
Sbjct  144   SVMDRTTRQHFEAKWNGSTEVKAFAMSETLTFELACWLLFSINDPVQVQKLSHLFEKVKA  203

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R+++       K E   +D+L  ++ 
Sbjct  204   GLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSD-------KSETR-KDLLSHVMI  255

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
                E  +  +E +I   ++ IL+ ++ + S+A+  V+ FLA+ PHIY +V  EQ+EIAKS
Sbjct  256   SNGEGEKFFSEMDIADVVLNILIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIAKS  315

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             KG  E LSWED+++MKYS NV+ EA+RL PP QGGF+   S+F+YA F IPKGWK FW+V
Sbjct  316   KGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFWSV  375

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             YSTHK+PKYF  PE+FDPSRFEG GP PFTF+PFG GPRMCPG E+ARLE+L+FMH++VT
Sbjct  376   YSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHLVT  435

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             NF+ EK+ P+EKI+Y    P P NGLP+RL+P
Sbjct  436   NFRWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>gb|KHM99864.1| Cytochrome P450 716B2 [Glycine soja]
Length=412

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 298/416 (72%), Gaps = 5/416 (1%)
 Frame = +2

Query  257   MKKYSPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRK  436
             M +YS ++FKTSI GE   +FCGA  NKF F+NEN L+  WWP SV K      Q+  ++
Sbjct  1     MIRYSSQLFKTSIFGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNKVFPSTLQSNSKE  60

Query  437   ISTLNRNNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKL  616
              S   R  + +  KPE L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+L
Sbjct  61    ESKKMRKLLPQFLKPEALQRYVGIMDTIAQNHFASLWDNKTELTVYPLAKRYTFLLACRL  120

Query  617   FLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE  796
             F+S+E  + V +  +P  +++SG+ S+P++ PGT +N+A+K  + +R++L+++I++RK +
Sbjct  121   FMSVEDVNHVAKFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVD  180

Query  797   AMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLK  976
                 + GK  +  +D+L  +L   +E GQ +NE +I   I+G+L+  + + SAA TF++K
Sbjct  181   L---AEGKA-SPTQDILSHMLLTCNENGQFMNELDIADKILGLLIGGHDTASAACTFIVK  236

Query  977   FLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRE  1156
             +LAELPHIY  VY+EQ+EIAKSK P E L+W+D+ +MKYSWNV CE +R+ PP QGGFRE
Sbjct  237   YLAELPHIYDSVYQEQMEIAKSKLPGELLNWDDINRMKYSWNVACEVMRIAPPLQGGFRE  296

Query  1157  TVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGP  1336
              +++F + GF+IPKGWK +W+  STHKNP+YF EPEKFDP+RFEG GPAPFTFVPFG GP
Sbjct  297   AINDFIFNGFSIPKGWKLYWSANSTHKNPEYFPEPEKFDPTRFEGQGPAPFTFVPFGGGP  356

Query  1337  RMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             RMCPGKEYARLEILVFMHN+V  FK EKL+PDEKI+  +  P P   LP+RL PH+
Sbjct  357   RMCPGKEYARLEILVFMHNLVKRFKWEKLIPDEKIIV-DPLPVPAKNLPIRLHPHK  411



>gb|AED99872.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score =   446 bits (1146),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 225/452 (50%), Positives = 315/452 (70%), Gaps = 17/452 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE+++ +       P+K+++ RMKKYSP+VF TS  GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSXAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             GA+GNKF F+NEN L+ +WWP ++ K ++  T  ++ K   L R+ I E  KPE L  +I
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISK-ILTATIPSVEKSKAL-RSLIVEFLKPEALHKFI  143

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +D   ++H   +W    EVK +A+S+  TF LAC L  SI    +V++L      V +
Sbjct  144   SVMDRTTRQHFEAKWNGSTEVKAFAMSETLTFELACWLLFSISDPVQVQKLSHLFEKVKA  203

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R+++       K E   +D+L  ++ 
Sbjct  204   GLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSD-------KSETR-KDLLSHVMI  255

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
                E  +  +E +I   ++ IL+ ++ + S+A+  V+ FLA+ PHIY +V  EQ+EIAKS
Sbjct  256   SNGEGEKFFSEMDIADVVLNILIASHDTTSSAMGSVVYFLADHPHIYAKVLAEQMEIAKS  315

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             KG  E LSWED+++MKYS NV+ EA+RL PP QGGF+   S+F+YA F IPKGWK FW+V
Sbjct  316   KGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFWSV  375

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             YSTHK+PKYF  PE+FDPSRFEG GP PFTF+PFG GPRMCPG E+ARLE+L+FMH++VT
Sbjct  376   YSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHLVT  435

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             NF+ EK+ P+EKI+Y    P P NGLP+RL+P
Sbjct  436   NFRWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>ref|XP_004139087.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus]
 gb|KGN66615.1| hypothetical protein Csa_1G649550 [Cucumis sativus]
Length=483

 Score =   446 bits (1146),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 224/457 (49%), Positives = 310/457 (68%), Gaps = 11/457 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  S PN PPG+ G P++GES++ +       P+K+I DR+ KY  +VFKTSI+G   A
Sbjct  28    KSLFSYPNTPPGAIGLPILGESVEFLSSGWKGHPEKFIFDRLNKYKSDVFKTSIVGVPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             +FCG   NKF F+NEN L+T WWP SV K     TQ + ++ +   +  + +  KPE L+
Sbjct  88    IFCGPICNKFLFSNENKLVTPWWPDSVNKIFPSTTQTSTKEEAKKLKKLLPQFLKPEALQ  147

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              YI  +D +A+ H    W    EV V+ L+K +TF++AC+LF+S+E    V+RL  P   
Sbjct  148   RYIGIMDELAERHFNSFWKNREEVLVFPLAKSFTFSIACRLFMSVEDEIHVERLSGPFEH  207

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
             +++G+ S+P++ PGT +NRA+K    +R+++V ++++RK +    + GK     +D+L  
Sbjct  208   IAAGIISMPIDLPGTPFNRAIKASKFIRKEVVAIVRQRKQDL---AEGKAL-ATQDILSH  263

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             +L   DE G ++NE +I   I+G+L+  + + S A TF++KFLAELPHIY  VY EQ+EI
Sbjct  264   MLLTCDENGVYMNESDITDKILGLLIGGHDTASVACTFIVKFLAELPHIYDAVYTEQMEI  323

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
             A++K   E L WED++KMKYSWNV CE LR+  P QG FRE +S+F + GF IPKGWK +
Sbjct  324   ARAKAEGETLKWEDIKKMKYSWNVACEVLRIASPLQGAFREALSDFVFNGFFIPKGWKLY  383

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHN  1393
             W+  STHKNP+YF EP KFDP RFEG+GP P+TFVPFG GPRMCPGKEYA+LEILVFMHN
Sbjct  384   WSANSTHKNPEYFPEPYKFDPGRFEGNGPLPYTFVPFGGGPRMCPGKEYAKLEILVFMHN  443

Query  1394  VVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +V  FK  KL+ +E I+  N  P P  GLPVRL PHQ
Sbjct  444   LVKRFKWTKLLENENIIV-NPMPIPQKGLPVRLFPHQ  479



>gb|ABC94483.1| putative taxadiene 5-alpha-hydroxylase cytochrome P450 [Artemisia 
annua]
Length=474

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 312/447 (70%), Gaps = 19/447 (4%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPVIGE+++ +       P+K+I DRM ++SP VFKTS++ E  AVFCG+AGN
Sbjct  38    LPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFKTSLMLEDAAVFCGSAGN  97

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  WWP SV K  + P+     K +T  R  +   F+PE+L+ Y+P +D 
Sbjct  98    KFLFSNENKLVKAWWPASVEK--ILPSA----KETTNQRKMLSRSFRPESLRQYVPVMDM  151

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA+ H   EW    ++  + +++ +TF+LACK+F+SIE  +EVK L  P    + G+FS+
Sbjct  152   MAQRHFKTEWDGMDQIVTHEVTQNFTFSLACKIFVSIEDPEEVKHLSGPFEKFAPGIFSI  211

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ P T   RA+  G+ +R++++ +IK+RK +    + GK  +  +D+L ++L   DEE
Sbjct  212   PIDLPWTPLRRAIHAGNFIRKEIIAIIKQRKIDL---ADGKA-SPTQDILSQML--CDEE  265

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
              Q++ E +    IIG+L+  + + S+   F++KFLA+LP IY+ V KEQ+EIAK K P E
Sbjct  266   SQNIAEADTADVIIGLLIGGHDNASSTCAFIVKFLADLPEIYEGVLKEQLEIAKFKAPGE  325

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+WED+ KMKYSWNV CE LRL PP QG FRE +++F Y G++IPKGWK +W+  STHK
Sbjct  326   LLNWEDLSKMKYSWNVACEVLRLAPPLQGSFREAMTDFVYNGYSIPKGWKLYWSALSTHK  385

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ FTEP+K DPSRF+G GPAP+TFVPFG GP MCPG+EYARLEILVFMH++V  +K E
Sbjct  386   NPEVFTEPQKLDPSRFDGKGPAPYTFVPFGGGPHMCPGREYARLEILVFMHHLVIKYKWE  445

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             K++P+E+I+  N  P    GLP+RL P
Sbjct  446   KVIPNEQIIV-NPMPKLAKGLPLRLYP  471



>ref|XP_008443638.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Cucumis melo]
Length=483

 Score =   444 bits (1141),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 224/457 (49%), Positives = 310/457 (68%), Gaps = 11/457 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  S PN PPG+ G P++GES++ +       P+K+I DR+ KY  +VFKTSI+G   A
Sbjct  28    KSLFSYPNTPPGAIGLPILGESLEFLSSGWRGHPEKFIFDRLNKYKSDVFKTSIVGVPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             +FCG   NKF F+NEN L+T WWP SV K     TQ + ++ +   +  + +  KPE L+
Sbjct  88    IFCGPICNKFLFSNENKLVTPWWPDSVNKIFPSTTQTSSKEEAKKLKKLLPQFLKPEALQ  147

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              YI  +D +A+ H    W    EV V+ L+K +TF+LAC+LF+S+E    V+RL  P   
Sbjct  148   RYIGIMDELAERHFNSFWKNREEVLVFPLAKSFTFSLACRLFMSVEDEIHVERLSGPFEH  207

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
             +++G+ S+P++ PGT +NRA+K    +R+++V ++++RK +    + GK     +D+L  
Sbjct  208   IAAGIISMPIDLPGTPFNRAIKASKFIRKEVVAIVRQRKQDL---AEGKAL-ATQDILSH  263

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             +L   DE G ++NE +I   I+G+L+  + + S A TF++KFLAELPHIY  VY EQ+EI
Sbjct  264   MLLTCDENGVYMNESDITDKILGLLIGGHDTASVACTFIVKFLAELPHIYDAVYTEQMEI  323

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
             A++K   E L WED++KMKYSWNV CE LRL  P QG FRE +++F + GF IPKGWK +
Sbjct  324   ARAKAEGETLKWEDIKKMKYSWNVACEVLRLASPLQGAFREALNDFVFNGFFIPKGWKLY  383

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHN  1393
             W+  STHKNP+YF EP KF+P RFEG+GP P+TFVPFG GPRMCPGKEYA+LEILVFMHN
Sbjct  384   WSANSTHKNPEYFPEPYKFEPGRFEGNGPLPYTFVPFGGGPRMCPGKEYAKLEILVFMHN  443

Query  1394  VVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +V  FK  KL+ +E I+  N  P P  GLPVRL PHQ
Sbjct  444   LVKRFKWTKLLENENIIV-NPMPIPQKGLPVRLFPHQ  479



>ref|XP_002279492.2| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=445

 Score =   442 bits (1137),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 305/445 (69%), Gaps = 13/445 (3%)
 Frame = +2

Query  194   GWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP+IGE+++  +      P ++++DRM KYSP+VFKTS+L   +AV CG +GNKF F+N
Sbjct  2     GWPIIGETLEFALSCQGGNPGRFLNDRMNKYSPQVFKTSLLEANMAVMCGPSGNKFLFSN  61

Query  356   entllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKE  529
             E+ L+ +WW +S+ K L FP+    TL          + E  KPE L+HYI T+DSMA E
Sbjct  62    EDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLPEFLKPEALQHYIATMDSMASE  121

Query  530   HIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNF  709
             HI   W+P REV V+ L++ Y+F LA +LF+SI+  + V+ +  P  I++ G  S+P++ 
Sbjct  122   HIELNWSPNREVLVFPLARKYSFALAFRLFMSIDDPEYVEMISHPFQILNEGFLSVPIDI  181

Query  710   PGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHL  889
             PGT +N A+K    +  +L+ +I++RK E       K ++  RD+L  +L  +DE     
Sbjct  182   PGTTFNWALKASKFIHNELLAIIRKRKMEL----EQKGDSAARDLLSHMLLASDENCYVK  237

Query  890   NEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSW  1069
             +E EI   +I +L  T+H+ S+ ITF+LK+LAE P +Y +V KEQ EIAKSKGP   L W
Sbjct  238   SEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYSKVLKEQKEIAKSKGPEGFLKW  297

Query  1070  EDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKY  1249
             +D+QKMKY+WNV  E +RL PP QG FRE +++ TYAGFTIP+GWK  WNV +TH++PKY
Sbjct  298   DDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGFTIPRGWKMHWNVNTTHRDPKY  357

Query  1250  FTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMP  1429
             F +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+EYAR ++L F+H+VVT FK EK+ P
Sbjct  358   FPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYARAQVLAFIHHVVTRFKWEKVDP  417

Query  1430  DEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              EK+ Y N +P P  G P+RL P Q
Sbjct  418   CEKVAY-NPSPIPSKGFPIRLQPLQ  441



>gb|EYU25767.1| hypothetical protein MIMGU_mgv1a025883mg [Erythranthe guttata]
Length=462

 Score =   442 bits (1136),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 219/450 (49%), Positives = 308/450 (68%), Gaps = 10/450 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG+TGWP++GES+  +       P+K++ DR+ KYS  VFKT ++GEK AV  GA+GN
Sbjct  17    LPPGNTGWPLVGESLHFLWAGCKGHPEKFVLDRVAKYSSTVFKTHLVGEKAAVLSGASGN  76

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  W+P  + K     T+++  +     R  +H   K E L+ YI  +D 
Sbjct  77    KFLFSNENKLVRAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTEALRRYIGKMDR  136

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA++H  E W    EV V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++
Sbjct  137   MAQKHFEEGWENKNEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAI  196

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N+ +K   +VR++L+ +IK+RK +    + GK  +  +D+L  +L  +DE 
Sbjct  197   PIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKA-SPTQDILSHMLLTSDEN  252

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+EI KSK P +
Sbjct  253   GKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMEILKSKAPGD  312

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+WED+QKMKYSWNV CE +RL  P  G FRE + +F+Y G++IPKG+K +W+  +THK
Sbjct  313   SLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIVDFSYKGYSIPKGFKLYWSATATHK  372

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK E
Sbjct  373   NPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFE  432

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             K++P++     +  P P  GLP+RL PH+K
Sbjct  433   KMIPNDGKFVVDPMPIPAKGLPIRLIPHEK  462



>gb|EYU25763.1| hypothetical protein MIMGU_mgv1a024885mg [Erythranthe guttata]
Length=461

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/450 (48%), Positives = 308/450 (68%), Gaps = 10/450 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG+TGWP++GES+  +       P+K++ DR+ KYS  VF+T ++GEK AV  GA+GN
Sbjct  16    LPPGNTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGEKAAVLSGASGN  75

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  W+P  + K     T+++  +     R  +H   K E L+ YI  +D 
Sbjct  76    KFLFSNENKLVRAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTEALRRYIGKMDR  135

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA++H  E W    EV V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++
Sbjct  136   MAQKHFEEGWENKNEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAI  195

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N+ +K   +VR++L+ +IK+RK +    + GK  +  +D+L  +L  +DE 
Sbjct  196   PIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKA-SPTQDILSHMLLTSDEN  251

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+EI KSK P +
Sbjct  252   GKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMEILKSKAPGD  311

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+WED+QKMKYSWNV CE +RL  P  G FRE +++F+Y G+ IPKG+K +W+  +THK
Sbjct  312   SLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYFIPKGFKLYWSATATHK  371

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK E
Sbjct  372   NPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFE  431

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             K++P++     +  P P  GLP+RL PH+K
Sbjct  432   KMVPNDGKFVVDPMPIPAKGLPIRLLPHEK  461



>gb|EYU26851.1| hypothetical protein MIMGU_mgv1a005213mg [Erythranthe guttata]
Length=493

 Score =   440 bits (1131),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 305/458 (67%), Gaps = 10/458 (2%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKV  310
             +   T+   LPPG  GWP++GES+  +       P+K++ DR+ KYS  VF+T ++GEK 
Sbjct  39    STTTTAAGPLPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSTVFRTHLVGEKA  98

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AV  GA+GNKF F+NEN L+  W+P  + K     T+++  +     R  +H   K E L
Sbjct  99    AVLSGASGNKFLFSNENKLVKAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTEAL  158

Query  491   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPII  670
             + YI  +D MA+ H  E W   +EV V  L+K YTF LAC+LF S+E   +V RL  P  
Sbjct  159   RRYIGKMDHMAQTHFEEGWENKKEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFN  218

Query  671   IVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLG  850
             +++S +F++P++ PGT +++ +K   +VR++LV +IK+RK +     +   +    D+L 
Sbjct  219   LLASSLFAIPIDLPGTPFSKGIKASKIVRQELVSIIKQRKIDLAQGKASPTQ----DILS  274

Query  851   RLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIE  1030
              +L  +DE G  + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+E
Sbjct  275   HMLLTSDENGNFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQME  334

Query  1031  IAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             I KSK P + L+WED+QKMKYSWNV CE +RL  P  G FRE +++F+Y G++IPKG+K 
Sbjct  335   ILKSKSPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYSIPKGFKL  394

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +W+  +THKNPK F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH
Sbjct  395   YWSATATHKNPKIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMH  454

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ++V  FK EK++P++     +  P P  GLP+RL PHQ
Sbjct  455   HLVKRFKFEKVIPNDGKFVVDPMPIPAKGLPIRLFPHQ  492



>gb|AGC31652.1| cytochrome P450 CYP6H [Panax quinquefolius]
Length=469

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/452 (48%), Positives = 314/452 (69%), Gaps = 17/452 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE+++ +       P+K+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             GA+GNKF F+NEN L+ +WWP ++ K ++  T  ++ K   L R+ I E  KPE L  +I
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISK-ILTATIPSVEKSKAL-RSLIVEFLKPEALHKFI  143

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +D   ++H  ++W    EVK +A+S+  TF LAC L  SI    +V++L      V +
Sbjct  144   SVMDRTTRQHFEDKWNGSTEVKAFAMSESLTFELACWLLFSINDPVQVQKLSHLFEKVKA  203

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ SLPLNFPGTA+NR +K  +++R++L  +IK+R+++ + +         +D+L  ++ 
Sbjct  204   GLLSLPLNFPGTAFNRGIKAANLIRKELSVMIKQRRSDKLQTR--------KDLLSHVML  255

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
                E  +  +E +I   ++ +L+ ++ + S+A+  V+ FLA+ PHIY +V  EQ+EIAKS
Sbjct  256   SNGEGEKFFSEMDIADVVLNLLIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIAKS  315

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             KG  E LSWED+++MKYS NV+ EA+RL PP QGGF+   S+F+YA F IPKGWK FW+V
Sbjct  316   KGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFWSV  375

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             YSTHK+PKYF  PE+FDPSRFEG GP PFTF+PFG GPRMCPG E+ARLE+L+FMH++VT
Sbjct  376   YSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHLVT  435

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             NF+ +K+ P+EKI+Y    PS  N   +RL+P
Sbjct  436   NFRWDKVFPNEKIIY-TPFPSTENSRTIRLSP  466



>ref|XP_010533078.1| PREDICTED: beta-amyrin 28-oxidase-like [Tarenaya hassleriana]
Length=469

 Score =   437 bits (1125),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 318/461 (69%), Gaps = 16/461 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV---PDKYISDRMKKYSPEVFKTSILGEK  307
             I++   ++ S PNLPPG+ G+P +GE++  +    P+K++SDR++++S  VFKT I+G  
Sbjct  19    IFYKHLSHFSYPNLPPGNIGFPFLGETLSFLSSGRPEKFVSDRVRRFSSAVFKTHIVGSP  78

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHEIFKP  481
              AV  G+ GNKF FTNE+ L+ +WWP SV K  +FP+      I      RN + +  KP
Sbjct  79    AAVVSGSLGNKFLFTNEDKLVVSWWPDSVNK--IFPSSMKTSSIEEAKNLRNLLPQFLKP  136

Query  482   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
             E L+ Y+  +D +A+ H  EEWA    V V+ L+K +TF LAC+LFL+IE +D+V++L +
Sbjct  137   EALQSYVGVMDEIARRHFDEEWANKDRVLVHLLTKRFTFRLACRLFLNIEDQDKVEKLGE  196

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
             P  ++ SG+FS+P++FPGT YNRA+K   +VR++L+E+I  R    +  + GK  +  +D
Sbjct  197   PFNLIGSGIFSVPIDFPGTPYNRAIKAAKLVRKELIEII--RSQMRIDPTVGKASS-NQD  253

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
              L  +L+L+D +     E ++   I+G+L+  + + S   TF++K+LAELPH+Y+ V  E
Sbjct  254   FLSHMLSLSDAK-----EEDVADKILGLLIAGHDTASTVCTFIVKYLAELPHVYELVLHE  308

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+EI K KG  E L WED++KMKYSWNV CE +RL PP  G FR+ +  F++ GF IPKG
Sbjct  309   QMEIEKEKGRGELLKWEDIKKMKYSWNVACEVMRLTPPVPGAFRQAIHPFSFDGFFIPKG  368

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WK +W+  +TH+NP+YF EPE+F+P RFEG+GPAP+T++PFG GPRMCPGKEYARLEILV
Sbjct  369   WKLYWSANATHRNPEYFPEPERFEPRRFEGNGPAPYTYIPFGGGPRMCPGKEYARLEILV  428

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             F+HN+V  F+ EK+ P E  V+ N  P P NGLP+R+ P+ 
Sbjct  429   FIHNLVKRFRWEKVFPHENTVF-NPFPFPSNGLPIRIFPYS  468



>gb|KDP42282.1| hypothetical protein JCGZ_01606 [Jatropha curcas]
Length=440

 Score =   436 bits (1120),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 214/445 (48%), Positives = 308/445 (69%), Gaps = 37/445 (8%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMVPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffft  352
             NLPPGSTGWP+IGESI+ +   +                             AGNKF F+
Sbjct  29    NLPPGSTGWPLIGESIEFLTTGR----------------------------KAGNKFLFS  60

Query  353   nentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAK  526
             NEN L+T WWP SV K  +FP+  Q + ++ S   R  + +  KPE L+ YI  +D +A+
Sbjct  61    NENKLVTAWWPSSVNK--IFPSSKQTSSQEESMRMRKLLPQFLKPEALQRYIGIMDVVAQ  118

Query  527   EHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLN  706
              H A  W   ++V V+ L+K YTF+LAC+LFLS+E R++V++   P  +++S + ++P++
Sbjct  119   SHFAFNWDNKQQVTVFPLAKMYTFSLACRLFLSMEDREQVEKFAKPFDVLASAIIAIPID  178

Query  707   FPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQH  886
             FPGT++NR +K  ++VR++L+++IK+RK +   + + + +    D+L  +L   D++GQ 
Sbjct  179   FPGTSFNRGIKASNLVRKELLKIIKQRKNDLGENKASQTQ----DILSHMLTTADDKGQF  234

Query  887   LNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLS  1066
             ++E EI   I+G+L+  + + SAAITFV+K+LAE+P +Y++V++EQ+ IAK+KG  E L+
Sbjct  235   MSEIEIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYEKVFEEQMRIAKTKGAGELLN  294

Query  1067  WEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPK  1246
             WED+QKMKYSWNV CE +RL PP QG FRE +++FTYA +TIPKGWK +W+  STH+NP+
Sbjct  295   WEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTYADYTIPKGWKLYWSANSTHRNPE  354

Query  1247  YFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLM  1426
              F +PEKFDPSRF+G+GPAP+TFVPFG GPRMCPGKEYARLEIL+FMHN+V  FK EK +
Sbjct  355   CFPDPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILIFMHNIVKKFKWEKWL  414

Query  1427  PDEKIVYNNAAPSPVNGLPVRLTPH  1501
             P E I+  +  P P  GLP+ L PH
Sbjct  415   PQENIIV-DPLPIPAKGLPIVLHPH  438



>ref|XP_010661150.1| PREDICTED: beta-amyrin 28-oxidase isoform X2 [Vitis vinifera]
Length=447

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 304/470 (65%), Gaps = 58/470 (12%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE+++  +      P+++++DRM KYSP+VFKTS
Sbjct  19    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH--  466
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+        TL R+N    
Sbjct  79    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFN----ETLTRDNFRPP  134

Query  467   ----EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE L+HYI T+DSMA EHI   W+P RE                        
Sbjct  135   TFLPEFLKPEALQHYIVTMDSMASEHIELNWSPNRE------------------------  170

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
                         I++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK E      
Sbjct  171   ------------ILNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRKMEL----E  214

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K ++  RD+L  +L  +DE     +E EI   +I +L  T+H+ S+ ITF+LK+LAE P
Sbjct  215   QKGDSATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFP  274

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              +Y +V KEQ+EIA+SKGP   L W+D+QKMKY+WNV  E +RL PP QG FRE +++FT
Sbjct  275   DVYSKVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFT  334

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFTIPKGWK  WNV +TH++PKYF +PEKF+PSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  335   YAGFTIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGR  394

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EYAR ++L F+HNVVT FK EK+ P EK+ Y N +P P  G P+RL P Q
Sbjct  395   EYARAQVLAFIHNVVTRFKWEKVDPCEKVAY-NPSPIPSKGFPIRLQPLQ  443



>gb|EYU38301.1| hypothetical protein MIMGU_mgv1a005334mg [Erythranthe guttata]
Length=488

 Score =   437 bits (1123),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 305/449 (68%), Gaps = 10/449 (2%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  GWP++GES+  +       P+K++ DRM KYS  VF+T ++GEK AVF  A+GN
Sbjct  43    LPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGCASGN  102

Query  338   KffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDS  517
             KF F+NEN L+  W+P  + +     T+++  +     R  +H   K E L+ YI  +D 
Sbjct  103   KFLFSNENKLVRVWFPSGIDRIFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKMDH  162

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             MA+ H AE W    +V V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++
Sbjct  163   MAQLHFAEGWENKTQVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAI  222

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             P++ PGT +N+ +K   +VR++LV +IK+RK +    + GK  +  +D+L  +L  +DE 
Sbjct  223   PIDLPGTPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKA-SPTQDILSHMLLTSDEN  278

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P +
Sbjct  279   GKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAPGD  338

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+WED+QKMKYSWNV CE +RL  P  G FRE +++F+Y G++IPKG+K +W+  +THK
Sbjct  339   SLNWEDLQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATATHK  398

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             NP+ F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK E
Sbjct  399   NPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFE  458

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K++P++     +  P P  GLP+ L PHQ
Sbjct  459   KVIPNDGKFVVDPMPIPAKGLPIHLFPHQ  487



>gb|EYU38302.1| hypothetical protein MIMGU_mgv1a006499mg [Erythranthe guttata]
Length=441

 Score =   434 bits (1115),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 303/443 (68%), Gaps = 10/443 (2%)
 Frame = +2

Query  194   GWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP++GES+  +       P+K++ DRM KYS  VF+T ++GEK AVF GA+GNKF F+N
Sbjct  2     GWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGGASGNKFLFSN  61

Query  356   entllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKEHI  535
             EN L+  W+P  + +     T+++  +     R  +H   K E L+ YI  +D MA+ H 
Sbjct  62    ENKLVRVWFPSGIDRIFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKMDHMAQLHF  121

Query  536   AEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPG  715
             AE W    EV V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++P++ PG
Sbjct  122   AEGWENKTEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAIPIDLPG  181

Query  716   TAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNE  895
             T +N+ +K   +VR++LV +IK+RK +    + GK  +  +D+L  +L  +DE G+ + E
Sbjct  182   TPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKA-SPTQDILSHMLLTSDENGKFMQE  237

Query  896   FEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWED  1075
             F+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P + L+WED
Sbjct  238   FDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAPGDSLNWED  297

Query  1076  VQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFT  1255
             +QKMKYSWNV CE +RL  P  G FRE +++F+Y G++IPKG+K +W+  +THKNP+ F 
Sbjct  298   LQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATATHKNPEIFP  357

Query  1256  EPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDE  1435
             EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK EK++P++
Sbjct  358   EPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKVIPND  417

Query  1436  KIVYNNAAPSPVNGLPVRLTPHQ  1504
                  +  P P  GLP+RL PHQ
Sbjct  418   GKFVVDPMPIPAKGLPIRLFPHQ  440



>emb|CDP12479.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   434 bits (1117),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 309/461 (67%), Gaps = 17/461 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             + F  K   SK  LPPG TGWP++GE+++         P+K+  DRM KYS EVFKTS+L
Sbjct  25    LSFKLKEPISKLQLPPGKTGWPIVGETLEFAAMGRNGTPEKFFKDRMSKYSQEVFKTSLL  84

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
              E++AVFCG A NKF F+NEN L+   WP S  K  +FP+ N+  K+    R     + K
Sbjct  85    CEQIAVFCGPAANKFVFSNENKLVALSWPSSAKK--IFPSSNSSTKL----RAVALTLLK  138

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             P+NL  Y+  +DS+AK H+  +W   +EV V +L + + FT AC+LFLSI    +++   
Sbjct  139   PDNLHKYVAIVDSIAKSHLETQWNFQKEVNVLSLVRQFDFTAACRLFLSINDPHQIEDCA  198

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
              P  ++++G+F+LP+N PG++YNR +K  + VR++L+ +IK+RK E M     K      
Sbjct  199   KPFEVMAAGIFTLPINLPGSSYNRGIKAANSVRQKLLGIIKQRKGEVM----DKQLVHDE  254

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L   L   DE G+ ++E EI  +++  LL +  S +A+ITF +K+LAE P IY +V K
Sbjct  255   DLLSLFLTKPDENGKFMSEPEIADHLLAALLASQDSTTASITFTMKYLAEFPDIYDEVLK  314

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ  IA+ K P E L+W+D+QKM+Y+WNVV E LRL PP QG FRE +++FTY+ F IPK
Sbjct  315   EQRSIAQEKIPGEPLNWKDLQKMRYAWNVVSEVLRLVPPVQGNFREVLTDFTYSTFFIPK  374

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W   STHKNP+YF++PEKFDPSRFEGSGP P TFVPFG G R+CPGK++AR+ IL
Sbjct  375   GWKIYWTPNSTHKNPQYFSDPEKFDPSRFEGSGPMPHTFVPFGGGSRICPGKDFARVVIL  434

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             VFM+NV+  F+ EKL+PDEK V     P P  GLPV L PH
Sbjct  435   VFMYNVIGKFRWEKLLPDEKTVV-LPIPLPAKGLPVVLHPH  474



>gb|EYU26852.1| hypothetical protein MIMGU_mgv1a005293mg [Erythranthe guttata]
Length=490

 Score =   434 bits (1117),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 303/457 (66%), Gaps = 10/457 (2%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKV  310
             +   T+   LPPG  GWP++GES+  +       P+K++ DR+ KYS  VF+T ++GEK 
Sbjct  36    STTTTAAGPLPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSTVFRTHLVGEKA  95

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AV  GA+GNKF F+NEN L+  W+P  + K     T+++  +     R  +H   K E L
Sbjct  96    AVLSGASGNKFLFSNENKLVKAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTEAL  155

Query  491   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPII  670
             + YI  +D MA+ H  E W   +EV V  L+K YTF LAC+LF S+E   +V RL  P  
Sbjct  156   RRYIGKMDHMAQTHFEEGWENKKEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFN  215

Query  671   IVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLG  850
             +++S +F++P++ PGT +++ +K   +VR++LV +IK+RK +     +   +    D+L 
Sbjct  216   LLASSLFAIPIDLPGTPFSKGIKASKIVRQELVSIIKQRKIDLAQGKASPTQ----DILS  271

Query  851   RLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIE  1030
              +L  +DE G  + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+E
Sbjct  272   HMLLTSDENGNFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQME  331

Query  1031  IAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             I KSK P + L+WED+QKMKYSWNV CE +RL  P  G FRE  ++F+Y G++IPKG+K 
Sbjct  332   ILKSKSPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAFADFSYKGYSIPKGFKL  391

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +W+  +THKNP+ F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH
Sbjct  392   YWSATATHKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMH  451

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             ++V  FK EK++P++     +  P P  GLP+RL PH
Sbjct  452   HLVKRFKFEKVIPNDGKFVVDPMPIPAKGLPIRLFPH  488



>gb|AHA50080.1| cytochrome P450 [Eleutherococcus senticosus]
Length=469

 Score =   433 bits (1114),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/452 (48%), Positives = 313/452 (69%), Gaps = 17/452 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE+++ +       P+K+I+ RM KYSP VF TS+ GEK+A+FC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEYLSWGQKGCPEKFITQRMNKYSPHVFTTSLAGEKMAIFC  85

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             GA+GNKF F+NEN L+ +WWP ++ K ++  T+ ++ K S   RN I E  KPE L  +I
Sbjct  86    GASGNKFMFSNENKLVVSWWPPAISK-IVNSTKPSVEK-SKAVRNLIVEFLKPEALHKFI  143

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
             P +D   + H   EW    EVK +ALS+  TF LAC+L  SI+    VK L      V +
Sbjct  144   PVMDRTTRLHFEAEWGGTTEVKAFALSEMLTFELACRLLCSIDDPVHVKTLSCLFAKVKA  203

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ SLP++FPGTA+N  +K  +++R+ L  +I++R+++       K++  G D+L  +L 
Sbjct  204   GLMSLPIDFPGTAFNSGIKAANLIRKDLSVLIEQRRSD-------KLQIRG-DLLSHILI  255

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
                E+ + L+E +I   ++G+L+ ++ + S+ +  V+ FL + P IY +V  EQ+EIAKS
Sbjct  256   SNGEDEKILSEMDIADVVLGLLIASHDTTSSVMASVVYFLTDHPGIYAKVLTEQMEIAKS  315

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K   + L+WE++Q+MKYS NV+ E +RL PP QGGF+E +SEF+YA F IPKGWK FW+V
Sbjct  316   KRAGDLLTWENIQRMKYSRNVINEVMRLVPPSQGGFKEVISEFSYADFIIPKGWKIFWSV  375

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             +STHK+PKYF  PE+FDP RFEG GP PFTF+PFG GPRMCPG E+AR+E+L+FMH++V 
Sbjct  376   HSTHKDPKYFKNPEEFDPPRFEGDGPMPFTFIPFGGGPRMCPGNEFARMEVLIFMHHLVM  435

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             NF+ EK+ P+EKI+Y  + P P  GLP+RL+P
Sbjct  436   NFRWEKVFPNEKIIY-TSFPFPEKGLPIRLSP  466



>gb|EYU25766.1| hypothetical protein MIMGU_mgv1a005367mg [Erythranthe guttata]
Length=487

 Score =   432 bits (1111),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 304/446 (68%), Gaps = 10/446 (2%)
 Frame = +2

Query  188   STGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKfff  349
             +TGWP++GES+  +       P+K++ DR+ KYS  VF+T ++GEK AV  GA GNKF F
Sbjct  46    NTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGEKAAVLSGARGNKFLF  105

Query  350   tnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKE  529
             +NEN L+  W+P  + K     T+++  +     R  +H   K E L+ YI  +D MA++
Sbjct  106   SNENKLVRAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTEALRRYIGKMDLMAQK  165

Query  530   HIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNF  709
             H  E W    EV V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++P++F
Sbjct  166   HFEEGWENKTEVVVLPLAKDYTFQLACRLFASVENPQQVDRLSKPFNLLASSLFAIPIDF  225

Query  710   PGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHL  889
             PGT +N+ +K   +VR++L+ +IK+RK +    + GK  +  +D+L  +L  +DE G+ +
Sbjct  226   PGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKA-SPTQDILSHMLLTSDENGKFM  281

Query  890   NEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSW  1069
              EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+EI KSK P + L+W
Sbjct  282   QEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMEILKSKAPGDSLNW  341

Query  1070  EDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKY  1249
             ED+QKMKYSWNV CE +RL  P  G FRE + +F+Y G++IPKG+K +W+  +THKNP+ 
Sbjct  342   EDLQKMKYSWNVACEVMRLATPVPGTFREAIVDFSYKGYSIPKGFKLYWSATATHKNPEI  401

Query  1250  FTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMP  1429
             F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK EK++P
Sbjct  402   FPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKIIP  461

Query  1430  DEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             ++     +  P P  GLP+RL PH+K
Sbjct  462   NDGKFVVDPMPIPAKGLPIRLFPHEK  487



>gb|EYU38303.1| hypothetical protein MIMGU_mgv1a025102mg [Erythranthe guttata]
Length=441

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/443 (48%), Positives = 302/443 (68%), Gaps = 10/443 (2%)
 Frame = +2

Query  194   GWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP++GES+  +       P+K++ DRM KYS  VF+T ++GEK AVF  A+GNKF F+N
Sbjct  2     GWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGCASGNKFLFSN  61

Query  356   entllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYIPTIDSMAKEHI  535
             EN L+  W+P  + +     T+++  +     R  +H   K E L+ YI  +D MA+ H 
Sbjct  62    ENKLVRVWFPSGIDRIFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKMDHMAQLHF  121

Query  536   AEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPG  715
             AE W    +V V  L+K YTF LAC+LF S+E   +V RL  P  +++S +F++P++ PG
Sbjct  122   AEGWENKTQVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAIPIDLPG  181

Query  716   TAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNE  895
             T +N+ +K   +VR++LV +IK+RK +    + GK  +  +D+L  +L  +DE G+ + E
Sbjct  182   TPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKA-SPTQDILSHMLLTSDENGKFMQE  237

Query  896   FEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWED  1075
             F+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P + L+WED
Sbjct  238   FDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAPGDSLNWED  297

Query  1076  VQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFT  1255
             +QKMKYSWNV CE +RL  P  G FRE +++F+Y G++IPKG+K +W+  +THKNP+ F 
Sbjct  298   LQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATATHKNPEIFP  357

Query  1256  EPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDE  1435
             EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVFMH++V  FK EK++P++
Sbjct  358   EPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKVIPND  417

Query  1436  KIVYNNAAPSPVNGLPVRLTPHQ  1504
                  +  P P  GLP+RL PHQ
Sbjct  418   GKFVVDPMPIPAKGLPIRLFPHQ  440



>emb|CAN63680.1| hypothetical protein VITISV_036273 [Vitis vinifera]
Length=467

 Score =   430 bits (1105),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 292/426 (69%), Gaps = 22/426 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE++   +      P+++I+DRM KYSPEVF+ S+
Sbjct  21    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP-------TQNTLRKISTLNR  454
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP       TQ+ ++  S L  
Sbjct  81    MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLP-  139

Query  455   NNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE LKHY+  +D MA  HI  +WAP+REVKV+ L K Y F L+C+LF+ ++ 
Sbjct  140   ----EFLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDD  195

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
                V R+  P  ++ +G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK E      
Sbjct  196   PQCVARISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRKMEL----G  251

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K  +  RD L  +L   ++ G+ ++E EI  ++I +LL T+ S SA ITFVLK+LAE P
Sbjct  252   QKGNSAARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFP  311

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY +V+KEQ+EIAK KG  E L+W+D+QKM+YSWNV  E +RL PP QG FRE +  FT
Sbjct  312   SIYNEVFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFT  371

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFT+PKGWKT WNV +TH+NPKYF + EKFDPSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  372   YAGFTMPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGR  431

Query  1355  EYARLE  1372
             EYAR +
Sbjct  432   EYARAQ  437



>emb|CBI39267.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   430 bits (1105),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 292/426 (69%), Gaps = 22/426 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE++   +      P+++I+DRM KYSPEVF+ S+
Sbjct  54    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  113

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFP-------TQNTLRKISTLNR  454
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP       TQ+ ++  S L  
Sbjct  114   MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLP-  172

Query  455   NNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                 E  KPE LKHY+  +D MA  HI  +WAP+REVKV+ L K Y F L+C+LF+ ++ 
Sbjct  173   ----EFLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDD  228

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
                V R+  P  ++ +G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK E      
Sbjct  229   PQCVARISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRKMEL----G  284

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
              K  +  RD L  +L   ++ G+ ++E EI  ++I +LL T+ S SA ITFVLK+LAE P
Sbjct  285   QKGNSAARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFP  344

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY +V+KEQ+EIAK KG  E L+W+D+QKM+YSWNV  E +RL PP QG FRE +  FT
Sbjct  345   SIYNEVFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFT  404

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGK  1354
             YAGFT+PKGWKT WNV +TH+NPKYF + EKFDPSRFEG GP PFTFVPFG GPRMCPG+
Sbjct  405   YAGFTMPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGR  464

Query  1355  EYARLE  1372
             EYAR +
Sbjct  465   EYARAQ  470



>ref|XP_008340177.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=485

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 309/464 (67%), Gaps = 15/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             ++ +  ++  +  NLPPG+ G+PVIGES   +       P+K+  DR+ K+S +VFKTS+
Sbjct  26    VLLYRHRSQFTSENLPPGNVGYPVIGESFKFLASGWKGQPEKFFFDRITKFSSQVFKTSL  85

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
              GE+ A+FCGAA NKF F+NEN L+  W+P S+ K     T+ + +K     R  I +  
Sbjct  86    FGEQAAIFCGAACNKFLFSNENKLVAVWYPSSIQKVFPSSTETSKKKF----RKLIPKFM  141

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L+ YI  +D+ A+ H A+ W    +V+ + L+  YTF LA +LFLS+E   E++ +
Sbjct  142   KPEVLQRYIGIMDTSARTHFADAWENKNQVQAFPLTNDYTFGLAVRLFLSLENPKEMEEI  201

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
                I ++++G+ S+P++FPGT ++ A+K    +R +L ++IK+RK +    + GK  +  
Sbjct  202   GHSIHLLNAGIISMPIDFPGTPFHTAIKSSKFIRDKLHKIIKQRKIDL---AEGKA-SPT  257

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L   DE G    E EI  +I G+L+  + + SA   F++K+LAELPH+Y  VY
Sbjct  258   QDILSHMLLTCDEHGTSATELEIADWINGLLIAGHETTSATCAFIVKYLAELPHVYDAVY  317

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQ+EIA SK P + L+W+D++KMKYSWNV  E LR+  P QGG+RE +++F + G  IP
Sbjct  318   NEQMEIANSKSPGKLLNWDDLKKMKYSWNVASEVLRMSSPVQGGWREPLTDFMFHGLYIP  377

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK +W+  STHKN  YF EPEKFDPSRFEGSGPAP+T+VPFG G RMCPGKEYARL I
Sbjct  378   KGWKLYWSATSTHKNEAYFPEPEKFDPSRFEGSGPAPYTYVPFGGGVRMCPGKEYARLAI  437

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             LVFMHN+V  FK EK++ DE IV  N  P P  GLP+RL PH +
Sbjct  438   LVFMHNLVKRFKFEKVVADETIVV-NPLPVPAEGLPIRLYPHTQ  480



>gb|AEY75213.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=482

 Score =   429 bits (1103),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 308/458 (67%), Gaps = 14/458 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE+++ +      V + ++  R +KYSP+VF+TS+LGE +A
Sbjct  30    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHEIFKPEN  487
             + CG  GNKF ++ E  L+  W+P SV K  MFP  +        +  R  +  + K + 
Sbjct  90    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  147

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             +K Y+  +D + K+ +  +W   +++ V+   K YT T++C++F+SI+  ++V RL   I
Sbjct  148   MKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  207

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               + +G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK + +     K  ++ +D+L
Sbjct  208   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLL---ENKQASQPQDLL  264

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   +++GQ L+E +I  ++IG++   Y +++  ITFVL +LAE P +Y QV KEQ+
Sbjct  265   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  324

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK P E L+WED++KMKYSWNV  E LR+ PPG G FRE +++FTYAG+ IPKGWK
Sbjct  325   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  384

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
                  + THKNP YF  PEKFDP+RFEG+GPAP+TF PFG GPRMCPG EYARL IL+FM
Sbjct  385   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  444

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HNVVTNF+ EKL+P+EKI+  +  P   +GLP+ L PH
Sbjct  445   HNVVTNFRWEKLIPNEKIL-TDPIPRFAHGLPIHLHPH  481



>gb|AFU93031.1| cytochrome P450 [Panax quinquefolius]
Length=482

 Score =   429 bits (1103),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 308/458 (67%), Gaps = 14/458 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE+++ +      V + ++  R +KYSP+VF+TS+LGE +A
Sbjct  30    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF--KPEN  487
             + CG  GNKF ++ E  L+  W+P SV K  MFP  +        ++     +F  K + 
Sbjct  90    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRCKMMFLLKVDG  147

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             +K Y+  +D + K+ +  +W   +++ V+   K YT T++C++F+SI+  ++V RL   I
Sbjct  148   MKKYVGLMDRVMKQFLESDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  207

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               + +G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK + +     K  ++ +D+L
Sbjct  208   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLL---ENKQASQPQDLL  264

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   +++GQ L+E +I  ++IG++   Y +++  ITFVL +LAE P +Y QV KEQ+
Sbjct  265   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  324

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK P E L+WED++KMKYSWNV  E LR+ PPG G FRE +++FTYAG+ IPKGWK
Sbjct  325   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  384

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
                  + THKNP YF  PEKFDP+RFEG+GPAP+TF PFG GPRMCPG EYARL IL+FM
Sbjct  385   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  444

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HNVVTNF+ EKL+P+EKI+  +  P   +GLP+ L PH
Sbjct  445   HNVVTNFRWEKLIPNEKIL-TDPIPRFAHGLPIHLHPH  481



>emb|CDP19705.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 306/484 (63%), Gaps = 39/484 (8%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESID---LMVPDKYISDRMKKYSPEVFKTSILGEKV  310
             +   ++++ K  LPPG++G P++GE++    L  P+K+I  RMKKYS EVF TS++G+ +
Sbjct  22    FLCHRSDSKKCKLPPGTSGLPLVGETLHFFYLSGPEKFIHQRMKKYSDEVFATSLIGQNM  81

Query  311   AVFCGAAGNKffftnentllttWWP--QSVIKPLMFPTQNTLRKISTLNRNNIHE--IFK  478
             AV CGAAGNKF     N  ++ W P  QS     +     + + + T   +  H+  I  
Sbjct  82    AVICGAAGNKFLLCTANDFVSPWLPAVQSRFSNWVVSLGKSRKDVHT-KIHGFHQAVIMS  140

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE LK YIP +DS+ ++H+  +W PF+ VKVY  S+  T  LACKL L ++  D  +R  
Sbjct  141   PEALKQYIPIMDSLTRQHLQTDWDPFQVVKVYPASQKLTLILACKLVLGLDP-DRAQRFS  199

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
             D   +   G FSLP+N PGT YNRA+K    +++  +++I ERK   + +     E  G 
Sbjct  200   DSFAVAQQGFFSLPINLPGTTYNRAVKEVEKLKQGFLKIILERKKMVLENR----EKAGS  255

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L R   L DE    L++ EI  Y++ +++P+Y   S++ITFVLK L+ELPHIY  VYK
Sbjct  256   DILSR--TLLDENVHLLSDLEIALYLVSLMIPSYEPTSSSITFVLKHLSELPHIYDMVYK  313

Query  1019  -----------------------EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLF  1129
                                    + +EIAKSK P E L+WEDV+KMKYSWNV+CEA+RL 
Sbjct  314   GTLRGNKIFFINYSISAGVVRSEQHMEIAKSKDPEELLNWEDVKKMKYSWNVICEAMRLT  373

Query  1130  PPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPF  1309
             PP  G +R   ++  +AG TIPKGWK  W+ ++T+KNPKYF EPE FDP+RFEG GP P 
Sbjct  374   PPAIGSYRVAKTDIHFAGITIPKGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDGPTPC  433

Query  1310  TFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVR  1489
             TF+PF +GPRMCPGKEY+R  ILV+M+NVV  FK++KL+PDEK++Y   AP P +GLP+ 
Sbjct  434   TFIPFSTGPRMCPGKEYSRFLILVYMYNVVRKFKLQKLIPDEKVLY-RGAPYPASGLPMS  492

Query  1490  LTPH  1501
             L PH
Sbjct  493   LQPH  496



>sp|H2DH16.2|C7A47_PANGI RecName: Full=Dammarenediol 12-hydroxylase; AltName: Full=Cytochrome 
P450 CYP716A47; AltName: Full=Protopanaxadiol synthase; 
Short=PgDDS [Panax ginseng]
 gb|AEY75212.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=486

 Score =   429 bits (1103),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 308/458 (67%), Gaps = 14/458 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE+++ +      V + ++  R +KYSP+VF+TS+LGE +A
Sbjct  34    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  93

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHEIFKPEN  487
             + CG  GNKF ++ E  L+  W+P SV K  MFP  +        +  R  +  + K + 
Sbjct  94    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  151

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             +K Y+  +D + K+ +  +W   +++ V+   K YT T++C++F+SI+  ++V RL   I
Sbjct  152   MKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  211

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               + +G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK + +     K  ++ +D+L
Sbjct  212   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLL---ENKQASQPQDLL  268

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   +++GQ L+E +I  ++IG++   Y +++  ITFVL +LAE P +Y QV KEQ+
Sbjct  269   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  328

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK P E L+WED++KMKYSWNV  E LR+ PPG G FRE +++FTYAG+ IPKGWK
Sbjct  329   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  388

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
                  + THKNP YF  PEKFDP+RFEG+GPAP+TF PFG GPRMCPG EYARL IL+FM
Sbjct  389   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  448

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HNVVTNF+ EKL+P+EKI+  +  P   +GLP+ L PH
Sbjct  449   HNVVTNFRWEKLIPNEKIL-TDPIPRFAHGLPIHLHPH  485



>emb|CDP04721.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   427 bits (1098),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 306/459 (67%), Gaps = 13/459 (3%)
 Frame = +2

Query  143   FITKANTSKPN-LPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVA  313
             F+++   SK + LP G+ G PV+GE++      P+K+I  RM+KYS EVF TS+ G+KVA
Sbjct  23    FLSQRFKSKTSILPTGTFGLPVVGETLHFFSSGPEKFIHQRMEKYSAEVFATSLFGKKVA  82

Query  314   VFCGAAGNKffftnentllttWWPQSVIK--PLMFPTQNTLRKISTLNRNNIH-EIFKPE  484
             V CGAAGNKF     N  L  W P +  K   L+     ++R++ +  R  +H E+  P+
Sbjct  83    VVCGAAGNKFLLYTANDQLAPWLPSAASKLMDLVDSPGQSVRQVISKCRTFLHNEVLNPK  142

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L+ YI  +D++A+EHI  EW P + ++VY L + Y  +L+C+L L +E   +++R+ D 
Sbjct  143   TLRQYITIMDALAREHIKTEWDPSKVIQVYPLCQMYALSLSCRLLLGLEDACQIQRISDS  202

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
               I+  G+FS+P+N PGT YNRA+K    V+ Q + +I  +K + +   +G   + G DV
Sbjct  203   FWIIMQGLFSMPINMPGTRYNRALKEVKRVKHQFLNIIA-KKRDMVFQDTG---SAGSDV  258

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L R+L   +     +++ EI  Y++ ++LP+Y  ISA ITF L  LAELPHIY+ VYKE 
Sbjct  259   LSRIL--LEGNAYSMSDSEIGAYLLTLMLPSYEGISATITFALNHLAELPHIYEGVYKEL  316

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             +EIA+SK P E L+WEDV+KMKYSWNV+CE++RL PP  G FRE + +  +AG TIP+GW
Sbjct  317   MEIARSKAPEELLNWEDVKKMKYSWNVICESMRLTPPSMGTFREALIDINFAGITIPRGW  376

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             K  W+ ++T+KN KYF +PE FDP+R+EG GP   TF+PF +GPRMCPGK+Y+   ILV+
Sbjct  377   KMHWSPFTTNKNHKYFPDPEAFDPTRYEGDGPTSCTFLPFSAGPRMCPGKDYSMFLILVY  436

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             ++NVVT FK++KL+ DEK+ Y    P P NGLP+RL  H
Sbjct  437   VYNVVTRFKLQKLIQDEKMRY-RVGPVPANGLPMRLQTH  474



>gb|EPS63621.1| hypothetical protein M569_11161, partial [Genlisea aurea]
Length=476

 Score =   427 bits (1097),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 305/451 (68%), Gaps = 15/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG++GWPV+GESI  +       P K+  DR+ +YS +VF+T+I GEK AVF GAAG
Sbjct  33    QLPPGTSGWPVLGESIPFLSTTWKGHPHKFFFDRIDRYSSKVFRTNIFGEKAAVFSGAAG  92

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTL--RKISTLNRNNIHEIFKPENLKHYIPT  508
             NK+ F++EN  + +W   S  K  +FP+   +  R+     R  +    K E L  YI  
Sbjct  93    NKYLFSHENKTVQSWLMPSFDK--IFPSTINIPPRQEGLRLRKLLPGYVKAEALSGYIGI  150

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D +   H AE W     V V   +K +TF +AC+LFLSI+    V     P  +++SG+
Sbjct  151   MDEIGNRHFAEFWENKESVVVVPTTKRFTFLIACRLFLSIDDPVAVAEFAKPFNVLNSGL  210

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              S P+N PGTA+NRA+K    +R  L   I+ R+ E M++ + +V    +D+L  +++ T
Sbjct  211   ISFPINLPGTAFNRAIKASKQIRNDLALRIRRRREE-MLAGNTQVP---KDILTHMVSTT  266

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE+G+ ++E +I   I+G+L+  + + S   TF++KFLAELPH+Y+ VY+E ++I ++K 
Sbjct  267   DEDGKLMDEMDIACKIVGLLVAGHDTTSTICTFIVKFLAELPHVYEAVYQEHMKILETKK  326

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
               E L WED+QKMKYSWNV CEALRL+PP QGGFRE + +F Y GF IPKGWK +W+  S
Sbjct  327   QGEPLKWEDMQKMKYSWNVACEALRLYPPVQGGFREAIDDFNYNGFHIPKGWKIYWSTTS  386

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             +H+NP++F +PEKF+PSRFEG+GP P++F+PFG GPRMCPGKEY+RLE+L+F+H++V  +
Sbjct  387   SHRNPEHFPDPEKFEPSRFEGAGPEPYSFIPFGGGPRMCPGKEYSRLEVLIFIHHLVKRY  446

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             + EK++PDEKI   N  P+PV GLP+RL PH
Sbjct  447   RWEKIIPDEKITI-NPFPAPVKGLPIRLFPH  476



>gb|AED99867.1| cytochrome P450 [Panax notoginseng]
Length=500

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 308/458 (67%), Gaps = 14/458 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE+++ +        + ++  R +KYSP+VF+TS+LGE +A
Sbjct  48    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  107

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHEIFKPEN  487
             + CG  GNKF ++ E  L+ TW+P SV K  MFP  +        +  R  +  + K + 
Sbjct  108   ILCGPEGNKFLYSTEKKLVQTWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  165

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             LK Y+  +D + K+ +  +W   +++ V+   K YT T++C++F+SI+  ++V+RL   I
Sbjct  166   LKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVRRLGSSI  225

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               + +G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK + +     K  ++ +D+L
Sbjct  226   QNIEAGLLAVPINIPGTAMNRAIKTVKLLSREVEAVIKQRKVDLL---ENKQASQPQDLL  282

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   +++GQ L+E +I  ++IG++   Y +++  ITFV+ +LAE P +Y QV KEQ+
Sbjct  283   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVINYLAEFPDVYNQVLKEQV  342

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK P E L+WED++KMKYSWNV  E LR+ PPG G FRE +++FTYAG+ IPKGWK
Sbjct  343   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  402

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
                  + THKNP YF  PEKFDP+RFEG+GPAP+TF PFG GPRMCPG EYARL IL+F+
Sbjct  403   MHLIPHDTHKNPTYFPNPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFI  462

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HNVVTNF+ EKL+P EKI+  +  P   +GLP+ L PH
Sbjct  463   HNVVTNFRWEKLIPSEKIL-TDPIPRFAHGLPIHLHPH  499



>gb|AIN44011.1| cytochrome P450, partial [Panax notoginseng]
Length=506

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 308/458 (67%), Gaps = 14/458 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE+++ +        + ++  R +KYSP+VF+TS+LGE +A
Sbjct  54    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  113

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN--RNNIHEIFKPEN  487
             + CG  GNKF ++ E  L+ TW+P SV K  MFP  +        +  R  +  + K + 
Sbjct  114   ILCGPEGNKFLYSTEKKLVQTWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  171

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             LK Y+  +D + K+ +  +W   +++ V+   K YT T++C++F+SI+  ++V+RL   I
Sbjct  172   LKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVRRLGSSI  231

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               + +G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK + +     K  ++ +D+L
Sbjct  232   QNIEAGLLAVPINIPGTAMNRAIKTVKLLSREVEAVIKQRKVDLL---ENKQASQPQDLL  288

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   +++GQ L+E +I  ++IG++   Y +++  ITFV+ +LAE P +Y QV KEQ+
Sbjct  289   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVINYLAEFPDVYNQVLKEQV  348

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK P E L+WED++KMKYSWNV  E LR+ PPG G FRE +++FTYAG+ IPKGWK
Sbjct  349   EIANSKQPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  408

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
                  + THKNP YF  PEKFDP+RFEG+GPAP+TF PFG GPRMCPG EYARL IL+F+
Sbjct  409   MHLIPHDTHKNPTYFPNPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFI  468

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HNVVTNF+ EKL+P EKI+  +  P   +GLP+ L PH
Sbjct  469   HNVVTNFRWEKLIPSEKIL-TDPIPRFAHGLPIHLHPH  505



>ref|XP_002325238.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
 gb|EEF03803.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
Length=475

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 306/464 (66%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II    ++    PNLPPGS+G P IGE+++L++      P K+  DR  KY+ EVFKT++
Sbjct  17    IIVHKHRSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNL  76

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
               +  AV CGAAGNKF F+NEN +L  W+P  V K      Q +L +     R  + E  
Sbjct  77    FCQPAAVLCGAAGNKFLFSNENKVLKAWYPDFVCKIFPSSVQRSLIEQVDRLRTLLPEFL  136

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             +P+ LK Y+   D++A  H A EW     V V+ L+K +TF LAC LFLSIE  D + +L
Sbjct  137   RPDALKRYVGIFDTVAGRHFASEWENKEVVVVFPLAKSFTFGLACSLFLSIEDPDHIAKL  196

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
               P  +V SG+FS+P++ PGT  NRA+K  + +R +L  +IK+RK +    + GK   + 
Sbjct  197   ASPFNLVVSGIFSIPIDLPGTPLNRAIKAANFIRTELFAIIKQRKKDL---AEGKASPK-  252

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L   DE+G  ++E  I   I+ +L   + S SAA  F++K+LAELPHIY+ VY
Sbjct  253   QDILSHMLLACDEKGAFMSELSIADTILALLASAHESTSAACAFIVKYLAELPHIYEGVY  312

Query  1016  KEQIEIAKSKGP-NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTI  1192
             KEQ+EI+++K P +E L+W D+QKM+YSWNV+ E LRL P      RE +  F + GF+I
Sbjct  313   KEQMEISETKAPGDELLNWNDIQKMRYSWNVIREVLRLCPTFPN-VREAILGFDFNGFSI  371

Query  1193  PKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLE  1372
             PKGWK +WN  STH+NP+YF EPE+FDPSRFEG+GP P+TFVPFG GP MCPG+ +ARLE
Sbjct  372   PKGWKVYWNANSTHRNPEYFPEPERFDPSRFEGTGPVPYTFVPFGGGPMMCPGQGFARLE  431

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +L+FMHN+V  FK +K + +EKI++ +  P P  G+P+RL PH+
Sbjct  432   MLIFMHNLVKRFKFDKFVAEEKIMF-SPMPIPEKGVPIRLFPHR  474



>emb|CBI24076.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 301/465 (65%), Gaps = 48/465 (10%)
 Frame = +2

Query  134   IIYFITK-ANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTS  292
             I +F+ K   +S  NLPPG  G+P IGES++ +       P+++I DRM KYS ++FKT 
Sbjct  81    IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  140

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIH  466
             +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV K  +FP+  Q + ++ S   R  + 
Sbjct  141   LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSVEK--IFPSSLQTSTKEESMKTRKLLP  198

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                KPE L+ Y+  +DS+A                                 +I+    +
Sbjct  199   AFLKPEALQKYVGIMDSIA---------------------------------NIDDPKHI  225

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +  +P  I+++G+ S+P+NFPGT +NRA+K    VR++L  +IK+RK + +   +GK  
Sbjct  226   AKFANPFHILAAGVMSIPINFPGTPFNRAIKAADSVRKELRAIIKQRKIQVL---AGKSS  282

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +   D+L  +L  TDE GQ LNE +I   I+G+L+  + + SA ITF++K+LAELP +Y 
Sbjct  283   SSKHDILSHMLTTTDENGQFLNEMDIADKILGLLIGGHDTASAVITFIIKYLAELPQVYN  342

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KEQ+E+A  K   E L WED+QKMKYSWNV  E +RL PP QG FRE +++FTYAGF
Sbjct  343   EVLKEQMEVAAGKKSGEMLDWEDIQKMKYSWNVANEVMRLAPPLQGSFREAITDFTYAGF  402

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             +IPKGWK +W+  +THKNP YF +PEKFDPSRFEG+GP P+T+VPFG GPRMCPGKEYAR
Sbjct  403   SIPKGWKLYWSTNATHKNPDYFPDPEKFDPSRFEGNGPIPYTYVPFGGGPRMCPGKEYAR  462

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             LEILVF+HNVV  F   KL P+E ++  +  P P  GLP+RL  H
Sbjct  463   LEILVFIHNVVRRFSWYKLHPNEDVIV-DPMPMPAKGLPIRLRHH  506



>ref|XP_002325242.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
 gb|EEF03807.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
Length=461

 Score =   423 bits (1087),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 303/458 (66%), Gaps = 31/458 (7%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             ++    PNLPPGS+G P IGE+++L+V      P K+  DR  KY+ EVFKT++  +  A
Sbjct  27    RSKFKHPNLPPGSSGLPYIGETLELLVTGCKGHPQKFFLDRKAKYASEVFKTNLFCQPAA  86

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             VFCGAAGNKF F+NEN +L  W+P  V K  +FP        S++ R+ I +        
Sbjct  87    VFCGAAGNKFLFSNENKVLKAWYPDFVCK--IFP--------SSVQRSLIEQ--------  128

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              Y+   D++A  H A EW     V V+ L+K +TF LAC LFLSIE  D + +L  P  +
Sbjct  129   RYVGIFDTVAGRHFASEWENKEVVVVFPLTKSFTFGLACSLFLSIEDPDHIAKLASPFNL  188

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
             V SG+FS+P++ PGT  NRA+K  + +R +L  +IK RK +    + GK   + +D+L  
Sbjct  189   VVSGIFSIPIDLPGTPLNRAIKASNFIRTELFAIIKRRKKDL---AEGKASPK-QDILSH  244

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             +L   DE+G  +NE  I   I+ +L   + S SAA  F++K+LAELPHIY+ VYKEQ+EI
Sbjct  245   MLLACDEKGSFMNELNIADTILALLASAHESTSAACAFIVKYLAELPHIYEGVYKEQMEI  304

Query  1034  AKSKGP-NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             +++K P +E L+W D+QKM+YSW V+ E LRL P      RE + +F + GF IPKGWK 
Sbjct  305   SETKAPGDELLNWNDIQKMRYSWKVIREVLRLCPTFPN-VREAIHDFDFNGFLIPKGWKV  363

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +WN  STH+NP+YF EPE+FDPSRFEG+GPAP+TFVPFG GP MCPG+ +ARLE+L+FMH
Sbjct  364   YWNANSTHRNPEYFPEPERFDPSRFEGNGPAPYTFVPFGGGPMMCPGQGFARLEMLIFMH  423

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             N+V  FK +KL+ DEKIV+ N  P P  G+P+RL PH+
Sbjct  424   NLVKRFKFDKLIADEKIVF-NPMPVPEKGVPIRLIPHR  460



>gb|EYU26126.1| hypothetical protein MIMGU_mgv1a017761mg, partial [Erythranthe 
guttata]
Length=452

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 306/460 (67%), Gaps = 17/460 (4%)
 Frame = +2

Query  143   FITKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGE  304
             F + A  +   LPPG+TGWP++GES+  +       P+K++ DR+ KYS  VF+T ++GE
Sbjct  3     FSSAAAAATGPLPPGNTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGE  62

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPE  484
             K AV  GA+GNKF F+NEN L+  W+P  + K     T+++  +     R  +H   K E
Sbjct  63    KAAVLSGASGNKFLFSNENKLVRAWFPSGIDKIFPSSTRSSSEEEGIKLRRMLHTFLKTE  122

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L+ YI  +D MA++H  E W    EV V  L+K YTF LAC+LF S+E   +V RL  P
Sbjct  123   ALRRYIGKMDRMAQKHFEEGWENKSEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKP  182

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
               +++S +F++P++ PGT +N+ +K   +VR++L+ +IK+RK +    + GK  +  +D+
Sbjct  183   FNLLASSLFAIPIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKA-SPTQDI  238

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L  +L  +DE G+ + EF+I   I+G+L+    S S A TF++K+LAE        Y EQ
Sbjct  239   LSHMLLTSDENGKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAEF-------YNEQ  291

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             +EI KSK P + L+WED+QKMKYSWNV CE +RL  P  G FRE +++F+Y G++IPKG+
Sbjct  292   MEILKSKAPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYSIPKGF  351

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             K +W+  +THKNP+ F EPEKFDPSRF+G+GPAP+TFVPFG GPRMCPG EYAR EILVF
Sbjct  352   KLYWSATATHKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVF  411

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             MH++V  FK EK++P++     +  P P  GLP+RL PH+
Sbjct  412   MHHLVKRFKFEKMIPNDGKFVVDPMPIPAKGLPIRLIPHE  451



>ref|XP_011074924.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Sesamum indicum]
Length=319

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 251/332 (76%), Gaps = 14/332 (4%)
 Frame = +2

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D++A+EH+  EW P   V V  LSK YTF LACKLFL +   +++KRL DP  + + GM
Sbjct  1     MDALAREHMDREWTPNALVNVVPLSKKYTFDLACKLFLDVVDVEDIKRLSDPFSLATQGM  60

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
               +P+N PG AYNRA++GG M+R++L+ +I ER+ + +     K E   +D+L ++L +T
Sbjct  61    LGVPINLPGMAYNRAIRGGKMIRKELIRIINERRKKLL----EKKETRHQDLLSKMLLVT  116

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE GQ  +E EI + I+G L+ ++ + S+A++ V+ +LA LPHIY+QV KEQ+EIAKSKG
Sbjct  117   DENGQFYSEMEISNNIVGFLVASFDATSSAVSSVINYLAHLPHIYEQVLKEQMEIAKSKG  176

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
             P+E L+WED+QKMKYSWNV  E+LRL P  QGGFRET +EFTYAGFTIPKGWKT W V+S
Sbjct  177   PDELLTWEDIQKMKYSWNVARESLRLGPSSQGGFRETTTEFTYAGFTIPKGWKTHWTVHS  236

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             +H+NP+YF EPEKFDPSRF+GSGP P+TFVPFG GPRMCPG+EYA+LEILVFMHNVV  F
Sbjct  237   SHRNPEYFPEPEKFDPSRFDGSGPPPYTFVPFGGGPRMCPGREYAKLEILVFMHNVVRRF  296

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K+EK +P+E          PV+GL VRL PH+
Sbjct  297   KLEKAIPNE----------PVDGLAVRLQPHE  318



>ref|XP_006372166.1| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
 gb|ERP49963.1| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
Length=393

 Score =   414 bits (1063),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 209/394 (53%), Positives = 272/394 (69%), Gaps = 5/394 (1%)
 Frame = +2

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             G AGNKF F+NEN L+ TWWP+ V K      + + ++ +   R       KPE L+ YI
Sbjct  4     GVAGNKFLFSNENRLVETWWPEFVNKIFPSAVEKSPKEEAKRMRRLFPPFLKPEALRRYI  63

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
              T+D + K H A EW    EV V+ L+K YTF LAC+LFLSIE    + R   P   ++S
Sbjct  64    GTMDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHITS  123

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+F++P+ FPGT +NRA+K   ++R +L+ +I++RK +    + GK  +  +D+L  +L 
Sbjct  124   GIFTIPIAFPGTPFNRAIKATKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHMLL  179

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
               D  GQ++NE EI   II +LL  + S   A TF++K+LAE+PHIY+ VYKEQ EI KS
Sbjct  180   SNDANGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEIIKS  239

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K P E L+W D+QKMKYSWNV CE LRL PP  G F+E + +FT+ GF IPKGWK +W+ 
Sbjct  240   KAPGELLNWVDIQKMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKLYWSA  299

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
              STHKNP+YF+EPEKFDPSRFEG GPAP+TF+PFG GPRMCPG EYARLEILVFMHN+V 
Sbjct  300   SSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMHNLVK  359

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              FK E+L+ DEKIV+ +  P P  GLPVRL PH+
Sbjct  360   RFKFERLVLDEKIVF-DPTPKPERGLPVRLLPHK  392



>ref|XP_004308257.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   417 bits (1073),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 307/472 (65%), Gaps = 30/472 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP----EVFKTSILGEKVAVFC  322
              LPPGSTGWP+IGE+++ +      VP+K+I+DR  K+S     +VFKTS+L E +AV C
Sbjct  40    QLPPGSTGWPIIGETLEYLSTAKQGVPEKFIADRRNKHSSSVPCKVFKTSLLQESMAVLC  99

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
              AAGNKF F+NEN L+ +WWP +  K      +    + S   R  +    KP+ L  YI
Sbjct  100   TAAGNKFLFSNENKLVKSWWPANFEKIFANSEKTDTTQESIRLRKVLSPFLKPDALHRYI  159

Query  503   PTIDSMAKEHIAEEWAPFREV------------KVYALSKCYTFTLACKLFLSIEGRDEV  646
               +D + K+H+   W+    V            KV+ L+K YTFTLACKLFL+IE    V
Sbjct  160   GAMDEVTKQHLNMYWSCSSSVDYVKEEDESVIIKVHPLAKKYTFTLACKLFLNIEDPKLV  219

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEA------MMS  808
              +L + I  +SSG  SLP+NFPGT +NRA++    +++++ E++K+R+ +         +
Sbjct  220   AKLEELIRHISSGFISLPINFPGTKFNRAIRASKQIKKEIEEMVKQRRIDLHPHLSDTSN  279

Query  809   SSGKVENEGRDVLGRLLNLTDEEGQHL-NEFEIYHYIIGILLPTYHSISAAITFVLKFLA  985
             S+       +D+L RLL  T  +G+ L  E +I + + G+++  Y +IS  +  ++ FL+
Sbjct  280   SNHHHHYHDQDLLSRLLVETYSDGKELMTESDIANKLYGLIVGAYDNISTTLVSIIMFLS  339

Query  986   ELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVS  1165
             +LPH+Y  V KEQ+EIA+SK   E L+WE++QKMKYSW+V CEALRL PP  G FRE ++
Sbjct  340   KLPHVYDAVLKEQMEIAESKAEGELLNWEELQKMKYSWSVACEALRLLPPILGTFREAIT  399

Query  1166  EFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMC  1345
             +F+Y G+ IPKG K  WN Y+THKNP+YF EPEKFDPSRF+  GPAP+++VPFG GPRMC
Sbjct  400   DFSYEGYIIPKGMKLHWNTYATHKNPEYFPEPEKFDPSRFQRQGPAPYSYVPFGGGPRMC  459

Query  1346  PGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             PGKEYAR +ILVFMHNVVT FK E + PDEK++ +     P  GL +RL PH
Sbjct  460   PGKEYARFKILVFMHNVVTRFKWEMVFPDEKMIMDPVL-VPTKGLTIRLFPH  510



>ref|XP_007139496.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
 gb|ESW11490.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
Length=475

 Score =   416 bits (1068),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/465 (47%), Positives = 315/465 (68%), Gaps = 22/465 (5%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             +++   A +S PNLPPG+ G+P IGESI+ +       P+K+I +RM KYS +VFKTS+ 
Sbjct  23    LFYSHYAQSSDPNLPPGNMGFPAIGESIEYLSLGWKGHPEKFIYERMAKYSSKVFKTSLF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQ-NTLRKISTLN-RNNIHEI  472
             GE   + C A  NKF F+NEN L+ +WWP +V K  +FP+   T  K+     R  + + 
Sbjct  83    GESTVMLCEAECNKFLFSNENKLVVSWWPDNVNK--IFPSSLETSSKVEAKKLRQMLPQF  140

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
                + L+ Y+  +D++A+ H A EW     V V+ L+K YTF +AC+LFL+++    V  
Sbjct  141   LSAQALQGYVGIMDTVAQRHFASEWENNTSVIVFPLAKSYTFWVACRLFLNVDDPIHVAN  200

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
             L +    ++ G+ S+P++ PGT +N+A+K   +++ +L+++I++RK E + + +  V   
Sbjct  201   LAESFNKIAPGIMSVPIDLPGTPFNKAIKASVIIKEKLLKIIRQRK-EDLANGTASVT--  257

Query  833   GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP-HIYQQ  1009
              +D+L  +L+  DE GQ++ +  I   I+G+L+  + + S+A TFV+K+LAELP +IY  
Sbjct  258   -QDILSHMLSSCDENGQYMADRYIADKILGLLIGGHDTASSACTFVVKYLAELPPNIYDN  316

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             VYKEQ+EIAKSKGP E L+W+D+QKMKYSWNV CE +RL PP QG FRE +++F + GF 
Sbjct  317   VYKEQMEIAKSKGPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGSFREAMNDFMFNGF-  375

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +WN  STH+NP+ F EPEK     FEG GPAP+TFVPFG GPRMCP KEYA++
Sbjct  376   IPKGWKLYWNASSTHRNPECFPEPEK-----FEGRGPAPYTFVPFGGGPRMCPEKEYAQM  430

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             EILVFMHN+V  FK E ++P+EK++  +  P P  GLPVRL PH+
Sbjct  431   EILVFMHNLVKRFKWEAMIPNEKVII-DPLPVPAKGLPVRLYPHK  474



>ref|XP_008227229.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=511

 Score =   416 bits (1069),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 215/473 (45%), Positives = 306/473 (65%), Gaps = 34/473 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY----------SPEVFKTSILGEK  307
             LPPGSTGWP+IGE+++ +      VP+K+I+DR  KY          + +VFKTS+L E 
Sbjct  40    LPPGSTGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSSANCKVFKTSLLFED  99

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKI-------STLNRNNIH  466
             +AV C AAGNKF F+NE  L+ +WWP  + K L+F      +K        ST  RN + 
Sbjct  100   MAVLCTAAGNKFLFSNEKKLVKSWWPPHLDK-LIFADSAPDKKAKAFITEESTRFRNTMA  158

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKCYTFTLACKLFLSIEG  634
                KP  L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y FT+AC+L L  E 
Sbjct  159   PYLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQVIKAHPLAKKYAFTMACRLMLDTED  218

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
             +    +L + +  +SSG  SLP++ PGT +NRA++G   +R ++  ++ +R+      S+
Sbjct  219   QQVFTKLENLMKDLSSGFTSLPIDLPGTQFNRAIQGSRQLREEIKNIVTQRRTHL---ST  275

Query  815   GKVENE--GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAE  988
              KV+ +  G D+L  L+  T   GQ L++ EI   + G+++  Y + S+ +  ++ +LAE
Sbjct  276   RKVDEDVDGLDILSSLIMDTSSNGQGLSDSEIASKLYGVIVSGYDNFSSTLATIVMYLAE  335

Query  989   LPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSE  1168
             LPH+Y  V KEQ +IA+SK   E L+W D+QKMKYSW+V CE +RL PP  G FRE +S+
Sbjct  336   LPHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREAISD  395

Query  1169  FTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCP  1348
             F Y G+ IPKG K  WNV+STHKNP+YF +PEKFDPSRFEG GP P++FVPFG GPRMCP
Sbjct  396   FVYEGYLIPKGMKLNWNVHSTHKNPEYFPDPEKFDPSRFEGQGPPPYSFVPFGGGPRMCP  455

Query  1349  GKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             GKEY+RL++LVFMHNVV  ++ EK+ PDEK V++ A   P  GLP+R+ PH K
Sbjct  456   GKEYSRLKMLVFMHNVVNRYRWEKVFPDEKFVWDPAL-VPTKGLPIRVFPHNK  507



>ref|XP_010098502.1| Cytochrome P450 [Morus notabilis]
 gb|EXB75162.1| Cytochrome P450 [Morus notabilis]
Length=479

 Score =   412 bits (1060),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 214/468 (46%), Positives = 303/468 (65%), Gaps = 21/468 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             +I+  TK++ +   LPPGS GWP+IGE+I+ +   P+ ++  RM KYSP++FKT+ILGEK
Sbjct  20    LIFKSTKSSENSKTLPPGSMGWPIIGETIEFLFGKPENFVFKRMNKYSPDIFKTNILGEK  79

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE------  469
              AV CG  G+KF F+NE   LT + P+S+ +  +F + N   K + L   +  E      
Sbjct  80    TAVICGPNGHKFLFSNEQKYLTAFRPRSMQR--LFRSYNKQHKAAQLQHASDEEAKKVLR  137

Query  470   ---IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRD  640
                  KPE L  Y+  +D++ +E +   W    EVK Y L+K  T TLAC+ FL I   +
Sbjct  138   SPGFLKPEGLIRYLSKMDAVTQEQMKNYWEGKNEVKAYPLAKILTLTLACRFFLGIGDPE  197

Query  641   EVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGK  820
              + RL+D    V+ GM SL +NFPGT + RAMK  + +R++L  VI E+K +AM +    
Sbjct  198   RIARLVDNFDNVTVGMHSLIVNFPGTTFYRAMKAANTLRKELKAVIGEKK-KAMAAGEAM  256

Query  821   VENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHI  1000
                  +D+L  ++  +D  G+H+ E EI   I+G+L   Y +++ A+ F +K++ E P +
Sbjct  257   -----QDILAHMIVASDASGKHMAEAEIADKIMGLLTAGYSTVATAMAFFMKYVGERPDV  311

Query  1001  YQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYA  1180
             YQ+V  EQ EIA+SK   + L WED+ KMKYSWNV+CE +RL PP QG FRE +++FTYA
Sbjct  312   YQKVLAEQKEIAESKKRGDMLEWEDINKMKYSWNVLCEVMRLTPPLQGTFREALTDFTYA  371

Query  1181  GFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGP-APFTFVPFGSGPRMCPGKE  1357
             G+TIPKGWK +W V +T++NP+YF EPEKF+PSR + +    PFTFVPFG GPRMCPGKE
Sbjct  372   GYTIPKGWKVYWTVSTTNQNPEYFPEPEKFNPSRHDNANAFPPFTFVPFGGGPRMCPGKE  431

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             YARL IL F+HN+V  F+ E + P+EKI   +  P+P  GLP+RL  H
Sbjct  432   YARLSILTFVHNIVKRFQWELVFPNEKI-EGDMMPTPEKGLPIRLRSH  478



>gb|KFK23969.1| hypothetical protein AALP_AAs58682U000100 [Arabis alpina]
Length=473

 Score =   412 bits (1059),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 204/457 (45%), Positives = 303/457 (66%), Gaps = 16/457 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGESIDLMVP------DKYISDRMKKYSPEVFKTSILGEKVAV  316
             ++ S P LPPG  G+P++GES   +        +K+I+DR+ ++S +VFKT I G   AV
Sbjct  26    SHFSYPKLPPGKIGFPLVGESFSFLSAGRKGHQEKFITDRVSRFSSDVFKTHIFGSPTAV  85

Query  317   FCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKH  496
               GA+GNKF FTNEN L+ +WWP SV K      + + ++ +   R  +    KPE L+ 
Sbjct  86    VTGASGNKFLFTNENKLVVSWWPDSVNKIFPSSMETSSKEEAKKMRTLLLPFLKPEGLRS  145

Query  497   YIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIV  676
             Y+  +D +A+ H   EWA   ++ V  L+K +TF++AC+LFLS++  + V++L +P   V
Sbjct  146   YVGVMDEIARRHFETEWANQDQLIVLPLTKKFTFSIACRLFLSMDDPERVRKLEEPFNTV  205

Query  677   SSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRL  856
             + G+FS+P+NFPGT +NRA+K   ++R+++  ++++RK E     +GKV  E +D+L  +
Sbjct  206   AIGVFSIPINFPGTRFNRAIKASRLLRKEVSAIMRKRKEEV---KAGKVLAE-QDILSHM  261

Query  857   L-NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             L N+ + +  H+ +      IIG+L+  Y + S   TF++ FLA+ P +Y++V  EQ EI
Sbjct  262   LMNIGETKDDHVAD-----KIIGLLIGGYDTASIVCTFIVSFLADFPDVYKRVLHEQQEI  316

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
                K  NE L WED++KM+YSWNV CE +R+ PP  G FRE +  F++ GF IPKGWK +
Sbjct  317   LTEKEGNEGLRWEDIEKMRYSWNVACEVMRIVPPLSGTFREAIEHFSFKGFYIPKGWKLY  376

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHN  1393
             W+  +THKNP YF EPE+F+P+RFEGSGP P+T+VPFG GPRMCPG+EYARLEIL+FMH+
Sbjct  377   WSATATHKNPDYFPEPERFEPNRFEGSGPKPYTYVPFGGGPRMCPGREYARLEILIFMHH  436

Query  1394  VVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +VT +K EK+ P E  +  +  P P  GLPVR++P  
Sbjct  437   LVTRYKWEKVFPKENKIVVDPLPLPAKGLPVRISPQS  473



>gb|KDP33425.1| hypothetical protein JCGZ_06996 [Jatropha curcas]
Length=473

 Score =   412 bits (1058),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 211/470 (45%), Positives = 311/470 (66%), Gaps = 30/470 (6%)
 Frame = +2

Query  134   IIYFITK-------ANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP  274
             +IYF+ +       A TS P  PPGSTGWP+IGE+++ +      +P+K+I+DR  KYS 
Sbjct  20    VIYFLRQKPRKNGEARTSPP--PPGSTGWPLIGETMEYLSTTREGIPEKFINDRRNKYSS  77

Query  275   EVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLR-KISTLN  451
             ++FKTS+LG+ + + C A GNKF F+NEN L+++WWP SV K  +F +QN  + +++T  
Sbjct  78    KLFKTSLLGQPMVLLCNAEGNKFVFSNENRLVSSWWPSSVDK--LFDSQNESKGELATKM  135

Query  452   RNNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIE  631
             R  +  + K + L+ Y+  +D+  ++H+   W   + V+V+  +K  TF LAC+L L I+
Sbjct  136   RKFVTPVLKSDMLRKYVDVVDAKTRQHLQNHWDGKQVVEVHPFAKDLTFVLACRLLLGID  195

Query  632   GRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSS  811
               + + +L       S+G+ SLP++ PGT + RA+K    +R +   +IK+ KA      
Sbjct  196   DEEAIAQLQKSFEHFSAGLLSLPIDLPGTNFRRAIKEAKKLREEFEVMIKQWKANP----  251

Query  812   SGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
                  ++ + +L +  +L +EEGQ   E EI   I+ ++  +Y ++S AITFV+K+LAE+
Sbjct  252   -----SKSQGLLSQ--HLINEEGQSSTESEIATRILALISASYDNVSTAITFVVKYLAEM  304

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             P +Y+ V +EQ EIA++K   E L+W DVQKM+YSWNV  E LRL PP  G FRE +++F
Sbjct  305   PDVYEAVLREQQEIARAKSSEELLNWHDVQKMRYSWNVASEVLRLHPPANGAFREVIADF  364

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPG  1351
             TYAGF+IPKGWK  WN ++THK+P+YF +PEKFDPSRF+G+G  P+++VPFG G  MCPG
Sbjct  365   TYAGFSIPKGWKLHWNAFATHKSPEYFPDPEKFDPSRFDGNGIVPYSYVPFGGGAHMCPG  424

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             KEYAR+ ILV MH+VV  FK+EK+ PDEKI+       P  GLPVRL P+
Sbjct  425   KEYARIAILVLMHHVVIKFKLEKVFPDEKII-GLPVLRPAKGLPVRLIPN  473



>ref|XP_011048169.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   411 bits (1057),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 300/464 (65%), Gaps = 15/464 (3%)
 Frame = +2

Query  137   IYFITKANTSK----PNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFK  286
             +Y ITK    +    P+LPPGS GWP+IGE+++ +       PD ++ DRM+K  P++FK
Sbjct  18    LYIITKTLKERLIPNPHLPPGSLGWPLIGETLNYLGACLAGRPDWFLRDRMEKLDPQIFK  77

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH  466
             TS+ GE VAVFCG AGNKF F+NEN L+  WWP+SV K L     N     +   R+ + 
Sbjct  78    TSLFGETVAVFCGPAGNKFLFSNENKLVNLWWPRSVKKLLKSSLVNVAGDEAKRIRSILL  137

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                 P+ LK YI  +D + + HI+  W    EVKV+     YTF L+C+LF+SI+    +
Sbjct  138   TFLNPDALKKYIERMDLVTQHHISTLWEGKEEVKVHPTVNLYTFELSCRLFISIDDPLHI  197

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +L     +   G+   P+N PGT + RA K    ++ +L  + + R+A    +   K+ 
Sbjct  198   SKLAHQFDVFLKGVIHFPINIPGTRFYRASKAAVAIKEELRLISRRRRA----ALDKKMA  253

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  LL  +D  G+ L+E EI   I+ +L  ++ + ++ IT V+K+LAELP +YQ
Sbjct  254   SPTQDLLSHLLVTSDASGKFLSETEIVDNILLLLFASHDTTTSVITCVMKYLAELPEVYQ  313

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V +EQI+IAKSK P E L WED+QKM+YSWNVV E LRL PP +G FRE + +FTYAG+
Sbjct  314   KVMREQIDIAKSKEPGELLKWEDIQKMRYSWNVVSEILRLMPPVRGAFREAIVDFTYAGY  373

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIPKGWK +W+  +T K+P  F   E+FD SR++G+GPAP+++VPFG GPR+C G EYAR
Sbjct  374   TIPKGWKVYWSPMTTSKDPTLFPNAEQFDASRYDGAGPAPYSYVPFGGGPRICLGNEYAR  433

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
              +ILVF+HN+V  FK + ++PDEKI Y +  P+P  GLP+RL P
Sbjct  434   PQILVFLHNIVKRFKWDLMIPDEKIPY-DPMPAPSQGLPIRLRP  476



>ref|XP_002324668.2| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
 gb|EEF03233.2| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
Length=399

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 272/400 (68%), Gaps = 11/400 (3%)
 Frame = +2

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             G AGNKF F+NEN L+ TWWP+ V K      + + ++ +   R       KPE L+ YI
Sbjct  4     GVAGNKFLFSNENRLVETWWPEFVNKIFPSAVEKSPKEEAKRMRRLFPPFLKPEALRRYI  63

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
              T+D + K H A EW    EV V+ L+K YTF LAC+LFLSIE    + R   P   ++S
Sbjct  64    GTMDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHITS  123

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+F++P+ FPGT +NRA+K   ++R +L+ +I++RK +    + GK  +  +D+L  +L 
Sbjct  124   GIFTIPIAFPGTPFNRAIKATKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHMLL  179

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
               D  GQ++NE EI   II +LL  + S   A TF++K+LAE+PHIY+ VYKEQ EI KS
Sbjct  180   SNDANGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEIIKS  239

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT----  1210
             K P E L+W D+QKMKYSWNV CE LRL PP  G F+E + +FT+ GF IPKGWK     
Sbjct  240   KAPGELLNWVDIQKMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKASHFL  299

Query  1211  --FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
               +W+  STHKNP+YF+EPEKFDPSRFEG GPAP+TF+PFG GPRMCPG EYARLEILVF
Sbjct  300   TLYWSASSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVF  359

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             MHN+V  FK E+L+ DEKIV+ +  P P  GLPVRL PH+
Sbjct  360   MHNLVKRFKFERLVLDEKIVF-DPTPKPERGLPVRLLPHK  398



>ref|XP_002527982.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34394.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 297/449 (66%), Gaps = 19/449 (4%)
 Frame = +2

Query  179   PPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  340
             PPG+TGWP+IGE+++ +      +P+K+I+DR K+YS ++FKTS+LG+   + C A GNK
Sbjct  40    PPGTTGWPLIGETLEYLSTTKAGIPEKFINDRRKRYSSKLFKTSLLGQPTVLLCNADGNK  99

Query  341   ffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-RNNIHEIFKPENLKHYIPTIDS  517
             F F+NEN L+T+WWP SV K   F TQN  +   ++  R  +  + KP+ L+ Y+  +D+
Sbjct  100   FIFSNENKLVTSWWPSSVDK--FFDTQNASKTEESMKMRKFVTPVLKPDTLRKYVHIVDA  157

Query  518   MAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMFSL  697
             + ++H+ + W   + V+VY  +K  TF LAC+L L I+  + + +L  P    S+G+ SL
Sbjct  158   ITRQHLRDHWGGKQVVEVYPFAKDLTFVLACRLLLGIDDEEAISQLQKPFAHFSAGLLSL  217

Query  698   PLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTDEE  877
             PL+ PGT + RA+K    +R +   +IK  K +          ++ + +L + L   +EE
Sbjct  218   PLDLPGTNFRRAIKAAKQLRNEFEVMIKRWKTDT---------SQSQGILSQHLVEINEE  268

Query  878   GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNE  1057
             GQ  +E E+   I+ ++  +Y ++S A+TFV+K+LAE+P++Y  V +EQ+ IAK+K    
Sbjct  269   GQSTSESEMATRILALISASYDNVSTAMTFVIKYLAEMPNVYDAVLREQMGIAKAKEAEV  328

Query  1058  RLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYSTHK  1237
              L+W+D+QKM+YSWNV  E LRL PP  G FRE +  F YAG+ IPKGWK  WN ++THK
Sbjct  329   GLNWDDIQKMRYSWNVASEVLRLHPPANGAFREVIHNFMYAGYLIPKGWKLHWNAFATHK  388

Query  1238  NPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFKME  1417
             + +YF EPEKF+PSRFEG+G  P+++VPFG G  MCPGKEYAR+ +LV MHNVVTNFK+E
Sbjct  389   SAEYFPEPEKFEPSRFEGNGLVPYSYVPFGGGAHMCPGKEYARIAMLVLMHNVVTNFKLE  448

Query  1418  KLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K+ P+EK++       P  GLP+RL P  
Sbjct  449   KVFPNEKVI-GLPVLRPAKGLPLRLHPQH  476



>ref|XP_011017724.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 212/466 (45%), Positives = 303/466 (65%), Gaps = 18/466 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSI  295
             II    ++     NLPPGS+G P IGE+++++       P K+  DR+ KY  +VFKT++
Sbjct  21    IIVHKHRSKFKHSNLPPGSSGLPYIGETLEVLSTGWKGHPQKFFLDRIDKYESQVFKTNL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNR--NNIHE  469
               +   V CGA+GNKF F+ EN +L  W+P  V K  +FP+      I  ++R    + E
Sbjct  81    FCQTAVVLCGASGNKFMFSKENKVLKAWYPDFVCK--IFPSSAQRSPIEQVDRLRTLLPE  138

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               +PE LK Y+   D++A  H   EW   +EV V+ L+K  TF LAC+LFLSIE  D + 
Sbjct  139   FLRPEALKRYVGIFDTVAGRHFESEWEN-KEVVVFPLAKSLTFGLACRLFLSIEDPDHIA  197

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +L  P  +V SG+FS+P++ PGT  NRA+   + +R +L  +IK+RK +    + GK   
Sbjct  198   KLASPFNLVVSGIFSIPIDLPGTPLNRAITASNFIRTELFAIIKQRKKDL---AEGKAAR  254

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
             + +D+L  +L   D++G  ++E  I   I+ +L   + S SAA  F++K+LAELPHIY+ 
Sbjct  255   K-QDILSHMLLACDDKGAFMSELSIADTILALLASAHESTSAACAFIVKYLAELPHIYEG  313

Query  1010  VYKEQIEIAKSKGP-NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             VYKEQ+EI+++K P +E L+W D+QKMKYS  V+ E LRL P      RE + +F +  F
Sbjct  314   VYKEQMEISETKAPGDELLNWNDIQKMKYSRKVIREVLRLCPTFPN-VREAIHDFDFNCF  372

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
              IPKGWK +WN  STH+NP+YF EPE+FDPSRFEG+GPAP+TFVPFG GP MCPG ++AR
Sbjct  373   LIPKGWKVYWNANSTHRNPEYFPEPERFDPSRFEGNGPAPYTFVPFGGGPMMCPGHQFAR  432

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +E+LVF+HN+V  FK +K + +EKIV+ N  P P  G+P+RL PH+
Sbjct  433   IEMLVFIHNLVKRFKFDKFVAEEKIVF-NPMPIPEKGVPIRLFPHR  477



>ref|XP_008385453.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Malus domestica]
Length=502

 Score =   407 bits (1047),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 212/463 (46%), Positives = 301/463 (65%), Gaps = 22/463 (5%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE+++ +      VP+ ++ DR+ +Y      S +VFKTS+L + +AV 
Sbjct  41    LPPGSTGWPIIGETLEYLRTAKKGVPEMFMLDRINRYLSSAGNSCKVFKTSLLLQDMAVL  100

Query  320   CGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNN--IHEIFKPENLK  493
             C A GNKF F+NE  L+ +WWP  + K ++  ++ TL      NR    +    KP  L+
Sbjct  101   CTAGGNKFLFSNEEKLVKSWWPAHLDKIIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  160

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              Y+ T+DS+ K+++   W    +VKV+  +K Y FTLACKL L +E    + +L   +  
Sbjct  161   QYVGTMDSVTKKYLVTFWDHKDQVKVHQHAKKYAFTLACKLMLDVEDPQVLDKLEGLLKD  220

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE-AMMSSSGKVENEGR--DV  844
             +SSG  +LP++ PGT +NRA++G + +R ++ +++ ER+ + +  S++  V+ +G   D+
Sbjct  221   LSSGFTALPIDLPGTTFNRAIRGSTQLREEIEKIVVERRIKLSTASANSMVDEDGDHGDM  280

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L  LL  T  +GQ ++E EI   + G+++  Y ++S+ +  ++ +LAE P +Y  V KEQ
Sbjct  281   LSSLLMETYSDGQQISESEIADKLYGVIVAGYDNLSSVLATIIMYLAEFPQVYDAVLKEQ  340

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             +EIA SK   E L+W DVQKMKYSW+V CE +RL PP  G FRE  + F Y G  IPKG 
Sbjct  341   MEIANSKAAGELLNWGDVQKMKYSWSVSCEVMRLLPPNLGTFREATTNFVYEGHLIPKGM  400

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             K  WNV STHKNP+ F  PEKFDPSRFEG GP PF FVPFG GPRMCPGKEY+RL+ILVF
Sbjct  401   KLHWNVNSTHKNPECFPNPEKFDPSRFEGKGPPPFAFVPFGGGPRMCPGKEYSRLKILVF  460

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAP--SPVNGLPVRLTPHQK  1507
             MHNVVT +K +K+ PDEK ++   AP   P  GLP++L PH K
Sbjct  461   MHNVVTKYKWDKVFPDEKFIW---APVLRPTKGLPIKLFPHNK  500



>emb|CDO98601.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 299/478 (63%), Gaps = 51/478 (11%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
              LPPGS GWP+IGE+++ +   P+K++ DRMKKYSP++FKT ILGEK AV CG  G+KF 
Sbjct  14    KLPPGSFGWPIIGETMEFLFGKPEKFVGDRMKKYSPDIFKTKILGEKTAVICGPNGHKFL  73

Query  347   ftnentllttWWPQSVIKPLMFPTQNTLRKIST---------------------LNRNNI  463
             F+NE  L T + P         PTQ   R   T                       +  I
Sbjct  74    FSNEQKLFTAFRPH--------PTQRLFRSYQTKAGAGATLPPRPPPSTPVAADQRKPRI  125

Query  464   HE---------IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKL  616
              E           KPE L  ++  I+S+ +  +        EVKV+ L+K  T T++CK 
Sbjct  126   DEETKVIRQPGFLKPEALARFLGKIESITRHLLQTHLEGKDEVKVFPLAKTVTLTISCKF  185

Query  617   FLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE  796
             FL  +  + + RL+D    V+ GM S+ +NFPGT +NRA +  + +R++L++VIKE+K E
Sbjct  186   FLGTDNPERIARLVDHFDDVTVGMHSIMVNFPGTIFNRANQAAAAIRKELLDVIKEKK-E  244

Query  797   AMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLK  976
             AM  ++GK     +D+L  ++ +TD  G+ + E EI   I+G++   Y +++  ITF++K
Sbjct  245   AM--AAGK---PMQDILSHMIVVTDATGKRMPEAEIADKIMGLITAGYSTVATTITFLMK  299

Query  977   FLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRE  1156
             ++ E P IY ++  EQ+EIA SK P E L WED+QKMKYSW V+CE +RL PP QG FRE
Sbjct  300   YVGERPDIYSKIRAEQMEIAASKKPGEFLEWEDMQKMKYSWTVICETMRLTPPLQGTFRE  359

Query  1157  TVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRF----EGSGPAPFTFVPF  1324
              +++FTYAG+TIPKGWK +W V +T+ NP YF +PEKFDPSR+    EG G A +T+VPF
Sbjct  360   VLTDFTYAGYTIPKGWKVYWTVSTTNMNPAYFKDPEKFDPSRYDSSGEGRGVAAYTYVPF  419

Query  1325  GSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             G GPR+CPGKEYARL IL F+HNVV N+K E L PDEKI   +  P+P  GLP+RL P
Sbjct  420   GGGPRLCPGKEYARLAILAFVHNVVKNYKWEVLFPDEKIT-GDMMPTPEKGLPIRLQP  476



>ref|XP_009337414.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=524

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 300/461 (65%), Gaps = 18/461 (4%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE+++ +      VP+ ++ DR+ KY      S +VFKTS+L + +AV 
Sbjct  63    LPPGSTGWPIIGETLEYLSTGKKGVPENFVLDRINKYLSSAGNSCKVFKTSLLLQDMAVL  122

Query  320   CGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNN--IHEIFKPENLK  493
             C A GNKF F+NE  L+ +WWP  + K ++  ++ TL      NR    +    KP  L+
Sbjct  123   CTAGGNKFLFSNEEKLVKSWWPAYLDKLIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  182

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              YI T+DS+ K+++   W    +VKV+  +K Y FTLACKL L  E    +  L   +  
Sbjct  183   KYIGTMDSVTKKYLVTYWDHKDQVKVHQHAKKYAFTLACKLMLDTEDPQLLGILQRLLKD  242

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE-AMMSSSGKVENEGR--DV  844
             +SSG  +LP++ PGT +NRA++    +R ++ +++ ER+ + +  S++  V+ +G   D+
Sbjct  243   LSSGFTALPIDLPGTTFNRAIRASRQLREEIEKIVVERRIKLSTASANSMVDKDGDHGDM  302

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L  LL  T  +G+ + E EI   + G+++  +  +S+A+T ++ +LAELP +Y  V+KEQ
Sbjct  303   LSSLLMETYSDGKQITESEIADKLYGVIVAGHDGLSSALTTIMMYLAELPQVYDTVFKEQ  362

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
             +EIA SK   E L+W DVQKMKYSW+V CEA+RL PP  G FRE  ++F Y G  IPKG 
Sbjct  363   MEIANSKAAEELLNWGDVQKMKYSWSVACEAMRLLPPSLGTFREATTDFVYEGHLIPKGM  422

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             K +W+ +STHKNP+ F  PEKFDPSRFEG GP PF FVPFG GPRMCPGKEYARL+ILVF
Sbjct  423   KLYWHPHSTHKNPECFPNPEKFDPSRFEGQGPPPFAFVPFGGGPRMCPGKEYARLKILVF  482

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             MHNVVT +K +K+ PDEK ++      P  GLP++L PH K
Sbjct  483   MHNVVTKYKWDKVFPDEKFIWTPVL-LPTKGLPIKLFPHNK  522



>ref|XP_007206798.1| hypothetical protein PRUPE_ppa025666mg [Prunus persica]
 gb|EMJ07997.1| hypothetical protein PRUPE_ppa025666mg [Prunus persica]
Length=524

 Score =   406 bits (1044),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 212/466 (45%), Positives = 302/466 (65%), Gaps = 33/466 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY---------SPEVFKTSILGEKV  310
             LPPGSTGWP+IGE+++ +      VP+K+I+DR  KY         + +VFKTS+L E +
Sbjct  40    LPPGSTGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSANCKVFKTSLLFEDM  99

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKI-------STLNRNNIHE  469
             AV C AAGNKF F+NE  L+ +WWP  + K L+F       K        ST  RN +  
Sbjct  100   AVLCTAAGNKFLFSNEKKLVKSWWPPHLDK-LIFADSAPDEKAKAFITEESTRFRNTMAP  158

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKCYTFTLACKLFLSIEGR  637
               KP  L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y FT+AC+L L  E +
Sbjct  159   YLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQVIKAHPLAKKYAFTMACRLMLDTEDQ  218

Query  638   DEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSG  817
                 +L + +  +SSG  SLP++ PGT +NRA++G   +R ++  ++ +R+      S+ 
Sbjct  219   QVFTKLENLMKDLSSGFTSLPIDLPGTQFNRAIRGSRQLREEIKNIVTQRRIHL---STR  275

Query  818   KVENE--GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
             KV+ +  G D+L  L+  T  +G  L++ EI   + G+++  Y + S+ +  ++ +LAEL
Sbjct  276   KVDEDVDGLDMLSSLIMDTGSDGLGLSDSEIASKLYGVIVSGYDNFSSTLATIVMYLAEL  335

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             PH+Y  V KEQ +IA+SK   E L+W D+QKMKYSW+V CE +RL PP  G FRE +S+F
Sbjct  336   PHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREAISDF  395

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPG  1351
              Y G+ IPKG K  WNV+STHKNP+YF +PEKFDPSRFEG GP P++FVPFG GPRMCPG
Sbjct  396   VYEGYLIPKGMKLNWNVHSTHKNPEYFPDPEKFDPSRFEGQGPPPYSFVPFGGGPRMCPG  455

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVR  1489
             KEY+RL++LVFMHNVVT ++ EK+ PDEK V++ A   P  GLP+R
Sbjct  456   KEYSRLKMLVFMHNVVTRYRWEKVFPDEKFVWDPAL-VPTKGLPIR  500



>ref|XP_008227237.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=510

 Score =   405 bits (1042),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 212/472 (45%), Positives = 303/472 (64%), Gaps = 33/472 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY---------SPEVFKTSILGEKV  310
             LPPGS GWP+IGE+++ +      VP+K+I+DR  KY         + +VFKTS+L E +
Sbjct  40    LPPGSPGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSANCKVFKTSLLFEDM  99

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKI-------STLNRNNIHE  469
             AV C AAGNKF F+NE  L+ +WWP  + K L+F      +K        ST  RN +  
Sbjct  100   AVLCTAAGNKFLFSNEKKLIKSWWPPHLDK-LIFADSAPDKKAKAFITEESTRFRNTMAP  158

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKCYTFTLACKLFLSIEGR  637
               KP  L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y  T+AC+L L  E +
Sbjct  159   YLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQGIKAHPLAKRYAVTMACRLMLDTEDQ  218

Query  638   DEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSG  817
                 +L +    +SSG  SLP++ PGT +NRA++G   +R ++  ++ +R+      S+ 
Sbjct  219   QVFNKLENLTKDLSSGFTSLPIDLPGTQFNRAIRGSRQLREEIKNIVTQRRIHL---STR  275

Query  818   KVENE--GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
             KV+ +  G D+L  L+  T  +GQ L++ EI   + G+++  Y + S+ +  ++  LAEL
Sbjct  276   KVDEDVDGLDILSSLIMDTSSDGQGLSDSEIASKLYGVIVSGYDTFSSTLAAIVMCLAEL  335

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             PH+Y  V KEQ +IA+SK   E L+W D+QKMKYSW+V CE +RL PP  G FRE  S+F
Sbjct  336   PHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREATSDF  395

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPG  1351
              Y G+ IPKG K  W+V+STHKNP++F +PEKFDPSRF+G GP P++FVPFG GPRMCPG
Sbjct  396   VYEGYLIPKGMKLKWSVHSTHKNPEHFPDPEKFDPSRFDGQGPPPYSFVPFGGGPRMCPG  455

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             KEY+RL++LVFMHNVVT ++ EK+ PDEK V+N A  S   GLP+R+ PH K
Sbjct  456   KEYSRLKMLVFMHNVVTRYRWEKVFPDEKFVWNPALVS-TKGLPIRVFPHNK  506



>ref|XP_011048168.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=497

 Score =   403 bits (1036),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/465 (45%), Positives = 297/465 (64%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSK----PNLPPGSTGWPVIGESIDLMV----PDKYISDRMKKYSPEVFKT  289
             ++YF+ K    +    P+LPPGS GWP++GE++  +     P+ +++ RMKKY   VFKT
Sbjct  35    LLYFVIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  94

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE  469
             S+ GE VAVF G AGNKF F+NEN L+  WWP SV K +     N +   +   R  +  
Sbjct  95    SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSVKKLMRLSLANVVGDKAKRLRKILMT  154

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
                 + LK YI  +D +A+ HI   W    +VKV+  +  YTF L+C+LF SI+    + 
Sbjct  155   SVDRDALKSYIDRMDLVAQNHIRTHWEGKEQVKVHPTANLYTFELSCRLFASIDDPIHIS  214

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +L     I   G+   P+  PGT + RA K G  ++ ++  V ++R+A    + + K+E+
Sbjct  215   KLAHHFDIFLKGVIHFPIYIPGTTFYRASKSGDALKEEIRLVARQRRA----ALNKKMES  270

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  LL   DE G+ L+E EI   ++ +L  ++ + ++A+T V+K+LAE+P +Y+ 
Sbjct  271   HRKDLLSHLLVTADESGKLLSESEIVDNMLMLLFVSHETTTSAMTCVMKYLAEMPEVYEM  330

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V +EQ++IAKSK   E L WED+QKMKYSW VV E LR+ PP  G FR+ + +FTYAG+T
Sbjct  331   VLREQLDIAKSKEAGELLKWEDIQKMKYSWRVVSEVLRMIPPISGTFRQAIVDFTYAGYT  390

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  +T K+P +F   E FDPSR+EG GPAP+T VPFG GPRMC G EY R 
Sbjct  391   IPKGWKLYWSPNTTTKDPAHFPNAEDFDPSRYEGEGPAPYTHVPFGGGPRMCLGYEYVRP  450

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +ILVF+HN+V  FK + L+PDEK+ Y N  P+P NGLP+R+ PHQ
Sbjct  451   KILVFLHNIVKRFKWDLLIPDEKVPY-NPLPAPSNGLPIRIQPHQ  494



>ref|XP_009758679.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=476

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 299/459 (65%), Gaps = 16/459 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + +++K  LPPGS GWPVIGE+ID +   P+K++SDRMKKYSP++F T I+GEK AV CG
Sbjct  25    RLSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSDRMKKYSPDIFMTKIMGEKTAVICG  84

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL----NRNNIHE--IFKPEN  487
               G+KF F+NE  L T +   S+ K       N+    S       R  I +    KPE 
Sbjct  85    PNGHKFLFSNEEKLFTAFRTHSMQKLFQSYQSNSSSSPSPSPSQSTRVMIRQPGFLKPEA  144

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L  Y+  +D + +E +   W    E+K Y  +K  T TLAC+ FL     + + +L++  
Sbjct  145   LTRYLGEMDLITQELLQSHWEGKNEIKTYPFAKFLTLTLACRFFLGTNNSERITKLVNYF  204

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               ++ G+ ++ LNFPGTA+ RA K    VRR+L+ VIKE+K E  M++  K++    D+L
Sbjct  205   DDITLGLHAMLLNFPGTAFYRANKAAIAVRRELIGVIKEKKEE--MANGVKMQ----DIL  258

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               ++ +TD +G+ + E EI   I+G+L+  Y +++  ITF++K++ +   IY+++  EQ 
Sbjct  259   CHMIVVTDSKGKFMPENEIADKIMGLLVAGYSTVATTITFLMKYVGQRSDIYEKILIEQK  318

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA +K   E L WED+QKMKYSWNV+CE +RL PP QG FR+ +++FTYAG++IPKGWK
Sbjct  319   EIAGAKKAGEVLEWEDMQKMKYSWNVICETMRLTPPLQGTFRQVLTDFTYAGYSIPKGWK  378

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSG-PAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
              +W   ST+KNP YF +PE+FDPSR+E    P P+T+VPFG GPRMCPGKEYARL IL F
Sbjct  379   VYWTASSTNKNPAYFQDPEEFDPSRYEKRDEPTPYTYVPFGGGPRMCPGKEYARLAILTF  438

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             +HNVV  +K E L PDEK+V  +  P+P  GLP+RL  H
Sbjct  439   LHNVVMKYKWELLAPDEKVV-GDMMPTPEKGLPIRLHQH  476



>emb|CDP14240.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   397 bits (1020),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 253/344 (74%), Gaps = 5/344 (1%)
 Frame = +2

Query  473   FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKR  652
              KPE L+ YI  +D +A  H +  W    +VKV+ L K YTF +A +LF+S+E   EV +
Sbjct  6     LKPEALQRYIGIMDHIAGRHFSSGWENKDQVKVFPLCKNYTFWIASRLFVSVEEPTEVAK  65

Query  653   LLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENE  832
             LL+P  +++SG+ S+P++ PGT +NRA+K  + +R+ LV +IK+RK +   S +   +  
Sbjct  66    LLEPFNVLASGLISVPIDLPGTPFNRAVKASNQIRKMLVALIKQRKVDLAESKASPTQ--  123

Query  833   GRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQV  1012
               D++  +L ++DE G+ ++E ++   I+G+L+  + + S+A TFV+KFLAELP IY+ V
Sbjct  124   --DIMSHMLTISDENGKFMHELDVADKILGLLIGGHDTASSACTFVIKFLAELPEIYEGV  181

Query  1013  YKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTI  1192
             YKEQ+EI KSK P E L+W+D+QKMKYSWNV CE LRL PP QG FRE +++F Y GF+I
Sbjct  182   YKEQMEIVKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALADFMYNGFSI  241

Query  1193  PKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLE  1372
             PKGWK +W+  +TH+NP+ F EP+KFDP+RFEGSGPAP+TFVPFG GPRMCPGKEYARLE
Sbjct  242   PKGWKIYWSANTTHRNPECFPEPQKFDPARFEGSGPAPYTFVPFGGGPRMCPGKEYARLE  301

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ILVF+H+VV  F+ EK++PDEKIV  +  P P  GLPVRL PH+
Sbjct  302   ILVFIHHVVKRFRWEKIIPDEKIVV-DPMPIPAKGLPVRLFPHK  344



>gb|KCW87056.1| hypothetical protein EUGRSUZ_B03598 [Eucalyptus grandis]
Length=485

 Score =   402 bits (1032),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 196/457 (43%), Positives = 286/457 (63%), Gaps = 11/457 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFKTSILGEKVA  313
             K  TS+P+LPPGS GWPV+GES++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  29    KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  88

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             V CG AGNKF F+NE   +  WWP SV + +              +R  +   F PE L 
Sbjct  89    VLCGPAGNKFLFSNEGKKVALWWPSSVRRLIGTSLITKAGDEGRSDRKMLMSFFNPEALM  148

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              ++ T+D + + H+  +W    +V+ Y   K YTF LAC+LF+SI     V RL     +
Sbjct  149   RFVGTMDEVTRHHLRTQWQGKDQVEAYPTLKLYTFELACRLFMSITDPQLVTRLAHHFEV  208

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
                G+ SLPL+FPGT ++RA +    +R++L  ++++R+ E       K+    +DV+  
Sbjct  209   FLKGLISLPLDFPGTRFHRARRATDSIRKELRALVRQRRVEL----EQKLARPSQDVMSH  264

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             LL   DE G+ + E EI + ++ +L   + + S+ +  +LK+L+ELPH+  ++  EQ EI
Sbjct  265   LLANGDENGKLMPEAEIINNMLNLLFAGHDTSSSTLMLLLKYLSELPHVLDKILAEQREI  324

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
             A SK P E L W+D+Q+MKYSWNV+CE +R+ PP  G FRE V +FT+ G+T+PKGWK +
Sbjct  325   AASKAPGELLQWDDLQRMKYSWNVICEVMRMTPPVGGSFREAVVDFTFEGYTVPKGWKLY  384

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHN  1393
             W+   TH++  +      FD SRFEGSGP P++FVPFG GPRMC GKE+AR+E+LVF+HN
Sbjct  385   WSAAVTHEDLNFHPRAASFDESRFEGSGPLPYSFVPFGGGPRMCLGKEFARVEMLVFLHN  444

Query  1394  VVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +V  F  +  +P+EKI+Y +  P+PV GLPVRL P Q
Sbjct  445   LVNLFDWDTAIPNEKIIY-DPMPTPVKGLPVRLRPRQ  480



>ref|XP_010052577.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW76647.1| hypothetical protein EUGRSUZ_D01027 [Eucalyptus grandis]
Length=471

 Score =   401 bits (1031),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 291/452 (64%), Gaps = 26/452 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP+IGE+++ +   PDK++ DRM KYSP++FKT ILGE  AV CG +G+KF 
Sbjct  33    NLPPGSFGWPIIGETVEFLFGKPDKFVFDRMAKYSPDIFKTRILGEDTAVICGPSGHKFL  92

Query  347   ftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE--------IFKPENLKHYI  502
             F+NE    T   P+S+        Q   R          HE          KPE L  Y+
Sbjct  93    FSNEERYFTASRPRSM--------QMIFRSYKKAAPPAKHEEKVLRSPGFLKPEALVRYL  144

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +DS+ K+ +  EW   REV+VY L+K  T TLAC+ F+  +  + + RL+D    ++ 
Sbjct  145   GKMDSITKQQMQSEWEGKREVRVYPLAKSLTLTLACRFFIGTDEPERIARLVDYFDDITL  204

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ S+ LN PGT + +A K  + +R++L  VI+++KA     S+G      +D+L  ++ 
Sbjct  205   GLHSITLNIPGTIFYKANKAAAAIRKELRAVIRDKKAAI---STG---TPMQDILSHMIV  258

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
              +D  G+++ E EI   I+G L   Y +++ A+TF +K++ E P IY++V  EQ+E+A S
Sbjct  259   ASDPSGKYMPEAEIADKIMGFLTAGYSTVATAMTFFMKYVGERPDIYKKVLDEQLEVAAS  318

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K P E L W+D+ KMKYSWNV+ E +RL PP QG FRE +++FTYAG+TIPKGWK +W V
Sbjct  319   KKPGEFLEWDDINKMKYSWNVLNEVMRLTPPLQGTFREALTDFTYAGYTIPKGWKVYWTV  378

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGP-APFTFVPFGSGPRMCPGKEYARLEILVFMHNVV  1399
              +T+KNP+YF EPEKFDPSR + S    PFTFVPFG GPR+CPGKEYARL IL F+HNVV
Sbjct  379   STTNKNPEYFPEPEKFDPSRHDDSNTFPPFTFVPFGGGPRLCPGKEYARLAILAFVHNVV  438

Query  1400  TNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLT  1495
               FK E + P EKI+  +  P+P  GLPVRL+
Sbjct  439   KRFKWELVDPKEKII-GDMMPAPQKGLPVRLS  469



>ref|XP_003532790.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=481

 Score =   401 bits (1031),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 205/464 (44%), Positives = 284/464 (61%), Gaps = 15/464 (3%)
 Frame = +2

Query  137   IYFITK----ANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFK  286
             +YFITK          NLPPG  GWP++GE+ D M         ++I +R++KY   VFK
Sbjct  20    LYFITKVVRLGKHPNLNLPPGRLGWPIVGETFDFMRTMNEGNVLRFIQERVEKYDARVFK  79

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH  466
             TS+ G+ V VFCG AGNKF F+NEN  +  WWP SV K L     N +   + + R  + 
Sbjct  80    TSMFGDPVVVFCGPAGNKFLFSNENKNVQVWWPSSVRKLLRLSLVNKVGDEAKMVRRLLM  139

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                  E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIE  D +
Sbjct  140   SFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVFVYPIVQLYTFELACCLFLSIEDSDHI  199

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +L         GM   PLN PGT ++RAMK    +R+++  ++K+RK +       K  
Sbjct  200   SKLSLKFDEFLKGMIGFPLNIPGTRFHRAMKAADAIRKEIRMILKKRKVDL----EEKRA  255

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  +L  +D  G+   E EI   I+ +L   + +  + ++ V+K+L +LPH+++
Sbjct  256   SATQDLLSHMLVTSDPSGRFTTEMEIIDNILLLLFAGHDTSRSVLSLVMKYLGQLPHVFE  315

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              V KEQ+EI++ K   + L  EDVQKMKYSWNV  E +RL PP  G +RE   +FTYA +
Sbjct  316   HVLKEQLEISQGKEAGQLLQLEDVQKMKYSWNVASEVMRLSPPVSGAYREAKEDFTYADY  375

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
              IPKGWK  WN  S+HK+P  F+ PE FD SRFEG+GP PF++VPFG GPRMC G+E+AR
Sbjct  376   NIPKGWKLHWNTGSSHKDPALFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGQEFAR  435

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LEILVFMHN+V  FK + ++PDEK  Y+     PV GL +RL P
Sbjct  436   LEILVFMHNIVKRFKWDLVIPDEKFKYDPML-EPVEGLAIRLHP  478



>ref|XP_008385452.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Malus domestica]
Length=503

 Score =   402 bits (1032),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 297/464 (64%), Gaps = 23/464 (5%)
 Frame = +2

Query  176   LPPGSTGWPVIGESIDLM------VPDKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE+++ +      VP+ ++ DR+ KY      S +VFKTS+L + +AV 
Sbjct  41    LPPGSTGWPIIGETLEYLSTAKKGVPENFVLDRINKYLSSAGNSCKVFKTSLLLQDMAVL  100

Query  320   CGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNN--IHEIFKPENLK  493
             C A GNKF F+NE  L+ +WWP  + K ++  ++ TL      NR    +    KP  L+
Sbjct  101   CTAGGNKFLFSNEEKLVKSWWPAYLDKLIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  160

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              YI T+DS+ K+++        +VKV+  +K Y FTLACKL L  E    + +L   +  
Sbjct  161   KYIGTMDSVTKKYLVTYCDHKDQVKVHQHAKKYAFTLACKLMLDTEDPQLLGKLQRLLKD  220

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
             +SSG  +LP++ PGT +NRA++G   +R ++ +++ ER+ +   +S+  + +E  D    
Sbjct  221   LSSGFTALPIDLPGTTFNRAIRGSRQLREEIEKIVVERRIKLSTASANSMVDEDGDHGDM  280

Query  854   LLNLTDEE----GQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             L +L  EE    G+ + E EI   + G+++  + S+S+A+T ++ +LAELP +Y  V KE
Sbjct  281   LSSLLMEETYSDGKQITESEIADKLYGVIVAGHDSLSSALTTIMMYLAELPQVYDAVLKE  340

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+EIA SK   E L+W DVQKMKYSW+V CE +RL PP  G FRE  + F Y G  IPKG
Sbjct  341   QMEIANSKAAGELLNWGDVQKMKYSWSVSCEVMRLLPPNLGTFREATTNFVYEGHLIPKG  400

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
              K  WNV STHKNP+ F  PEKFDPSRFEG GP PF FVPFG GPRMCPGKEY+RL+ILV
Sbjct  401   MKLHWNVNSTHKNPECFPNPEKFDPSRFEGKGPPPFAFVPFGGGPRMCPGKEYSRLKILV  460

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAP--SPVNGLPVRLTPHQK  1507
             FMHNVVT +K +K+ PDEK ++   AP   P  GLP++L PH K
Sbjct  461   FMHNVVTKYKWDKVFPDEKFIW---APVLRPTKGLPIKLFPHNK  501



>ref|XP_010044931.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=509

 Score =   402 bits (1033),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 196/457 (43%), Positives = 286/457 (63%), Gaps = 11/457 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFKTSILGEKVA  313
             K  TS+P+LPPGS GWPV+GES++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  53    KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  112

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             V CG AGNKF F+NE   +  WWP SV + +              +R  +   F PE L 
Sbjct  113   VLCGPAGNKFLFSNEGKKVALWWPSSVRRLIGTSLITKAGDEGRSDRKMLMSFFNPEALM  172

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              ++ T+D + + H+  +W    +V+ Y   K YTF LAC+LF+SI     V RL     +
Sbjct  173   RFVGTMDEVTRHHLRTQWQGKDQVEAYPTLKLYTFELACRLFMSITDPQLVTRLAHHFEV  232

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
                G+ SLPL+FPGT ++RA +    +R++L  ++++R+ E       K+    +DV+  
Sbjct  233   FLKGLISLPLDFPGTRFHRARRATDSIRKELRALVRQRRVEL----EQKLARPSQDVMSH  288

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             LL   DE G+ + E EI + ++ +L   + + S+ +  +LK+L+ELPH+  ++  EQ EI
Sbjct  289   LLANGDENGKLMPEAEIINNMLNLLFAGHDTSSSTLMLLLKYLSELPHVLDKILAEQREI  348

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
             A SK P E L W+D+Q+MKYSWNV+CE +R+ PP  G FRE V +FT+ G+T+PKGWK +
Sbjct  349   AASKAPGELLQWDDLQRMKYSWNVICEVMRMTPPVGGSFREAVVDFTFEGYTVPKGWKLY  408

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHN  1393
             W+   TH++  +      FD SRFEGSGP P++FVPFG GPRMC GKE+AR+E+LVF+HN
Sbjct  409   WSAAVTHEDLNFHPRAASFDESRFEGSGPLPYSFVPFGGGPRMCLGKEFARVEMLVFLHN  468

Query  1394  VVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +V  F  +  +P+EKI+Y +  P+PV GLPVRL P Q
Sbjct  469   LVNLFDWDTAIPNEKIIY-DPMPTPVKGLPVRLRPRQ  504



>ref|XP_009364167.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=415

 Score =   399 bits (1024),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 200/414 (48%), Positives = 280/414 (68%), Gaps = 9/414 (2%)
 Frame = +2

Query  269   SPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLR--KIS  442
             S ++FKTS+ G++ A F GAAGNKF F+NEN L+  WWP  V K  +FPT   +   K +
Sbjct  6     SSQIFKTSLFGKQAAFFYGAAGNKFLFSNENRLVNVWWPDHVNK--IFPTSADVSATKEA  63

Query  443   TLNRNNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFL  622
                +  I    KPE LK YI  +D++ ++H A  W   ++V V+ L+K YT  +A +LFL
Sbjct  64    IKLKKLIPNFMKPEALKRYIGIMDAITQKHFANSWENKQQVHVFPLAKNYTLAIAARLFL  123

Query  623   SIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAM  802
             S+E + ++ +L   + + ++G+ S+P++FPGT   +A+K   ++   L E+IK+RKA+  
Sbjct  124   SLEDQKDIDKLGHYLYLANAGVISMPIDFPGTPLRKAIKASKLINGMLTEIIKQRKADL-  182

Query  803   MSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFL  982
               ++GK  +  +D+L  +L   DE+G ++ E +I   I+G+L+  Y +  A  T ++KFL
Sbjct  183   --ANGKA-SPTQDILSHMLMTCDEDGTYMKELDISTKIMGLLIGGYEATGAVCTLIVKFL  239

Query  983   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETV  1162
             AELPHIY  VYKEQ+EIA SK   E L+W+D+QKMKYSWNV  E +RL PP QG FRE  
Sbjct  240   AELPHIYDAVYKEQMEIANSKALGELLNWDDIQKMKYSWNVAQEVMRLTPPIQGSFREAT  299

Query  1163  SEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRM  1342
             ++F + G+TIP GW  +W+  +THK+  YF EP+KFDPSRFEG+GPAP T+VPFG GP M
Sbjct  300   TDFVFNGYTIPNGWILYWSSITTHKSADYFQEPDKFDPSRFEGTGPAPCTYVPFGGGPMM  359

Query  1343  CPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             CPGKEYAR+EILVFMHN+V  FK E+L+P EKIV +  A  P  GLP+RL PH 
Sbjct  360   CPGKEYARMEILVFMHNLVKRFKCERLLPQEKIVMDPLA-MPAKGLPIRLFPHN  412



>gb|KDP42301.1| hypothetical protein JCGZ_01625 [Jatropha curcas]
Length=350

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = +2

Query  452   RNNIHEIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIE  631
             R  + +  KPE L+ YI  +D++A+ H A +W    +V V++L+K YTF +AC+LF+SIE
Sbjct  4     RKLLPQFLKPEALQRYIGIMDTIAQRHFASDWENKEQVNVFSLAKKYTFWVACRLFVSIE  63

Query  632   GRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSS  811
                 + +  DP  +++SG+FS+P++ PGT ++RA+K    +R++L  +IK+RK E    +
Sbjct  64    DPHHIAKFADPFNVLASGIFSVPIDLPGTPFHRAIKASKFIRKELFSIIKKRKVEL---A  120

Query  812   SGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
              GK     +D+L  +L   DE G+++NE +I   I+G+L+  + + S+A T ++K LAEL
Sbjct  121   EGKAST-SQDILSHMLTTCDENGKYMNEMDIADKILGLLIGGHDTASSACTSIVKCLAEL  179

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             PHIY  VY+EQI+IAKSKG  E L+W+D+QKMKYSWNV CE +RLFPP +G FRE + +F
Sbjct  180   PHIYDGVYQEQIDIAKSKGEGELLNWKDIQKMKYSWNVACEVMRLFPPLRGAFREAIDDF  239

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPG  1351
              + GF++PKGWK +W   STHK+ +YF EPEKFDPSRFEG GPAP+TFVPFG GPRMCPG
Sbjct  240   IFNGFSVPKGWKVYWCANSTHKSGEYFPEPEKFDPSRFEGDGPAPYTFVPFGGGPRMCPG  299

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             KEYARLEILVFMHN++  F+  K+ PDEKI+  +  P P  GLPV L PH 
Sbjct  300   KEYARLEILVFMHNLIKRFRFHKIFPDEKIIV-DPMPMPAKGLPVYLHPHN  349



>ref|XP_002299097.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
 gb|EEE83902.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
Length=483

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/465 (44%), Positives = 297/465 (64%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSK----PNLPPGSTGWPVIGESIDLMV----PDKYISDRMKKYSPEVFKT  289
             ++YF  K    +    P+LPPGS GWP++GE++  +     P+ +++ RMKKY   VFKT
Sbjct  21    LLYFAIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  80

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE  469
             S+ GE VAVF G AGNKF F+NEN L+  WWP SV K +     N +   +   R  +  
Sbjct  81    SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSVKKLMKLSLANVVGDEAKRLRKILMT  140

Query  470   IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
                 + LK YI  +D +A+ HI   W   ++VKV+  +  YTF L+C+LF SI+    + 
Sbjct  141   SVDRDALKSYIDRMDLVAQNHIRTRWEGKQQVKVHPTANLYTFELSCRLFASIDDPIHIS  200

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             +L     I   G+   P+  PGT + RA K G  ++ ++  V ++R+A    +   K+E+
Sbjct  201   KLAHHFDIFLKGVIHFPIYIPGTTFYRASKSGDALKEEIRLVARQRRA----ALDKKMES  256

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
               +D+L  LL   DE G+ L+E EI   ++ +L  ++ + ++A+T V+K+LAE+P +Y+ 
Sbjct  257   HRKDLLSHLLVTADESGKLLSESEIVDNMLMLLFVSHETTTSAMTCVIKYLAEMPEVYEM  316

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V +EQ++IAKSK   E L WED+QKMKYSW VV E LR+ PP  G FR+ + +FTYAG+T
Sbjct  317   VLREQLDIAKSKEAGELLKWEDIQKMKYSWRVVSEVLRMIPPISGTFRQAIVDFTYAGYT  376

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             IPKGWK +W+  +T K+P +F   E FDPSR+EG+GPAP+T VPFG GPRMC G EY R 
Sbjct  377   IPKGWKLYWSPNTTTKDPAHFPNAEDFDPSRYEGAGPAPYTHVPFGGGPRMCLGYEYVRP  436

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +ILVF+HN+V  FK + L+PDEK+ Y N  P+P +GLP+R+ PHQ
Sbjct  437   KILVFLHNIVKRFKWDLLIPDEKVPY-NPLPAPSHGLPIRIRPHQ  480



>ref|XP_006405735.1| hypothetical protein EUTSA_v10027740mg [Eutrema salsugineum]
 gb|ESQ47188.1| hypothetical protein EUTSA_v10027740mg [Eutrema salsugineum]
Length=475

 Score =   400 bits (1028),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/458 (44%), Positives = 295/458 (64%), Gaps = 16/458 (3%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEV--FKTSILGEKV  310
             ++ S PNLPPG+ G+P IGES   +       P+K+I+DR+ ++S  V  FKT I G   
Sbjct  26    SHFSYPNLPPGNAGFPFIGESFSFLSAGRKGHPEKFITDRVHRFSSSVGIFKTHIFGTPT  85

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AV  GA+GNKF FTNEN L+ +WWP+SV K      +  + + S   R  +    KPE L
Sbjct  86    AVVMGASGNKFLFTNENKLVVSWWPESVKKIFPSTVKMNINEGSKKLRTLVTPFLKPEAL  145

Query  491   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPII  670
             + Y+  +D +A  H   EWA   ++ V+ L+K +TF++AC+L LS++  + V++L +P  
Sbjct  146   RRYVGIMDEIASRHFETEWANQDQLIVFPLTKKFTFSIACRLLLSMDDPERVRKLEEPFR  205

Query  671   IVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLG  850
             +V  GMFS+P++ PGT ++RA+K   ++R++++ +++ RK E + +     E+   D+L 
Sbjct  206   MVIVGMFSVPIDLPGTRFSRAIKASRLIRKEVIAIMRMRKEE-LKARKASAEH---DILS  261

Query  851   RLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIE  1030
              LL    E        ++   IIG+L+  Y + S   TFV+ +LAE PH+Y+ V +EQ E
Sbjct  262   HLLMSIGETKDE----DVADKIIGLLVGGYDTASIVCTFVVHYLAEYPHVYEHVLQEQKE  317

Query  1031  IAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             I K K   E L WED++KM++SWNV CE +R+ PP  G FRE +  F++ GF IPKGWK 
Sbjct  318   ILKGKQEKEGLRWEDIEKMRFSWNVACEVMRMVPPISGTFREAIDHFSFKGFYIPKGWKL  377

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
             +W+  +THKNP YF EPEKF+P+RFEGSGP P+T+VPFG GP+MCPGKEYARLEIL+F+H
Sbjct  378   YWSANATHKNPDYFPEPEKFEPNRFEGSGPRPYTYVPFGGGPKMCPGKEYARLEILIFIH  437

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             ++V  FK EK+ P E  +  +  P P  GLP+R+ P  
Sbjct  438   HLVKRFKWEKVFPKETKIVFDPLPVPAKGLPIRIFPQS  475



>ref|XP_003531282.1| PREDICTED: cytochrome P450 716B2-like isoformX1 [Glycine max]
Length=481

 Score =   400 bits (1028),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/464 (44%), Positives = 289/464 (62%), Gaps = 15/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKP----NLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFK  286
             ++FITKA+  +     NLPPG  G P++GE+++ +         ++I +R++KY   VFK
Sbjct  20    LHFITKADRLRKHPNLNLPPGRLGCPIVGETLEFLRTMNEGNVLRFIQERVEKYDARVFK  79

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH  466
             TS+ G+ V VFCG AGNKF F+NEN  +  WWP SV K L     N +   + + R  + 
Sbjct  80    TSMFGDPVVVFCGPAGNKFLFSNENKNVQVWWPSSVRKLLRLSLVNKVGDEAKMVRRLLM  139

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                  E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIE  D +
Sbjct  140   SFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVLVYPIVQLYTFELACCLFLSIEDSDHI  199

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +L         G+  LPLN PGT ++RAMK   ++R ++  ++K+RK +       K  
Sbjct  200   SKLSLKFDEFLKGIIGLPLNIPGTRFHRAMKAADVIRNEIEMILKKRKVDL----EEKRA  255

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  +L  +D  G+ + E EI   I+ +L   + S  + ++ V+K+L +LP +Y+
Sbjct  256   SPTQDLLSHMLVTSDPNGRFMTEMEIIDNILLLLFAGHDSSRSVLSLVMKYLGQLPQVYE  315

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              V KEQ+EI++ K   + L WEDVQKMKYSWNV  E +RL PP  G +RE + +FTY  +
Sbjct  316   HVLKEQLEISQGKEAGQLLQWEDVQKMKYSWNVASEVMRLSPPVSGAYREAIKDFTYGDY  375

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
              IPKGWK  WN  S+H++P  F+ PE FD SRFEG+GP PF++VPFG GPRMC G+E+AR
Sbjct  376   NIPKGWKLHWNTGSSHEDPALFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGQEFAR  435

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LEILVFMHN+V  FK + ++PDEK  Y+     PV GL +RL P
Sbjct  436   LEILVFMHNIVKRFKWDLVIPDEKFKYDPLL-EPVKGLAIRLHP  478



>ref|XP_007159554.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
 gb|ESW31548.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
Length=478

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 284/461 (62%), Gaps = 12/461 (3%)
 Frame = +2

Query  137   IYFITK-ANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFKTSI  295
             ++FIT+       NLPPG  GWP++GE+ + M         +++ +R++KY   VFKTS+
Sbjct  20    LHFITRRVRLRNLNLPPGRLGWPIVGETFEFMHAMLEGNVLRFLKERVEKYDSRVFKTSM  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
              G+ VAVFCG AGNKF F+NEN  +  WWP SV K L     N +   + + R  +    
Sbjct  80    FGDPVAVFCGPAGNKFLFSNENKNVQVWWPSSVKKLLRLSLVNKVGDEAKMVRKLLMNFL  139

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
               E LK+Y+P +D +A+ HI   W    +V V+   K YTF LAC LFLSIE  D++ +L
Sbjct  140   NAETLKNYLPKMDRIAQHHIDTYWKGKEQVFVHPTVKLYTFELACCLFLSIEDSDQISKL  199

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
                      G+    LN PGT ++RAMK    +R+++  ++++RK +       K  +  
Sbjct  200   SLKFNAFLKGIIGFTLNIPGTRFHRAMKAADEIRKEIKMILEKRKGDL----EEKRASPT  255

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  +L  +D  G+ + E EI    + +L   + +  + ++ V+K+L +LPH+Y+ V 
Sbjct  256   QDLLSHMLVTSDPSGRFMTEMEILDNTLLLLFAGHDTARSVLSLVMKYLGQLPHVYEHVL  315

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EI + K   + L WED+QKMKYSWNVV E +RL PP  G +RE + +FTYA + IP
Sbjct  316   KEQLEIIQGKEVGQLLQWEDIQKMKYSWNVVSEVMRLSPPVSGAYREAIKDFTYADYNIP  375

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK  WN  S+H +P  F+ PE FD SRFEGSGP PF+ VPFG GPRMC G+EYARLEI
Sbjct  376   KGWKLHWNTGSSHNDPTIFSNPETFDASRFEGSGPTPFSHVPFGGGPRMCLGQEYARLEI  435

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LVFMHN+V  FK E ++PDEK+ Y+     PV GL VRL P
Sbjct  436   LVFMHNIVKRFKWELVIPDEKLKYDPML-EPVKGLAVRLHP  475



>ref|XP_004504209.1| PREDICTED: cytochrome P450 716B1-like [Cicer arietinum]
Length=479

 Score =   399 bits (1026),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 202/462 (44%), Positives = 286/462 (62%), Gaps = 12/462 (3%)
 Frame = +2

Query  140   YFITK-ANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFKTSIL  298
             +FIT+     K NLP GS GWP+IGE+ + +         ++I +RMKKY   VFKTS+ 
Sbjct  21    HFITRIVKLKKLNLPLGSLGWPIIGETFEFVKASVEGKQIRFIEERMKKYDKRVFKTSMF  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             GE +AVFCG  GNKF F+NEN  +  WWP SV + L     N +   + + R  +     
Sbjct  81    GEHIAVFCGPLGNKFLFSNENKNVQVWWPSSVKRLLRLSIVNKVGDEAKVTRKLLMSFLN  140

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLS+E   +V  L 
Sbjct  141   PETLRNYLPKMDSIARHHINTHWKGNEQVVVYPIIQLYTFELACSLFLSMEDPIQVSNLS  200

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
                     G+    +NFPGT ++++MK  +++R ++  ++K+RK +       K  +  +
Sbjct  201   PHFDEFLKGIIGFSINFPGTTFHKSMKAANIIREEIKMIMKKRKVDL----EEKKASPTQ  256

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  LL  +D  G+ LNE EI   I+ +L   + +  + ++ V+K+L +LP +Y+QV K
Sbjct  257   DLLSHLLVTSDTNGKFLNEVEIIDNILLLLFAGHDTSRSVLSSVMKYLGQLPEVYEQVLK  316

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+EI       E L WED+QKMK+SWNV  E +RL PP  G +R+ + +FTYA + IP 
Sbjct  317   EQLEIXXXXXXXELLQWEDIQKMKFSWNVASEVMRLAPPVGGAYRKAIKDFTYADYNIPN  376

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
              WK  WN ++TH +P  FT PEKFD SRFEG GP P+++VPFG GPRMC G+E+ARLEIL
Sbjct  377   EWKLHWNTHTTHMDPTLFTNPEKFDASRFEGEGPTPYSYVPFGGGPRMCLGQEFARLEIL  436

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VFMHN+V  FK + ++P EK  Y+     P NGLP+RL PHQ
Sbjct  437   VFMHNMVKRFKWDLVIPHEKFKYDPML-EPENGLPIRLQPHQ  477



>ref|XP_006852240.1| hypothetical protein AMTR_s00049p00153870 [Amborella trichopoda]
 gb|ERN13707.1| hypothetical protein AMTR_s00049p00153870 [Amborella trichopoda]
Length=485

 Score =   399 bits (1026),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 210/460 (46%), Positives = 289/460 (63%), Gaps = 9/460 (2%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV----PDKYISDRMKKYSPEVFKTSILGEK  307
             ++ TK     P LPPG+ GWP+IGE++  +      + +I  RM+KY  +VF+T ILG  
Sbjct  29    WWRTKHPGEGPKLPPGTGGWPLIGETLPYLALTGSGENFIVKRMRKYRTQVFRTHILGSP  88

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPEN  487
             +AVFCGAAGNKF F+NEN +L   WP SV K        T    +   R  +     PE 
Sbjct  89    MAVFCGAAGNKFIFSNENRVLVNAWPASVAKLFGRSVITTTGDEAKRVRKVLMAFLSPEA  148

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L  ++  +DS A+ H+   W    EVKVY++ K YTF+LAC LF SIE  +   +L    
Sbjct  149   LHEFVGQMDSAARLHLKRYWDGKAEVKVYSMLKVYTFSLACSLFASIESEERKAQLSAFF  208

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
              +   GM  + L  PGT Y +A K    +RR+L + + +RK EA+ + +    N  +D++
Sbjct  209   NVFLKGMMQMDLKIPGTRYYKAKKAVDALRRELRKEVDDRK-EALRAGTA---NPKQDLM  264

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   D+ G+H+++ E+   II +L   + + S+ +  VLK LAE P+ Y ++  EQ 
Sbjct  265   SYLLTTADDSGKHMSDEEVVDNIINLLFAGHDTSSSTLLMVLKHLAEKPYYYNEILNEQR  324

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EI KSKG  E L+WED++KMKY+WNVVCE +R+ P   G FR  +++F YAGF IPKGW+
Sbjct  325   EIEKSKGKEEVLNWEDLKKMKYTWNVVCEVMRVSPAVAGAFRLAITDFDYAGFRIPKGWR  384

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
               WNV++TH   +YF EPEKFDPSRFEG GP P+TFVPFG GPRMCPG E+AR+E+LVF+
Sbjct  385   LHWNVHTTHMMEEYFPEPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGLEFARVEMLVFL  444

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQK  1507
             HN+V N+K E + P+EKI + +  P   NGLPV L PHQK
Sbjct  445   HNLVKNYKWELVFPNEKI-HMDPMPVAENGLPVHLHPHQK  483



>ref|XP_004293194.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   400 bits (1027),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 300/467 (64%), Gaps = 26/467 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP-------------EVFKTSI  295
              LPPGSTGWP+IGE+++ +      VP+K+I+DR KKYS              +VFKT +
Sbjct  36    QLPPGSTGWPIIGETLEYLSTARDGVPEKFIADRRKKYSDASASSAAATEGSCKVFKTLL  95

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE +A+ C AAGNKF F+NEN L+ TWWP    K     T+    K++  NR  I    
Sbjct  96    LGEPMAMLCTAAGNKFLFSNENKLVKTWWPAIFQKLFTDSTKLEYSKVTIHNRKAIFPFL  155

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFRE---VKVYALSKCYTFTLACKLFLSIEGRDEV  646
             KP+ ++ +I  +D + KEH  + W+   +   +K ++L K YT  L+ +LFL++E    +
Sbjct  156   KPDAVRKHIGVMDQVTKEHFGKHWSLQDQKQVIKFHSLVKKYTLALSSRLFLNLEDPQVI  215

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAM---MSSSG  817
              +L + I  ++ G+ SLP++ PGT +NRA++    +++++  ++ +RK + M   M    
Sbjct  216   AKLQESIRHINEGLVSLPVDLPGTNFNRAIRASRKMKKEIDSMVAQRKNDLMNLNMIDRE  275

Query  818   KVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPH  997
             ++EN  +D++   L  T  +GQ L E EI  Y+ GI+L  + +I   +   +  L++LP 
Sbjct  276   QLENAPQDLMSSFLLETRSDGQELTEEEISKYLCGIMLAGFDAIINTLCATVIVLSQLPE  335

Query  998   IYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTY  1177
             +Y  V KEQ+EIA+SK   E L+W DV+KMKY+WNVVCE LRL PP  G FRE +++F Y
Sbjct  336   VYDAVLKEQMEIAESKDEGELLNWGDVRKMKYTWNVVCEVLRLQPPTGGTFREAMTDFVY  395

Query  1178  AGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKE  1357
              G+ IPKG K  WNV++THKNP+YF +P KFDPSRFEG GP P+++VPFG GPRMCPGKE
Sbjct  396   EGYLIPKGMKIHWNVHATHKNPEYFPDPHKFDPSRFEGHGPPPYSYVPFGGGPRMCPGKE  455

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             +AR EILVF+HN+VT FK E + PDEK+V  +  P P  GLP+ + P
Sbjct  456   HARYEILVFLHNLVTRFKWEMVFPDEKMVV-DPVPFPSKGLPLHVFP  501



>ref|XP_004299475.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   400 bits (1027),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 209/468 (45%), Positives = 303/468 (65%), Gaps = 26/468 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP---------EVFKTSILGEK  307
              LPPGS+GWP+IGE +  +      VP+K+I DR  K+S          +VF TS+L E 
Sbjct  41    QLPPGSSGWPIIGEGLAFLMTAKRGVPEKFIGDRRIKFSSSSHSKSSICKVFTTSLLRES  100

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPEN  487
             VAV C AAGNKF F+NEN L+ +WWP+++        +    + S   R  +   F P  
Sbjct  101   VAVLCTAAGNKFLFSNENKLVHSWWPENIYTIFAGSDRPESHEESIRLRKVLSPFFSPNC  160

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L+ Y+  +D+  K H+   W+  ++VKV AL+K +TF L CK+FL++E    + +L +PI
Sbjct  161   LQKYVGIMDAFTKRHLDVFWSDKKQVKVLALTKMHTFALVCKIFLNVEDPSVIAKLEEPI  220

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE-----AMMSSSGKVENE  832
               +++G  +LP+N PGTA+NRA+K    VR+ L E++++R+ +        ++S   EN 
Sbjct  221   QHIAAGFIALPINLPGTAFNRAIKASMQVRKDLEEMVQQRRIDLDRFRQTATASDVNENS  280

Query  833   G-RDVLGRLLNLTDEEGQHLNE---FEIYHYIIGILLPTYHSISAAITFVLKFLAELPHI  1000
               +D++ +LL  T  +G+ + E    +I + + G+L+  Y ++   +  ++ +L+EL  +
Sbjct  281   NYQDLMSKLLMDTYSDGRQMKETDIADIANKLNGLLIAAYDNVFITLCSIVMYLSELSTV  340

Query  1001  YQQVYKEQIEIAKS-KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTY  1177
             Y  V KEQ+EIA S K   E L+W D+QKMKY+WNVVCE LRL PP  G FRE +S+F Y
Sbjct  341   YDAVLKEQMEIASSSKAEGELLNWGDIQKMKYTWNVVCEVLRLEPPNPGTFREAMSDFVY  400

Query  1178  AGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKE  1357
              G+ IPKG K +W+V+STHK+P+YF +P+KFDPSRF+G GPAP+++VPFG GPRMCPG+E
Sbjct  401   EGYLIPKGMKLYWSVFSTHKDPEYFPDPKKFDPSRFDGGGPAPYSYVPFGGGPRMCPGRE  460

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             YARL ILVFMHN++T F+ EK+ PDEK+V       P  GLPVRL PH
Sbjct  461   YARLTILVFMHNLITRFRWEKVFPDEKMVMTPFL-LPTKGLPVRLYPH  507



>ref|XP_009617496.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   399 bits (1024),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 293/459 (64%), Gaps = 11/459 (2%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKV  310
             T+  T   NLPPGS GWPVIGE+ + +       P+K+++DR++KY  ++FKT I+GEKV
Sbjct  25    TRNRTKTLNLPPGSYGWPVIGETPEFLRSRRDGSPEKFVTDRIEKYQSQIFKTCIVGEKV  84

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AV CG AGNKF F NEN L+  WWP SV + L         + + L R  +     P+  
Sbjct  85    AVLCGPAGNKFLFGNENKLVNVWWPSSVRQLLGSCLSTISGEEAKLMRKMLTYFVSPDAF  144

Query  491   -KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
              K YI T++   ++HI   W    E+KV+   K +TF LAC+LF+S+E  + +  L +  
Sbjct  145   SKLYIKTMELSTQQHIKNYWQGKEELKVFPTIKLHTFELACRLFMSLEDTNRISNLFNLF  204

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
              I   G+ SL LNFPGT +  A K  + +R++LV ++++R+ EA+      +    +D+L
Sbjct  205   NIFLKGVLSLALNFPGTRFYHAKKATNSIRKELVLIVQQRR-EAL--EQKLLVCPPQDLL  261

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   DE G+ ++E E+ + I+ +L   + + S  IT V+K+L ELPH+Y +V +EQ 
Sbjct  262   SHLLLFPDENGKFMSELELANNILLLLFAGHDTTSVTITLVMKYLGELPHVYDKVLQEQK  321

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA  KG  E L+W+D+QKMKY+W+VV E LRL  P  G FRE +    Y G+ IPKGWK
Sbjct  322   EIASLKGGREYLNWDDMQKMKYTWDVVSEVLRLTSPITGSFREALVNLDYQGYIIPKGWK  381

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
              +WN   TH +PK+F   + FDPSRFEG+GP PF++VPFG GPRMC GKE+ARLEILVF+
Sbjct  382   LYWNGAVTHMDPKFFLNTKNFDPSRFEGAGPTPFSYVPFGGGPRMCLGKEFARLEILVFI  441

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             HNVV +F+ + L+P EKI Y +  P+P+ GLPV L PH 
Sbjct  442   HNVVKDFRWKLLIPTEKIEY-DPMPTPIEGLPVLLQPHN  479



>ref|XP_009598096.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   398 bits (1023),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 300/460 (65%), Gaps = 17/460 (4%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + +++K  LPPGS GWPVIGE+ID +   P+K++S+RMKKYSP++FKT I+GEK AV CG
Sbjct  25    RRSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSNRMKKYSPDIFKTKIMGEKTAVICG  84

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEI-------FKPE  484
               G+KF F+NE  L T++   S+ +       N+    S+ + +    +        KPE
Sbjct  85    PNGHKFLFSNEEKLFTSFRTHSMQRIFQSYQSNSPSPSSSPSPSQSTRVIIRQPGFLKPE  144

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L  Y+  +D + +E +   W    E+K Y  +K  T TLAC+ FL     D + +L++ 
Sbjct  145   ALTRYLGEMDLITQELLKSHWEGRNEIKTYPFAKFLTLTLACRFFLGTNNTDRITKLVNY  204

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
                ++ G+ ++ LNF GTA+ RA K    VRR+L+ VIKE+K E  M++  K++    D+
Sbjct  205   FDDITLGLHAMILNFRGTAFYRANKAAFAVRRELIGVIKEKKEE--MANGVKMQ----DI  258

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L  ++ +TD +G+ + E EI   I+G+L+  Y +++  ITF++K++ +   IY+++  EQ
Sbjct  259   LCYMIVVTDSKGKFMPENEIADKIMGLLVAGYSTVATTITFLMKYVGQRSDIYEKILIEQ  318

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
              EI  +K P E L+WED+ KMKYSWNV+CE +RL PP QG FR+ +++FTYAG++IPKGW
Sbjct  319   KEIVAAKKPGEVLTWEDMLKMKYSWNVICETMRLTPPLQGTFRQVLTDFTYAGYSIPKGW  378

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSG-PAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             K +W   ST+KNP YF  PE+FDPSR+E    P P+T+VPFG GPRMCPGKEYARL IL 
Sbjct  379   KVYWTASSTNKNPAYFQNPEQFDPSRYEKRDEPTPYTYVPFGGGPRMCPGKEYARLAILT  438

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             F+HNVV  +K E L PDEK+V  +  P+P  GLP+RL  H
Sbjct  439   FLHNVVLKYKWELLAPDEKVV-GDMMPTPEKGLPIRLHQH  477



>ref|XP_007213882.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
 gb|EMJ15081.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
Length=471

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/468 (46%), Positives = 283/468 (60%), Gaps = 28/468 (6%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GE+++ +   P+ ++S RM++YSPE+FKT ILGEK 
Sbjct  19    IFAVKGKSDDGKNLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE-------  469
             AV CG  G+KF F+NE    T + P S+        Q   R          H+       
Sbjct  79    AVICGPNGHKFLFSNEQKYCTAFRPHSM--------QKMFRSYKAPAAQPAHDEEAKVLR  130

Query  470   ---IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRD  640
                  KPE L  Y+  +DS+ +E +   W    EVKVY L+K  T  LAC+ FL I+   
Sbjct  131   SPGFLKPEALVRYLGIMDSITQEQMKAYWEGKDEVKVYPLAKTLTLGLACRFFLGIDEPG  190

Query  641   EVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGK  820
              + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI E+KA   M+S   
Sbjct  191   RIARFVSYFDDVTLGMHSLILNFPGTTFYKATKAADALRRELKTVIPEKKAA--MASGAS  248

Query  821   VENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHI  1000
             + N    VL  +L  TD+ G+H+ E EI   I+G+L   Y +++ A+TF +K + E P I
Sbjct  249   MHN----VLSHMLEATDQTGKHMPEAEIADKIMGLLTAGYSTVATAMTFFMKHVGERPDI  304

Query  1001  YQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYA  1180
             Y +V  E  EIA SK P E L WED+ KMKYSWNV+ E +R  PP QG FRE +++FTYA
Sbjct  305   YAKVLAEHKEIAYSKKPGEFLEWEDINKMKYSWNVMYEVMRFTPPLQGTFREALTDFTYA  364

Query  1181  GFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCPGKE  1357
             G+TIPKGWK +W V +T+ NP+YF  PEKFDPSR++     P FTFVPFG GPRMCPGKE
Sbjct  365   GYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLSTFPAFTFVPFGGGPRMCPGKE  424

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             YAR+ IL F+HNVV  FK E L P EKI   +  P+P  GLPVRL  H
Sbjct  425   YARIAILTFVHNVVMRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLIRH  471



>ref|XP_010044930.1| PREDICTED: cytochrome P450 716B1-like [Eucalyptus grandis]
 gb|KCW87054.1| hypothetical protein EUGRSUZ_B03596 [Eucalyptus grandis]
Length=475

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/457 (44%), Positives = 284/457 (62%), Gaps = 11/457 (2%)
 Frame = +2

Query  146   ITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEK  307
             + K  T++ NLPPGS GWP+IGES++ +       P+K+I DRM KY   VFKTS+LGE 
Sbjct  22    LLKLKTARRNLPPGSFGWPIIGESLEFLRCQRGGHPEKFIQDRMSKYDSPVFKTSVLGEP  81

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPEN  487
             +A+ CG AGNKF F+NE   +  WWP SV K L     +     +  ++  +   F PE 
Sbjct  82    IAILCGPAGNKFLFSNEGKKVALWWPSSVEKVLGRCLVSKAGHEARSDKKMLMSFFNPEA  141

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L   +  ID M K H+   W    +++ Y++ K +TF LAC+ F++I     V RL D  
Sbjct  142   LMRSVGVIDEMTKAHLRTHWEGKDQLEAYSILKQHTFDLACRQFMAITDPQLVSRLADHF  201

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
              +   G+  LPLN PGT + R+ K    +R++L  ++K+R+AE       K  +  +D++
Sbjct  202   HVFLRGVVDLPLNVPGTNFYRSKKAADSIRKELRVLVKQRRAEL----EKKTASPSQDII  257

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   DE G+ + E EI + ++ +L   + + ++ + F++K+L+ELPH+ ++V  EQ 
Sbjct  258   THLLANGDENGKLMPEAEIINNVLSLLFAGHDTSTSTLVFIIKYLSELPHVLEKVVAEQR  317

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK   E L W D+QKM+YSWNV+ E +R+  P  G FRE + EFTY G+TIPKGWK
Sbjct  318   EIAASKARGELLHWGDLQKMRYSWNVISEVMRMTAPVYGAFREALVEFTYEGYTIPKGWK  377

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
               W+  STH++P Y+     FD SRFEGSGPAP+T+VPFG GPRMC G E+AR E+LVF+
Sbjct  378   LHWSACSTHRDPDYYPRSLTFDESRFEGSGPAPYTYVPFGGGPRMCLGLEFARAELLVFL  437

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             HN+V  F+   + PDEKI+Y +  P P  GLP+RL P
Sbjct  438   HNLVDGFQWSLVHPDEKIIY-HLMPIPAKGLPIRLRP  473



>emb|CDP19706.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 285/459 (62%), Gaps = 57/459 (12%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVA  313
             +   ++ + K  LPPGS+G+P++GE++  ++  P+K+I  RM+KYS EVF TS++G+ +A
Sbjct  22    FLCHRSKSKKSKLPPGSSGFPLVGETLHFLMSGPEKFIHQRMEKYSDEVFATSLMGQNLA  81

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMF------PTQNTLRKISTLNRNNIHEIF  475
             V CGAAGNKF     N  ++ W P S+   LMF      P ++     S +   +   I 
Sbjct  82    VICGAAGNKFLLCTANDFVSPWLPDSL---LMFLNWVESPGKSRKDLFSKIRGFHQAVIM  138

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             +PE LK YIP +DS+ ++H+  +W PF  VKV+  S+  T  LACKL L ++        
Sbjct  139   RPEALKQYIPIMDSLTRQHLQTDWDPFHVVKVHPASQKITLILACKLLLEVDK-------  191

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
                                             ++++ +++I ERK   + +     E  G
Sbjct  192   --------------------------------LKQEFLKIILERKKMVLENR----EKAG  215

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              DVL R   L DE    L++ E   Y++ +++PTY S SA+ITFVLK LAELPHIY  VY
Sbjct  216   SDVLSR--TLLDENAHLLSDLEFAVYLVSLMIPTYESGSASITFVLKHLAELPHIYDMVY  273

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KE +EIAKSK P E L+WEDV+KMKYSWNVVCEA+RL PP  G FRE  ++  +AG TIP
Sbjct  274   KEHMEIAKSKDPEELLNWEDVKKMKYSWNVVCEAMRLAPPATGAFREVETDIHFAGVTIP  333

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
             KGWK  W+ ++T+KNPKYF EPE FDP+RFEG GP   TF+PF +GPRMCPGK+Y+R  I
Sbjct  334   KGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDGPTSCTFIPFSTGPRMCPGKDYSRFLI  393

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             LV+M+NVV  FK++KL+PDEK++Y    P P +GLP+ +
Sbjct  394   LVYMYNVVRKFKLKKLIPDEKVLY-RVGPYPASGLPISV  431



>ref|XP_011085174.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=480

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 299/471 (63%), Gaps = 22/471 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I++  ++ + S PNLPPG+ GWP+IGE+I+ +   P+ ++ DRMKKYSP++FKT ILGEK
Sbjct  17    ILFITSRRSASDPNLPPGTFGWPIIGETIEFLFGKPENFVGDRMKKYSPDIFKTKILGEK  76

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQN---------TLRKISTLNRNN  460
              AV CG  G+KF F+NE+   T + P   ++ L    QN           +  S+     
Sbjct  77    TAVICGPNGHKFLFSNEHKYFTAFRPHP-MQHLFRSYQNKAAAASLAPPSQTQSSDEAKA  135

Query  461   IHE--IFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
             I +    KPE L  ++  +D + ++ + E  A    V+VY L+K  T +LAC+ FL I  
Sbjct  136   IRQPGFLKPEALMRFLAKMDVVTQQQLQEHCAGKSVVEVYPLAKTITLSLACQFFLGINN  195

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
              + + RL+     V+ GM S+ LN PGT + RA K  + +R++L+ VI E+K    M+S 
Sbjct  196   PERIARLVKYFDDVTVGMHSIMLNVPGTIFYRANKAAAAIRKELLSVITEKKQG--MASG  253

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
               ++    D+L  ++ + D  G+ + E EI   I+G+L   Y +++  ITF++K++ +  
Sbjct  254   APLQ----DILSHMIAIRDSSGKSMPEAEIADKIMGLLTAGYSTVATTITFLMKYVGQSS  309

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY++V  EQ+EIA SK   E L WED+ KMKYSWNV+CE +R+ PP QG FRE ++E +
Sbjct  310   EIYEKVRAEQMEIAASKEAGELLGWEDMAKMKYSWNVICETMRMVPPLQGTFREVLTEIS  369

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRF-EGSGPAPFTFVPFGSGPRMCPG  1351
             YAG+TIPKGWK +W V +T+KNP+YF EPE F+PSR+ EG  P P+T+VPFG GPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNKNPEYFREPETFNPSRYDEGEAPPPYTYVPFGGGPRMCPG  429

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             KEYARL IL F+HNVV N+K E + P+EK V  +  P P  GLP+RL  H 
Sbjct  430   KEYARLAILAFLHNVVKNYKWEVIDPNEK-VEGDMMPEPQKGLPIRLYHHH  479



>ref|XP_002317072.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
 gb|EEE97684.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
Length=482

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 295/464 (64%), Gaps = 17/464 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE++D +   P+K++SDRMK+YS ++FKT ILGE+ 
Sbjct  21    IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPL-----MFPTQNTLRKISTLNRNNIHEIF  475
             AV CG  G+KF F+NE  L T + P ++ K         P Q      S + R+      
Sbjct  81    AVICGPGGHKFLFSNEQKLFTAFRPHAMQKIFRSYQAAAPAQIPREAESKILRSP--GFL  138

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L  Y+  +DS+ + H+   W    EVK +AL+K  T +LAC+ FL  +  + + RL
Sbjct  139   KPEALVRYLGKMDSITQLHMQTCWEGKDEVKAFALAKTLTLSLACRFFLGSDDPERIARL  198

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
             +     ++ GM S+PLN  GT + RA K  + +R++L  +I E++A+  MS   +V+   
Sbjct  199   VSNFDDMTLGMHSIPLNVYGTTFYRANKAAAAIRKELRIIIDEKRAD--MSKGAQVQ---  253

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  ++  TD  G+H+ E EI   I+G+L+  Y +++ A+TF +K + E P IY ++ 
Sbjct  254   -DILCHMILATDPSGKHMAEAEIADKIMGLLVAGYSTVATAMTFFMKNVGERPDIYAKIL  312

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQIE+A  K   E L W D+QKMKYSWNV+ E +RL PP QG FRE +++FTYAG+TIP
Sbjct  313   AEQIEVAADKKAGELLDWNDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFTYAGYTIP  372

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGP-APFTFVPFGSGPRMCPGKEYARLE  1372
             KGWK +W V +T+K+P+YF +PEKFDPSR++      PFTFVPFG GPRMCPGKEYARL 
Sbjct  373   KGWKIYWTVSTTNKDPEYFPDPEKFDPSRYDDEKVFPPFTFVPFGGGPRMCPGKEYARLA  432

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             IL F+HNVV  F+ E   P EKIV  +  P+P  GLP+RL   Q
Sbjct  433   ILTFVHNVVKRFRWEVAFPAEKIV-GDMMPTPEKGLPIRLRSRQ  475



>ref|XP_011089169.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=479

 Score =   397 bits (1019),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/450 (45%), Positives = 295/450 (66%), Gaps = 12/450 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPGS GWP++GE+++ +       P+K+I +R +KY  +VFKTS++GE + + CGAAG
Sbjct  33    NLPPGSYGWPILGETVEFLRAGLEGTPEKFIKERSEKYKSQVFKTSLMGEPMVMLCGAAG  92

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL-KHYIPTI  511
             NKF F+NEN L+T WWP SV + L      +        R  +     P+   + YI T+
Sbjct  93    NKFLFSNENKLVTVWWPSSVRQLLGHCLATSSGDEGKQMRKMVSYFVSPDAFTRLYIRTM  152

Query  512   DSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMF  691
             D ++++HI   W    EVK+    K YTF LAC+LF+S+E ++++ +L+    +   G+ 
Sbjct  153   DLVSQQHIKTHWQGKEEVKISPTIKLYTFELACRLFMSLEDQEQISKLVTLFNVFLKGII  212

Query  692   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTD  871
             S+P+NFPGT + +A +  S ++ QL +++++R+A    +   +     +D+L  LL   D
Sbjct  213   SVPVNFPGTRFYKAKRATSAIKSQLQKIVRQRRA----ALEQRTAVPSQDLLSHLLVAPD  268

Query  872   EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1051
             E G+ ++E  I + I+ +L   + + S AIT ++K LA+LP IY++V +EQ EIA SK  
Sbjct  269   ENGKFMSEPVIVNNILMLLFAGHDTSSVAITMLMKNLAQLPDIYEKVLREQNEIASSKEA  328

Query  1052  NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYST  1231
              E L WEDVQKMKYSWNVVCE  R+ PP  G FRE +++ TYAG+ IPKGWK +W+   T
Sbjct  329   GEFLQWEDVQKMKYSWNVVCEVARISPPIIGAFREALADITYAGYHIPKGWKLYWSSSFT  388

Query  1232  HKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFK  1411
             H++  +F +   FDPSRFEG+GPAPF++VPFG GPRMC GKE+ARLEIL+F+HNV+  ++
Sbjct  389   HRDASWFPDYPNFDPSRFEGAGPAPFSYVPFGGGPRMCLGKEFARLEILIFLHNVIRRYR  448

Query  1412  MEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
                 +PDEKI Y +  P+PV GLPV+L  H
Sbjct  449   WNLQIPDEKIAY-DPMPTPVEGLPVQLHSH  477



>ref|XP_004306884.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   397 bits (1021),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 209/467 (45%), Positives = 299/467 (64%), Gaps = 26/467 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP-------------EVFKTSI  295
              LPPGSTGWP+IGE+++ +      VP+K+I+DR KKYS              +VFKT +
Sbjct  36    QLPPGSTGWPIIGETLEYLRTARNGVPEKFIADRRKKYSDVSVPSAAATEGSCKVFKTLL  95

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
             LGE +A+ C AAGNKF F+NEN L+ TWWP    K  +  T+    K++  NR  I    
Sbjct  96    LGEPMAMLCTAAGNKFLFSNENKLVKTWWPAIFQKLFIDSTKLEYSKVTIHNRKAIFPFL  155

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKV---YALSKCYTFTLACKLFLSIEGRDEV  646
             KP+ ++ +I  +D + K+H  + W+   + +V   ++L K YT  L+ +LFL++E    +
Sbjct  156   KPDAVRKHIGVMDQVTKDHFGKHWSLQDQKQVSKFHSLVKKYTLALSSRLFLNLEDPQVI  215

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAM---MSSSG  817
              +L + I  VS G+ SLP++ PGT +NRA++    +++++  ++ +RK + M   M    
Sbjct  216   AKLEESIRHVSEGLVSLPIDLPGTNFNRAIRASRKMKKEIDSMVAQRKNDLMNLNMIDRE  275

Query  818   KVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPH  997
             ++EN  +D++   L  T  +GQ L E EI  Y+ GI+L  + +I   +   +  L++ P 
Sbjct  276   QLENAPQDLMSSFLLETRFDGQELTEEEISKYLCGIMLAGFDNIINTLCATVIVLSQFPE  335

Query  998   IYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTY  1177
             +Y  V KEQ+EIA+SK   E L+W DV+KMKY+WNVVCE LRL PP  G FRE +++F Y
Sbjct  336   VYDAVLKEQMEIAESKDEGELLNWGDVRKMKYTWNVVCEVLRLHPPIGGTFREAMTDFVY  395

Query  1178  AGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKE  1357
              G  IPKG K  WNVY+THKNP+YF +P KFDPSRFEG GP P+++VPFG GPRMCPGKE
Sbjct  396   EGHLIPKGMKIHWNVYATHKNPEYFPDPHKFDPSRFEGHGPPPYSYVPFGGGPRMCPGKE  455

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             +AR EILVF+HN+VT FK E + PDEK+V  +  P P  GLP+ + P
Sbjct  456   HARYEILVFLHNLVTRFKWEMVFPDEKMVV-DPVPLPSKGLPLHVFP  501



>ref|XP_011040561.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=482

 Score =   397 bits (1019),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/464 (45%), Positives = 295/464 (64%), Gaps = 17/464 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE++D +   P+K++SDRMK+YS ++FKT ILGE+ 
Sbjct  21    IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPL-----MFPTQNTLRKISTLNRNNIHEIF  475
             AV CG  G+KF F+NE  L T + P ++ K         P Q      S + R+      
Sbjct  81    AVICGPRGHKFLFSNELKLFTAFRPHAMQKIFRSYQAAAPAQIPREAESKILRSP--GFL  138

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             KPE L  Y+  +DS+ + H+   W    EVK +AL+K  T +LAC+ FL  +  + + RL
Sbjct  139   KPEALVRYLGKMDSITQLHMQTYWEGKDEVKAFALAKTLTLSLACRFFLGSDDPERIARL  198

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
             +     ++ GM S+PLN  GT + RA K  + +R++L  +I E++A   MS   +V+   
Sbjct  199   VSNFDDMTLGMHSIPLNVYGTTFYRANKAAAAIRKELRIIIDEKRAA--MSKGTQVQ---  253

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
              D+L  ++  TD  G+H+ E EI   I+G+L+  Y +++ A+TF +K + E P IY ++ 
Sbjct  254   -DILSHMILATDPSGKHMAEAEIADKIMGLLVAGYSTVATAMTFFMKNVGERPDIYAKIL  312

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
              EQIE+A  K   E L W+D+QKMKYSWNV+ E +RL PP QG FRE +++FTYAG+TIP
Sbjct  313   AEQIEVAADKKAGELLGWDDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFTYAGYTIP  372

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGP-APFTFVPFGSGPRMCPGKEYARLE  1372
             KGWK +W+V +T+K+P+YF +PEKFDPSR++      PFTFVPFG GPRMCPGKEYARL 
Sbjct  373   KGWKIYWSVSTTNKDPQYFPDPEKFDPSRYDDEKAFPPFTFVPFGGGPRMCPGKEYARLA  432

Query  1373  ILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             IL F+HNVV  F+ E   P EKI   +  P+P  GLP+RL   Q
Sbjct  433   ILTFVHNVVKRFRWEVAFPAEKIA-GDMMPTPEKGLPIRLQSRQ  475



>ref|XP_003633047.1| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=475

 Score =   396 bits (1018),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 208/464 (45%), Positives = 286/464 (62%), Gaps = 17/464 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K+      LPPGS GWP++GE+++ +   P+ ++ DRMKKYSP++FKT ILGEK
Sbjct  21    IFAFTRKSGDDDKKLPPGSLGWPIMGETLEFLFGKPENFVFDRMKKYSPDIFKTKILGEK  80

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE---IFK  478
               V CG  G+KF F+NE    T + P S+ K          ++I+      I       K
Sbjct  81    TVVICGPEGHKFLFSNEAKYFTAFRPHSMQKIFRSYQAAAPKQIARDAEAKIIRAPGFLK  140

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L HY+  +DS+ ++ +   W    EVKV+  +K  T TLAC+ FL I+  + + RL+
Sbjct  141   PEALIHYLGKMDSITQQQLQAHWEGKTEVKVFPFAKTLTLTLACRFFLGIDDPERIARLV  200

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
                  ++ GM S+PL  PGT + +A K  + +R++L  +IKE+KA AM +         +
Sbjct  201   TNFDDITLGMHSIPLRIPGTIFYQASKAAAAIRKELFTIIKEKKA-AMATG-----QPMQ  254

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  ++   D  G+ + E EI   I+G+L   Y +++ AI F++  + E P IY ++  
Sbjct  255   DILSHMIVAADPTGRFMPEAEIADKIMGLLTAGYSTVATAIAFLI--VGERPDIYNKILA  312

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ EIA SK P + LSW+D+ KMKYSWN V E +R  PP QG FR  +  FTYAG+TIPK
Sbjct  313   EQWEIAASKQPGDFLSWDDMHKMKYSWNTVYEVMRFTPPLQGTFRTVLEGFTYAGYTIPK  372

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFE---GSGPAPFTFVPFGSGPRMCPGKEYARL  1369
             GWK +W V +T+KNP YF +PEKFDP+R+E   GS P PF FVPFG G RMCPGKEYAR 
Sbjct  373   GWKVYWTVSTTNKNPAYFRDPEKFDPTRYEERNGSSPPPFAFVPFGGGQRMCPGKEYARF  432

Query  1370  EILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              IL F+HNVV  +K E L+PDEKIV  +  P+P  GLP+RL PH
Sbjct  433   AILTFLHNVVKRYKWEVLLPDEKIV-GDMMPTPQKGLPIRLQPH  475



>ref|XP_004293684.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   396 bits (1017),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 290/453 (64%), Gaps = 17/453 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GE+++ +   P+ ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29    NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  347   ftnentllttWWPQSVIKPLM-FPTQNTLRKISTLNRNNIHEIFK------PENLKHYIP  505
             F+NE    T + P S+ K    +           + R+   ++ K      PE L  Y+ 
Sbjct  89    FSNEQKYFTAFRPHSMQKMFRSYKAATPAAAPKQIARDEESKVLKSPGFLKPEALMRYLG  148

Query  506   TIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSG  685
              +DS+ +E +   W    +V  Y L+K  T +LAC+ FL I+  + + RL++    V+ G
Sbjct  149   KMDSITQEQMKVYWEGKNQVLAYPLAKTLTLSLACRFFLGIDEPERIARLVENFDDVTVG  208

Query  686   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNL  865
             M SL +NFPGT ++RA K    +R++L  VI+E+KA AM S +  +     D+L  ++  
Sbjct  209   MHSLIVNFPGTIFHRATKAADAIRKELKTVIQEKKA-AMASGAPMM-----DILTHMIVA  262

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
             +D  GQH+ E EI   ++G+L   Y +++ A+TF +K++ E P IY +V  EQ++IA+SK
Sbjct  263   SDPSGQHMPEAEIADKMMGLLTAGYSTVATAMTFFMKYVGERPDIYAKVLAEQMDIAESK  322

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
              P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++F YAG+TIPKGWK +W V 
Sbjct  323   KPGQLLEWEDLNKMKYSWNVIYEVMRFTPPLQGTFREALTDFEYAGYTIPKGWKVYWTVS  382

Query  1226  STHKNPKYFTEPEKFDPSRFEG-SGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             +T+ NP+YF  PEKFDPSR++  S   PFTFVPFG GPRMCPGKEYARL IL F+HNVV 
Sbjct  383   TTNMNPEYFPNPEKFDPSRYDDLSAFPPFTFVPFGGGPRMCPGKEYARLAILTFVHNVVK  442

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              FK E + P EKI   +  P+P  GLPVRLT H
Sbjct  443   RFKWEVVFPKEKIT-GDMMPTPEKGLPVRLTCH  474



>sp|Q50EK0.1|C16B2_PICSI RecName: Full=Cytochrome P450 716B2; AltName: Full=Cytochrome 
P450 CYPA2 [Picea sitchensis]
 gb|AAX07437.1| cytochrome P450 CYPA2 [Picea sitchensis]
Length=497

 Score =   397 bits (1019),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 207/462 (45%), Positives = 286/462 (62%), Gaps = 13/462 (3%)
 Frame = +2

Query  140   YFITKANTSK-PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSIL  298
             Y I+   T     +PPG+ GWP+IGE+++ +       P  +   R +KY   VF TS++
Sbjct  38    YLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGNPRDFFDSRTQKYG-NVFTTSLV  96

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             G    VFC   GN+F F+NEN L+   WP SV          T+   +   R  +    +
Sbjct  97    GHPTVVFCSPEGNRFLFSNENKLVVNSWPSSVGNLFRSSLITTVGDDAKRLRRILMTFLR  156

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ ++  +DSM K H+AE W    EV    L K YTF+LAC LF SI  +D++ RL 
Sbjct  157   PEALREFVGRVDSMTKRHLAEHWIGKDEVTALPLLKRYTFSLACDLFASINNKDDLGRLW  216

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
                ++   G+  +P++ PGT YN+A    + +R+QL  +I ERK   +   +G    E +
Sbjct  217   LHFMVFVKGVMQIPIDLPGTRYNKAKHAANAIRQQLGSIINERK---IGLEAGNASPE-Q  272

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  LL+  DE+G+ L + EI   I+ +L   + + S+ +T +LKFLAE PH Y++V +
Sbjct  273   DLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEVLR  332

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ++IA SK   + L WED+Q+MKYSW V  EALRLFP  QG FR+ + EF Y GFTIPK
Sbjct  333   EQLDIAGSKEAGQLLEWEDLQRMKYSWRVAQEALRLFPAAQGSFRKAIKEFIYDGFTIPK  392

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK +W V STH+  +YF+ PE FDPSRFEG GP P+TFVPFG GPRMCPG E+ARLEIL
Sbjct  393   GWKMYWTVNSTHRKSEYFSNPETFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARLEIL  452

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             VF+HN+V N K   + P EK++  +  P+PVNGLP++L PH 
Sbjct  453   VFLHNIVKNCKWNLVNPGEKVIV-DPMPAPVNGLPIKLVPHD  493



>ref|XP_008358591.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Malus domestica]
Length=477

 Score =   396 bits (1017),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 297/469 (63%), Gaps = 23/469 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GESI+ +   P+ ++  RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL----NRNNIHEI-  472
              AV CG +G+KF F+NE    T + P S+ K  MF +       +      +R+   ++ 
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTAPAVAQPSRDEEAKVI  135

Query  473   -----FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGR  637
                   KPE L  Y+  +DS+ +E +   W    EV+VY L+K  T  LAC+ FL I+  
Sbjct  136   RSPGFLKPEALVRYLGRMDSITQEQMKVYWEGKDEVQVYPLAKTLTLGLACRFFLGIDEP  195

Query  638   DEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSG  817
             + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M++ G
Sbjct  196   ERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAGG  253

Query  818   KVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPH  997
              +     D+L  ++  +D  G+ + E E+   I+G+L   Y +++ A+TF +K++ E P 
Sbjct  254   PMH----DILSHMIAASDPSGKLMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERPD  309

Query  998   IYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTY  1177
             IY +V  EQ+EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++FTY
Sbjct  310   IYAKVLAEQMEIANSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFTY  369

Query  1178  AGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCPGK  1354
             AG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR++     P FTFVPFG GPRMCPGK
Sbjct  370   AGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPGK  429

Query  1355  EYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             EYARL IL F+HNVV  FK E L P EKI   +  P+P  GLPVRLT H
Sbjct  430   EYARLAILTFVHNVVKRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLTRH  477



>gb|KHG26601.1| Cytochrome P450 protein [Gossypium arboreum]
Length=486

 Score =   395 bits (1016),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 211/480 (44%), Positives = 308/480 (64%), Gaps = 38/480 (8%)
 Frame = +2

Query  134   IIYFITKANTSKPN------LPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKT  289
             I++ +T A   KP       LPPGS GWP++GE+++ +   P+ ++ +RM+KYSP +FKT
Sbjct  22    IVFVVTFALRPKPKSSLAKELPPGSLGWPIVGETLEFLFGNPENFVFNRMRKYSPRIFKT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE  469
              ILGE+  V CG  G+KF F+NE  L T +   S        TQ   R   + +  ++  
Sbjct  82    RILGEETVVICGPEGHKFLFSNEQKLFTAFRLHS--------TQKLFRSYQSSSAASVQS  133

Query  470   IF--------------KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLA  607
              F              KPE L  Y+  +D++ ++ + + W    +VK + L+K  T TLA
Sbjct  134   SFDADSKKILRSPGFLKPEALMRYLGKMDAITQQQMEKYWEKNDQVKAFPLAKTLTLTLA  193

Query  608   CKLFLSIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKER  787
             C+ FL I+  + + RL+     ++ GM S+PL+FPGTA+ +A K  + +RR+L EVIKE+
Sbjct  194   CRFFLGIDEPERISRLVKRFDDITLGMHSIPLDFPGTAFYKANKAAAAIRRELKEVIKEK  253

Query  788   KAEAMMSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITF  967
             KA AM+  +G V    +D+L  ++  TD+ G+++ E EI   I+G+L+  Y +++ A+TF
Sbjct  254   KA-AMV--TGVVM---QDILCHMIVATDKTGKYMAEAEIADKIMGLLVAGYSTVATAMTF  307

Query  968   VLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGG  1147
              +K++ E PHIY ++  EQ+++   K   E L W+D+QKMKYSWNV+ E +RL PP QG 
Sbjct  308   FMKYVGERPHIYAKILAEQLQVEGDKKAGEMLEWDDIQKMKYSWNVMYEVMRLTPPLQGT  367

Query  1148  FRETVSEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRF-EGSGPAPFTFVPF  1324
             FR  +++FTYAG+T+PKGWK +W V +T+KNP+YF+EPEKFDPSR+ EG+   PFT+VPF
Sbjct  368   FRVALTDFTYAGYTVPKGWKIYWTVSTTNKNPEYFSEPEKFDPSRYDEGNKLPPFTYVPF  427

Query  1325  GSGPRMCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             G G RMCPGKEYARL IL F+HNVV  F+ E + P EKIV  +  P+P NGLP+RLTP  
Sbjct  428   GGGLRMCPGKEYARLAILTFVHNVVKRFQWELVNPKEKIV-GDMMPTPDNGLPIRLTPRH  486



>ref|XP_010060835.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW67713.1| hypothetical protein EUGRSUZ_F01453 [Eucalyptus grandis]
Length=479

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 211/458 (46%), Positives = 292/458 (64%), Gaps = 18/458 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +S P LPPGS GWP++GE+++ +   PDK++ DRM+KYS  VFKT ILGEKVAVFCG AG
Sbjct  27    SSGPKLPPGSFGWPILGETVEFLFGNPDKFVGDRMRKYSSTVFKTKILGEKVAVFCGPAG  86

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF------KPENLKH  496
             NKF F+NE  L+T W P S+ K +     N+    S     +  ++       KPE L  
Sbjct  87    NKFIFSNEQKLVTEWRPHSMQKLMRSYEANSPPPPSANPNESKTKVLRQPGFLKPEALCR  146

Query  497   YIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIV  676
             ++  +DS A++H+   W    +V V+ LSK +T +LA K FL +   D + RL +    V
Sbjct  147   FMEQMDSTAQQHMKLHWEGQSKVLVFPLSKNFTLSLASKFFLGLNEHDRITRLANEFDDV  206

Query  677   SSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRL  856
             S G+ S+P  FPGT +  A +G   +R+ L+ VI+E+K EA+ S +       +D+L  +
Sbjct  207   SLGLHSIPWKFPGTIFYNASRGAVAIRKALLSVIREKK-EALASGA-----RSQDILTYM  260

Query  857   LNLTD-EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             +   D   G+ + E EI   ++G+L   Y +++ AITF++KF+ E P IY+++  EQ+ I
Sbjct  261   VAAADPATGRMMPETEIADKMMGLLTAGYSTVAIAITFLMKFVGERPDIYEKILAEQLAI  320

Query  1034  AKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTF  1213
              KSK P E L+WED+QKMKYSWNV  E LRL PP QG FRE +++ TY G+TIPKGWK +
Sbjct  321   KKSKNPGETLAWEDIQKMKYSWNVTSEVLRLTPPLQGTFREAMTDITYEGYTIPKGWKIY  380

Query  1214  WNVYSTHKNPKYFTEPEKFDPSRFEGSGPA--PFTFVPFGSGPRMCPGKEYARLEILVFM  1387
             W V ST+ +P YF  P  FDP+R+E    A  P+T+VPFG GPR+CPGKEYARL +L F+
Sbjct  381   WTVSSTNNDPTYFPNPATFDPTRYEEGNAALPPYTYVPFGGGPRLCPGKEYARLVVLTFL  440

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HN V  FK E + P EKI+  +  P+P  GLPVRL PH
Sbjct  441   HNTVNRFKWELVDPKEKIIV-DMMPTPSKGLPVRLIPH  477



>ref|XP_008358589.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Malus domestica]
Length=480

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 214/472 (45%), Positives = 296/472 (63%), Gaps = 26/472 (6%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GESI+ +   P+ ++  RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL-------NRNNIH  466
              AV CG +G+KF F+NE    T + P S+ K  MF +       ++        +R+   
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTASAAPAVAQPSRDEES  135

Query  467   EI------FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSI  628
             ++       KPE L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I
Sbjct  136   KVIRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGI  195

Query  629   EGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMS  808
             +  + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M+
Sbjct  196   DDSERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MA  253

Query  809   SSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAE  988
             + G +     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E
Sbjct  254   AGGPMH----DILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGE  309

Query  989   LPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSE  1168
              P IY +V  E  EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++
Sbjct  310   RPDIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTD  369

Query  1169  FTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMC  1345
             FTYAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR+E     P FT VPFG GPRMC
Sbjct  370   FTYAGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMC  429

Query  1346  PGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             PGKEYARL IL F+HNVV  F+ E L P EKI   +  P+P  GLPVRL  H
Sbjct  430   PGKEYARLAILTFVHNVVKRFEWEVLFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>ref|XP_006370477.1| hypothetical protein POPTR_0001s43070g [Populus trichocarpa]
 gb|ERP67046.1| hypothetical protein POPTR_0001s43070g [Populus trichocarpa]
Length=474

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 208/461 (45%), Positives = 294/461 (64%), Gaps = 13/461 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE+++ +   P++++  RMKKYS ++FKT ILGE+ 
Sbjct  21    IFAFKYSSRSAKNLPPGSLGWPIFGETLEFLFGKPEEFVFHRMKKYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE---IFKP  481
              V CG  G+K+ FTNE  L T +   S+ K  +    +   +I+    + I       KP
Sbjct  81    VVMCGPDGHKYLFTNEQKLFTVFRTHSMQKLFLSDEASAPIEITREAESKIIRSPGFLKP  140

Query  482   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
             E L  Y+  +DS+ ++ +   W    EVKV+  +K  T +LAC+ FL  +  + + RL+ 
Sbjct  141   EALVRYLGKMDSITQQKMQAYWEGKDEVKVFPFAKTLTLSLACRFFLGSDDPERIARLVS  200

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
                 V+ GM S+PLNFPGT + RA K  + +R +L  VI E++A  +M+   +V+    D
Sbjct  201   NFDDVTLGMHSIPLNFPGTTFYRANKAAAAIREELRLVISEKRA--IMAEGAQVQ----D  254

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             VL  ++  TD  G+H+ E EI   ++G+L+  Y +++ A+TF +K++ + P IY ++  E
Sbjct  255   VLCHMILATDPSGKHMAEAEIAGMMMGLLVAGYSTVATAMTFFMKYVGQRPDIYAKILAE  314

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q EIA +K   E L W D+QKMKYSWNVV E +RL PP QG FRE +++ TYAG+TIPKG
Sbjct  315   QTEIATAKKAGEVLDWNDIQKMKYSWNVVYEVMRLTPPIQGTFREALTDVTYAGYTIPKG  374

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFE-GSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             WK +W V +T+KNPKYF +PEK DPSR E G    PFTFVPFG+GPRMCPGKEYARL IL
Sbjct  375   WKIYWTVSTTNKNPKYFPDPEKLDPSRHEDGKAFPPFTFVPFGAGPRMCPGKEYARLAIL  434

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              F+HNVV  +K E + P+EKIV  +  PSP  GLP+RL  H
Sbjct  435   TFVHNVVKRYKWEVVFPEEKIV-GDMMPSPEKGLPIRLQSH  474



>ref|XP_002868459.1| CYP716A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44718.1| CYP716A1 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   394 bits (1012),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/459 (44%), Positives = 294/459 (64%), Gaps = 18/459 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPE----VFKTSILGE  304
             +N S PNLPPG TG+P+IGES   +       P+K+I+DR++++S      VFKT + G 
Sbjct  27    SNFSYPNLPPGKTGFPLIGESFSFLSAGRQGHPEKFITDRVRRFSSSSSSCVFKTHLFGS  86

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPE  484
               AV  GA+GNKF FTNEN L+ +WWP SV K      Q + ++ +   R  + +  KPE
Sbjct  87    PTAVVTGASGNKFLFTNENKLVVSWWPDSVNKIFPSSMQTSSKEEAKKLRMLLSQFMKPE  146

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L+ Y+  +D +A+ H   EWA   ++ V+ L+K +TF++AC+ FLS++    V++L + 
Sbjct  147   ALRRYVGVMDEIAQRHFETEWANHDQLIVFPLTKKFTFSIACRSFLSMDDPARVRQLEEQ  206

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
                V+ G+FS+P++ PGT +NRA+K   ++R+++  ++++RK E     SGK   E   +
Sbjct  207   FNTVAVGIFSIPIDLPGTRFNRAIKASRLLRKEVSAIVRQRKEEL---KSGKALEEHDIL  263

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
                L+N+ + + + L +      IIG+L+  + + S   TFV+ +LAE  H+YQ+V +EQ
Sbjct  264   SHMLMNIGETKDEDLAD-----KIIGLLIGGHDTASIVCTFVVNYLAEFSHVYQRVLQEQ  318

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
              EI   K   E L WED++KM+YSWNV CE +R+ PP  G FRE +   ++ GF IPKGW
Sbjct  319   KEILNEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLPGTFREAIDHISFKGFYIPKGW  378

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVF  1384
             K +W+  +TH NP YF EPE+F+P RFEGSGP  +T+VPFG GPRMCPG+EYARLEIL+F
Sbjct  379   KLYWSATATHMNPDYFPEPERFEPKRFEGSGPKAYTYVPFGGGPRMCPGREYARLEILIF  438

Query  1385  MHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             MHN+V  FK EK+ P E  +  +  P P  GLP+R+ P 
Sbjct  439   MHNLVKRFKWEKVFPKENKIVVDPLPIPGKGLPIRIFPQ  477



>ref|XP_004295460.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   394 bits (1012),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 205/453 (45%), Positives = 289/453 (64%), Gaps = 17/453 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GE+++ +   P+ ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29    NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  347   ftnentllttWWPQSVIKPLM-FPTQNTLRKISTLNRNNIHEIF------KPENLKHYIP  505
             F+NE    T + P S+ K    +           + R+   ++       KPE L  Y+ 
Sbjct  89    FSNEQKYFTAFRPHSMQKMFRSYKAATPAAAPKQIARDEESKVLRSPGFLKPEALMRYLG  148

Query  506   TIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSG  685
              +DS+ +E +   W    +V  Y L+K  T +LAC+ FL I+  + + RL++    V+ G
Sbjct  149   KMDSITQEQMKVYWEGKNQVLAYPLAKTLTLSLACRFFLGIDEPERIARLVENFDDVTVG  208

Query  686   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNL  865
             M SL +NFPGT ++RA K    +R++L  VI+E+KA AM S +  +     D+L  ++  
Sbjct  209   MHSLIVNFPGTIFHRATKAADAIRKELKTVIQEKKA-AMASGAPMM-----DILTHMIVA  262

Query  866   TDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1045
             +D  GQH+ E EI   ++G+L   Y +++ A+TF +K++ E P IY +V  EQ+EIA+SK
Sbjct  263   SDPSGQHMPEAEIADKMMGLLTAGYSTVATAMTFFMKYVGERPDIYAKVLAEQMEIAESK  322

Query  1046  GPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVY  1225
              P + L W+D+ KMKYSWNV+ E +R  PP QG FRE +++F YAG+TIPKGWK +W V 
Sbjct  323   TPGQLLEWDDLNKMKYSWNVIYEVMRFTPPLQGTFREALTDFEYAGYTIPKGWKVYWTVS  382

Query  1226  STHKNPKYFTEPEKFDPSRFEG-SGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
             +T+ NP YF  PEKFDPSR++  S   P+TFVPFG GPRMCPGKEYARL IL F+HNVV 
Sbjct  383   TTNMNPDYFPNPEKFDPSRYDDVSAFPPYTFVPFGGGPRMCPGKEYARLAILTFVHNVVK  442

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              FK E + P EKI   +  P+P  GLP+RLT H
Sbjct  443   RFKWEVVFPKEKIT-GDMMPTPEKGLPIRLTCH  474



>ref|XP_007022977.1| Cytochrome P450 716B1 [Theobroma cacao]
 gb|EOY25599.1| Cytochrome P450 716B1 [Theobroma cacao]
Length=557

 Score =   396 bits (1017),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 304/457 (67%), Gaps = 19/457 (4%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +  ++   +LPPGS GWPV+GE+++ +   P+K++ DRMKKYSP +FKT ILGE+ AV C
Sbjct  31    SSTSSGAKDLPPGSLGWPVMGETLEFLFGKPEKFVFDRMKKYSPHIFKTKILGEETAVIC  90

Query  323   GAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF------KPE  484
             G  G+KF F+NE  L T + P S+ K  +F +      +  + R+   +I       KPE
Sbjct  91    GPEGHKFLFSNEQKLFTAFRPHSMQK--LFRSYQAAAPVQ-IARDAEAKILRSPGFLKPE  147

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L  Y+  +DS+ ++ + + W    EVK +AL+K  T TLAC+ FL I+  + + RL+  
Sbjct  148   ALVRYLGKMDSITQQQMEKYWQGKDEVKAFALAKTLTLTLACRFFLGIDDPERISRLVTN  207

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
                ++ GM S+P+NFPGT + RA +  + +R++L EVIKE+K    M++   ++    D+
Sbjct  208   FDDITLGMHSIPVNFPGTIFYRANRAAAAIRKELREVIKEKKTA--MATGAPMQ----DI  261

Query  845   LGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQ  1024
             L  ++  TD  G+++ E EI   I+G+L+  Y +++ A+TF +K++ E P IY ++  EQ
Sbjct  262   LSHMIVATDPSGKYMPEAEIADKIMGLLVAGYSTVATAMTFFMKYVGEWPDIYDKILAEQ  321

Query  1025  IEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGW  1204
              E+A +K P E L W+D+QKMKYSWNV+ E +RL PP QG FRE ++EFTYAGFTIPKGW
Sbjct  322   SEVAAAKKPGELLDWDDIQKMKYSWNVLYEVMRLTPPLQGTFREALTEFTYAGFTIPKGW  381

Query  1205  KTFWNVYSTHKNPKYFTEPEKFDPSRF-EGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             K +W V + ++NP++F EP+KFDPSR+ EG+   PFTFVPFG GPRMCPGKEYARL IL 
Sbjct  382   KVYWTVSTANRNPEFFPEPDKFDPSRYDEGNTFPPFTFVPFGGGPRMCPGKEYARLAILT  441

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             F+HNVV  FK E + P EKI+  +  P+P  GLP+RL
Sbjct  442   FVHNVVKRFKWELVEPKEKII-GDMMPTPEKGLPIRL  477



>ref|XP_008349137.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score =   393 bits (1010),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 211/471 (45%), Positives = 294/471 (62%), Gaps = 25/471 (5%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GESI+ +   P+ ++  RM+KYSP++FKT ILGEK 
Sbjct  19    IFALKGKSDDGKNLPPGSMGWPIVGESIEFLFGKPENFVFKRMRKYSPDIFKTYILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL-------NRNNIHE  469
             AV CG +G+KF F+NE    T + P S+ K  MF +       ++        +R+   +
Sbjct  79    AVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTASAAPAVAQPSRDEESK  136

Query  470   I------FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIE  631
             +       KPE L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I+
Sbjct  137   VIRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGID  196

Query  632   GRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSS  811
               + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M++
Sbjct  197   DSERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAA  254

Query  812   SGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
              G +     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E 
Sbjct  255   GGPMH----DILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGER  310

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             P IY +V  E  EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++F
Sbjct  311   PDIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDF  370

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCP  1348
             TYAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR+E     P FT VPFG GPRMCP
Sbjct  371   TYAGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMCP  430

Query  1349  GKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             GKEYARL IL F+HNVV  F+ E L P EKI   +  P+P  GLPVRL  H
Sbjct  431   GKEYARLAILTFVHNVVKRFEWEVLFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>ref|XP_002529893.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF32496.1| cytochrome P450, putative [Ricinus communis]
Length=474

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/465 (45%), Positives = 304/465 (65%), Gaps = 18/465 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             +  F  ++     NLPPGS GWPVIGE+I+ +   P+K++ DRMKKYSPE+FKT+ILGEK
Sbjct  19    LFAFKIRSKNGSKNLPPGSLGWPVIGETIEFLFGKPEKFVFDRMKKYSPEIFKTNILGEK  78

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF----  475
              AV CG  G+KF F+NE  L T + P S+ K  +F +  +    + ++R    ++     
Sbjct  79    TAVICGPNGHKFLFSNEQKLFTAFRPHSMQK--IFRSYQSSAPPAQISREAEIKMLRSPG  136

Query  476   --KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVK  649
               KPE L  Y+ T+DS+ ++H+   W    E+KV+ L+K  T +LAC+ FL     D++ 
Sbjct  137   FLKPEALVRYLGTMDSITQQHMEYYWVGKDELKVFPLAKTLTLSLACRFFLGTHEPDKIT  196

Query  650   RLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVEN  829
             RL+     ++ G+ S+P+NFPGT +N+A K  + +R++L  +I E+KA   M + G+++ 
Sbjct  197   RLVGNFDDITLGIHSIPVNFPGTIFNKANKAAAAIRKELRTIINEKKAA--METGGRMQ-  253

Query  830   EGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQ  1009
                D+L  ++  +D  G+H+ E EI   I+G+L+  Y +++ A+TF +K++ E P IY +
Sbjct  254   ---DILSHMIMASDPTGKHMPEAEIADKIMGLLVAGYSTVATAMTFFMKYVGERPDIYAK  310

Query  1010  VYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFT  1189
             V  EQ EI+++K   E L W D+QKMKYSWNV+ E +RL PP QG FRE +++FT+AG+T
Sbjct  311   VLAEQKEISEAKKDGELLEWNDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFTFAGYT  370

Query  1190  IPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCPGKEYAR  1366
             IPKGWK +W V + +KNP YF  PE+FDPSR+E     P FTFVPFG GPRMCPGKEYAR
Sbjct  371   IPKGWKVYWTVSTANKNPDYFPNPEEFDPSRYEDDKRLPAFTFVPFGGGPRMCPGKEYAR  430

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             L IL F++NVV  FK E  +P EK++  +  P+P  GLP+ L  H
Sbjct  431   LAILTFINNVVKRFKWEVAIPQEKVI-GDMMPTPEKGLPICLISH  474



>gb|AHF49536.1| CYP450 716-like protein (mitochondrion) [Ginkgo biloba]
Length=485

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/450 (44%), Positives = 294/450 (65%), Gaps = 20/450 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N PPG+ G P+IGE+++ +       P ++   R+ KY  E+FKTSI+G   A+FC  AG
Sbjct  39    NAPPGTFGLPLIGETLEFLGCQRSGKPAEFFDTRINKYG-EIFKTSIVGHPTAMFCSPAG  97

Query  335   NKffftnentllttWWPQSVIK----PLMFPTQNTLRKISTLNRNNIHEIFKPENLKHYI  502
             N+  F+NEN L+ + WP SV K     ++  T +  +++    R  +    +PE L+ ++
Sbjct  98    NRLLFSNENKLVVSSWPSSVGKLFGKSILTATGDEAKRL----RRMLMMFLRPEALQTFV  153

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               +D +A+ H+A+EW    EV+V+ L + YTF+LAC LF S++   E+ +L    +++  
Sbjct  154   GRVDLIARRHLADEWIGKEEVRVFPLMEHYTFSLACNLFASVDDEGEIAKLSHHFMVLLK  213

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+  +P++ PGT YN+A    S +RR+L  +I  R+  A+   +  +E   +D++  LL+
Sbjct  214   GVLQIPIDLPGTRYNKAKHAASAIRRELQSIIDHRRI-ALAHGNASLE---QDLMSYLLS  269

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
               DEEG+ L + EI   I+ +   ++ + SA +T +LK+LAE P  Y+++ KEQ+EIA S
Sbjct  270   NVDEEGKSLTDEEIKDNILQLFFASHDTSSATLTLLLKYLAEHPDCYERILKEQLEIAGS  329

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K   + L WE++QKMKYSW    E LR+ PP QG FRE +++FTY GFTIP+GWK +W V
Sbjct  330   KAGGQLLEWEELQKMKYSWRAAQETLRMTPPVQGSFREAITDFTYGGFTIPRGWKCYWTV  389

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
              STHK  +YF +PEKFDPSRFEG+GPAP+TFVPFG G RMCPG E+AR+E+LVF+HN+  
Sbjct  390   NSTHKKAEYFEDPEKFDPSRFEGAGPAPYTFVPFGGGHRMCPGNEFARMEMLVFLHNIAK  449

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRL  1492
             +FK E +  DEKI   +  P+PVNGLP++L
Sbjct  450   SFKWELVDKDEKISV-DPMPAPVNGLPIKL  478



>emb|CBI20810.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 286/452 (63%), Gaps = 77/452 (17%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLP G+TG P IGESI  +       P+K+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37    NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  335   NKffftnentllttWWPQSVIKPLMFPT--QNTLRKISTLNRNNIHEIFKPENLKHYIPT  508
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ S   R  +    KPE L+ YI  
Sbjct  97    NKFLFSNENKLVTAWWPSSVNK--IFPSSLQTSSQEESKKMRKLLPGFLKPEALQRYI--  152

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
                                                     +  D V++L +P   +++G+
Sbjct  153   ----------------------------------------KDPDHVEKLAEPFNELAAGI  172

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              +LP++ PGT++N+ +K  ++                         +  +D+L  +L   
Sbjct  173   IALPIDLPGTSFNKGIKASNLA------------------------STTQDILSHMLLTC  208

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             DE G+++NE +I   I+G+L+  + + SA ITF++KFLAELPH+Y +V+KEQ+EIAKSK 
Sbjct  209   DENGEYMNEEDIADKILGLLVGGHDTASATITFIVKFLAELPHVYDEVFKEQMEIAKSKA  268

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
             P E L+WED+ KM+YSWNV CE +RL PP QG FRE +++F + GF+IPKGWK +W+ +S
Sbjct  269   PGELLNWEDIPKMRYSWNVACEVMRLAPPVQGAFREAMNDFIFEGFSIPKGWKLYWSTHS  328

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             TH+NP++F +PEKFDPSRF+G GPAP+T+VPFG GPRMCPGKEYARLE+LVFMHN+V  F
Sbjct  329   THRNPEFFPKPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEYARLEVLVFMHNLVRRF  388

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             K EKL+PDEKI+  +  P P  GLP+RL  HQ
Sbjct  389   KWEKLLPDEKIIV-DPMPIPAKGLPIRLHHHQ  419



>ref|XP_003524231.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=486

 Score =   392 bits (1007),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 283/464 (61%), Gaps = 15/464 (3%)
 Frame = +2

Query  137   IYFITK----ANTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFK  286
             +YFI K          NLPPG  GWPV+GE+++ +         ++I +R +KY   VFK
Sbjct  25    LYFIIKVFRLGKHPNLNLPPGRLGWPVVGETLEFLRTMNEGNVLRFIQERKEKYDSRVFK  84

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIH  466
             TS+ G+ V +FCG AGNKF F+NEN  +  WWP SV + L     N +   + + R  + 
Sbjct  85    TSMFGDPVVLFCGPAGNKFLFSNENKNVQVWWPSSVRRLLRLSLVNKVGDEAKMVRRLLM  144

Query  467   EIFKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEV  646
                  E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIE  D +
Sbjct  145   SFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVCVYPIVQLYTFELACCLFLSIEDSDHI  204

Query  647   KRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVE  826
              +L         G+   PLN PGT + RAMK   ++R+++  ++K+RK +       K  
Sbjct  205   SKLSLKFDEFLKGIIGFPLNVPGTRFYRAMKAADVIRKEIKMILKKRKVDL----EEKRV  260

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
             +  +D+L  +L  +D  G+ + E EI   I+ +L   + +  + ++ V+K+L +LP +Y+
Sbjct  261   SPTQDLLSHMLVTSDPSGRFMTEMEILDNILLLLFAGHDTSRSVLSLVMKYLGQLPQVYE  320

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
              V +EQ+EI++ K   + L WEDVQKMKYSWNV  E +RL PP  G +RE + +FTYA +
Sbjct  321   HVLEEQLEISQGKEAGQLLQWEDVQKMKYSWNVASEVMRLSPPVSGAYREAIKDFTYADY  380

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
              IPKGWK  WN  S+HK+P  F+ PE FD SRFEG+GP PF++VPFG GPRMC G E+AR
Sbjct  381   NIPKGWKLHWNTGSSHKDPTLFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGLEFAR  440

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             LEILVFMHN+V  FK + ++PDE   Y+     P+ GL +RL P
Sbjct  441   LEILVFMHNIVKRFKWDLVIPDEMFKYDPML-EPIKGLAIRLHP  483



>sp|Q50EK1.1|C16B1_PICSI RecName: Full=Cytochrome P450 716B1; AltName: Full=Cytochrome 
P450 CYPA1 [Picea sitchensis]
 gb|AAX07436.1| cytochrome P450 CYPA1 [Picea sitchensis]
Length=493

 Score =   392 bits (1007),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 205/462 (44%), Positives = 285/462 (62%), Gaps = 13/462 (3%)
 Frame = +2

Query  140   YFITKANTSK-PNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSIL  298
             Y I+   T     +PPG+ GWP+IGE+++ +       P  +   R +KY   VF TS++
Sbjct  38    YLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGNPRDFFDSRTQKYG-NVFTTSLV  96

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFK  478
             G    VFC   GN+F F+NEN L+   WP SV          T+   +   R  +    +
Sbjct  97    GHPTVVFCSPEGNRFLFSNENKLVVNSWPSSVGNLFRSSLITTVGDDAKRLRRILMTFLR  156

Query  479   PENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLL  658
             PE L+ ++  +DSM K H+AE W    EV    L K YTF+LAC LF SI  +D++ RL 
Sbjct  157   PEALREFVGRVDSMTKRHLAEHWIGKDEVMALPLLKRYTFSLACDLFASINTKDDLDRLW  216

Query  659   DPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGR  838
                ++   G+  +P++ PGT YN+     + +R+QL  +I ERK  A+ + +   E   +
Sbjct  217   LHFMVFVKGVMQIPIDLPGTRYNKTKHAANAIRQQLGSIINERKI-ALEAGNASPE---Q  272

Query  839   DVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYK  1018
             D+L  LL+  DE+G+ L + EI   I+ +L   + + S+ +T +LKFLAE PH Y++V +
Sbjct  273   DLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEVLR  332

Query  1019  EQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPK  1198
             EQ+ IA SK   + L WED+Q+MKYSW V  EALRLFP  QG FR+ + EF Y GFTIPK
Sbjct  333   EQLNIAGSKEEGQLLEWEDLQRMKYSWRVAQEALRLFPAVQGSFRKAIKEFIYDGFTIPK  392

Query  1199  GWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             GWK  W V STH+  +YF+ PEKFDPSRFEG GP P+TFVPFG GPRMCPG E+AR+EIL
Sbjct  393   GWKLHWTVNSTHQKSEYFSNPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARMEIL  452

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             +F+HN+V NF    + P EK++  +  P+PVNGLP++L PH 
Sbjct  453   IFLHNIVKNFNWNLVNPLEKVIV-DPMPAPVNGLPIKLVPHD  493



>ref|XP_008225706.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Prunus mume]
 ref|XP_008225707.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X3 [Prunus mume]
Length=478

 Score =   391 bits (1004),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 292/470 (62%), Gaps = 24/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+++ +   P+ ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-----RNNIHEI  472
              AV CG  G+KF F+NE    T + P S+ K  MF +       +        R+   ++
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAPPAVAQPARDEEAKV  135

Query  473   F------KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                    KPE L  Y+  +DS+ +  +   W    EV+VY L+K  T  LACK FL I+ 
Sbjct  136   LRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLTKTLTLGLACKFFLGIDE  195

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
              D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM S +
Sbjct  196   PDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AMASGA  254

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
                     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E P
Sbjct  255   PM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  309

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY +V  E  EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++FT
Sbjct  310   DIYAKVLAEHKEIADSKKPGQFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  369

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCPG  1351
             YAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR++     P FTFVPFG GPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPG  429

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             KEYARL IL F+HNVV  FK E L P+EKI   +  P+P  GLPVR+  H
Sbjct  430   KEYARLAILTFVHNVVMRFKWEVLFPNEKIT-GDMMPTPEKGLPVRIHRH  478



>ref|XP_008225708.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=482

 Score =   391 bits (1004),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 294/474 (62%), Gaps = 28/474 (6%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+++ +   P+ ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQN---------TLRKISTLNRNN  460
              AV CG  G+KF F+NE    T + P S+ K  MF +               ++   R+ 
Sbjct  78    TAVICGPKGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAAAAAPPAVAQPARDE  135

Query  461   IHEI------FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFL  622
               ++       KPE L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL
Sbjct  136   EAKVLRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLAKTLTLGLACRFFL  195

Query  623   SIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAM  802
              I+  D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM
Sbjct  196   GIDEPDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AM  254

Query  803   MSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFL  982
              S +        D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++
Sbjct  255   ASGAPM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYV  309

Query  983   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETV  1162
              E P IY +V  E  EIA SK P + L W+D+ KMKYSWNV+ E +R  PP QG FRE +
Sbjct  310   GERPDIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREAL  369

Query  1163  SEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPR  1339
             ++FTYAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR++     P FTFVPFG GPR
Sbjct  370   TDFTYAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLSAFPAFTFVPFGGGPR  429

Query  1340  MCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             MCPGKEYARL IL F+HNVV  FK E L P+EKI   +  P+P  GLPVRLT H
Sbjct  430   MCPGKEYARLAILTFVHNVVMRFKWEVLYPNEKIT-GDMMPTPEKGLPVRLTCH  482



>ref|NP_198460.1| cytochrome P450, family 716, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 dbj|BAA96885.1| cytochrome P450-like [Arabidopsis thaliana]
 gb|AED94045.1| cytochrome P450, family 716, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=477

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 205/458 (45%), Positives = 300/458 (66%), Gaps = 17/458 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPE---VFKTSILGEK  307
             ++ S PNLPPG+TG P+IGES   +       P+K+I+DR++++S     VFKT + G  
Sbjct  27    SHFSYPNLPPGNTGLPLIGESFSFLSAGRQGHPEKFITDRVRRFSSSSSCVFKTHLFGSP  86

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPEN  487
              AV  GA+GNKF FTNEN L+ +WWP SV K      Q + ++ +   R  + +  KPE 
Sbjct  87    TAVVTGASGNKFLFTNENKLVVSWWPDSVNKIFPSSMQTSSKEEARKLRMLLSQFMKPEA  146

Query  488   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
             L+ Y+  +D +A+ H   EWA   +V V+ L+K +TF++AC+ FLS+E    V++L +  
Sbjct  147   LRRYVGVMDEIAQRHFETEWANQDQVIVFPLTKKFTFSIACRSFLSMEDPARVRQLEEQF  206

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
               V+ G+FS+P++ PGT +NRA+K   ++R+++  ++++RK E     +GK   E   + 
Sbjct  207   NTVAVGIFSIPIDLPGTRFNRAIKASRLLRKEVSAIVRQRKEEL---KAGKALEEHDILS  263

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               L+N+ + + + L +      IIG+L+  + + S   TFV+ +LAE PH+YQ+V +EQ 
Sbjct  264   HMLMNIGETKDEDLAD-----KIIGLLIGGHDTASIVCTFVVNYLAEFPHVYQRVLQEQK  318

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EI K K   E L WED++KM+YSWNV CE +R+ PP  G FRE +  F++ GF IPKGWK
Sbjct  319   EILKEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLSGTFREAIDHFSFKGFYIPKGWK  378

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
              +W+  +TH NP YF EPE+F+P+RFEGSGP P+T+VPFG GPRMCPGKEYARLEIL+FM
Sbjct  379   LYWSATATHMNPDYFPEPERFEPNRFEGSGPKPYTYVPFGGGPRMCPGKEYARLEILIFM  438

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             HN+V  FK EK+ P+E  +  +  P P  GLP+R+ P 
Sbjct  439   HNLVNRFKWEKVFPNENKIVVDPLPIPDKGLPIRIFPQ  476



>ref|XP_011089170.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=492

 Score =   391 bits (1004),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 291/459 (63%), Gaps = 12/459 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKV  310
             +K+     NLPPGS GWP++GE++  +       P+K++ +RM KY  +VFKTS+LGE V
Sbjct  38    SKSRNKILNLPPGSYGWPILGETMAFLRGSIDGSPEKFVKERMDKYKTQVFKTSLLGESV  97

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL  490
             AV  G AG KF F+NEN L+T WWP SV + L      T    +   R  +     P+  
Sbjct  98    AVLRGPAGYKFLFSNENKLVTVWWPSSVRELLGTCLATTGGTQAIQMRKMVSYFVSPDVF  157

Query  491   -KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPI  667
              K YI  +D ++++HI   W    E+KV+   K YTF LAC+LF+S+E   ++KRL    
Sbjct  158   TKRYIKVMDIVSQQHIQTHWQGKEELKVFPAIKLYTFELACRLFMSVEEPTQIKRLSALF  217

Query  668   IIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVL  847
              I   G+ S+PLNFPGT + +A +  + ++++L  ++++RK    +     V +E  D+L
Sbjct  218   NIFLGGIISIPLNFPGTRFYKAKRATAAIKKELQVILRQRKER--LGQQDTVASE--DLL  273

Query  848   GRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQI  1027
               LL   DE G+ ++E +I + I+ +L   + + S+AIT ++K LAE P +Y +V +EQ 
Sbjct  274   SHLLACPDENGKFMSESDIINNILLLLFAGHDTSSSAITMLIKTLAEHPEVYDKVLREQS  333

Query  1028  EIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWK  1207
             EIA SK   E L WED+QKMKY+WNVV E LRL+PP  G FRE + +  Y G+ IPKGWK
Sbjct  334   EIASSKEAGECLQWEDIQKMKYTWNVVSETLRLWPPVVGAFREALVDIKYGGYDIPKGWK  393

Query  1208  TFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFM  1387
              +WN  STH +   FT+   FDPSRF+G+GP P++FVPFG GPRMC GKE+ARLEIL F+
Sbjct  394   FYWNTSSTHTDSSLFTDSTNFDPSRFDGAGPIPYSFVPFGGGPRMCLGKEFARLEILTFL  453

Query  1388  HNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             HNV+  FK   L+P EKI+  +  P+P  GLP+RL PH+
Sbjct  454   HNVIGQFKWNLLIPGEKIIC-DPIPTPEEGLPIRLHPHK  491



>ref|XP_008225705.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=478

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 214/470 (46%), Positives = 291/470 (62%), Gaps = 24/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+++ +   P+ ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-----RNNIHEI  472
              AV CG  G+KF F+NE    T + P S+ K  MF +       +        R+   ++
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAPPAVAQPARDEEAKV  135

Query  473   F------KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEG  634
                    KPE L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL I+ 
Sbjct  136   LRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLAKTLTLGLACRFFLGIDE  195

Query  635   RDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSS  814
              D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM S +
Sbjct  196   PDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AMASGA  254

Query  815   GKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELP  994
                     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E P
Sbjct  255   PM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  309

Query  995   HIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFT  1174
              IY +V  E  EIA SK P + L W+D+ KMKYSWNV+ E +R  PP QG FRE +++FT
Sbjct  310   DIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  369

Query  1175  YAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCPG  1351
             YAG+TIPKGWK +W V +T+ +PKYF  PEKFDPSR++     P FTFVPFG GPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNMDPKYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPG  429

Query  1352  KEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             KEYARL IL F+HNVV  FK E L P EKI   +  P+P  GLPVRL  H
Sbjct  430   KEYARLAILTFVHNVVMRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLVRH  478



>ref|XP_007213963.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
 gb|EMJ15162.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
Length=482

 Score =   390 bits (1002),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 292/474 (62%), Gaps = 28/474 (6%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+++ +   P+ ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN---------RNN  460
              AV CG  G+KF F+NE    T + P S+ K  MF +       +            R+ 
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAAAAALPAVAQPARDE  135

Query  461   IHEIF------KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFL  622
               ++       KPE L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL
Sbjct  136   EAKVLRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLTKTLTLGLACRFFL  195

Query  623   SIEGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAM  802
              I+  D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM
Sbjct  196   GIDEPDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AM  254

Query  803   MSSSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFL  982
              S +        D+L  ++  +D  G+H+ E EI   I+G+L   Y +++ A+TF +K++
Sbjct  255   ASGAPM-----HDILSHMIVASDPTGKHMAEAEIADKIMGLLTAGYSTVATAMTFFMKYV  309

Query  983   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETV  1162
              E P IY +V  E  EIA SK P + L W+D+ KMKYSWNV+ E +R  PP QG FRE +
Sbjct  310   GERPDIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREAL  369

Query  1163  SEFTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPR  1339
             ++FTYAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR++     P FTFVPFG GPR
Sbjct  370   TDFTYAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPR  429

Query  1340  MCPGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             MCPGKEYARL IL F+HNVV  FK E L P+EKI   +  P+P  GLPVRL  H
Sbjct  430   MCPGKEYARLAILTFVHNVVMRFKWEVLFPNEKIT-GDMMPTPEKGLPVRLHRH  482



>ref|XP_008350555.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
 ref|XP_008350556.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/472 (45%), Positives = 296/472 (63%), Gaps = 26/472 (6%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GESI+ +   P+ ++  RM++YSP++FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPDIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL-------NRNNIH  466
              AV CG +G+KF F+NE    T + P S+ K  MF +       ++        +R+   
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTASAAPAVAQPSRDEEA  135

Query  467   EI------FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSI  628
             ++       KPE L  Y+  +DS+ +E +   W    EV+VY L+K  T +LAC+ FL I
Sbjct  136   KVIRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVEVYPLAKTLTLSLACRFFLGI  195

Query  629   EGRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMS  808
             +  + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M+
Sbjct  196   DDSERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MA  253

Query  809   SSGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAE  988
             + G +     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E
Sbjct  254   AGGPMH----DILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGE  309

Query  989   LPHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSE  1168
              P IY +V  E  EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++
Sbjct  310   RPDIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTD  369

Query  1169  FTYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMC  1345
             FTYAG+TIPKGWK +W V + + N +YF  PEKFDPSR++     P FTFVPFG GPRMC
Sbjct  370   FTYAGYTIPKGWKVYWTVSTVNMNSEYFPNPEKFDPSRYDDLSVFPXFTFVPFGGGPRMC  429

Query  1346  PGKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             PGKEYARL IL F+HNVV  FK E + P EKI   +  P+P  GLPVRLT H
Sbjct  430   PGKEYARLAILTFVHNVVKRFKWEVVFPKEKIT-GDMMPTPEKGLPVRLTRH  480



>ref|XP_009353896.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=480

 Score =   389 bits (1000),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 209/471 (44%), Positives = 294/471 (62%), Gaps = 25/471 (5%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GESI+ +   P+ ++ +RM+KYSP++FKT ILGEK 
Sbjct  19    IFALKGKSDGAKNLPPGSMGWPIVGESIEFLFGKPENFVFNRMRKYSPDIFKTYILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTL-------NRNNIHE  469
             AV CG +G+KF F+NE    T + P S+ K  MF +       ++        +R+   +
Sbjct  79    AVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTASAAPAVAQPSRDEEAK  136

Query  470   I------FKPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIE  631
             +       KPE L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I+
Sbjct  137   VIRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGID  196

Query  632   GRDEVKRLLDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSS  811
               + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M++
Sbjct  197   DSERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAA  254

Query  812   SGKVENEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAEL  991
              G +     D+L  ++  +D  G+H+ E E+   I+G+L   Y +++ A+TF +K++ E 
Sbjct  255   GGPMH----DILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGER  310

Query  992   PHIYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEF  1171
             P IY +V  E  EIA SK P + L WED+ KMKYSWNV+ E +R  PP QG FRE +++F
Sbjct  311   PDIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDF  370

Query  1172  TYAGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAP-FTFVPFGSGPRMCP  1348
             TYAG+TIPKGWK +W V +T+ NP+YF  PEKFDPSR+E     P FT VPFG GPRMCP
Sbjct  371   TYAGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMCP  430

Query  1349  GKEYARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             GKE ARL IL F+HNVV  F+ E + P EKI   +  P+P  GLPVRL  H
Sbjct  431   GKENARLAILTFVHNVVKRFEWEVVFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>ref|XP_006340081.1| PREDICTED: cytochrome P450 716B1-like [Solanum tuberosum]
Length=474

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 193/450 (43%), Positives = 291/450 (65%), Gaps = 12/450 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N PPGS GWP +GE++  +       P+K++ +R++KY  ++FKTS++GE V V  GA+G
Sbjct  28    NYPPGSCGWPFLGETLKFLKANKEGKPEKFVKERIEKYKSKIFKTSLMGETVVVLGGASG  87

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL-KHYIPTI  511
             NKF F+NEN  +  WWP +V K +      T+ + + + R  +     P+   + YI T+
Sbjct  88    NKFLFSNENKQVVIWWPITVRKIIGSCLITTVGEEAKIMRKMLSTFVSPDAFSRLYIKTM  147

Query  512   DSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMF  691
               +A  H    W    +VKVY L K YTF +AC+LF+SIE  DEV+RL     I+  G+ 
Sbjct  148   QLVAHHHFMNYWQGKEKVKVYPLVKLYTFKVACQLFMSIEDHDEVERLSTQFNILLKGLI  207

Query  692   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTD  871
             SLP+N PGTA+ +AM+  + +R++L++V+K+R+     +++    +  +D+L  LL+  D
Sbjct  208   SLPINLPGTAFYKAMRATTAIRKELLQVVKKRRETLEQNTA----SPSQDILSHLLSCPD  263

Query  872   EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1051
             E G++++E  I + I+  L   + + S A+T ++K LAE P IYQ + +E IEIA SK  
Sbjct  264   ENGKYMSELLIVNNILLFLFAGHDTSSVALTLLIKRLAEHPQIYQNILQEHIEIASSKKE  323

Query  1052  NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYST  1231
              E L+W+D+QKMKYSWNVV E +RL PP  G +RE + +  Y G+ IPKGWK +WN   T
Sbjct  324   GEFLNWDDIQKMKYSWNVVSEVMRLTPPIMGAYREAIVDINYGGYHIPKGWKFYWNTALT  383

Query  1232  HKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFK  1411
               +P+ F      +PSRFEG GPAP+T++PFG GPRMC GKE+ARLEIL+F+H+++  F 
Sbjct  384   SLDPEIFPNATSLEPSRFEGVGPAPYTYIPFGGGPRMCVGKEFARLEILIFLHSLIRKFN  443

Query  1412  MEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              + L+P+EK++Y +  P+P+ GLP+ L PH
Sbjct  444   WKLLIPNEKMIY-DPMPTPLEGLPISLQPH  472



>ref|XP_010450437.1| PREDICTED: beta-amyrin 28-oxidase-like [Camelina sativa]
Length=476

 Score =   389 bits (998),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 296/460 (64%), Gaps = 21/460 (5%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKY----SPEVFKTSILGE  304
             ++ S  NLPPG  G+P+IGES   +       P+K+I+DR++++    S  VFKT + G 
Sbjct  26    SHFSYQNLPPGKIGFPLIGESFSFLSAGRRGHPEKFITDRVRRFYSSSSSCVFKTHLFGS  85

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPE  484
               AV  GA+GNKF FTNEN L+ +WWP SV K      Q + ++ +   R  + +  KPE
Sbjct  86    PTAVVTGASGNKFLFTNENKLVVSWWPDSVNKIFPSSMQTSSKEEAKKLRMILSQFMKPE  145

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L+ Y+  +D +A+ H   EWA   ++ V+ L+K +TF++AC+ FLS++  + V++L + 
Sbjct  146   ALRKYVGVMDEIAQRHFEMEWANQDQLMVFPLTKKFTFSIACRSFLSMDDPERVRQLREK  205

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDV  844
                V  G+FS+P++ PGT +NRA+K   ++R+++  +I++RK E      GK   E +D+
Sbjct  206   FNTVGVGVFSIPIDLPGTRFNRAIKASRLLRKEVSAIIRQRKEEL---KDGKALEE-KDI  261

Query  845   LGRLL-NLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             L  +L N+ + + + L +      IIG+L+  + + S   TF++ +LAE PHIYQ+V +E
Sbjct  262   LSHMLMNIGETKDEDLAD-----KIIGVLIGGHDTASIVCTFIVNYLAEFPHIYQRVLQE  316

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q EI   K   + L WED++KM+YSWNV CE +R+ PP  G FRE +  F++ GF IPKG
Sbjct  317   QNEILNQKK-EKGLRWEDIEKMRYSWNVACEVMRIVPPLPGTFREAIDHFSFKGFYIPKG  375

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WK +W+  +TH NP YF EPE+FDP+RFEGSGP P+T+VPFG GPRMCPG+EY RLEIL+
Sbjct  376   WKLYWSATATHMNPDYFPEPERFDPNRFEGSGPKPYTYVPFGGGPRMCPGREYGRLEILI  435

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
             FMHN+V  FK E + P E  +  +  P P  GLP+R+ P 
Sbjct  436   FMHNLVKRFKWELVSPKENKIVVDPLPIPSEGLPIRIFPQ  475



>gb|EPS63622.1| hypothetical protein M569_11162 [Genlisea aurea]
Length=966

 Score =   403 bits (1035),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 291/451 (65%), Gaps = 15/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +LPPGS+GWP+IGES+ L+       P+K+  DR+ KYS  VF+T++ G++V VF G AG
Sbjct  523   HLPPGSSGWPIIGESLTLLYDAWRGHPEKFFFDRIAKYSSPVFRTNLFGQRVVVFFGTAG  582

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKI--STLNRNNIHEIFKPENLKHYIPT  508
             NK+ F++EN  + +W   S  K  +FP+   +  +      R  +    KPE L  Y+  
Sbjct  583   NKYLFSHENKTVQSWLMPSYDK--LFPSTANISAVEEGLRLRKLLPGYVKPEALSGYVGI  640

Query  509   IDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGM  688
             +D +A  +  E W     V V+A  K  TF +A ++FLSIE   E+    +P   V+ G+
Sbjct  641   MDEIANRYFKECWEGKGNVVVHAAMKNITFWIASRVFLSIEDPVEMADFWEPFDAVNDGV  700

Query  689   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLT  868
              ++P++ PGTA+N+AMK    +R +LV +I+ RKA  +  ++        D+L  +L   
Sbjct  701   VAIPIDLPGTAFNKAMKASKHIRNELVSIIRRRKALMLEGTAAP----PHDILSHMLLTA  756

Query  869   DEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1048
             D+ G+ + + EI   I+GIL+    + S   TFV+KFLAE P +Y  VY+EQ+EI K K 
Sbjct  757   DDNGKLMEDMEIATKILGILVAGQDTTSTITTFVVKFLAEYPQVYDAVYEEQMEILKWKK  816

Query  1049  PNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYS  1228
               E L WEDVQKMKY+WNV CEA RL+PP QGGFRE +++F++ GF IPKGWK +W+  S
Sbjct  817   EGELLKWEDVQKMKYTWNVACEAFRLYPPVQGGFREAIADFSFNGFHIPKGWKIYWSTNS  876

Query  1229  THKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNF  1408
             TH+NP+Y+ +PE+FDP RF+G G  P++F+PFG GPRMCPGKEYARL+ILV +HN+V  F
Sbjct  877   THRNPEYYPDPERFDPMRFDGRGVEPYSFIPFGGGPRMCPGKEYARLKILVIIHNMVKRF  936

Query  1409  KMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
               EK++ DEK V  N  PSP  GLP+RL PH
Sbjct  937   GWEKVVADEK-VNINPFPSPAKGLPIRLIPH  966



>ref|XP_002325241.2| hypothetical protein POPTR_0018s13450g [Populus trichocarpa]
 gb|EEF03806.2| hypothetical protein POPTR_0018s13450g [Populus trichocarpa]
Length=467

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/458 (45%), Positives = 294/458 (64%), Gaps = 25/458 (5%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             ++    PNLPPGS+G P IGE+++L++      P K+  DR  KY+ EVFKT++  +  A
Sbjct  27    RSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNLFCQPAA  86

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENLK  493
             V CGAAGN+F F+N+N +L  W+P  V K      Q  L +     R  + E+ +P+ LK
Sbjct  87    VLCGAAGNRFLFSNKNKVLKAWYPDFVCKIFPSSVQRPLIEQVDRLRTLLPELLRPDALK  146

Query  494   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIII  673
              Y+   D  A  H A EW   + V V+ L+K +TF LAC LFLSIE  D + +L  P  +
Sbjct  147   RYVGIFDKAAGRHFASEWENKKVVVVFPLAKRFTFGLACSLFLSIEDPDHIAKLASPFNL  206

Query  674   VSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGR  853
             V SG+FS+P++ PGT  +RA+K  +++R +L  +IK+RK +    + GK   + +D+L  
Sbjct  207   VVSGIFSIPIDLPGTPLSRAIKASTIIRTELFAIIKQRKKDL---AKGKASPK-QDILSH  262

Query  854   LLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEI  1033
             +L   DE+G  ++E +I   I+ +L   + S SAA  F++K+LAELP IY  VYKEQ++I
Sbjct  263   MLA-CDEKGAFMSELDIADTILALLASAHESTSAACAFIVKYLAELPLIYNAVYKEQMKI  321

Query  1034  AKSKGP-NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKT  1210
             +++K P ++ L+W D+Q M YSWNV+ E LRL P      RE + +F + GF+IPKGWK 
Sbjct  322   SETKAPGDDLLNWNDIQNMTYSWNVIREVLRLCPTFP-NVREAIHDFDFNGFSIPKGWKA  380

Query  1211  FWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMH  1390
                        KYF EPE+FDPSRFEG+GPAP+TFVPFG GP MCPG+ +ARLE+L+FMH
Sbjct  381   -----------KYFPEPERFDPSRFEGTGPAPYTFVPFGGGPMMCPGQGFARLEMLIFMH  429

Query  1391  NVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             N+V  FK +K + +EKI++ +  P P  G+P+RL PH+
Sbjct  430   NLVKRFKFDKFVAEEKIMF-SPMPIPEKGVPIRLFPHR  466



>gb|EPS59491.1| hypothetical protein M569_15315, partial [Genlisea aurea]
Length=471

 Score =   387 bits (994),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 289/455 (64%), Gaps = 14/455 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVA  313
             K+   K NLPPG  GWP+IGES+D         P K+   R++KY   +FKTS+LGEK+A
Sbjct  21    KSTDGKRNLPPGGYGWPIIGESLDFFRDARNGEPQKFALSRVEKYKSPIFKTSLLGEKMA  80

Query  314   VFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLN-RNNIHEIFKPENL  490
                GA+GNKF F+NEN L++ WWP SV + L+ P  +T      L  R  +     PE  
Sbjct  81    FLSGASGNKFLFSNENKLVSLWWPASV-RRLLGPCLSTTSGEEGLAMRKFMSHFLNPERF  139

Query  491   -KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRD-EVKRLLDP  664
              K YI T+DS+ ++H+   W    EV V+  +K YTF LAC+LFLS++  D E++RL D 
Sbjct  140   SKVYITTMDSVTQQHVRNHWEGKSEVNVFKTAKFYTFELACRLFLSLDDSDGEIRRLFDL  199

Query  665   IIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG-RD  841
               +   G+ SL  NFPG  ++ A +   +++++L  +++ RK   M+    + + +  +D
Sbjct  200   FNVFLKGIISLDFNFPGFRFHAANRATLVIKQRLQNIVRNRKQ--MLEQGTRTDADAPQD  257

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L  LL   DE G+ + E  I + I+ +L   + + S+AIT V+K+LAELP +Y+ V KE
Sbjct  258   LLTHLLVACDENGKFMAESMIVNNILMLLFAGHDTSSSAITLVMKYLAELPQVYEDVLKE  317

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q EIA  K   E L WED+QKM+Y+WNVV E +RL PP  G FRE + + TY G+ IPKG
Sbjct  318   QEEIAGGKESGEFLRWEDIQKMRYTWNVVSEVIRLAPPVVGSFREALVDITYGGYHIPKG  377

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILV  1381
             WK +W   STH++P  F E ++FDPSRFEGSGP P++FV FG GPRMC GKE ARLEIL+
Sbjct  378   WKLYWGAPSTHRDPDLFAECDRFDPSRFEGSGPVPYSFVAFGGGPRMCLGKELARLEILI  437

Query  1382  FMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPV  1486
             F+HNVV  ++    M DE++VY +  P+P++GL +
Sbjct  438   FLHNVVRRYEWRLKMGDERVVY-DPMPTPIHGLDI  471



>ref|XP_011096738.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=475

 Score =   387 bits (993),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 206/461 (45%), Positives = 288/461 (62%), Gaps = 19/461 (4%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGESIDLMV--PDKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + N +   LPPGS GWP++GES++ +   P+K++ DRMKKYSP++FKT ILGEK AV CG
Sbjct  23    RRNNAGAKLPPGSFGWPILGESVEFLFGKPEKFVGDRMKKYSPDIFKTKILGEKTAVICG  82

Query  326   AAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHE--------IFKP  481
               G+KF F+NE+   T + P   ++ L    ++            + E          KP
Sbjct  83    PNGHKFLFSNEHKYFTAFRPHP-MQHLFRSYKDKAAPPPPPETQRLDETKTIRQPGFLKP  141

Query  482   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLD  661
             E L  Y+  +D + ++ +         V+ Y L+K  T TLAC+ FL I   + + RL+ 
Sbjct  142   EALMRYLAKMDIVTQQQLKTHCEGKNVVEAYPLAKTITLTLACQFFLGINNPERIARLVK  201

Query  662   PIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRD  841
                 V+ GM  L +N PGT + RA K  + +R++L+ VIKE+K    M+S G +     D
Sbjct  202   YFDDVTVGMHCLMINVPGTIFYRANKAAAAIRKELITVIKEKKQA--MASGGPM----LD  255

Query  842   VLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKE  1021
             +L  ++  TD  G+ + E EI   I+G+L   Y +++  ITF++K++   P IY++V  E
Sbjct  256   ILSHMIVATDPSGKSMPEAEIADKIMGLLTAGYSTVATTITFLMKYVGLNPEIYEKVRAE  315

Query  1022  QIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKG  1201
             Q+EIA SK   E L WED+ KMKYSWNV+CE +RL PP QG FRE ++EF+YAG+TIPKG
Sbjct  316   QMEIAASKKAGELLEWEDMSKMKYSWNVICETMRLVPPLQGTFREVLTEFSYAGYTIPKG  375

Query  1202  WKTFWNVYSTHKNPKYFTEPEKFDPSRFEGS-GPAPFTFVPFGSGPRMCPGKEYARLEIL  1378
             WK +W V +T+ NP+YF +PEKF+PSR+E S  P P+T VPFG GPRMCPGKEYARL IL
Sbjct  376   WKVYWTVSTTNMNPQYFKDPEKFNPSRYEESEAPPPYTSVPFGGGPRMCPGKEYARLAIL  435

Query  1379  VFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPH  1501
              F+HNVV ++K E + P+EK V  +  P P  GLPVRL  H
Sbjct  436   AFVHNVVKDYKWEVVDPNEK-VEGDMMPEPQKGLPVRLYHH  475



>gb|AHF22082.1| CYP716D22 [Artemisia annua]
Length=479

 Score =   387 bits (993),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 293/466 (63%), Gaps = 21/466 (5%)
 Frame = +2

Query  143   FITKANTSKPNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEV-FKTSILG  301
             +   +  SK NLPPGS GWP +GES+ L+       P+++I++R++K+   V FKTS+LG
Sbjct  22    YTKSSQRSKINLPPGSFGWPFLGESLSLLRACWAGEPERFINERIEKHGNSVVFKTSLLG  81

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLR-KISTLNRNNIHEIFK  478
             + +AV CG AGNKF F NEN L+  WWP  V K L      T+R   +   R  +     
Sbjct  82    DYMAVLCGPAGNKFLFGNENKLVAAWWPLPVRK-LFGRCLITIRGDEAKWMRKMLLSYLG  140

Query  479   PENLK-HYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
             P+    HY  T+D + + HI   W    EV VY   K Y F LAC+LF+S+E  + + +L
Sbjct  141   PDAFATHYAVTMDVVTRRHIEVHWRGKEEVNVYQTVKLYAFELACRLFMSLEEPNHIAKL  200

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERK---AEAMMSSSGKVE  826
                  +   G+  LP++FPGT +  + K  + +R +L  +I  R+   AE   +SS    
Sbjct  201   ASLFNVFLKGIIELPIDFPGTRFYSSKKAAAAIRTELKTLINARRVALAEGKATSS----  256

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQ  1006
                +D+L  LL  +DE+G++L E EI + I+ +L   + + + +IT ++K LAE P +Y 
Sbjct  257   ---QDLLSHLLTSSDEDGKYLTEMEIANNILLLLFAGHDTSTCSITLLMKRLAEHPAVYD  313

Query  1007  QVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGF  1186
             +V KE ++I K+K   E L WED+QKMKYSWNVV E +RL PP  G +RE + +F Y G+
Sbjct  314   KVLKEHLDICKTKEAGELLKWEDIQKMKYSWNVVSEVMRLTPPIVGAYREALVDFEYGGY  373

Query  1187  TIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYAR  1366
             TIPKGWK +W+  + HK+   F + E+FDPSRFEG+GP PFT+VPFG GPRMC GKE++R
Sbjct  374   TIPKGWKLYWSAAAAHKDEANFEDVERFDPSRFEGAGPTPFTYVPFGGGPRMCLGKEFSR  433

Query  1367  LEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LE+LV++HN+VTNFK + L+PDEKI Y+  A  P  GLP+RL PHQ
Sbjct  434   LEVLVYLHNIVTNFKWDLLIPDEKIEYDPMA-VPEKGLPIRLHPHQ  478



>ref|XP_006445580.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
 gb|ESR58820.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
Length=484

 Score =   387 bits (993),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 200/454 (44%), Positives = 284/454 (63%), Gaps = 20/454 (4%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+LPPG+ GWPVIGE++  +       P+++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  39    PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  98

Query  332   GNKffftnentllttWWPQSVIKPLMFPTQNTLR---KISTLNRNNIHEIFKPENLKHYI  502
             G+K  F+NEN L+ TWWP SV K  +F T   ++       + R  +     P  L  Y+
Sbjct  99    GHKLLFSNENKLVRTWWPSSVGK--LFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYV  156

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               ID + ++HIA  W    EVKV+   K YTF LAC L  S+E    + +L     I   
Sbjct  157   ERIDMITQQHIATYWEGKEEVKVHPTVKLYTFELACHLLASVEDPLLISKLASHFNIFLK  216

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ S P+NFPGT + ++++    +R +L+++I ++  EA+ S         +D+L RL+ 
Sbjct  217   GVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSK--------QDLLSRLVV  268

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
             + D  G+ L E E+   I+ +L  ++ + S+AIT +LK+L ++P +++ V +EQI IA+S
Sbjct  269   IADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAES  328

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K   E L WED+QKMKY+WNV  E +RL PP  G FRE + +FTY+G+TIPKGWK  W+ 
Sbjct  329   KEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWST  388

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
              STHK+   F  PE FD SRFE  G  P+++VPFG GPRMCPG E+ RL ILVF+HN++ 
Sbjct  389   GSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIK  448

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              FK + L+PDEK  Y+    SP  GLP+RL PHQ
Sbjct  449   RFKWDLLIPDEKFGYDPML-SPSQGLPIRLQPHQ  481



>ref|XP_006488945.1| PREDICTED: cytochrome P450 716B2-like [Citrus sinensis]
Length=500

 Score =   387 bits (993),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 200/454 (44%), Positives = 284/454 (63%), Gaps = 20/454 (4%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGESIDLMV------PDKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+LPPG+ GWPVIGE++  +       P+++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  55    PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  114

Query  332   GNKffftnentllttWWPQSVIKPLMFPTQNTLR---KISTLNRNNIHEIFKPENLKHYI  502
             G+K  F+NEN L+ TWWP SV K  +F T   ++       + R  +     P  L  Y+
Sbjct  115   GHKLLFSNENKLVRTWWPSSVGK--LFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYV  172

Query  503   PTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSS  682
               ID + ++HIA  W    EVKV+   K YTF LAC L  S+E    + +L     I   
Sbjct  173   ERIDMITQQHIATYWEGKEEVKVHPTVKLYTFELACHLLASVEDPLLISKLASHFNIFLK  232

Query  683   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLN  862
             G+ S P+NFPGT + ++++    +R +L+++I ++  EA+ S         +D+L RL+ 
Sbjct  233   GVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSK--------QDLLSRLVV  284

Query  863   LTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1042
             + D  G+ L E E+   I+ +L  ++ + S+AIT +LK+L ++P +++ V +EQI IA+S
Sbjct  285   IADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAES  344

Query  1043  KGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNV  1222
             K   E L WED+QKMKY+WNV  E +RL PP  G FRE + +FTY+G+TIPKGWK  W+ 
Sbjct  345   KEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWST  404

Query  1223  YSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVT  1402
              STHK+   F  PE FD SRFE  G  P+++VPFG GPRMCPG E+ RL ILVF+HN++ 
Sbjct  405   GSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIK  464

Query  1403  NFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              FK + L+PDEK  Y+    SP  GLP+RL PHQ
Sbjct  465   RFKWDLLIPDEKFGYDPML-SPSQGLPIRLQPHQ  497



>ref|XP_004301516.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   387 bits (994),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 296/467 (63%), Gaps = 30/467 (6%)
 Frame = +2

Query  179   PPGSTGWPVIGESIDLM------VPDKYISDRMKKYSP----------EVFKTSILGEKV  310
             PPGS+GWP+IGE +         VP+K+I  R  KYS           +VF TS+L E V
Sbjct  41    PPGSSGWPIIGEGLSFTMTAKRGVPEKFIEKRRIKYSSSDSKGSNSSCKVFTTSLLRESV  100

Query  311   AVFCGAAGNKffftnentllttWWPQSVIKPLMFP--TQNTLRKISTLNRNNIHEIFKPE  484
             AV C AAGNKF F+NEN L+ +WWP ++    +FP   +    K S   R  +   F P 
Sbjct  101   AVLCTAAGNKFLFSNENKLVHSWWPYTIYT--IFPGLKKPDTHKDSIRLRKVMSPFFSPN  158

Query  485   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDP  664
              L+ ++  +D   K H+ E W+  ++VKV AL+K +TFTLACK+FL++E  + + +L +P
Sbjct  159   CLQKHVGIMDGFTKRHMDEFWSDEKQVKVLALAKMHTFTLACKIFLNVEDPEVIAKLEEP  218

Query  665   IIIVSSGMFS-LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAE-----AMMSSSGKVE  826
             I  +S+G  S LP+N PGT +NRA++    V + L E+++ R+ +        +++  ++
Sbjct  219   IQHISAGFISTLPINLPGTPFNRAIRASKKVTKDLEEMVERRRIDLDRYRQSTATAADLD  278

Query  827   NEGRDVLGRLLNLTDEEGQHLNEFEIYHY---IIGILLPTYHSISAAITFVLKFLAELPH  997
                +D++ +LL  T   G+ + E +I      + G+L+    ++   I  ++ FL +LP 
Sbjct  279   ENNQDMMSKLLMDTYSNGRQMKETDISDIADKLKGLLIAGSDNVVTTICSMVIFLFQLPT  338

Query  998   IYQQVYKEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTY  1177
             +Y  V KEQ+EIA SK   E L+W D+QKMK++WNV CE LRL PP  G FRE +++F Y
Sbjct  339   VYDAVLKEQMEIADSKAEGELLNWGDIQKMKHTWNVACEVLRLEPPNPGTFREAMTDFVY  398

Query  1178  AGFTIPKGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKE  1357
              G+ IPKG K +W+V+STHKNP+YF +PEKFDPSRFEG GPAP+++VPFG GPRMCPG+E
Sbjct  399   EGYRIPKGMKLYWSVFSTHKNPEYFPDPEKFDPSRFEGEGPAPYSYVPFGGGPRMCPGRE  458

Query  1358  YARLEILVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTP  1498
             YAR  ILVFMHN+VT F+ EK+ PDEK+V +     P  GL VRL P
Sbjct  459   YARFTILVFMHNLVTRFRWEKIFPDEKMVMSPFL-GPTRGLHVRLYP  504



>ref|XP_003629928.1| Cytochrome P450 [Medicago truncatula]
Length=948

 Score =   399 bits (1025),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 287/463 (62%), Gaps = 12/463 (3%)
 Frame = +2

Query  137   IYFITKA-NTSKPNLPPGSTGWPVIGESIDLMVPD------KYISDRMKKYSPEVFKTSI  295
             ++FI +     K NLP G+ G+P +GES + +  +      ++I +RMKKY  +VFKTS+
Sbjct  20    LHFIKRIIKLRKLNLPKGTLGFPFVGESFEFLKANLEGKQIRFIQERMKKYDSKVFKTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIF  475
              GE +AVFCG AGNKF F+NEN  +  WWP SV K L     N +   + + R  +    
Sbjct  80    FGENIAVFCGPAGNKFLFSNENKNVQVWWPSSVKKLLRLSLVNKVGDEAKVTRRLLMSFL  139

Query  476   KPENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRL  655
              PE L++Y+P +D +A+ HI   W    +V VY + + YTF LAC LFLS+E   +V  L
Sbjct  140   NPETLRNYLPNMDRIAQHHINTHWKGKEQVVVYPIIQLYTFELACCLFLSMEDPIDVSNL  199

Query  656   LDPIIIVSSGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEG  835
                      G+    +NFPGT +++AMK    +R+++  ++K+RK +       K  +  
Sbjct  200   SSYFEEFLKGIIGFSINFPGTRFHKAMKAADEIRKEIKMIMKKRKVDL----DEKKASPT  255

Query  836   RDVLGRLLNLTDEEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVY  1015
             +D+L  LL   D  G+ LNE EI   I+ +L   + +  + ++ V+K+L  LP +Y+QV 
Sbjct  256   QDLLSHLLATPDTSGRFLNEVEIIDNILLLLFAGHDTSRSVLSLVMKYLGNLPQVYEQVL  315

Query  1016  KEQIEIAKSKGPNERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIP  1195
             KEQ+EI++ K   E L WED+QKMKYSWNV  E LRL PP  G FR+ + +FTYA + IP
Sbjct  316   KEQLEISQGKEAGELLQWEDIQKMKYSWNVASEVLRLSPPVGGAFRDAIKDFTYADYNIP  375

Query  1196  KGWKTFWNVYSTHKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEI  1375
              GWK  WN ++TH +P  F+ PEKFD SRFEG GP P+++VPFG GPRMC G+E+ARLEI
Sbjct  376   SGWKLHWNTHTTHMDPTLFSNPEKFDASRFEGEGPTPYSYVPFGGGPRMCLGQEFARLEI  435

Query  1376  LVFMHNVVTNFKMEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
             LVFMHN+V  FK + + PDEK  Y+     P NGLP++L P Q
Sbjct  436   LVFMHNIVKRFKWDLVNPDEKFKYDPML-EPENGLPIQLQPSQ  477



>gb|EYU33953.1| hypothetical protein MIMGU_mgv1a023105mg [Erythranthe guttata]
Length=483

 Score =   384 bits (986),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 197/451 (44%), Positives = 289/451 (64%), Gaps = 12/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGESIDLM------VPDKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG+ GWP++GE+++ +      +P K++ +R+ KY+ +VFKTS++G+ VAV  G +G
Sbjct  36    NLPPGTYGWPILGETLEFLNTRFDGLPHKFVQERVDKYNSKVFKTSLMGQSVAVLYGPSG  95

Query  335   NKffftnentllttWWPQSVIKPLMFPTQNTLRKISTLNRNNIHEIFKPENL-KHYIPTI  511
             NKF F+NEN L+T WWP SV K L      T        R  +     P+   K YI  +
Sbjct  96    NKFLFSNENKLVTVWWPSSVRKILGTCISTTGGLQGMHMRKMVSYFVSPDAFTKLYIKKM  155

Query  512   DSMAKEHIAEEWAPFREVKVYALSKCYTFTLACKLFLSIEGRDEVKRLLDPIIIVSSGMF  691
             D  A++HIA  W    E+KV+   + YTF +AC+LF+SIE    +  L     +   G+ 
Sbjct  156   DLTAQQHIANHWLGNDEIKVFEAIRLYTFEVACRLFMSIEDPMHIDTLATLFNVFIKGVI  215

Query  692   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAEAMMSSSGKVENEGRDVLGRLLNLTD  871
             S+P+NFPGT + +A +  + +R++L +++K R+    ++   K     +D+L  LL   D
Sbjct  216   SIPINFPGTRFFKAKRATNSIRKELEKIVKHRR----VALEEKTAVPSQDLLSHLLYYPD  271

Query  872   EEGQHLNEFEIYHYIIGILLPTYHSISAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1051
             E G+ ++E  I + I+ +L   + + S+A+T ++K+LA+ P +YQ+V  EQ +IA SK  
Sbjct  272   ENGKFMSEEVIINNILMLLFAGHDTSSSALTMLIKYLAQHPQVYQKVLTEQNKIASSKKD  331

Query  1052  NERLSWEDVQKMKYSWNVVCEALRLFPPGQGGFRETVSEFTYAGFTIPKGWKTFWNVYST  1231
              E L WED+QKMKYSWNV  EA+RL PP  G FRE V +  Y G+ IPKGWK +W+   T
Sbjct  332   GEFLEWEDLQKMKYSWNVASEAMRLSPPLIGAFREAVVDLNYGGYDIPKGWKLYWSSSLT  391

Query  1232  HKNPKYFTEPEKFDPSRFEGSGPAPFTFVPFGSGPRMCPGKEYARLEILVFMHNVVTNFK  1411
             H++P  F + + FDPSRFEG+GP P+++VPFG GPRMC GKE+ARLEIL+F+HN+V  FK
Sbjct  392   HRDPNLFKDSKDFDPSRFEGTGPIPYSYVPFGGGPRMCLGKEFARLEILIFLHNLVKTFK  451

Query  1412  MEKLMPDEKIVYNNAAPSPVNGLPVRLTPHQ  1504
              E ++  EKI+Y +  P+PV GLP+RL PH 
Sbjct  452   WELVIDSEKIIY-DPIPTPVQGLPIRLRPHH  481



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5121296209290