BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25317_g1_i1 len=1744 path=[1:0-214 216:215-237 239:238-371
373:372-485 487:486-592 594:593-723 725:724-798 5449:799-834
836:835-865 867:866-868 870:869-935 4110:936-953 955:954-1067
1069:1068-1081 1083:1082-1109 1111:1110-1112 1114:1113-1168
1170:1169-1215 1217:1216-1257 4734:1258-1325 4802:1326-1335
1337:1336-1338 1340:1339-1409 4506:1410-1476 1478:1477-1511
1513:1512-1539 1541:1540-1575 1577:1576-1612 1614:1613-1743]

Length=1744
                                                                      Score     E

ref|XP_006353629.1|  PREDICTED: cytochrome P450 716B2-like              630   0.0      
ref|XP_004241821.1|  PREDICTED: beta-amyrin 28-oxidase-like             615   0.0      
emb|CDP18172.1|  unnamed protein product                                611   0.0      
ref|XP_006353706.1|  PREDICTED: cytochrome P450 716B2-like              607   0.0      
ref|XP_004242231.1|  PREDICTED: beta-amyrin 28-oxidase-like             602   0.0      
gb|EYU22847.1|  hypothetical protein MIMGU_mgv1a022104mg                598   0.0      
ref|XP_009620720.1|  PREDICTED: beta-amyrin 28-oxidase-like             594   0.0      
ref|XP_009768074.1|  PREDICTED: beta-amyrin 28-oxidase-like             593   0.0      
ref|XP_011099144.1|  PREDICTED: beta-amyrin 28-oxidase-like             589   0.0      
ref|XP_009768075.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       582   0.0      
ref|XP_009601238.1|  PREDICTED: beta-amyrin 28-oxidase-like             577   0.0      
emb|CDP10718.1|  unnamed protein product                                572   0.0      
emb|CDP10717.1|  unnamed protein product                                569   0.0      
ref|XP_010056285.1|  PREDICTED: beta-amyrin 28-oxidase-like             548   0.0      
ref|XP_010056287.1|  PREDICTED: beta-amyrin 28-oxidase-like             540   0.0      
ref|XP_010070480.1|  PREDICTED: beta-amyrin 28-oxidase-like             537   0.0      
ref|XP_010063751.1|  PREDICTED: beta-amyrin 28-oxidase-like             534   0.0      
gb|EYU22845.1|  hypothetical protein MIMGU_mgv1a021193mg                530   4e-180   
ref|XP_006376223.1|  hypothetical protein POPTR_0013s11080g             521   1e-176   
ref|XP_002521782.1|  cytochrome P450, putative                          518   1e-175   Ricinus communis
gb|KCW72951.1|  hypothetical protein EUGRSUZ_E01403                     512   2e-173   
ref|XP_002278948.1|  PREDICTED: beta-amyrin 28-oxidase                  513   2e-173   Vitis vinifera
ref|XP_002319920.2|  hypothetical protein POPTR_0013s11090g             513   2e-173   Populus trichocarpa [western balsam poplar]
ref|XP_010669702.1|  PREDICTED: beta-amyrin 28-oxidase-like             513   2e-173   
ref|XP_011001074.1|  PREDICTED: beta-amyrin 28-oxidase-like             513   6e-173   
ref|XP_011074929.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    509   1e-172   
ref|XP_011001073.1|  PREDICTED: beta-amyrin 28-oxidase-like             512   1e-172   
ref|XP_010252185.1|  PREDICTED: beta-amyrin 28-oxidase-like             511   2e-172   
ref|XP_011003986.1|  PREDICTED: beta-amyrin 28-oxidase-like             510   2e-172   
ref|XP_007023618.1|  Cytochrome P450                                    508   8e-172   
ref|XP_002279608.1|  PREDICTED: beta-amyrin 28-oxidase                  508   8e-172   Vitis vinifera
ref|XP_002279623.1|  PREDICTED: beta-amyrin 28-oxidase                  508   2e-171   Vitis vinifera
ref|XP_002325975.1|  hypothetical protein POPTR_0019s10970g             506   1e-170   Populus trichocarpa [western balsam poplar]
ref|XP_002526799.1|  cytochrome P450, putative                          504   3e-170   Ricinus communis
ref|XP_007014637.1|  Cytochrome P450                                    503   1e-169   
gb|KDP42281.1|  hypothetical protein JCGZ_01605                         502   3e-169   
gb|AGN04219.1|  cytochrome P450                                         501   8e-169   
ref|XP_007011469.1|  Cytochrome P450                                    500   1e-168   
ref|XP_002528002.1|  cytochrome P450, putative                          499   2e-168   Ricinus communis
ref|XP_007023620.1|  Cytochrome P450                                    499   3e-168   
ref|XP_002513183.1|  cytochrome P450, putative                          498   8e-168   Ricinus communis
ref|XP_010058451.1|  PREDICTED: beta-amyrin 28-oxidase-like             498   1e-167   
ref|NP_001268115.1|  cytochrome P450 CYP716A15                          496   6e-167   
ref|XP_010696134.1|  PREDICTED: beta-amyrin 28-oxidase-like             496   9e-167   
ref|XP_007020151.1|  Cytochrome P450                                    495   1e-166   
ref|XP_006338129.1|  PREDICTED: cytochrome P450 716B2-like              495   1e-166   
ref|XP_010048517.1|  PREDICTED: beta-amyrin 28-oxidase-like             495   2e-166   
ref|XP_011031513.1|  PREDICTED: beta-amyrin 28-oxidase-like             493   6e-166   
ref|XP_002263499.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       493   7e-166   Vitis vinifera
emb|CBI39273.3|  unnamed protein product                                508   8e-166   
emb|CBI39948.3|  unnamed protein product                                493   8e-166   
ref|XP_011078182.1|  PREDICTED: beta-amyrin 28-oxidase-like             493   1e-165   
ref|XP_004243906.1|  PREDICTED: beta-amyrin 28-oxidase-like             493   1e-165   
ref|XP_007020143.1|  Cytochrome P450                                    493   1e-165   
ref|XP_004239296.1|  PREDICTED: beta-amyrin 28-oxidase                  492   2e-165   
ref|XP_002325964.2|  hypothetical protein POPTR_0019s10730g             492   2e-165   Populus trichocarpa [western balsam poplar]
ref|XP_007160209.1|  hypothetical protein PHAVU_002G302100g             491   4e-165   
ref|XP_009609682.1|  PREDICTED: beta-amyrin 28-oxidase-like             491   4e-165   
gb|AHL46848.1|  cytochrome P450                                         491   5e-165   
ref|XP_009759030.1|  PREDICTED: beta-amyrin 28-oxidase-like             491   8e-165   
gb|AJD25248.1|  cytochrome P450 CYP716A89                               490   1e-164   
ref|XP_011093941.1|  PREDICTED: beta-amyrin 28-oxidase-like             490   1e-164   
ref|XP_003530525.1|  PREDICTED: cytochrome P450 716B2                   490   2e-164   
ref|XP_002279472.1|  PREDICTED: beta-amyrin 28-oxidase                  489   3e-164   Vitis vinifera
ref|XP_007020144.1|  Cytochrome P450                                    489   3e-164   
ref|XP_002266024.1|  PREDICTED: beta-amyrin 28-oxidase                  489   3e-164   Vitis vinifera
ref|XP_006372247.1|  cytochrome P450 family protein                     489   5e-164   
ref|XP_003525322.1|  PREDICTED: cytochrome P450 716B2-like              488   1e-163   
gb|AIT93302.1|  cytochrome P450 monooxygenase CYP716A12                 487   2e-163   
dbj|BAP59951.1|  cytochrome P450 monooxygenase CYP716A50                487   2e-163   
ref|XP_007222742.1|  hypothetical protein PRUPE_ppa004988mg             487   2e-163   
ref|XP_011017588.1|  PREDICTED: beta-amyrin 28-oxidase-like             487   3e-163   
ref|XP_003531849.1|  PREDICTED: cytochrome P450 716B2 isoform X1        486   3e-163   
ref|XP_009345334.1|  PREDICTED: beta-amyrin 28-oxidase-like             486   4e-163   
ref|XP_006353745.1|  PREDICTED: cytochrome P450 716B2-like              486   4e-163   
gb|ABC59076.1|  cytochrome P450 monooxygenase CYP716A12                 486   4e-163   Medicago truncatula
ref|XP_008224572.1|  PREDICTED: beta-amyrin 28-oxidase-like             486   5e-163   
gb|KCW72928.1|  hypothetical protein EUGRSUZ_E01367                     485   7e-163   
emb|CAN72302.1|  hypothetical protein VITISV_041935                     486   7e-163   Vitis vinifera
emb|CBN88268.1|  cytochrome P450 monoxygenase                           486   7e-163   
ref|NP_001268076.1|  cytochrome P450 CYP716A17                          486   8e-163   
ref|XP_009787233.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   2e-162   
gb|AEX07772.1|  cytochrome P450                                         484   3e-162   
ref|XP_009591188.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   3e-162   
ref|XP_010048515.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   3e-162   
ref|XP_011031249.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   3e-162   
ref|XP_011019870.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   4e-162   
ref|XP_002522937.1|  cytochrome P450, putative                          484   4e-162   Ricinus communis
ref|XP_010245748.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   4e-162   
ref|XP_010046875.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   4e-162   
gb|AFK47215.1|  unknown                                                 483   5e-162   
ref|XP_010252179.1|  PREDICTED: beta-amyrin 28-oxidase-like             484   5e-162   
ref|XP_009376339.1|  PREDICTED: beta-amyrin 28-oxidase-like             483   6e-162   
ref|XP_002264643.3|  PREDICTED: beta-amyrin 28-oxidase-like             484   7e-162   Vitis vinifera
ref|XP_002280969.1|  PREDICTED: beta-amyrin 28-oxidase                  483   9e-162   Vitis vinifera
gb|ACJ84447.1|  unknown                                                 483   1e-161   Medicago truncatula
ref|XP_008391096.1|  PREDICTED: beta-amyrin 28-oxidase                  483   1e-161   
ref|XP_002309057.1|  hypothetical protein POPTR_0006s08560g             482   2e-161   Populus trichocarpa [western balsam poplar]
gb|EYU25770.1|  hypothetical protein MIMGU_mgv1a005482mg                481   4e-161   
emb|CBI39253.3|  unnamed protein product                                480   5e-161   
emb|CAN67939.1|  hypothetical protein VITISV_013692                     481   8e-161   Vitis vinifera
sp|I7C6E8.1|C7A52_PANGI  RecName: Full=Beta-amyrin 28-oxidase; Al...    480   1e-160   
emb|CBI39268.3|  unnamed protein product                                479   2e-160   
gb|EYU26567.1|  hypothetical protein MIMGU_mgv1a005379mg                479   2e-160   
ref|XP_004503562.1|  PREDICTED: cytochrome P450 716B2-like              479   4e-160   
dbj|BAP59949.1|  cytochrome P450 monooxygenase CYP716A48                478   7e-160   
gb|AED99868.1|  cytochrome P450                                         478   9e-160   
gb|AHF22088.1|  CYP716A75                                               477   2e-159   
gb|EYU26566.1|  hypothetical protein MIMGU_mgv1a021994mg                476   2e-159   
emb|CDP14237.1|  unnamed protein product                                476   4e-159   
ref|XP_010095208.1|  Cytochrome P450                                    476   4e-159   
ref|XP_009778451.1|  PREDICTED: beta-amyrin 28-oxidase-like             471   4e-157   
ref|XP_006488697.1|  PREDICTED: cytochrome P450 716B2-like              473   4e-157   
gb|KDO67048.1|  hypothetical protein CISIN_1g037867mg                   471   5e-157   
gb|KHN16705.1|  Cytochrome P450 716B2                                   470   6e-157   
ref|XP_007139495.1|  hypothetical protein PHAVU_008G034400g             470   7e-157   
ref|XP_006425177.1|  hypothetical protein CICLE_v10030148mg             470   1e-156   
ref|XP_006353795.1|  PREDICTED: cytochrome P450 716B2-like              469   2e-156   
emb|CBI39252.3|  unnamed protein product                                472   2e-156   
dbj|BAP59952.1|  cytochrome P450 monooxygenase CYP716A51                468   5e-156   
ref|XP_004296643.1|  PREDICTED: cytochrome P450 716B1-like              466   5e-155   
ref|XP_002279492.2|  PREDICTED: beta-amyrin 28-oxidase                  461   1e-153   Vitis vinifera
ref|XP_011017728.1|  PREDICTED: beta-amyrin 28-oxidase-like             461   2e-153   
gb|AFK79029.1|  cytochrome P450 CYP716A41                               459   1e-152   
ref|XP_002324669.1|  hypothetical protein POPTR_0018s13390g             459   1e-152   Populus trichocarpa [western balsam poplar]
emb|CDP19704.1|  unnamed protein product                                457   9e-152   
ref|XP_004139087.1|  PREDICTED: cytochrome P450 716B1-like              457   1e-151   
gb|KCW72929.1|  hypothetical protein EUGRSUZ_E01368                     455   2e-151   
gb|KDP43440.1|  hypothetical protein JCGZ_16727                         456   2e-151   
gb|AHF22083.1|  CYP716A14v2                                             456   2e-151   
ref|XP_008443638.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1       456   4e-151   
gb|EYU25767.1|  hypothetical protein MIMGU_mgv1a025883mg                455   4e-151   
gb|EYU26851.1|  hypothetical protein MIMGU_mgv1a005213mg                456   4e-151   
gb|ACU20818.1|  unknown                                                 453   1e-150   Glycine max [soybeans]
gb|KHM99864.1|  Cytochrome P450 716B2                                   451   2e-150   
gb|EYU25763.1|  hypothetical protein MIMGU_mgv1a024885mg                453   2e-150   
ref|XP_004296583.1|  PREDICTED: cytochrome P450 716B1-like              454   3e-150   
gb|EYU38301.1|  hypothetical protein MIMGU_mgv1a005334mg                452   7e-150   
gb|ABC94483.1|  putative taxadiene 5-alpha-hydroxylase cytochrome...    452   9e-150   Artemisia annua [sweet Annie]
gb|KDP42282.1|  hypothetical protein JCGZ_01606                         450   1e-149   
ref|XP_010661150.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       451   1e-149   
gb|EYU38302.1|  hypothetical protein MIMGU_mgv1a006499mg                449   3e-149   
sp|I7CT85.1|C7A53_PANGI  RecName: Full=Protopanaxadiol 6-hydroxyl...    450   5e-149   
gb|AHK23636.1|  cytochrome P450                                         450   5e-149   
emb|CBI24045.3|  unnamed protein product                                448   6e-149   
gb|EYU26852.1|  hypothetical protein MIMGU_mgv1a005293mg                450   9e-149   
gb|AED99872.1|  cytochrome P450                                         449   1e-148   
gb|EYU38303.1|  hypothetical protein MIMGU_mgv1a025102mg                445   1e-147   
ref|XP_010533078.1|  PREDICTED: beta-amyrin 28-oxidase-like             444   1e-146   
gb|EYU25766.1|  hypothetical protein MIMGU_mgv1a005367mg                443   5e-146   
gb|AFU93031.1|  cytochrome P450                                         442   7e-146   
gb|AEY75213.1|  cytochrome P450 CYP716A47                               441   2e-145   
sp|H2DH16.2|C7A47_PANGI  RecName: Full=Dammarenediol 12-hydroxyla...    441   2e-145   
emb|CAN63680.1|  hypothetical protein VITISV_036273                     440   2e-145   Vitis vinifera
emb|CBI39267.3|  unnamed protein product                                441   2e-145   
gb|EYU26126.1|  hypothetical protein MIMGU_mgv1a017761mg                439   6e-145   
gb|AGC31652.1|  cytochrome P450 CYP6H                                   437   6e-144   
ref|XP_002325238.1|  hypothetical protein POPTR_0018s13420g             437   7e-144   Populus trichocarpa [western balsam poplar]
emb|CDP12479.1|  unnamed protein product                                436   1e-143   
gb|AED99867.1|  cytochrome P450                                         437   1e-143   
gb|AIN44011.1|  cytochrome P450                                         437   2e-143   
emb|CBI24076.3|  unnamed protein product                                437   2e-143   
ref|XP_008340177.1|  PREDICTED: beta-amyrin 28-oxidase-like             436   2e-143   
ref|XP_011074924.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    429   4e-143   
ref|XP_002325242.2|  hypothetical protein POPTR_0018s13490g             433   1e-142   Populus trichocarpa [western balsam poplar]
gb|AHA50080.1|  cytochrome P450                                         433   2e-142   
ref|XP_007139496.1|  hypothetical protein PHAVU_008G034500g             432   3e-142   
emb|CDP04721.1|  unnamed protein product                                431   2e-141   
gb|EPS63621.1|  hypothetical protein M569_11161                         431   2e-141   
emb|CDP19705.1|  unnamed protein product                                427   6e-140   
ref|XP_006372166.1|  hypothetical protein POPTR_0018s13380g             421   8e-139   
ref|XP_011017724.1|  PREDICTED: beta-amyrin 28-oxidase-like             421   2e-137   
ref|XP_004308257.1|  PREDICTED: cytochrome P450 716B1-like              421   6e-137   
ref|XP_009364167.1|  PREDICTED: beta-amyrin 28-oxidase-like             416   2e-136   
ref|XP_002324668.2|  hypothetical protein POPTR_0018s13380g             414   4e-136   Populus trichocarpa [western balsam poplar]
gb|KFK23969.1|  hypothetical protein AALP_AAs58682U000100               416   1e-135   
ref|XP_010098502.1|  Cytochrome P450                                    413   1e-134   
gb|KDP33425.1|  hypothetical protein JCGZ_06996                         410   1e-133   
ref|XP_008227229.1|  PREDICTED: beta-amyrin 28-oxidase-like             412   1e-133   
ref|XP_002527982.1|  cytochrome P450, putative                          410   2e-133   Ricinus communis
ref|XP_011048168.1|  PREDICTED: beta-amyrin 28-oxidase-like             407   3e-132   
ref|XP_011048169.1|  PREDICTED: beta-amyrin 28-oxidase-like             406   6e-132   
ref|XP_006405735.1|  hypothetical protein EUTSA_v10027740mg             405   2e-131   
ref|XP_007206798.1|  hypothetical protein PRUPE_ppa025666mg             405   8e-131   
ref|XP_009758679.1|  PREDICTED: beta-amyrin 28-oxidase-like             403   1e-130   
ref|XP_002299097.1|  hypothetical protein POPTR_0001s04010g             403   1e-130   Populus trichocarpa [western balsam poplar]
gb|KHG26601.1|  Cytochrome P450 protein                                 403   2e-130   
ref|XP_009337414.1|  PREDICTED: beta-amyrin 28-oxidase-like             404   2e-130   
emb|CDO98601.1|  unnamed protein product                                402   4e-130   
gb|KCW87056.1|  hypothetical protein EUGRSUZ_B03598                     402   4e-130   
emb|CBI20810.3|  unnamed protein product                                399   6e-130   
ref|XP_010044931.1|  PREDICTED: beta-amyrin 28-oxidase-like             402   7e-130   
emb|CDP14240.1|  unnamed protein product                                396   8e-130   
ref|XP_002325241.2|  hypothetical protein POPTR_0018s13450g             400   8e-130   Populus trichocarpa [western balsam poplar]
ref|XP_008385453.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    402   8e-130   
gb|KDP42301.1|  hypothetical protein JCGZ_01625                         395   2e-129   
ref|XP_003532790.1|  PREDICTED: cytochrome P450 716B2-like              399   3e-129   
ref|XP_011040561.1|  PREDICTED: beta-amyrin 28-oxidase-like             399   3e-129   
ref|XP_004293194.1|  PREDICTED: cytochrome P450 716B1-like              400   3e-129   
ref|XP_008227237.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    400   5e-129   
ref|XP_002317072.2|  hypothetical protein POPTR_0011s15910g             399   6e-129   Populus trichocarpa [western balsam poplar]
ref|XP_003531282.1|  PREDICTED: cytochrome P450 716B2-like isoformX1    398   9e-129   
ref|XP_002868459.1|  CYP716A1                                           398   1e-128   
ref|XP_009617496.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    398   1e-128   
ref|NP_198460.1|  cytochrome P450, family 716, subfamily A, polyp...    397   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598096.1|  PREDICTED: beta-amyrin 28-oxidase-like             397   2e-128   
ref|XP_008358591.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    397   2e-128   
ref|XP_007022977.1|  Cytochrome P450 716B1                              399   3e-128   
gb|AHF49536.1|  CYP450 716-like protein                                 397   4e-128   
ref|XP_010060835.1|  PREDICTED: beta-amyrin 28-oxidase-like             396   4e-128   
ref|XP_004504209.1|  PREDICTED: cytochrome P450 716B1-like              396   6e-128   
ref|XP_004299475.1|  PREDICTED: cytochrome P450 716B2-like              397   6e-128   
ref|XP_004306884.1|  PREDICTED: cytochrome P450 716B1-like              397   6e-128   
ref|XP_007159554.1|  hypothetical protein PHAVU_002G247300g             396   6e-128   
ref|XP_007213882.1|  hypothetical protein PRUPE_ppa005225mg             395   9e-128   
emb|CDP19706.1|  unnamed protein product                                395   1e-127   
ref|XP_010052577.1|  PREDICTED: beta-amyrin 28-oxidase-like             395   1e-127   
ref|XP_002529893.1|  cytochrome P450, putative                          395   2e-127   Ricinus communis
sp|Q50EK0.1|C16B2_PICSI  RecName: Full=Cytochrome P450 716B2; Alt...    395   2e-127   Picea sitchensis
ref|XP_011089169.1|  PREDICTED: beta-amyrin 28-oxidase-like             395   2e-127   
ref|XP_006852240.1|  hypothetical protein AMTR_s00049p00153870          395   2e-127   
ref|XP_008385452.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    395   3e-127   
ref|XP_010450437.1|  PREDICTED: beta-amyrin 28-oxidase-like             394   3e-127   
ref|XP_011085174.1|  PREDICTED: beta-amyrin 28-oxidase-like             394   6e-127   
ref|XP_008358589.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    394   6e-127   
ref|XP_008225706.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    393   7e-127   
ref|XP_010044930.1|  PREDICTED: cytochrome P450 716B1-like              393   7e-127   
ref|XP_011089170.1|  PREDICTED: beta-amyrin 28-oxidase-like             393   1e-126   
ref|XP_006340081.1|  PREDICTED: cytochrome P450 716B1-like              392   1e-126   
ref|XP_006370477.1|  hypothetical protein POPTR_0001s43070g             392   1e-126   
gb|EPS63622.1|  hypothetical protein M569_11162                         407   2e-126   
ref|XP_011016385.1|  PREDICTED: beta-amyrin 28-oxidase-like             391   2e-126   
ref|XP_008349137.1|  PREDICTED: beta-amyrin 28-oxidase-like             392   2e-126   
ref|XP_004293684.1|  PREDICTED: cytochrome P450 716B2-like              392   2e-126   
ref|XP_008225708.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    392   3e-126   
ref|XP_008225705.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    391   5e-126   
ref|XP_007213963.1|  hypothetical protein PRUPE_ppa004999mg             391   6e-126   
ref|XP_003524231.1|  PREDICTED: cytochrome P450 716B2-like              390   9e-126   
ref|XP_004295460.1|  PREDICTED: cytochrome P450 716B1-like              389   2e-125   
ref|XP_004301516.1|  PREDICTED: cytochrome P450 716B2-like              390   2e-125   
ref|XP_008350555.1|  PREDICTED: beta-amyrin 28-oxidase-like             389   3e-125   
ref|XP_003633047.1|  PREDICTED: beta-amyrin 28-oxidase-like             389   3e-125   
sp|Q50EK1.1|C16B1_PICSI  RecName: Full=Cytochrome P450 716B1; Alt...    389   4e-125   Picea sitchensis
ref|XP_009353896.1|  PREDICTED: beta-amyrin 28-oxidase-like             389   5e-125   
gb|EPS59491.1|  hypothetical protein M569_15315                         387   1e-124   
gb|EYU33953.1|  hypothetical protein MIMGU_mgv1a023105mg                387   2e-124   
gb|AHF22082.1|  CYP716D22                                               386   4e-124   
ref|XP_006445580.1|  hypothetical protein CICLE_v10015070mg             386   7e-124   
gb|AJD25250.1|  cytochrome P450 CYP716D25                               385   8e-124   
ref|XP_010435488.1|  PREDICTED: beta-amyrin 28-oxidase-like             385   8e-124   
ref|XP_006488945.1|  PREDICTED: cytochrome P450 716B2-like              386   1e-123   
ref|XP_011004881.1|  PREDICTED: beta-amyrin 28-oxidase-like             384   2e-123   
ref|XP_010440783.1|  PREDICTED: beta-amyrin 28-oxidase-like             384   3e-123   
ref|XP_002529895.1|  cytochrome P450, putative                          382   8e-123   Ricinus communis
ref|XP_006852242.1|  hypothetical protein AMTR_s00049p00155050          382   2e-122   
gb|KDP34865.1|  hypothetical protein JCGZ_09153                         380   2e-122   
ref|XP_004233188.1|  PREDICTED: beta-amyrin 28-oxidase-like             381   2e-122   
ref|XP_009617512.1|  PREDICTED: beta-amyrin 28-oxidase-like             381   4e-122   
ref|XP_008388261.1|  PREDICTED: beta-amyrin 28-oxidase-like             380   6e-122   
gb|ABC94482.1|  putative taxane 13-alpha-hydroxylase cytochrome P450    380   8e-122   Artemisia annua [sweet Annie]
gb|KDP27043.1|  hypothetical protein JCGZ_20978                         377   9e-122   
ref|XP_003629928.1|  Cytochrome P450                                    394   9e-122   
gb|KHN48077.1|  Cytochrome P450 716B2                                   378   1e-121   
ref|XP_008388262.1|  PREDICTED: beta-amyrin 28-oxidase-like             380   1e-121   
ref|XP_011096738.1|  PREDICTED: beta-amyrin 28-oxidase-like             379   2e-121   
ref|XP_008225710.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    378   3e-121   
ref|XP_006340080.1|  PREDICTED: cytochrome P450 716B2-like isofor...    379   3e-121   
ref|XP_008225709.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    377   4e-121   
ref|XP_006283658.1|  hypothetical protein CARUB_v10004715mg             378   5e-121   
gb|ABD60225.1|  ent-kaurenoic acid 13-hydroxylase                       378   6e-121   Stevia rebaudiana
gb|KHN48078.1|  Cytochrome P450 716B2                                   375   2e-120   
ref|XP_006353039.1|  PREDICTED: cytochrome P450 716B2-like              377   2e-120   
gb|ABR16707.1|  unknown                                                 377   2e-120   Picea sitchensis
gb|ACL10147.1|  cytochrome P450 monooxygenase                           376   3e-120   Stevia rebaudiana
gb|EYU29474.1|  hypothetical protein MIMGU_mgv1a020714mg                373   6e-120   
gb|EYU25768.1|  hypothetical protein MIMGU_mgv1a006650mg                374   6e-120   
ref|XP_006852236.1|  hypothetical protein AMTR_s00049p00150940          375   1e-119   
ref|XP_006340079.1|  PREDICTED: cytochrome P450 716B2-like isofor...    374   1e-119   
gb|AHF45909.1|  CYP716Y1                                                374   1e-119   
ref|XP_010031614.1|  PREDICTED: cytochrome P450 716B1-like              374   2e-119   
ref|XP_004306780.1|  PREDICTED: cytochrome P450 716B1-like              374   3e-119   
gb|KHN06480.1|  Cytochrome P450 716B2                                   371   7e-119   
gb|AJD25249.1|  cytochrome P450 CYP716C12                               372   1e-118   
emb|CAN77161.1|  hypothetical protein VITISV_020236                     371   2e-118   
gb|EYU43204.1|  hypothetical protein MIMGU_mgv1a005450mg                370   5e-118   
ref|XP_004171393.1|  PREDICTED: cytochrome P450 716B1-like              364   8e-118   
ref|XP_006585768.1|  PREDICTED: cytochrome P450 716B2 isoform X2        361   4e-117   
gb|KCW78587.1|  hypothetical protein EUGRSUZ_C00059                     367   5e-117   
ref|XP_008443639.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       361   8e-117   
ref|XP_004291627.1|  PREDICTED: cytochrome P450 716B2-like              367   1e-116   
emb|CDP21516.1|  unnamed protein product                                366   1e-116   
gb|KDO51686.1|  hypothetical protein CISIN_1g011873mg                   364   2e-115   
ref|XP_006852239.1|  hypothetical protein AMTR_s00049p00153260          363   2e-115   
ref|XP_006432202.1|  hypothetical protein CICLE_v10001024mg             363   4e-115   
gb|KCW52345.1|  hypothetical protein EUGRSUZ_J01761                     362   5e-115   
emb|CDP18585.1|  unnamed protein product                                359   1e-114   
ref|XP_006829767.1|  hypothetical protein AMTR_s00119p00024530          362   2e-114   
emb|CDP19442.1|  unnamed protein product                                347   3e-112   
ref|XP_008389235.1|  PREDICTED: beta-amyrin 28-oxidase-like             354   1e-111   
ref|XP_006351699.1|  PREDICTED: cytochrome P450 716B2-like              353   2e-111   
ref|XP_010046682.1|  PREDICTED: beta-amyrin 28-oxidase-like             353   5e-111   
ref|XP_006351700.1|  PREDICTED: cytochrome P450 716B2-like              351   1e-110   
ref|XP_006585214.1|  PREDICTED: cytochrome P450 716B2-like isofor...    349   2e-110   
ref|XP_010247736.1|  PREDICTED: beta-amyrin 28-oxidase-like             349   2e-110   
emb|CDP21078.1|  unnamed protein product                                349   3e-110   
gb|EYU26850.1|  hypothetical protein MIMGU_mgv1a018058mg                348   3e-110   
ref|XP_006852238.1|  hypothetical protein AMTR_s00049p00152020          351   2e-109   
dbj|BAC23044.1|  cytochrome P450                                        347   4e-109   
gb|KEH21306.1|  cytochrome P450 family protein                          344   7e-109   
ref|XP_002523409.1|  cytochrome P450, putative                          345   2e-108   
gb|KDO54465.1|  hypothetical protein CISIN_1g013728mg                   342   2e-107   
ref|XP_009344146.1|  PREDICTED: beta-amyrin 28-oxidase-like             337   2e-107   
emb|CAN71865.1|  hypothetical protein VITISV_033123                     342   2e-107   
ref|XP_004250858.1|  PREDICTED: beta-amyrin 28-oxidase                  342   4e-107   
emb|CDP10715.1|  unnamed protein product                                332   7e-107   
ref|XP_010098504.1|  Cytochrome P450                                    341   1e-106   
ref|XP_006443082.1|  hypothetical protein CICLE_v10019893mg             340   6e-106   
ref|XP_003630001.1|  Abscisic acid 8'-hydroxylase                       337   1e-105   
gb|KDO41269.1|  hypothetical protein CISIN_1g011325mg                   338   1e-105   
ref|XP_006443083.1|  hypothetical protein CICLE_v10019890mg             337   4e-105   
emb|CDP21077.1|  unnamed protein product                                335   2e-104   
ref|XP_006580231.1|  PREDICTED: cytochrome P450 716B2-like              335   3e-104   
gb|KCW52344.1|  hypothetical protein EUGRSUZ_J01759                     332   2e-103   
ref|XP_002310350.1|  hypothetical protein POPTR_0007s15190g             326   2e-102   
ref|XP_002299098.2|  hypothetical protein POPTR_0001s04020g             325   4e-102   
ref|XP_009786412.1|  PREDICTED: beta-amyrin 28-oxidase-like             326   5e-101   
ref|XP_010034533.1|  PREDICTED: beta-amyrin 28-oxidase-like             325   7e-101   
ref|XP_009620428.1|  PREDICTED: beta-amyrin 28-oxidase-like             323   7e-100   
ref|XP_007159604.1|  hypothetical protein PHAVU_002G251200g             320   1e-98    
ref|XP_011074931.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    315   3e-98    
emb|CDP11383.1|  unnamed protein product                                316   5e-98    
ref|XP_006453162.1|  hypothetical protein CICLE_v10010450mg             316   1e-97    
emb|CDP17152.1|  unnamed protein product                                316   2e-97    
gb|ACU18094.1|  unknown                                                 307   4e-97    
gb|ABK26968.1|  unknown                                                 306   2e-95    
gb|AAX59903.1|  13-alpha-hydroxylase                                    311   5e-95    
ref|XP_003634587.2|  PREDICTED: beta-amyrin 28-oxidase                  302   7e-95    
emb|CBI39272.3|  unnamed protein product                                302   9e-95    
sp|Q8W4T9.1|T13H_TAXCU  RecName: Full=Taxane 13-alpha-hydroxylase...    309   3e-94    
gb|AAX20147.1|  taxane 13-alpha-hydroxylase                             307   1e-93    
ref|XP_008227243.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    301   1e-93    
gb|AAS89065.2|  taxoid 2-alpha-hydroxylase                              305   9e-93    
ref|XP_009358879.1|  PREDICTED: beta-amyrin 28-oxidase-like             301   1e-92    
ref|XP_011048247.1|  PREDICTED: beta-amyrin 28-oxidase-like             305   2e-92    
ref|XP_002971610.1|  hypothetical protein SELMODRAFT_231756             302   4e-92    
ref|XP_002965726.1|  hypothetical protein SELMODRAFT_84634              302   1e-91    
ref|XP_002325239.2|  hypothetical protein POPTR_0018s13420g             298   3e-91    
gb|AAU93341.1|  taxadiene 5-alpha hydroxylase                           301   5e-91    
sp|Q6WG30.2|T5H_TAXCU  RecName: Full=Taxadiene 5-alpha hydroxylase      300   2e-90    
gb|AFD32421.1|  5-alpha-hydroxylase                                     299   2e-90    
gb|AFD32415.1|  taxane 14b-hydroxylase                                  300   2e-90    
ref|XP_002299099.2|  hypothetical protein POPTR_0001s04030g             294   1e-89    
gb|AAV54171.1|  taxoid 2-alpha-hydroxylase                              296   3e-89    
gb|KHN06510.1|  Cytochrome P450 716B2                                   291   7e-89    
gb|AFJ04877.1|  taxadiene 5nalpha hydroxylase                           293   1e-88    
sp|Q84KI1.1|T14H_TAXCU  RecName: Full=Taxoid 14-beta-hydroxylase;...    295   2e-88    
ref|XP_010682414.1|  PREDICTED: dammarenediol 12-hydroxylase-like       285   2e-88    
gb|AFJ04860.1|  taxadiene 5nalpha hydroxylase                           293   2e-88    
gb|AFJ04873.1|  taxadiene 5nalpha hydroxylase                           292   2e-88    
gb|AFJ04862.1|  taxadiene 5nalpha hydroxylase                           292   2e-88    
gb|AFJ04859.1|  taxadiene 5nalpha hydroxylase                           292   3e-88    
gb|AFJ04872.1|  taxadiene 5nalpha hydroxylase                           292   3e-88    
gb|AFJ04884.1|  taxadiene 5nalpha hydroxylase                           292   3e-88    
gb|AAN52360.1|  5-alpha-taxadienol-10-beta-hydroxylase                  293   3e-88    
gb|AFJ04880.1|  taxadiene 5nalpha hydroxylase                           292   4e-88    
ref|XP_006346227.1|  PREDICTED: cytochrome P450 716B1-like              293   4e-88    
gb|AFJ04863.1|  taxadiene 5nalpha hydroxylase                           291   4e-88    
gb|AFJ04888.1|  taxadiene 5nalpha hydroxylase                           291   5e-88    
gb|AFJ04876.1|  taxadiene 5nalpha hydroxylase                           291   5e-88    
gb|AFJ04874.1|  taxadiene 5nalpha hydroxylase                           291   5e-88    
gb|AFJ04882.1|  taxadiene 5nalpha hydroxylase                           291   6e-88    
gb|AFJ04878.1|  taxadiene 5nalpha hydroxylase                           291   6e-88    
gb|AFJ04871.1|  taxadiene 5nalpha hydroxylase                           291   6e-88    
gb|AFJ04870.1|  taxadiene 5nalpha hydroxylase                           291   6e-88    
gb|AFJ04866.1|  taxadiene 5nalpha hydroxylase                           291   7e-88    
gb|AFJ04881.1|  taxadiene 5nalpha hydroxylase                           291   9e-88    
gb|AFJ04869.1|  taxadiene 5nalpha hydroxylase                           291   1e-87    
gb|AFJ04865.1|  taxadiene 5nalpha hydroxylase                           290   1e-87    
gb|KHN38289.1|  Taxadiene 5-alpha hydroxylase                           291   1e-87    
gb|AFJ04858.1|  taxadiene 5nalpha hydroxylase                           290   1e-87    
gb|AFJ04883.1|  taxadiene 5nalpha hydroxylase                           290   1e-87    
gb|AFJ04867.1|  taxadiene 5nalpha hydroxylase                           290   2e-87    
gb|AFJ04887.1|  taxadiene 5nalpha hydroxylase                           290   2e-87    
ref|XP_004491368.1|  PREDICTED: cytochrome P450 716B1-like              291   2e-87    
gb|AFJ04875.1|  taxadiene 5nalpha hydroxylase                           290   2e-87    
gb|AFJ04879.1|  taxadiene 5nalpha hydroxylase                           290   2e-87    
ref|NP_001242838.1|  uncharacterized protein LOC100790001 precursor     291   2e-87    
ref|XP_009607399.1|  PREDICTED: cytochrome P450 716B1-like              291   2e-87    
ref|XP_009793750.1|  PREDICTED: cytochrome P450 716B1-like              290   2e-87    
ref|XP_011030804.1|  PREDICTED: cytochrome P450 716B1-like              291   3e-87    
ref|XP_008226970.1|  PREDICTED: cytochrome P450 716B1-like              290   4e-87    
gb|AET00449.2|  cytochrome P450 family protein                          290   5e-87    
ref|XP_007141897.1|  hypothetical protein PHAVU_008G235000g             290   5e-87    
ref|XP_010921144.1|  PREDICTED: cytochrome P450 716B1-like isofor...    289   8e-87    
gb|AFJ04864.1|  taxadiene 5nalpha hydroxylase                           288   1e-86    
gb|AFJ04861.1|  taxadiene 5nalpha hydroxylase                           288   1e-86    
ref|XP_002522969.1|  cytochrome P450, putative                          289   1e-86    
ref|XP_010921143.1|  PREDICTED: taxane 13-alpha-hydroxylase-like ...    289   1e-86    
ref|XP_007214033.1|  hypothetical protein PRUPE_ppa017328mg             289   1e-86    
ref|XP_004244351.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      288   3e-86    
ref|XP_002981278.1|  hypothetical protein SELMODRAFT_114324             286   8e-86    
ref|XP_002991753.1|  hypothetical protein SELMODRAFT_161932             285   1e-85    
ref|XP_002989743.1|  hypothetical protein SELMODRAFT_130337             285   1e-85    
ref|XP_004299710.1|  PREDICTED: cytochrome P450 716B1-like              285   3e-85    
ref|XP_007214243.1|  hypothetical protein PRUPE_ppa023488mg             284   5e-85    
emb|CDP20362.1|  unnamed protein product                                281   1e-84    
ref|XP_007020904.1|  Cytochrome P450                                    283   1e-84    
ref|XP_004295817.1|  PREDICTED: cytochrome P450 716B1-like              283   2e-84    
emb|CDP18586.1|  unnamed protein product                                282   2e-84    
ref|XP_008782776.1|  PREDICTED: cytochrome P450 716B1-like              283   3e-84    
ref|XP_001755044.1|  predicted protein                                  282   4e-84    
ref|XP_009607400.1|  PREDICTED: cytochrome P450 716B1-like              281   1e-83    
ref|XP_006376949.1|  hypothetical protein POPTR_0012s11470g             281   1e-83    
ref|XP_008243438.1|  PREDICTED: beta-amyrin 28-oxidase-like             276   1e-83    
ref|XP_010060379.1|  PREDICTED: cytochrome P450 716B1-like              280   2e-83    
ref|XP_003617490.1|  Taxane 13-alpha-hydroxylase                        281   2e-83    
gb|KDO41268.1|  hypothetical protein CISIN_1g045001mg                   279   2e-83    
ref|XP_010658310.1|  PREDICTED: cytochrome P450 716B1                   280   4e-83    
sp|Q6JTJ0.1|T7H_TAXCU  RecName: Full=Taxoid 7-beta-hydroxylase          280   5e-83    
ref|XP_006474348.1|  PREDICTED: cytochrome P450 716B1-like              275   8e-83    
ref|XP_009794406.1|  PREDICTED: LOW QUALITY PROTEIN: taxane 13-al...    280   8e-83    
emb|CAN70350.1|  hypothetical protein VITISV_012582                     279   9e-83    
gb|AFD32418.1|  cytochrome P450 taxane 7-beta-hydroxylase               279   1e-82    
ref|XP_011003573.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      278   1e-82    
gb|KDP39106.1|  hypothetical protein JCGZ_00863                         276   3e-82    
ref|XP_008803662.1|  PREDICTED: cytochrome P450 716B1-like              278   3e-82    
gb|AFD32419.1|  10-beta-hydroxylase                                     278   3e-82    
ref|XP_008371267.1|  PREDICTED: cytochrome P450 716B1-like              277   3e-82    
sp|Q9AXM6.1|T10H_TAXCU  RecName: Full=Taxane 10-beta-hydroxylase;...    278   3e-82    
gb|AHF49535.1|  CYP450 725 family protein                               278   4e-82    
gb|EYU39276.1|  hypothetical protein MIMGU_mgv1a023490mg                273   5e-82    
ref|XP_008226931.1|  PREDICTED: cytochrome P450 716B1-like              276   5e-82    
emb|CBI18205.3|  unnamed protein product                                266   7e-82    
emb|CBI24039.3|  unnamed protein product                                266   7e-82    
ref|XP_004957873.1|  PREDICTED: cytochrome P450 716B1-like              276   8e-82    
gb|AAS49032.1|  5-alpha-taxadienol-10-beta-hydroxylase                  276   9e-82    
gb|AJD25254.1|  cytochrome P450 CYP728D17                               276   1e-81    
gb|ACR78247.1|  taxoid 7-beta-hydroxylase                               276   2e-81    
gb|AAW03151.1|  taxane 10-beta-hydroxylase                              276   2e-81    
ref|XP_001762633.1|  predicted protein                                  275   2e-81    
ref|XP_010092132.1|  Cytochrome P450                                    275   3e-81    
ref|XP_008457111.1|  PREDICTED: cytochrome P450 716B1-like              275   4e-81    
ref|XP_009617504.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...    271   6e-81    
ref|XP_009768076.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2       262   1e-80    
ref|XP_007213798.1|  hypothetical protein PRUPE_ppa004984m2g            270   1e-80    
ref|XP_008345868.1|  PREDICTED: cytochrome P450 716B1-like              272   2e-80    
ref|XP_002278616.2|  PREDICTED: cytochrome P450 716B1-like              272   2e-80    
ref|XP_004140824.1|  PREDICTED: cytochrome P450 716B1-like              272   2e-80    
gb|AAT47183.1|  taxoid 10-beta hydroxylase                              272   3e-80    
ref|XP_009334824.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    272   3e-80    
gb|EYU19246.1|  hypothetical protein MIMGU_mgv1a005723mg                272   3e-80    
gb|EAZ04083.1|  hypothetical protein OsI_26220                          271   5e-80    
ref|XP_003563018.2|  PREDICTED: cytochrome P450 716B1-like              273   7e-80    
ref|XP_010923918.1|  PREDICTED: cytochrome P450 716B2-like              271   9e-80    
ref|XP_011040241.1|  PREDICTED: cytochrome P450 716B1-like              270   1e-79    
ref|XP_011097890.1|  PREDICTED: cytochrome P450 716B1-like isofor...    270   2e-79    
ref|XP_011097891.1|  PREDICTED: cytochrome P450 716B1-like isofor...    270   2e-79    
ref|XP_002969665.1|  hypothetical protein SELMODRAFT_231370             269   3e-79    
ref|XP_011003980.1|  PREDICTED: beta-amyrin 28-oxidase-like             265   3e-79    
ref|XP_003617455.1|  Taxane 13-alpha-hydroxylase                        269   3e-79    
ref|XP_007011311.1|  Cytochrome P450, putative                          278   4e-79    
ref|XP_004308981.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        268   6e-79    
emb|CBI26615.3|  unnamed protein product                                271   8e-79    
ref|XP_008369414.1|  PREDICTED: cytochrome P450 716B1-like              267   2e-78    
gb|EYU25992.1|  hypothetical protein MIMGU_mgv1a017984mg                264   2e-78    
emb|CDP18717.1|  unnamed protein product                                267   2e-78    
ref|XP_009352449.1|  PREDICTED: cytochrome P450 716B1-like              266   3e-78    
ref|XP_009363898.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      266   4e-78    
ref|XP_004294367.1|  PREDICTED: cytochrome P450 716B1-like              266   4e-78    
dbj|BAC19981.1|  putative 5-alpha-taxadienol-10-beta-hydroxylase        266   5e-78    
ref|XP_009602928.1|  PREDICTED: taxadiene 5-alpha hydroxylase           266   6e-78    
ref|XP_002267028.1|  PREDICTED: cytochrome P450 716B1                   266   6e-78    
ref|XP_002983285.1|  hypothetical protein SELMODRAFT_1987               265   7e-78    
ref|XP_002987404.1|  hypothetical protein SELMODRAFT_126145             265   9e-78    
emb|CBI23510.3|  unnamed protein product                                266   1e-77    
ref|NP_001148166.1|  taxane 13-alpha-hydroxylase precursor              265   1e-77    
tpg|DAA62930.1|  TPA: putative cytochrome P450 superfamily protein      265   2e-77    
ref|XP_009334834.1|  PREDICTED: cytochrome P450 716B1-like              265   2e-77    
ref|XP_002979923.1|  hypothetical protein SELMODRAFT_112151             265   2e-77    
ref|XP_010102173.1|  Taxadiene 5-alpha hydroxylase                      264   3e-77    
ref|XP_004296016.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      264   3e-77    
ref|XP_004158484.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    264   4e-77    
ref|XP_004152028.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      263   5e-77    
ref|XP_008229454.1|  PREDICTED: taxadiene 5-alpha hydroxylase           263   6e-77    
ref|XP_002443327.1|  hypothetical protein SORBIDRAFT_08g017540          263   7e-77    
ref|XP_010323638.1|  PREDICTED: taxadiene 5-alpha hydroxylase           263   1e-76    
ref|XP_004517250.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      262   1e-76    
ref|XP_002266981.2|  PREDICTED: cytochrome P450 716B1-like              262   1e-76    
gb|AAR21106.1|  hydroxylase                                             262   2e-76    
emb|CDP18056.1|  unnamed protein product                                258   3e-76    
ref|XP_010103649.1|  Taxadiene 5-alpha hydroxylase                      261   3e-76    
ref|XP_010921145.1|  PREDICTED: cytochrome P450 716B1-like isofor...    259   3e-76    
ref|XP_008454553.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    261   5e-76    
ref|XP_010092133.1|  Cytochrome P450                                    259   5e-76    
ref|XP_009758604.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      261   5e-76    
ref|XP_002960196.1|  hypothetical protein SELMODRAFT_402287             261   6e-76    
ref|XP_011095373.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      260   6e-76    
ref|XP_006348988.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      260   1e-75    
ref|XP_002981450.1|  hypothetical protein SELMODRAFT_444868             259   1e-75    
ref|XP_002462934.1|  hypothetical protein SORBIDRAFT_02g034870          260   2e-75    



>ref|XP_006353629.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 382/468 (82%), Gaps = 16/468 (3%)
 Frame = +2

Query  134   IIYFITKANTSK---PNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSI  295
             +I+FI K N S     NLPPGS GWP++GENID+     PEK+I +RM+K+S +VFKTS+
Sbjct  20    LIFFILKGNYSNNKHTNLPPGSYGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQ--NTLRKITILNRTNI  469
              GEK+A+FCG++GNKF F+NEN LLTTWWPQS+TKPL+ PT +Q  N+++KI + NR  +
Sbjct  80    FGEKIAIFCGSSGNKFLFSNENKLLTTWWPQSLTKPLLCPTQSQSQNSIKKIALSNRGFL  139

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
              EI K ENLK YIP +DSMA++H+ +EW PF+EVK+Y L K YTF LACKLFLSIED   
Sbjct  140   LEILKPENLKQYIPFMDSMARDHLKQEWVPFKEVKIYPLVKKYTFGLACKLFLSIEDFQH  199

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             VK+L DP ILV++GMF++P+N PGT YNRA+KGG MVR +L+++IKERK       + + 
Sbjct  200   VKKLSDPFILVTSGMFTVPINLPGTPYNRAIKGGKMVREELMKIIKERK-------INEK  252

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
              +    +L RL+S +DE GQ +N+ EIY+ IIG+L+ +Y +TSAAITFVLK+LAELP I+
Sbjct  253   NNHSDHLLSRLISFSDENGQFMNDAEIYNNIIGLLVASYDTTSAAITFVLKYLAELPKIF  312

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +VYKEQ+EI KSKG  E L+W+DIQKMKYSWNVACEA+RL PP QG FRE +TDFT+ G
Sbjct  313   NEVYKEQMEIRKSKGEGELLNWDDIQKMKYSWNVACEAIRLMPPAQGAFREAITDFTFGG  372

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             FTIPKGWKTFWNVYSTHKNPKYF EP+KFDP R+EG+GPAP+TFVPFGGGPRMCPGKEYA
Sbjct  373   FTIPKGWKTFWNVYSTHKNPKYFPEPEKFDPCRFEGSGPAPYTFVPFGGGPRMCPGKEYA  432

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             RLEILVFM+NVVTNFK+EKLVP+EKI+Y S SP+P+NGLPVR+ PH N
Sbjct  433   RLEILVFMYNVVTNFKLEKLVPHEKIIYQS-SPVPLNGLPVRIQPHGN  479



>ref|XP_004241821.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/464 (64%), Positives = 380/464 (82%), Gaps = 16/464 (3%)
 Frame = +2

Query  137   IYFITKANTSK---PNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSIL  298
             +YFI K N S     NLP GS GWP++GENID+     PEK+I +RM+K+S +VFKTS+L
Sbjct  18    LYFIFKGNYSNNKHTNLPLGSNGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSLL  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQ--NTLRKITILNRTNIH  472
             G+K+A+FCG +GNKF F+NEN LLTTWWP S+TKPLM PT +Q  N++++I +LNR  + 
Sbjct  78    GQKIAIFCGTSGNKFLFSNENKLLTTWWPPSLTKPLMCPTQSQSQNSVKEIALLNRGFLR  137

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             EI K ENLK YIP +DSMA++H+ +EW PF+EVK+Y L K YTF+LACKLFLSI+D   V
Sbjct  138   EILKPENLKQYIPFMDSMARDHLKQEWIPFKEVKIYPLVKKYTFSLACKLFLSIDDFRHV  197

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             K+L DP +LV++GMF++P+N PGT YNRA+KGG MV  +L+++IKERK       + +  
Sbjct  198   KKLSDPFVLVTSGMFTVPINLPGTPYNRAIKGGKMVHEELMKIIKERK-------INEKN  250

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
             +   D+L +L+S +DE GQ +N+ EIY+ IIG+L+ +Y +TSAAITFVLK+LAELP+I+ 
Sbjct  251   NHSNDLLSQLISFSDENGQFMNDAEIYNNIIGLLVASYDTTSAAITFVLKYLAELPNIFN  310

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +VYKEQ+EIAKSKG  E L+W+DIQKMKYSWNVACEA+RL PP QG FRE +TDFT+ GF
Sbjct  311   EVYKEQMEIAKSKGEGELLNWDDIQKMKYSWNVACEAIRLMPPAQGAFREAITDFTFGGF  370

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             T+PKGWKTFW+VYSTHKNPKYF EP+KFDP R+EG+GP P+TFVPFGGGPRMCPGKEYAR
Sbjct  371   TVPKGWKTFWSVYSTHKNPKYFPEPEKFDPCRFEGSGPEPYTFVPFGGGPRMCPGKEYAR  430

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             LEILVFM+N+VTNFK+EKLVP+EKI+Y S SP+P+NGLPVR+ P
Sbjct  431   LEILVFMYNIVTNFKLEKLVPHEKIIYKS-SPVPLNGLPVRIQP  473



>emb|CDP18172.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/459 (63%), Positives = 379/459 (83%), Gaps = 5/459 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKV  310
             I+ I K N+S   LPPG++GWP++GE++   L+ P+K++ DRMKKYSP+VF+TS++GEK+
Sbjct  21    IFLIRKRNSSSLKLPPGTSGWPMVGESLQFALLGPQKFVKDRMKKYSPDVFQTSLMGEKM  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             A+FCGA GNKF FTNEN LLT+WWPQS+ K L+FP   +++L++++ L R+ +H+I K E
Sbjct  81    AIFCGAQGNKFLFTNENKLLTSWWPQSMKKALLFPEFVEDSLKEVSALKRSFMHDILKPE  140

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              LK YIP +D++A+EHI +EWAP +EVKV+ LSK YTF LAC+LFLS+ D + +K+L DP
Sbjct  141   ALKQYIPVMDALAREHIEQEWAPHKEVKVFPLSKKYTFDLACRLFLSVMDPEHIKKLADP  200

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               LV+ GMFS+P++ PGTAYN A+KGG MVR +L+ VI+ER+ + M N   +     +D+
Sbjct  201   FHLVTNGMFSVPIDLPGTAYNGAIKGGKMVREELLRVIRERRKELMENK--ETAAACKDL  258

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L R+L VTDE+GQ+L+E EI + IIG+L+ +Y +TS A+TFVLK LAELPHIY++V +EQ
Sbjct  259   LSRMLLVTDEDGQYLSEMEISNNIIGLLVASYETTSTAVTFVLKHLAELPHIYREVLREQ  318

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIAK+KGP+E L+WEDI+KMKYSWNVA E+LR+ PP QG FRE+V DFTYAGFTIPKGW
Sbjct  319   MEIAKTKGPDELLTWEDIEKMKYSWNVARESLRVTPPAQGAFRESVADFTYAGFTIPKGW  378

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             KTFW V++THKNPKYF EP+KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLE+LVF
Sbjct  379   KTFWTVHTTHKNPKYFPEPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEVLVF  438

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             M+ +VT F+++K +PNEKIVY+ ASP+P NGLPV L PH
Sbjct  439   MYRIVTQFQLKKAIPNEKIVYH-ASPVPANGLPVLLQPH  476



>ref|XP_006353706.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=474

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 374/456 (82%), Gaps = 7/456 (2%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K ++S   LPPG++GWP++GEN++  L+ P+K+I DRM+KYSPEVF+TSI+GEK+A FCG
Sbjct  24    KRDSSSKTLPPGTSGWPLLGENMEFALLGPQKFIKDRMEKYSPEVFQTSIMGEKMAFFCG  83

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
             A GNKF F++EN LLT+WWPQS+ K L+FP   +++L++++ L R+ +H+I K E LK Y
Sbjct  84    AQGNKFLFSSENKLLTSWWPQSMKKALLFPEFVESSLKEVSALKRSFLHDILKPEALKQY  143

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             IP +D+MA+EH+ E W   R VKV+ LSK YTF LAC+LF+S+ D +E+KRL DP  LV+
Sbjct  144   IPLMDAMAREHLDENWNSNRVVKVFPLSKKYTFDLACRLFMSLVDPEEIKRLADPFTLVT  203

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
              GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ +   N     E  GRD+L ++L
Sbjct  204   NGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKELTENQ----ETAGRDLLSKML  259

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
              VTDE+GQ ++E EI + IIG+L+ ++ +TS+A+T VLK+LAELPH+Y +VY+EQ+ IAK
Sbjct  260   LVTDEDGQFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDEVYREQMAIAK  319

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             SKG  + L+WEDI+KMKYSWN A E+LRL PP QG FRET+TDFTYAGFTIPKGWKTFW+
Sbjct  320   SKGAEDLLTWEDIEKMKYSWNAARESLRLTPPAQGSFRETITDFTYAGFTIPKGWKTFWS  379

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
             V+STHKNPKYFS+P+KFDPSR+EG+GPAPFTFVPFGGGPRMCPGKEYARLE+LVFMHNVV
Sbjct  380   VHSTHKNPKYFSDPEKFDPSRFEGSGPAPFTFVPFGGGPRMCPGKEYARLEVLVFMHNVV  439

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
               FK+EK +P+EKIV++ ASP+PV GLPVRL PH N
Sbjct  440   KRFKLEKDIPDEKIVFH-ASPVPVYGLPVRLLPHGN  474



>ref|XP_004242231.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/461 (61%), Positives = 376/461 (82%), Gaps = 7/461 (2%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKV  310
             ++ + K ++S  +LPPG+ GWP++GEN++  L+ P+K+I DRM+KYS +VF+TSI+GEK+
Sbjct  20    MFILRKRDSSSKSLPPGTCGWPLLGENVEFALLGPQKFIKDRMEKYSAQVFQTSIMGEKM  79

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             A FCGA GNKF F++EN L+T+WWPQS+ K L+FP   +++L++++ L R+ +H+I K E
Sbjct  80    AFFCGAQGNKFLFSSENKLVTSWWPQSMKKALLFPEFVESSLKQVSALKRSFLHDILKPE  139

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              LK YIP +D+MA++H+ + W   R V V+ LSK YTF LAC+LF+S+ D +E+KRL DP
Sbjct  140   ALKQYIPLMDAMARQHLHQNWDSNRVVTVFPLSKKYTFDLACRLFMSLVDPEEIKRLADP  199

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               LV+ GMFS+P++ PGTAY+RA+KGG+MVR +L+ +I +R+ +   N     E  GRD+
Sbjct  200   FTLVTNGMFSMPIDLPGTAYHRAIKGGTMVRDELMRIITQRRKELTENQ----ETSGRDL  255

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L ++L VTDE+GQ ++E EI + IIG+L+ ++ +TS+A+T VLK+LAELPH+Y QVY+EQ
Sbjct  256   LSKMLLVTDEDGQFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDQVYREQ  315

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             + IAKSKG  + L+WEDI+KMKYSWN A E+LRL PP QG FRET+TDFTYAGFTIPKGW
Sbjct  316   MAIAKSKGAEDLLTWEDIEKMKYSWNAARESLRLTPPAQGSFRETITDFTYAGFTIPKGW  375

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             KTFW+V+STHKNPKYFS+P+KFDPSR+EG+GPAPFTFVPFGGGPRMCPGKEYARLE+LVF
Sbjct  376   KTFWSVHSTHKNPKYFSDPEKFDPSRFEGSGPAPFTFVPFGGGPRMCPGKEYARLEVLVF  435

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             MHNVV  FK+EK +P+EKIV++ ASP+PV GLPVRL PH N
Sbjct  436   MHNVVKRFKLEKEIPDEKIVFH-ASPVPVYGLPVRLLPHGN  475



>gb|EYU22847.1| hypothetical protein MIMGU_mgv1a022104mg [Erythranthe guttata]
Length=477

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/461 (62%), Positives = 374/461 (81%), Gaps = 8/461 (2%)
 Frame = +2

Query  137   IYFITKAN-TSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             + F+ K   T   NLPPGS GWP++GEN++  +  P++++ +RM+KYSPEVF+TS+LGEK
Sbjct  21    VSFLRKTGPTESKNLPPGSNGWPMLGENMEFALSGPQQFVKERMQKYSPEVFRTSLLGEK  80

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKL  487
             +AVFCGA GNKF FTNEN LLT+WWPQS+ K L+FP   ++ L++++ L R+  H+I K 
Sbjct  81    MAVFCGAQGNKFLFTNENKLLTSWWPQSMKKALLFPEFIESNLKEVSALKRSFHHDILKP  140

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E LK YIP +DS+A++H+  +W P   VKV+ LSK YTF LACKLFLS+ D++++K+L D
Sbjct  141   EALKQYIPAMDSLARQHLDSDWLPNTVVKVFPLSKKYTFELACKLFLSLVDQEDIKKLSD  200

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
             P  LV+ GMFS+P++FPGTAYN A+KGG MVR +L+ +I ER+ + +MN+    E EGRD
Sbjct  201   PFTLVTNGMFSVPIDFPGTAYNGAIKGGKMVREELMRIITERRKEIVMNN----ETEGRD  256

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             +L ++L V DE+G  ++E EI + IIG+L+ ++ +TS+A+T V+ +LA LPHIY++V+KE
Sbjct  257   LLSKMLLVRDEDGNFMSEMEISNNIIGLLVASFETTSSAVTAVMNYLAGLPHIYREVFKE  316

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+EIAKSKGPNE L+WEDI+KMKYSWNVA E+LRL PP QG FRET+T+FTYAGFT+PKG
Sbjct  317   QMEIAKSKGPNELLTWEDIEKMKYSWNVARESLRLTPPAQGAFRETITEFTYAGFTVPKG  376

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WKTFW V+STHKNPKYF EP+KFDP R+EG GPAP+TFVPFGGGPRMCPGKEYARLE+LV
Sbjct  377   WKTFWTVHSTHKNPKYFPEPEKFDPKRFEGTGPAPYTFVPFGGGPRMCPGKEYARLEVLV  436

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             FMHNVVT FK+EK +PNEKIV++ ASP P +GLPV L PH+
Sbjct  437   FMHNVVTRFKLEKAIPNEKIVFH-ASPTPAHGLPVHLHPHE  476



>ref|XP_009620720.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 380/462 (82%), Gaps = 5/462 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++   LPPG++GWP++GEN++  L+ PEK+I +RM+KYSP+VF+TSI+GEK+
Sbjct  18    IFFLRKRDSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKNRMEKYSPQVFQTSIMGEKM  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA GNKF F++EN LLT+WWPQS+ K L+FP  A+++L++++ L R  +H+I K E
Sbjct  78    AVFCGAQGNKFLFSSENKLLTSWWPQSMKKALLFPEFAESSLKQVSALQRGFLHDILKPE  137

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
              LK YIP +DSMA+EH+ E W P   V KV+ LSK YTF LAC+LF+++ + +E+KRL D
Sbjct  138   ALKQYIPVMDSMAREHVDENWIPNNGVVKVFPLSKKYTFDLACRLFMNLVNPEEIKRLAD  197

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
             P  LV+ G+FS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ +  M +  ++   GRD
Sbjct  198   PFTLVTNGIFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKELQMEN-KEIIAGGRD  256

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             +L ++L VTDE G+ ++E EI + IIG+L+ ++ +TS+A+T VLK+LAELPH+Y QVYKE
Sbjct  257   LLSKMLLVTDENGRFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYYQVYKE  316

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+ IAK KG +E LSWEDI+KMKYSWNVA E+LRL PP QG FRET+TD TYAGFTIPKG
Sbjct  317   QMAIAKLKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDCTYAGFTIPKG  376

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WKTFW+V+STHKNPKYFS+P+KFDP+R+EG+GPAP+TF+PFGGGPRMCPGKEYARLEILV
Sbjct  377   WKTFWSVHSTHKNPKYFSDPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEILV  436

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              MHNVV  FK+EK++P+E+IV++ ASP+P +GLPVRL PH N
Sbjct  437   LMHNVVKRFKLEKVIPDEEIVFH-ASPVPKHGLPVRLLPHGN  477



>ref|XP_009768074.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 378/462 (82%), Gaps = 5/462 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++   LPPG++GWP++GEN++  L+ PEK+I  RM+KYSP+VF+TSI+GEK+
Sbjct  21    IFFLRKRHSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKKRMEKYSPQVFQTSIMGEKM  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA GNKF F+NEN LLT+WWP+S+ K L+FP  A+++L++++ L R  +H+I K E
Sbjct  81    AVFCGAQGNKFLFSNENKLLTSWWPKSMKKALLFPEFAESSLKEVSALQRGFLHDILKPE  140

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
              LK YIP +DSMA++H+ E W P   V KV+ LSK YTF LAC+LF+S+ + +E+KRL D
Sbjct  141   ALKQYIPVMDSMARDHLDENWIPNNGVVKVFPLSKKYTFDLACRLFMSLVNPEEIKRLAD  200

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
             P  LV+ G+FS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ +  M +   +   GRD
Sbjct  201   PFTLVTNGIFSMPIDLPGTAYNRAIKGGKMVRVELMRIITQRRKELQMENKETIAG-GRD  259

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             +L ++L VTDE G+ ++E EI + +IG+L+ ++ +TS+A T VLK+LAELPH+Y QVYKE
Sbjct  260   LLSKMLLVTDENGRFMSEMEISNNLIGMLVASFETTSSAATSVLKYLAELPHVYDQVYKE  319

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+ IAKSKG +E LSWEDI+KMKYSWNVA E+LRL PP QG FRET+TD TYAGFTIPKG
Sbjct  320   QMAIAKSKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDSTYAGFTIPKG  379

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WKTFW+V+STHKNPKYFS P+KFDP+R+EG+GPAP+TF+PFGGGPRMCPGKEYARLE+LV
Sbjct  380   WKTFWSVHSTHKNPKYFSNPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEVLV  439

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              MHNVV  FK+EK++P+EKIV++ ASP+P++GLPVRL PH N
Sbjct  440   LMHNVVKRFKLEKVIPDEKIVFH-ASPVPMHGLPVRLLPHGN  480



>ref|XP_011099144.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=477

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/448 (63%), Positives = 363/448 (81%), Gaps = 7/448 (2%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GENI+  V  P+K++ DRM+KYSPEVF+TS+LGEK+A+FCGA GNKF 
Sbjct  34    NLPPGSRGWPMLGENIEFAVLGPQKFVKDRMEKYSPEVFQTSLLGEKMAIFCGAQGNKFL  93

Query  347   ftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSM  526
             F NEN LLT+WWPQS+ K L+FP   ++ L++++ L R+  H+I K E LK YIP +D++
Sbjct  94    FMNENKLLTSWWPQSMKKALLFPEFVESNLKEVSALKRSFHHDILKPEALKQYIPVMDAL  153

Query  527   AKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLP  706
             A+EH+  +W P   VKV  LSK YTF LAC+LFLS+ D + +KRL +P  LV+ GMFS+P
Sbjct  154   AREHLDNDWTPNSVVKVSPLSKKYTFELACRLFLSVVDPEHIKRLSEPFTLVTNGMFSVP  213

Query  707   LNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEG  886
             ++ PGTAYNRA+KGG +VR +L+ +I ER+ +       K E EGRD+L ++L VTDE+G
Sbjct  214   IDLPGTAYNRAIKGGKLVREELMRIITERRKELT----EKKETEGRDLLSKMLLVTDEDG  269

Query  887   QHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNER  1066
             Q L+E EI + IIG+L+ ++ +TS+A+T V+ +LAELPHIY+QV +EQ+EIAKSKGP+E 
Sbjct  270   QFLSEMEISNNIIGLLVASFETTSSAVTAVMNYLAELPHIYKQVLEEQMEIAKSKGPDEL  329

Query  1067  LSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKN  1246
             L+WEDI+KM+YSWNVA E+LRL PP QG FRET T+FTYAGFTIPKGWKTFW V+S+HKN
Sbjct  330   LTWEDIEKMRYSWNVARESLRLTPPAQGAFRETTTEFTYAGFTIPKGWKTFWTVHSSHKN  389

Query  1247  PKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEK  1426
             PKYF EP+KF+PSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLE+LVFMHNVV  F++EK
Sbjct  390   PKYFPEPEKFNPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEVLVFMHNVVRRFRLEK  449

Query  1427  LVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              +PNEKIV++ ASP P  GLPV L PH+
Sbjct  450   AIPNEKIVFH-ASPTPAYGLPVHLHPHE  476



>ref|XP_009768075.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Nicotiana sylvestris]
Length=476

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/461 (60%), Positives = 369/461 (80%), Gaps = 4/461 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+   +++   LPPG++GWP++GENI+L +  PEK++ +R +KYSP VF+T I+GEK+
Sbjct  18    IFFLRNRDSNSKKLPPGTSGWPLLGENIELALLGPEKFLKNRTEKYSPHVFQTLIMGEKL  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA GNKF F+NEN LLT+WWP+S+ K L+FP  A+++L+ +  L R  + +I K E
Sbjct  78    AVFCGAQGNKFLFSNENKLLTSWWPKSMKKALLFPEFAESSLKDVLTLQRGFLQDILKPE  137

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              LK YIP +D+MA+EH+ E W P   VKV+ LSK YTF LAC+LF+S+ + +E+KRL DP
Sbjct  138   ALKQYIPIMDAMAREHLDENWIPNGVVKVFPLSKKYTFDLACRLFMSLVNPEEIKRLADP  197

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               LV+ GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ +  M +   +   GRD+
Sbjct  198   FTLVTNGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIISQRRKELQMENKETIAG-GRDL  256

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L ++L VTDE G+ ++E EI + IIG+L+ ++ +TS+A+T VLK+LAELPH+Y QVYKEQ
Sbjct  257   LSKILLVTDENGRFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVYDQVYKEQ  316

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             + IAK KG +E L+WEDI+KMKYSWNV  E+LRL PP QG FRET+TD TYAGFTIPKGW
Sbjct  317   MAIAKLKGEDELLTWEDIEKMKYSWNVVRESLRLTPPAQGAFRETITDCTYAGFTIPKGW  376

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             KTFW+V+STHKNPKYF++P+KFDP R+EG+GPAP+TF+PFGGGPRMCPGKEYAR E+LV 
Sbjct  377   KTFWSVHSTHKNPKYFTDPEKFDPMRFEGSGPAPYTFIPFGGGPRMCPGKEYARTEVLVL  436

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             MHNVV  FK+EK++P+EKIV++ ASP+P +GLPVRL PH N
Sbjct  437   MHNVVKRFKLEKVIPDEKIVFD-ASPVPKHGLPVRLLPHGN  476



>ref|XP_009601238.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/462 (60%), Positives = 371/462 (80%), Gaps = 5/462 (1%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+F+ K +++    PPG++GWP++GEN++L +  PEK+I +RM+KYSP+VF+T+I+GEK+
Sbjct  18    IFFLRKRDSNSKKHPPGTSGWPLLGENMELALLGPEKFIKNRMEKYSPQVFQTTIVGEKM  77

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA GNKF F++EN LLT+WWP+S+ K L FP  A+++L+++  L     ++I K E
Sbjct  78    AVFCGAQGNKFLFSSENILLTSWWPKSMKKALFFPEFAESSLKEVLALQLGIQYDILKPE  137

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREV-KVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
              LK Y+P +D+MA+EH+ E W P   V KV+ LSK YTF +AC+LF+++ + +E+KRL D
Sbjct  138   ALKQYVPVMDAMAREHVDENWIPNNGVVKVFPLSKKYTFDVACRLFMNLVNPEEIKRLAD  197

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
             P  LV+ GMFS+P++ PGTAYNRA+KGG MVR +L+ +I +R+ +  + +   +   GRD
Sbjct  198   PFTLVTNGMFSMPIDLPGTAYNRAIKGGKMVRDELMRIITQRRKELQIENKETIAG-GRD  256

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             +L +LL VTDE G+ ++E EI + IIG+LL ++ +TS A+T VLK+LAELPHIY QVYKE
Sbjct  257   LLSKLLLVTDENGRFMSEMEISNNIIGMLLASFETTSTAVTSVLKYLAELPHIYDQVYKE  316

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+ IAK KG +E LSWEDI+KMKYSWNVA E+LRL PP QG FRET+TDFTYAGFTIPKG
Sbjct  317   QMAIAKLKGEDELLSWEDIEKMKYSWNVARESLRLTPPAQGAFRETITDFTYAGFTIPKG  376

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WKTFW+V+STHKNPKYFS+P+KFDP+R+EG+GPAP+TF+PFGGGPRMCPGKEYARLEILV
Sbjct  377   WKTFWSVHSTHKNPKYFSDPEKFDPTRFEGSGPAPYTFIPFGGGPRMCPGKEYARLEILV  436

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              MHNVV  FK+EK++P+EKIV+  AS +P +GLPVRL P  N
Sbjct  437   LMHNVVKRFKLEKVIPDEKIVFR-ASLVPKHGLPVRLVPRGN  477



>emb|CDP10718.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 357/454 (79%), Gaps = 13/454 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K   +K  LPPG+ GWPV+GEN+D     P K+I +RM KYS +VFKTS +GEKV+VFCG
Sbjct  27    KPKFNKSKLPPGNIGWPVLGENVDFARGGPRKFIEERMSKYSSQVFKTSFMGEKVSVFCG  86

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
              AGNKF F+NE+  +T+W P+S+ K L+FP+     L+++  L  + +HEI K E LK Y
Sbjct  87    PAGNKFLFSNEDKAVTSWLPRSMRKALLFPSYVDAPLKEVGALQHSFLHEILKPEALKKY  146

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             IP +D+MA++H+  EWAPF EVKVY L+K YTFALAC+LFL+IED + VKRL DP   V 
Sbjct  147   IPVMDAMARKHLDAEWAPFEEVKVYHLAKKYTFALACRLFLNIEDPEHVKRLADPFARVM  206

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE---GRDVLG  856
              G+FS+PL+FPGTAYN A+KGG+ VR +L++++  RK +        VEDE   GRD+L 
Sbjct  207   NGLFSIPLDFPGTAYNGAIKGGNKVREELLKIVTNRKKEL-------VEDESSAGRDLLS  259

Query  857   RLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIE  1036
             R++ V DE+G+ +NE EI + I+G+L+ ++ +TS A+TFVLK+L+ELPHIY++VY+E +E
Sbjct  260   RMILVKDEDGKLMNEMEICNNIVGLLVASFDTTSCAVTFVLKYLSELPHIYEKVYQEIME  319

Query  1037  IAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKT  1216
             IA+SKGP + LSWEDIQKM YSWNV  E+LRL PP QG FRE  +DF YAGFTIPKGWKT
Sbjct  320   IAESKGPEDLLSWEDIQKMTYSWNVGRESLRLTPPAQGSFREAKSDFDYAGFTIPKGWKT  379

Query  1217  FWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMH  1396
             FW+VYSTH+N K+F+ PD FDPSR+EG+GPAPFTF+PFGGGP+MCPGKEYARLEILVFM+
Sbjct  380   FWSVYSTHRNAKHFANPDVFDPSRFEGSGPAPFTFIPFGGGPKMCPGKEYARLEILVFMY  439

Query  1397  NVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             NVVT FKME+L+P+EKI+ N ASP PVNGLPVRL
Sbjct  440   NVVTRFKMERLIPDEKII-NLASPTPVNGLPVRL  472



>emb|CDP10717.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 355/454 (78%), Gaps = 13/454 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             K   +K  LPPG+ GW ++GEN+D     P K+I +RM KYS +VFKTS +GEKVAVFCG
Sbjct  27    KPKVNKSKLPPGNLGWAILGENVDFATGGPRKFIEERMSKYSSQVFKTSFMGEKVAVFCG  86

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
              AGNKF F+NE+  +T+W P+S+ K L+FP+     L+++  L  + +HEI K E LK Y
Sbjct  87    PAGNKFLFSNEDKTVTSWLPRSMRKALLFPSYVDAPLKEVGALQHSFLHEILKPEALKKY  146

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             IP +D+MA++H+  EWA F+EVKVY L+K YTFALAC+LFL+IED + VKRL DP   V 
Sbjct  147   IPAMDAMARKHLDAEWARFQEVKVYHLAKKYTFALACRLFLNIEDPEHVKRLSDPFACVL  206

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE---GRDVLG  856
              G+FS+PL+FPGTAYN A+KGG+ VR +L++++  RK + M       EDE   GRD+L 
Sbjct  207   NGLFSIPLDFPGTAYNGAIKGGNKVREELLKIVTNRKKELM-------EDESSAGRDLLS  259

Query  857   RLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIE  1036
             R++ V DE+G+ +NE EI + I+G+L+ ++ +TS A+TFVLK L +LPHIY++VY+E +E
Sbjct  260   RMILVKDEDGKLMNEMEICNNIVGLLVASFDTTSCAVTFVLKNLLDLPHIYEKVYQEIME  319

Query  1037  IAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKT  1216
             IAKSKGP++ LSWEDIQKM YSWNVA E+LRL PP QG FRE  TDF YAGFTIPKGWKT
Sbjct  320   IAKSKGPDDILSWEDIQKMTYSWNVARESLRLTPPAQGSFREAKTDFDYAGFTIPKGWKT  379

Query  1217  FWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMH  1396
             FW+VYSTH+NPK+F+ PD FDPSR+EG+GPAPFTF+PFGGGP+MCPGKEYARLEILVFM+
Sbjct  380   FWSVYSTHRNPKHFANPDVFDPSRFEGSGPAPFTFIPFGGGPKMCPGKEYARLEILVFMY  439

Query  1397  NVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             NVVT FKM KL+P+EKI+ N ASP PVNGLPV L
Sbjct  440   NVVTRFKMHKLIPDEKII-NLASPTPVNGLPVLL  472



>ref|XP_010056285.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72950.1| hypothetical protein EUGRSUZ_E01401 [Eucalyptus grandis]
Length=479

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/463 (55%), Positives = 353/463 (76%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGE++D +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSAPNLPPGKKGWPIIGESLDFVGAGKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AVFCGA+GNKF F+ ++  +TTWWP S+ K  +FP   +   +      R+ + E
Sbjct  80    LGEDMAVFCGASGNKFLFSGQDKYITTWWPSSMKKVTIFPETMEKFNKDDPKKMRSFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSM +EH+  +W P++EVKV+ L+K YTFALAC+LF++I+D   V 
Sbjct  140   FLKPEALQHYIPVMDSMTREHLESDWYPYKEVKVFPLTKNYTFALACRLFMNIKDPQVVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P   ++ G  S+P+NFPGT +N+A++GG ++R++L+ +I++RK +    S GK + 
Sbjct  200   KFASPFARIAPGFTSVPINFPGTPFNKAVEGGKVIRQELLNIIRQRKKEI---SEGK-DA  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             + RD+L RLL+  D++G    E ++ + IIG+L+ ++ +TS +IT ++ +LA LPHIY++
Sbjct  256   KSRDLLSRLLTEADDDGSVYYEMDVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIYEK  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK P E L+W+DIQKMKYSWNV CE++RL PP QG FRE +TDFT+AG+T
Sbjct  316   VYKEQMEIAKSKAPGELLNWDDIQKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAGYT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWKTFW VY+THKNPKYF +P+KFDPSR+EGNGP PFT+VPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPTPFTYVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EIL+F+HN+VT FK+EK++P+EKI YN  SP+P NGL +RL P
Sbjct  436   EILIFIHNLVTKFKLEKVIPDEKIFYN-PSPVPANGLLIRLRP  477



>ref|XP_010056287.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72954.1| hypothetical protein EUGRSUZ_E01406 [Eucalyptus grandis]
Length=479

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/463 (55%), Positives = 350/463 (76%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++   +  +  PNLPPG  GWP+IGE+++ +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLAFRKKSPAPNLPPGKKGWPIIGESLEFVGTAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AVFCGA+GNKF F+ +N  +TTWWP S+ K ++FP   +   +      R+ + E
Sbjct  80    LGEDMAVFCGASGNKFLFSGQNKYVTTWWPTSMKKVVIFPETMEKFNKDDPKKMRSFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YIP +DSM +EH+  +W+P++EVKV+ L+K YTFALAC+LF++I+D   V 
Sbjct  140   FLKPEALQCYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPKVVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   ++ G  S+P+N PGT +N+A+ GG ++R++L+ +I++RK +    S GK + 
Sbjct  200   KFADPFARIAPGFTSVPINIPGTPFNKAVGGGKLIRQELLNIIRQRKQEI---SEGK-DA  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD+L RLL+  D++G    E  + + IIG+L+ ++ +TS +IT ++ +LA LPHIY++
Sbjct  256   NARDLLTRLLTEADDDGSVFYEMNVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIYER  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK P E L+W DIQKMKYSWNVACE++RL PP QG FRE +TDF++AG+T
Sbjct  316   VYKEQMEIAKSKAPGELLNWNDIQKMKYSWNVACESMRLTPPAQGAFREAITDFSFAGYT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK FW VY+THKNPKYF +P+KFDPSR+EGNGPAPFT+VPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKAFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPAPFTYVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EILVF+HN+VT FK+EK++P+EKI+YN  SP+P NGL +RL P
Sbjct  436   EILVFIHNLVTKFKLEKVIPDEKIIYN-PSPVPANGLLIRLKP  477



>ref|XP_010070480.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW59275.1| hypothetical protein EUGRSUZ_H01951 [Eucalyptus grandis]
Length=479

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/463 (53%), Positives = 352/463 (76%), Gaps = 11/463 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGE+++         PEK+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSAPNLPPGKKGWPIIGESLEFFGAAKSGCPEKFINDRTTKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AVFC A+GNKF F+ ++  +TTWWP S+ K ++FP   +   +      R+ + E
Sbjct  80    LGEDMAVFCSASGNKFLFSGQDKYITTWWPSSMKKVIIFPKTMEKFNKDDPKKMRSFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L++YIP +DSM +EH+  +W+P++EVKV+ L+K YTFALAC+LF++I+D   V 
Sbjct  140   FLKPEALQNYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPQVVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   ++ G  S+P+N PGT +N+A++ G ++R++L+ +I++RK +    S GK + 
Sbjct  200   KFADPFARIAPGFTSVPINIPGTPFNKAVEAGKVIRQELLNIIRQRKKEI---SEGK-DA  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             + RD+L RLL+  D++G    E ++ + IIG+L+ ++ +TS +IT ++ +LA LPHIY++
Sbjct  256   KSRDLLSRLLTEADDDGSVYYEMDVSNKIIGLLIASHDTTSTSITVIVNYLASLPHIYEK  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK P E L+W+DIQKMKYSWNV CE++RL PP QG FRE +TDFT+AG+T
Sbjct  316   VYKEQMEIAKSKAPGELLNWDDIQKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAGYT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWKTFW VY+THKNPKYF +P+KFDPSR+EGNGP PFT+VPFGGGPR CPGKEYA++
Sbjct  376   IPKGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGPTPFTYVPFGGGPRKCPGKEYAQI  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EIL+F+HN+VT FK+EK++P+EKI+YN  SP+P NGL +RL P
Sbjct  436   EILIFVHNLVTKFKLEKVIPDEKIIYN-PSPVPANGLLIRLRP  477



>ref|XP_010063751.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW71006.1| hypothetical protein EUGRSUZ_F04112 [Eucalyptus grandis]
Length=482

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/465 (54%), Positives = 349/465 (75%), Gaps = 11/465 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             I++ + +   S PNLPPG  GWP+IGE+++ +       PEK+I+DR  KYS EVF+TS+
Sbjct  20    ILFLVFRKKPSPPNLPPGRRGWPLIGESLEFVGTAKGGCPEKFIADRTAKYSSEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AVFCGA+GNKF F+ +N  +TTWWP S+ K L+FP   +   +      R+ + E
Sbjct  80    LGENLAVFCGASGNKFLFSGQNKYITTWWPSSMKKVLVFPETLEKFNKDDPKKMRSFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSMA++H+  +W    EV+V+  +K YTFALAC+LF++I+D   V 
Sbjct  140   FLKPEALQHYIPIMDSMARDHLDTDWLRREEVEVFPSAKNYTFALACRLFMNIKDPKIVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   ++ G+ S+P+N PGT +++A++GG  +R +L+ +I++RK +    S GK + 
Sbjct  200   KFADPFACIAPGLTSVPINLPGTPFSKAVEGGKQIREELLAIIRQRKKEL---SEGK-DA  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD+L RLL   D++G    E E+ + IIG+L+ ++ +TS +IT V+ FLA+ P ++Q+
Sbjct  256   NARDLLSRLLLEADDDGSMFYEMEVSNKIIGLLIASHDTTSTSITVVVNFLAQFPDVFQR  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSKGP+E L+W+DIQKMKYSWNVACE++RL PP QG FRE +TDFT+AG+T
Sbjct  316   VYEEQMEIAKSKGPDELLNWDDIQKMKYSWNVACESIRLCPPAQGAFREAITDFTFAGYT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWKTFW VYSTHKNPKYF +P+KFDPSR+EG+GPAPFT+VPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKTFWTVYSTHKNPKYFPDPEKFDPSRFEGDGPAPFTYVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             E+LVF+HN+VT FK+EK +P+EKI+YN  SP+P NGL +RL  H 
Sbjct  436   ELLVFIHNLVTRFKIEKAIPDEKIIYN-PSPVPANGLLIRLRTHN  479



>gb|EYU22845.1| hypothetical protein MIMGU_mgv1a021193mg [Erythranthe guttata]
Length=473

 Score =   530 bits (1364),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 345/452 (76%), Gaps = 9/452 (2%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             T   NLPPGS GWP++GEN++     P+K+I DRM+KYSPEVF TS+LG+K+A+FCGA G
Sbjct  28    TGSKNLPPGSNGWPLLGENMEFAFSGPQKFIQDRMRKYSPEVFMTSLLGQKIAIFCGAKG  87

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F N++ L T++W QS+ K L+FP  A+     I+IL R+   +  K E LK YIP 
Sbjct  88    NKFLFMNDDKLFTSFWLQSMKKALLFPEPAKGNF--ISILKRSYHGDFLKPEALKQYIPA  145

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D++A++H+   W P   V+V+ LSK YTF LAC+LFL++ D   + +L  P  LV++GM
Sbjct  146   MDALARQHLDSYWIPNSVVEVFPLSKKYTFELACRLFLNVVDPAHIGKLSGPFTLVTSGM  205

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
               +P+N PGTAY+RA+KGG +VR ++V ++ +R+ + +MN     E EGRD+L ++L +T
Sbjct  206   LYVPVNLPGTAYHRAVKGGKLVREKVVSIVTKRRKELVMNE----ETEGRDLLSKMLLLT  261

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE+G+ L+E E+ +  IG L+ +Y +TS+AIT V+ +LAE PH+Y++V+KEQ+ IAKSKG
Sbjct  262   DEDGRFLSEMEVSNIFIGYLVASYMTTSSAITVVMNYLAEFPHVYREVFKEQMAIAKSKG  321

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P+E L+WEDI+KMKYSWNVA E+ RL PP QG  RET  +FTYAGFTIPKG K  W V+S
Sbjct  322   PDELLTWEDIEKMKYSWNVARESFRLMPPAQGAIRETTNEFTYAGFTIPKGSKIVWTVHS  381

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             +HKNP+YF EP+KFDP+R+EG+GPAP+T+VPFGGG R+CPG EYARLE+LVFMHNVVT F
Sbjct  382   SHKNPEYFPEPEKFDPTRFEGSGPAPYTYVPFGGGSRICPGIEYARLEVLVFMHNVVTRF  441

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K+EK +PNEKI+++ A  +P +GLP+RL PH+
Sbjct  442   KLEKAIPNEKILFH-AETVPAHGLPLRLHPHE  472



>ref|XP_006376223.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
 gb|ERP54020.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
Length=486

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/466 (53%), Positives = 339/466 (73%), Gaps = 9/466 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I+ + K  +S    PPG  GWP+IGE    ++      PEK+ +DRMKKYS EVF+TS+
Sbjct  21    LIFLVYKKKSSNIKFPPGRIGWPIIGEAWGFVMAGKRGTPEKFFNDRMKKYSTEVFQTSL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
              G+ +AVFCGA+GNKF F++EN  + TWWP+++ K + FP    N+  + T   R  + E
Sbjct  81    FGDNMAVFCGASGNKFLFSSENKYVATWWPRTIKKIIYFPEHVDNSSIEETAALRRFLPE  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSMA+E +  +W P ++V+V+ LSK YTFALAC+LF+ I D D V 
Sbjct  141   FLKPEALQHYIPIMDSMAREQLEADWCPHKQVRVFPLSKKYTFALACRLFMRIRDPDHVT  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             RL +   LV+ G+ S+P+NFPGT YNRA+KGG M+R +L+ ++K+R+ + + ++  K + 
Sbjct  201   RLANQFALVTDGLVSVPINFPGTTYNRAIKGGKMIREELLAIMKQREGELISDN--KDDA  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                D+L R+L  +D+ G+ +N  EI + I+G+L+ ++ +TS++IT V+ +LA+ P IYQ+
Sbjct  259   GAIDLLTRMLITSDDNGKTMNHKEIANKIVGLLVASHDTTSSSITMVMYYLAQHPCIYQK  318

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ EIA SK P E L+W D+QKMKYSW V CEA+R   P QG FRE +TDF YAGF 
Sbjct  319   VLKEQTEIAMSKAPGELLNWNDVQKMKYSWCVVCEAMRFSSPSQGAFREAITDFFYAGFI  378

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK  W+V+STHKNPKYF +P++FDPSR+EG+GPAP+TFVPFGGGPRMC GKEYARL
Sbjct  379   IPKGWKVHWSVHSTHKNPKYFPDPERFDPSRFEGSGPAPYTFVPFGGGPRMCAGKEYARL  438

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             EILVFMHNVVT FK EK++P EK++ N + P+PVNGLP+ L PH  
Sbjct  439   EILVFMHNVVTKFKWEKIIPEEKVL-NISFPMPVNGLPILLQPHST  483



>ref|XP_002521782.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40592.1| cytochrome P450, putative [Ricinus communis]
Length=483

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/468 (53%), Positives = 343/468 (73%), Gaps = 12/468 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  298
             I+ I K+  + P  PPG TGWPVIGE +D +      VP+K++  RMK YSP+VF+TS+L
Sbjct  17    IFLIYKSKPANPQFPPGKTGWPVIGETLDYLINARHGVPDKFVIKRMKTYSPDVFQTSLL  76

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             G+++AVFCGA+GNKF F+  N  +  WWP+S+ + L+FP    N+  + + + R+ + + 
Sbjct  77    GDRMAVFCGASGNKFIFSTGNKFVQAWWPRSLKQALLFPETHDNSYNEESCILRSFLRDF  136

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              + E LK YIP +DSMAKEH+  EW P++EVKV+   K Y FALAC++F+SI+D   VKR
Sbjct  137   LRAEALKDYIPVMDSMAKEHLEAEWLPYKEVKVFPQVKTYIFALACRMFMSIKDPVHVKR  196

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             + D   +V+ G+FSLP+N PGTA+NRA +GG ++R + + +IK+R+++ + N     E+ 
Sbjct  197   VKDLFDVVAAGVFSLPVNIPGTAFNRAFRGGKIMREEFLAIIKQRRSELLENK--GTEEA  254

Query  839   GRDVLGRLLSVTD---EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
             G D++ R+L   D   +EG  L+E +I + I+G+L+  Y +T+ ++T ++ +LAE P+IY
Sbjct  255   GMDLMSRMLLGLDHDHQEGGTLDEMKIANRIMGLLIAGYDTTTISLTAIVNYLAENPNIY  314

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +V +EQ+EIAKSK P E L+W D+QKMKY+W VACE++RL PP QG F+E  TDFTYAG
Sbjct  315   DKVLREQMEIAKSKIPGELLNWGDVQKMKYAWCVACESMRLSPPVQGTFKEVTTDFTYAG  374

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             F IPKGWKT W V+ST+K+PKYF +P KFDPSR+EG GP P+TFVPF GGPRMCPGKEYA
Sbjct  375   FIIPKGWKTHWTVHSTYKDPKYFPDPGKFDPSRFEGQGPPPYTFVPFAGGPRMCPGKEYA  434

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             R EILVF+HN+VT F+ EK++P+EKI+Y   +  P NGLPVRL PHQN
Sbjct  435   RFEILVFVHNLVTKFQWEKVIPDEKIIY-IPNVTPENGLPVRLLPHQN  481



>gb|KCW72951.1| hypothetical protein EUGRSUZ_E01403 [Eucalyptus grandis]
Length=459

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 240/463 (52%), Positives = 338/463 (73%), Gaps = 31/463 (7%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++ + +  +S PNLPPG  GWP+IGE++D +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20    LLFLVFRKKSSSPNLPPGKKGWPIIGESLDFVGAAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AVFCGA+GNKF F+ ++  +TTWWP S                    + +  + E
Sbjct  80    LGEDMAVFCGASGNKFLFSGQDKYITTWWPSS--------------------MKKLLLLE  119

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSM +EH+  +W+P++EVKV+ L+K YTFALAC+LF++I+D   V 
Sbjct  120   FLKPEALQHYIPIMDSMTREHLESDWSPYKEVKVFPLTKNYTFALACRLFMNIKDPQVVS  179

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   ++ G  S+P+N  GT +++A++GG ++R++L+ +I++R  +       K+  
Sbjct  180   KFADPFARIAPGFTSVPINISGTPFSKAVEGGKVIRQELLNIIRQRTKEISEGKDAKL--  237

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD+L RLL+  D++G    E ++ + I G+L+ +Y +T  +IT ++ +LA LPHIY++
Sbjct  238   --RDLLSRLLTEADDDGSVYYEMDVSNKIFGLLIASYDTTGTSITVIVNYLASLPHIYEK  295

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
              YKEQ+EIAKSK   E L+W+DI+KMKYSWNV CE++RL PP QG FRE +TDFT+AG+T
Sbjct  296   AYKEQMEIAKSKAAGELLNWDDIRKMKYSWNVTCESMRLTPPAQGAFREAITDFTFAGYT  355

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWKTFW VY+THKNPKYF +P+KFDPSR+EGNG  PFT+VPFGGGPRMCPGKEYARL
Sbjct  356   IPKGWKTFWTVYTTHKNPKYFPDPEKFDPSRFEGNGLTPFTYVPFGGGPRMCPGKEYARL  415

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EIL+F+HN+VT FK+EK++P+EKI+YN  SP+P NGL +RL P
Sbjct  416   EILIFIHNLVTKFKLEKVIPDEKIIYN-PSPVPANGLLIRLRP  457



>ref|XP_002278948.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score =   513 bits (1321),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 341/469 (73%), Gaps = 14/469 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I F+     S   LPPG  G P+IGE+I+  +      P+ +I+DRM +YSP+VF+TS+
Sbjct  20    LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT--DAQNTLRKITILN-RTN  466
             +GE +AV CGAAGNKF F+NEN L+ +WWP+SV K L FP+  D  ++     ++N ++ 
Sbjct  80    MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSVYKVLYFPSPNDKDSSGAADLMMNMKSY  139

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             + E  K + L+ YIP +DSMA+EHI  +WAP REVKV+ L + YTFALAC+LF+ I+  +
Sbjct  140   LIEFVKPDALQQYIPVMDSMAREHIDMDWAPNREVKVFQLVQKYTFALACRLFMYIQGEE  199

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + ++  P  L+  G  S+P++ PGT +NR +KGG M+R ++  VIK R+ + +   + K
Sbjct  200   NIAKIAHPFHLIVQGFMSVPIDLPGTGFNRGIKGGKMIREEIEAVIKRRRTELLEKGVSK  259

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
             V D    +L R+L   DE+G+HLN+ EI  Y++G+LL ++ +TS+AITF LK+LA  P +
Sbjct  260   VPD----LLSRMLLSPDEKGRHLNDIEINSYMVGLLLASHDTTSSAITFTLKYLALFPDV  315

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             + +V KEQ+EIA+SKGP E L+W DIQKMKY+W VA E++RL PP QG FRE  TDFT+A
Sbjct  316   HNKVLKEQMEIAQSKGPGELLNWSDIQKMKYTWCVARESMRLAPPAQGAFREATTDFTFA  375

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
             GFTIPKGWKT W V+STHKNPKYF  P+KFDPSR+EG GP P+TFVPFGGGPRMC GKEY
Sbjct  376   GFTIPKGWKTHWCVHSTHKNPKYFPNPEKFDPSRFEGKGPEPYTFVPFGGGPRMCVGKEY  435

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ARLEILVF+HNVVT FK+E ++ NEKI++   S +P  GLP+RL PHQN
Sbjct  436   ARLEILVFIHNVVTKFKLETVLENEKILF-GLSALPAKGLPIRLQPHQN  483



>ref|XP_002319920.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
 gb|EEE95843.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
Length=500

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/468 (53%), Positives = 341/468 (73%), Gaps = 11/468 (2%)
 Frame = +2

Query  137   IYFITKA---NTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKT  289
             +Y +  A    +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF T
Sbjct  35    LYLVVSAYRRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHT  94

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
             S+LG+ +A+FCG +GNKF F++EN  +TTWWP+ + + L FP +   + +  + + R  +
Sbjct  95    SLLGDNLAMFCGVSGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFL  154

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
              EI K E LKHYIP +DSMAK+H+  +W+P+++V+V  LSK YTFALAC+LF++I+D   
Sbjct  155   PEILKPEALKHYIPVMDSMAKDHLEADWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAH  214

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V RL +   LV+ G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK +    +  + 
Sbjct  215   VSRLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGELASENYEE-  273

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
               E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + +TS+AIT V+ +LAE PHIY
Sbjct  274   RAEATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIY  333

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
             Q V +EQ EIA SK P E L+W+D+QKMKYSW+VACE LR+ PP  G FRE + DF++AG
Sbjct  334   QGVLEEQKEIAMSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAG  393

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             FTIPKGWK +W+VYSTHKNPKYF +P+KFDPSR+EG GPAP+TFVPFGGGP MC GKEYA
Sbjct  394   FTIPKGWKAYWSVYSTHKNPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYA  453

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             RLEILVFMHN+V   K EK++PNEKI+Y S + +PV GLPV L P +N
Sbjct  454   RLEILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQPLRN  500



>ref|XP_010669702.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=482

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 333/464 (72%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             I+++  K+     NLPPG TGWP++GE ++ +       PEK++ DRM KYS E FKT+I
Sbjct  22    IVFYKNKSIFFSANLPPGRTGWPLLGETLEFLSTGWRGHPEKFVYDRMVKYSQECFKTNI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE VA+ CGA GNKF F+NEN L+T WWP SV K  +FPT  Q   ++     R  + +
Sbjct  82    LGEPVAIVCGATGNKFLFSNENKLVTAWWPDSVNK--VFPTSLQTNSKEEAKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D+ A+ H A EW   +E+ V+ L+K YTF LAC+LFLS+ED D + 
Sbjct  140   FLKAEALQRYIGIMDTFAQRHFANEWENQKEICVFPLAKRYTFWLACRLFLSVEDPDHIA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R   P  L++ G+ S+P++FPGT +N+A+K   ++R++L  +IK+RK    ++   K   
Sbjct  200   RFAGPFHLLAAGIISIPIDFPGTPFNKAIKAAELIRKELKLIIKQRK----IDLAEKKAT  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L++T+E GQ++ E +I   I+G+L+  + + S  ITF++K+LAE PHIY  
Sbjct  256   PTQDILSHMLTITNENGQNMTEMDIADKILGLLIGGHDTASVVITFIVKYLAEFPHIYNA  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK P E L WEDIQKMKYSWNVACE +RL PP QG FRE +T+FTYAGFT
Sbjct  316   VYKEQMEIAKSKAPGELLKWEDIQKMKYSWNVACEVMRLTPPQQGAFREAMTEFTYAGFT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+ YSTH++PKYF +P+KFDP+R+EGNGPAP+T+VPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSAYSTHRDPKYFVDPEKFDPTRFEGNGPAPYTYVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EIL FMHNVV  F+ EKL+ NEKI+ +   P+P  GLP+RL PH
Sbjct  436   EILAFMHNVVKRFRWEKLLANEKIIVDPF-PVPTKGLPIRLIPH  478



>ref|XP_011001074.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score =   513 bits (1320),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 341/466 (73%), Gaps = 8/466 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++      +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF TS+
Sbjct  46    LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG+ +A+FCGA+GNKF F++EN  +TTWWP+ + + L FP +   + +  + + R  + E
Sbjct  106   LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFLPE  165

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
             I K E LK+YIP +DSMAK+H+  +W+P+++V+V  LSK YTFALAC+LF++I+D   V 
Sbjct  166   ILKPEALKYYIPVMDSMAKDHLEADWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAHVS  225

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             RL +   LV+ G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK +    +  +   
Sbjct  226   RLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGELASENYEE-RA  284

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + +TS+AIT V+ +LAE PHIYQ+
Sbjct  285   EATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIYQR  344

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V +EQ EIA SK P E L+W+D+QKMKYSW+VACE LR+ PP  G FRE + DF++AGFT
Sbjct  345   VLEEQKEIAVSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAGFT  404

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+VYSTHKNPKYF  P+KFDPSR+EG GPAP+TFVPFGGGP MC GKEYARL
Sbjct  405   IPKGWKAYWSVYSTHKNPKYFPNPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYARL  464

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             EILVFMHN+V   K EK++PNEKI+Y S + +PV GLPV L P +N
Sbjct  465   EILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQPLKN  509



>ref|XP_011074929.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Sesamum indicum]
Length=421

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/434 (57%), Positives = 331/434 (76%), Gaps = 17/434 (4%)
 Frame = +2

Query  218   IDLMVPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVT  397
             + L+  +K++ +RM+KYSP+VF+TS+ GE++AVFCGA GNKF FTN+N LLT+W P+++T
Sbjct  3     LALLGQQKFVKNRMEKYSPDVFQTSLFGERMAVFCGAQGNKFLFTNDNKLLTSWSPKTMT  62

Query  398   KPLMFP--TDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREV  571
             K  +F    D+ N L+++T + R+  ++I K E+LK YIP +D++A+EH+  EW P   V
Sbjct  63    KTFLFTEFVDSSN-LKQVTAVRRSFQYDILKPESLKQYIPVMDALAREHMDREWTPNALV  121

Query  572   KVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGG  751
              V  LSK YTF LACKLFL + D +++KRL DP  L + GM  +P+N PG AYNRA++GG
Sbjct  122   NVVPLSKKYTFDLACKLFLDVVDVEDIKRLSDPFSLATQGMLGVPINLPGMAYNRAIRGG  181

Query  752   SMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGI  931
              M+R++L+ +I ER+ K     L K E   +D+L ++L VTDE GQ  +E EI + I+G 
Sbjct  182   KMIRKELIRIINERRKKL----LEKKETRHQDLLSKMLLVTDENGQFYSEMEISNNIVGF  237

Query  932   LLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNV  1111
             L+ ++ +TS+A++ V+ +LA LPHIY+QV KEQ+EIAKSKGP+E L+WEDIQKMKYSWNV
Sbjct  238   LVASFDATSSAVSSVINYLAHLPHIYEQVLKEQMEIAKSKGPDELLTWEDIQKMKYSWNV  297

Query  1112  ACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRY  1291
             A E+LRL P  QGGFRET T+FTYAGFTIPKGWKT W V+S+H+NP+YF EP+KFDPSR+
Sbjct  298   ARESLRLGPSSQGGFRETTTEFTYAGFTIPKGWKTHWTVHSSHRNPEYFPEPEKFDPSRF  357

Query  1292  EGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPI  1471
             +G+GP P+TFVPFGGGPRMCPG+EYA+LEILVFMHNVV  FK+EK +PNE          
Sbjct  358   DGSGPPPYTFVPFGGGPRMCPGREYAKLEILVFMHNVVRRFKLEKAIPNE----------  407

Query  1472  PVNGLPVRLTPHQN  1513
             PV+GL V L PH+N
Sbjct  408   PVDGLAVHLQPHEN  421



>ref|XP_011001073.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score =   512 bits (1318),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 341/466 (73%), Gaps = 8/466 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             +++      +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF TS+
Sbjct  46    LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG+ +A+FCGA+GNKF F++EN  +TTWWP+ + + L FP +   + +  + + R  + E
Sbjct  106   LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPIQRILSFPEEIVTSSKDDSTILRRFLPE  165

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
             I K E LK+YIP +DSMAK+H+  +W+P+++V+V  LSK YTFALAC+LF++I+D   V 
Sbjct  166   ILKPEALKYYIPVMDSMAKDHLEVDWSPYKQVRVLPLSKKYTFALACRLFMNIKDPAHVS  225

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             RL +   LV+ G+ S+P+NFPGT Y RA+KGG ++R +L+ ++K+RK +    +  +   
Sbjct  226   RLENHFNLVTNGLVSVPINFPGTTYYRAVKGGKIIREELLAIMKQRKGELASENYEE-RA  284

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             E  D+L  +L  +D+ GQ LNE +I + ++G+L+  + +TS+AIT V+ +LAE PHIYQ+
Sbjct  285   EATDLLTLMLLASDDNGQPLNERDIAYKVLGLLVAGHDTTSSAITMVMYYLAEYPHIYQR  344

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V +EQ EIA SK P E L+W+D+QKMKYSW+VACE LR+ PP  G FRE + DF++AGFT
Sbjct  345   VLEEQKEIAVSKAPGELLNWDDVQKMKYSWSVACEVLRVSPPVSGTFREVIADFSFAGFT  404

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+VYSTHKNPKYF  P+KFDPSR+EG GPAP+TFVPFGGGP MC GKEYARL
Sbjct  405   IPKGWKAYWSVYSTHKNPKYFPNPEKFDPSRFEGKGPAPYTFVPFGGGPFMCAGKEYARL  464

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             EILVFMHN+V   K EK++PNEKI+Y S + +PV GLPV L P +N
Sbjct  465   EILVFMHNLVNRVKWEKVIPNEKIMYTSFA-MPVKGLPVLLQPLKN  509



>ref|XP_010252185.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=488

 Score =   511 bits (1315),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/464 (54%), Positives = 332/464 (72%), Gaps = 14/464 (3%)
 Frame = +2

Query  140   YFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  298
             YF+ K   T    LPPGS GWPV+GE+++ +       PEK+  DRMKKYSPEVFKTS+L
Sbjct  31    YFVCKYKRTGGAYLPPGSLGWPVVGESLEFLSTGRNGTPEKFFEDRMKKYSPEVFKTSLL  90

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE  AVFCGA GNKF F+NEN L+T+WWP+SV K  +FPT  Q + ++  +  R  +   
Sbjct  91    GEPAAVFCGAGGNKFLFSNENKLVTSWWPRSVEK--IFPTSLQTSTKEEAVKMRKLLPSF  148

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ Y+  +D +A+ H+   W    +V V+ L K YTF+LAC+LF+SIED D V +
Sbjct  149   LKPEALQKYVGIMDIVARRHLDASWDGKEQVTVFPLVKRYTFSLACRLFMSIEDPDHVAK  208

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
               DP  +++ G+ SLP+N PGT +NRA+K   ++R++L+ +I++RK      ++   +D 
Sbjct  209   FADPFHVLAAGVMSLPINLPGTPFNRAIKAAQLIRKELLAIIRKRKTDLAEKTVSSTQD-  267

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
                +L  +L+ TDE G+ +NE +I   I+G+L+  + + SAAITF++K+LAELP IY +V
Sbjct  268   ---ILSHMLTTTDESGKFMNELDIADKILGLLIGGHDTASAAITFIMKYLAELPEIYNEV  324

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              KEQ EIAKSK   E L+WEDIQKMKYSWNVACE +RL PP QG FRE +TDFT+AGF+I
Sbjct  325   LKEQTEIAKSKASGELLTWEDIQKMKYSWNVACEVMRLAPPLQGTFREALTDFTFAGFSI  384

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W   STH+NPKYF EP KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  385   PKGWKLYWTSNSTHRNPKYFPEPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLE  444

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVF++++V  FK E  +P+EKI+ +   P P  GLPVRL PH+
Sbjct  445   ILVFIYHLVRRFKWENALPDEKIIVDPM-PQPAKGLPVRLQPHK  487



>ref|XP_011003986.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   510 bits (1313),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 248/466 (53%), Positives = 335/466 (72%), Gaps = 13/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I  + K        PPG TGWP+IGE  D M+      PEK+I+DR+ KYSPEVF+TS+
Sbjct  20    LIVLLHKRKYWNTKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKYSPEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG  +AVFCG+ GNKF +++EN  +T W P S+ K L  P  A N+ ++ +   R  + E
Sbjct  80    LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHSIMKILFSPEHASNSYKEDSAKLRKFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSMAK+H+  +W P+++VKV+ LSK YTF+LAC+LF++I+D + V 
Sbjct  140   FLKPEPLQHYIPLMDSMAKDHLKADWFPYKQVKVFPLSKTYTFSLACRLFMNIKDPEHVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             RL +   +++ G+ SLPLNFPGTAYNRA+KGG+M+R +++ ++KER+         + E 
Sbjct  200   RLQNHFNIITKGILSLPLNFPGTAYNRAIKGGNMIREEILGIMKERRELIS----ERKEP  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             E  D+L R+L VTDE    +N+ EI   ++G+L  ++ +TSA+I+  + +LA  PH+Y +
Sbjct  256   EFIDLLTRMLLVTDENA--MNDMEIADRVVGLLFGSHDTTSASISMAMHYLANNPHVYTK  313

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ+EI K K P E L+W DIQKMKY+W V CE +RL PPGQGGFRE +TDF+YAGFT
Sbjct  314   VLKEQMEIQKLKAPGESLTWNDIQKMKYTWCVVCEVMRLSPPGQGGFREAITDFSYAGFT  373

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK  W+V+STHKNPKYF +P+KFDPSR+EG    P++FVPFGGGPRMCPGKEYARL
Sbjct  374   IPKGWKVHWSVHSTHKNPKYFPDPEKFDPSRFEGKDIEPYSFVPFGGGPRMCPGKEYARL  433

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ILVFMHNVVT FK E++  +EKI+Y S  P+P   LP+ L PH+N
Sbjct  434   AILVFMHNVVTQFKWERVTQDEKIIYMSI-PMPACSLPITLHPHKN  478



>ref|XP_007023618.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26240.1| Cytochrome P450 [Theobroma cacao]
Length=478

 Score =   508 bits (1309),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 334/465 (72%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++ +    N S PNLPPG  G P+IGE+++ ++      PEK+++DRM KYS +VFKTSI
Sbjct  20    VLLYSKNPNASHPNLPPGRMGLPLIGESLEYLLTGRKGYPEKFLNDRMAKYSSQVFKTSI  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +AV CGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  +  
Sbjct  80    LGESMAVVCGAAGNKFLFSNENKLVTAWWPDSVNK--IFPSSTQTSSKEESKKMRKMLPN  137

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H    W   +E+ V+ L+K YTF +ACK+FLSIED + V 
Sbjct  138   FLKPEALQRYIGMMDNIAQRHFEASWEGKQEITVFPLAKRYTFWVACKVFLSIEDPEHVS  197

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   +++G+ S+P+N PGT + RA+    ++R++L+ +IK+RK     N       
Sbjct  198   KFADPFNALASGIISVPINLPGTPFRRAINASELIRKELMAIIKQRKIDLAENKAAP---  254

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  TDE GQ+LNE  I   I+G+L+  + + SAAITF++K+LAELP IY +
Sbjct  255   -NQDILSHMLLATDENGQYLNELNIADRILGLLIGGHDTASAAITFIIKYLAELPDIYNE  313

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIA+SK P E L+WEDIQKMKYSWNVACE +RL PP QG FRE +TDFT++GF+
Sbjct  314   VYKEQMEIARSKEPGELLNWEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTFSGFS  373

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK  WNV STHKN + F EP+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  374   IPKGWKLHWNVNSTHKNVECFPEPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  433

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHNV+  F  EKL+P+EKI+ +   P+P  GLPVRL PH+
Sbjct  434   EILVFMHNVMKRFNWEKLLPDEKIIVDPL-PMPAKGLPVRLLPHK  477



>ref|XP_002279608.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=481

 Score =   508 bits (1309),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 255/470 (54%), Positives = 349/470 (74%), Gaps = 23/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +++ + +  ++   LPPG+ GWP+IGE +   +      P ++I +RM KYSP+VF+TS+
Sbjct  19    VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GEKVAVFCG AGNKF F+N N L+ TW P+S+ K L+F +  +   R +    R+ + E
Sbjct  79    VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSMEKILLFESPPKVEPRGL----RSYVLE  134

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               + + L+ YI  +DSMA+EHI  +WAP REVKVY LSK YTFALAC+LF+SI+D ++V 
Sbjct  135   FLRPDVLQRYIQIMDSMAREHIEMDWAPNREVKVYPLSKKYTFALACRLFMSIKDPEQVA  194

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             ++  P  L+++G+ S+P++FPGT +NRA KGG M+R +LV +IK+R+         ++ D
Sbjct  195   KVAHPFHLITSGLVSVPIDFPGTPFNRAKKGGKMLRDELVAIIKQRR--------NELSD  246

Query  836   EGR----DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
             EG     D+L  LL  +DE G+ LN+ EI   I+G+ L ++ STSA +TFVL +LAE P 
Sbjct  247   EGEPEVQDLLSSLLLQSDENGKGLNDMEISDKIVGLFLASFDSTSATLTFVLNYLAEFPD  306

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             +Y +V KEQ+EIAKSK P E L W DIQKMKY+W+VA E +RL PP QG FRE +TDFTY
Sbjct  307   VYDKVLKEQMEIAKSKDPGEFLKWNDIQKMKYTWSVANETMRLAPPAQGTFREVITDFTY  366

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKE  1363
              GFTIPKGWKT+W+V++T++NPK+F +P+KFDPSR+EG GPAP+TFVPFGGGPR+CPGKE
Sbjct  367   EGFTIPKGWKTYWSVHTTNRNPKHFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKE  426

Query  1364  YARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             Y+RL+ILVF+HN+VT FK EK+ PNEK++YN  SPIPVNGLP+RL P +N
Sbjct  427   YSRLQILVFIHNMVTRFKWEKVDPNEKVIYN-PSPIPVNGLPIRLHPREN  475



>ref|XP_002279623.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=476

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/465 (55%), Positives = 331/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II+ +++  ++   LPPG  GWP+IGE  +  +      PE++I+DRMKKYSP VF+TS+
Sbjct  19    IIFLVSRRKSACSKLPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGEKVAVFCG AGNKF F+N N L+TTW P S+ K L+F +       +     R+ + E
Sbjct  79    LGEKVAVFCGPAGNKFLFSNHNKLITTWKPPSMEKALLFQSSPPKAEPRGM---RSFVLE  135

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               + + L+  I  +DSMA ++I  +WAP +EV VY LSK YTF LAC LF+SI+D + + 
Sbjct  136   FLRPDALQRNIHIMDSMAHQNINTDWAPHKEVNVYPLSKKYTFTLACHLFISIKDPEHIA  195

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R+  P   + +G+ SLP++FPGTA+N A KGG M+R +LV +IK+R+ +       K E 
Sbjct  196   RIARPFHQMLSGLVSLPIDFPGTAFNSAKKGGKMLRHELVAIIKQRRKELS----EKEES  251

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD+L  LL  TDE G  LN+ EI   I+GI L ++ STS  +TF+  +LAE PH Y +
Sbjct  252   VARDLLSSLLLATDENGAVLNDMEISDKIVGIFLASFDSTSTTLTFIFNYLAEFPHAYDK  311

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ+EIA SK P E L W DIQKMKY+W V  E +RL PP QG FRE +TDFT+ GFT
Sbjct  312   VLKEQMEIAMSKDPEEFLKWNDIQKMKYTWCVVKETMRLAPPAQGTFREAITDFTFEGFT  371

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWKT+W+V+ST+KNPKYF +P+KFDPSR+EG GPAP+TFVPFGGGPR+CPGKEY RL
Sbjct  372   IPKGWKTYWSVHSTNKNPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYVRL  431

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              ILVF+HN+VT FK  K+VPNEKI+YN  SP PVNGLP+RL PH+
Sbjct  432   VILVFIHNMVTRFKWAKVVPNEKIIYN-PSPFPVNGLPIRLQPHE  475



>ref|XP_002325975.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
 gb|EEF00357.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
Length=478

 Score =   506 bits (1302),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 338/466 (73%), Gaps = 13/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I  + K        PPG TGWP+IGE  D M+      PEK+I+DR+ K+SPEVF+TS+
Sbjct  20    LIVLLHKRKFWNSKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKFSPEVFQTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG  +AVFCG+ GNKF +++EN  +T W P  + K L  P  A N+ ++ +   R  + E
Sbjct  80    LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHPIMKVLFSPEHASNSYKEDSAKLRKFLPE  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+HYIP +DSMAK+H+  +W P+++VKV+ LSK YTF+LAC+LF++I+D ++V 
Sbjct  140   FLKPEPLQHYIPVMDSMAKDHLKADWFPYKQVKVFPLSKTYTFSLACRLFMNIKDPEQVS  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             RL +   LV+ G+ SLPLNFPGTAYNRA+KGG+M+R +++ ++KER+    + S  K E 
Sbjct  200   RLQNHFNLVTKGILSLPLNFPGTAYNRAIKGGNMIREEILGLMKERRE---LISESK-EP  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             E  D+L R+L VTDE    +++ EI   ++G+L  ++ +TSA+I+  + +LA  PH+Y +
Sbjct  256   EFIDLLTRMLLVTDENA--MDDMEIADRVVGLLFGSHDTTSASISMAMYYLAGNPHVYTK  313

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ+EI K K P E L+W DIQKMKY+W V CE +RL PPGQGGFRE +TDF+YAGFT
Sbjct  314   VLKEQMEIQKLKAPGELLTWNDIQKMKYTWCVVCEVMRLSPPGQGGFREAITDFSYAGFT  373

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK  W+V+STHKNPKYF +P+KFDPSR+EG    P++FVPFGGGPRMCPGKEYARL
Sbjct  374   IPKGWKVHWSVHSTHKNPKYFPDPEKFDPSRFEGKDIEPYSFVPFGGGPRMCPGKEYARL  433

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ILVFMHNVVT FK EK++ +EKI+Y S  P+P   LP+ L PH++
Sbjct  434   AILVFMHNVVTQFKWEKVIKDEKIIYMSI-PMPACSLPITLHPHKS  478



>ref|XP_002526799.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF35534.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   504 bits (1299),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 327/450 (73%), Gaps = 11/450 (2%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG+ GWP IGE++  ++      PEK+I+DR+ KYS +VF+TS+LGE +AVFCGAAG
Sbjct  35    KLPPGTKGWPFIGESLAFLMTSRRGHPEKFINDRVTKYSADVFQTSLLGENMAVFCGAAG  94

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NK  FT+EN  +  WWP+S+ K  + P   + + ++++   R  + E  K E L+  IP 
Sbjct  95    NKLLFTSENKYVKAWWPKSLLKAFLVPDPDEFSFKEVSTGYRRILTEFLKPEALQRSIPV  154

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +DSMA+EH+  +W PF+EVKV+ L + Y+FAL+C+LF+SI+D + V +LL P  LVS+GM
Sbjct  155   MDSMAREHLKTDWHPFKEVKVFPLIRKYSFALSCRLFISIKDPNLVSKLLGPFALVSSGM  214

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              S+P+NFPGT Y +A+K   ++    +E++  RK    +    K      D+L RLL   
Sbjct  215   LSVPINFPGTPYYKAIKASKVINHDFLEIMNRRK----LELAEKKNITSPDLLTRLLLHK  270

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             +++G+ + +  +Y  I+ +L  ++ + S AITF+ K LAE PH+  +V+KEQ+EIAKSK 
Sbjct  271   EDDGRSMTDAGVYSRIMALLFASHDTISTAITFMFKHLAEHPHVSNRVFKEQMEIAKSKE  330

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+WEDIQKMKY+W VACE +RL PP QG FRE +TDFTYAGFTIPKGWK +W V+S
Sbjct  331   PGELLNWEDIQKMKYTWCVACETMRLLPPSQGAFREAITDFTYAGFTIPKGWKIYWTVHS  390

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             THKNPKYF +P+KFDPSRYEG+GPAP+TFVPFGGGP MCPG+EYARLEIL+FMHN+VT F
Sbjct  391   THKNPKYFPDPEKFDPSRYEGDGPAPYTFVPFGGGPVMCPGREYARLEILIFMHNMVTKF  450

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             K  K++  EKI+++SA PIPV GLP+ L P
Sbjct  451   KWHKVIEGEKIIFHSA-PIPVKGLPILLEP  479



>ref|XP_007014637.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY32256.1| Cytochrome P450 [Theobroma cacao]
Length=480

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 337/465 (72%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  K+N S PNLPPG  G P++GE+++ +       PEK+I DR+ KYS +VFKT+I
Sbjct  22    VLFYRHKSNYSAPNLPPGKPGLPIVGESLEFLSTGWKGHPEKFIFDRIAKYSSQVFKTNI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  + +
Sbjct  82    LGEPAAVFCGAAGNKFLFSNENKLVTAWWPSSVDK--IFPSSLQTSSKEESKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H A  W    EV V+ L+K YTF LAC+LFLSIED + V 
Sbjct  140   FLKPEALQRYIGIMDTIAQRHFASGWENKDEVVVFPLAKRYTFWLACRLFLSIEDPNHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  L+++G+ SLP++ PGT +NR +K  + +R++LV++IK+RK      + GK   
Sbjct  200   KFEGPFHLLASGIISLPIDLPGTPFNRGIKASNFIRKELVKIIKQRKVDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  +DE GQ +NE +I   I+G+L+  + + SAA TF++K+LAELPH+Y++
Sbjct  257   T-QDILSHMLLTSDENGQFMNEMDIADKILGLLIGGHDTASAACTFIVKYLAELPHMYEE  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQIEIA SK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE + DF + GF+
Sbjct  316   VYKEQIEIANSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREAINDFIFNGFS  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH+NP+ F +P KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHRNPECFPDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK EKL+P+EKI+ +   P+P  GLPV L PH+
Sbjct  436   EILVFMHNLVKRFKWEKLLPDEKIIVDPM-PMPAKGLPVHLYPHK  479



>gb|KDP42281.1| hypothetical protein JCGZ_01605 [Jatropha curcas]
Length=474

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 340/452 (75%), Gaps = 15/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPGSTGWP+IGE+I+ +       PEK+I DRM K+S +VFKTS+  E  AVFCGAAG
Sbjct  29    NLPPGSTGWPLIGESIEFLTTGRKGQPEKFIFDRMVKFSNKVFKTSLFCEPAAVFCGAAG  88

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ ++  R  + +  K E L+ YI  
Sbjct  89    NKFLFSNENKLVTAWWPSSVNK--IFPSSKQTSSQEESMRMRKLLPQFLKPEALQRYIGI  146

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A+ H A +W   ++V V+ L+K YTF+LAC+LFLS+EDR++V++   P  ++++ +
Sbjct  147   MDVVAQSHFAFDWDNKQQVTVFPLAKMYTFSLACRLFLSMEDREQVEKFAKPFDVLASAI  206

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE-DEGRDVLGRLLSV  871
              ++P++FPGT++NR +K  ++VR++L+++IK+RK     N LG+ +  + +D+L  +L+ 
Sbjct  207   IAIPIDFPGTSFNRGIKASNLVRKELLKIIKQRK-----NDLGENKASQTQDILSHMLTT  261

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
              D++GQ ++E EI   I+G+L+  + + SAAITFV+K+LAE+P +Y++V++EQ+ IAK+K
Sbjct  262   ADDKGQFMSEIEIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYEKVFEEQMRIAKAK  321

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
                E L+WEDIQKMKYSWNVACE +RL PP QG FRE +TDFTYA +TIPKGWK +W+  
Sbjct  322   VAGELLNWEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTYADYTIPKGWKLYWSAN  381

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
             STH+NP+ F +P+KFDPSR++GNGPAP+TFVPFGGGPRMCPGKEYARLEIL+FMHN+V  
Sbjct  382   STHRNPECFHDPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILIFMHNIVKK  441

Query  1412  FKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             FK EKL+P E I+ +   PIP  GLP+ L PH
Sbjct  442   FKWEKLLPQENIIVDPL-PIPAKGLPIVLHPH  472



>gb|AGN04219.1| cytochrome P450 [Salvia miltiorrhiza]
Length=474

 Score =   501 bits (1289),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 333/465 (72%), Gaps = 13/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +YF+     +   LPPG TGWPVIGE+++ +       PEK+I DRM KYSP VF+T +L
Sbjct  17    LYFLFYKTKAGARLPPGRTGWPVIGESLEFLSIGWKGHPEKFIFDRMAKYSPTVFRTHLL  76

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE+ AVFCGAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +  I
Sbjct  77    GERAAVFCGAAGNKFLFSNENKLVQAWWPASVDK--IFPSSTQTSSKEEAIKMRKMLPNI  134

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L  Y+  +D +A+ H A+ W   +EV V+ L+K YTF LAC+LF+SIED  +V++
Sbjct  135   LKPEALHRYVEIMDHIARRHFADGWDNKKEVVVFPLAKNYTFWLACRLFVSIEDPAQVQK  194

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
               +P  L+++G+ S+P++ PGT +N+ +K  + VR++LV +IK+RK    ++        
Sbjct  195   FAEPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKELVAIIKQRK----LDLADGKASP  250

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  +L  TD+ G+ ++E +I   I+G+L+  + + S+A  F++K+LAELPHIY +V
Sbjct  251   TQDILSHMLLATDDSGKSMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPHIYDRV  310

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             Y EQ+ IA+SK   E L WED+QKMKYSWNVACE +R+ PP QG FRE +TDFTY GF+I
Sbjct  311   YHEQMGIARSKAAGELLKWEDVQKMKYSWNVACEVMRMAPPLQGAFREALTDFTYNGFSI  370

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STHKNP++F+EP KF+P+R+EG+GPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  371   PKGWKLYWSANSTHKNPEFFAEPMKFEPARFEGSGPAPYTFVPFGGGPRMCPGKEYARLE  430

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ILVFMH++VT FK E L+PNE IV +   PIP  GLPVRL PH++
Sbjct  431   ILVFMHHLVTRFKWEMLIPNETIVVDPM-PIPAKGLPVRLFPHRS  474



>ref|XP_007011469.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY29088.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score =   500 bits (1288),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/467 (53%), Positives = 333/467 (71%), Gaps = 15/467 (3%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  289
             ++Y I +  A  +  NLPPG+TG P +GE+I  +       PEK++ DRM K+S +VFKT
Sbjct  23    LVYLIHRRIAPVASKNLPPGTTGLPFLGESIQFLRAGQKGHPEKFVYDRMTKFSSKVFKT  82

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
             S+LGE  AVFCG+ GNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +I  R  +
Sbjct  83    SLLGETAAVFCGSTGNKFLFSNENKLVTAWWPNSVNK--IFPSSLQTSSKQESIKMRKLL  140

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                 K E L+ Y+  +D +A+ H+A  W   +EV V+ L+K +TF LAC+LFLSIED   
Sbjct  141   PNFLKPEALQRYVSVMDMIAQRHLASSWDNEQEVTVFPLAKRFTFWLACRLFLSIEDPQH  200

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V +  +P   +++G+ S+P++FPGT +NRA+K  +++R++L ++I+ RK     N     
Sbjct  201   VAKFSEPFNALASGIISIPIDFPGTPFNRAIKASNLIRKELRDIIRRRKVDLAENKASPT  260

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
             +D    +L  +L   DE GQ++NE EI   I+G+L+  + + S AITFV+K+LAELP +Y
Sbjct  261   QD----ILSHMLLTADENGQYMNEMEIADKILGLLIGGHDTASTAITFVVKYLAELPQVY  316

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +V KEQ+EIAKSK P E L+W+DIQKM+YSWNVACE +RL PP QG FRE +TDF YAG
Sbjct  317   SEVLKEQMEIAKSKEPGELLNWDDIQKMRYSWNVACEVMRLAPPLQGAFREAMTDFIYAG  376

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             F+IPKGWK +W+  STH+NP+ F EP+KFDP R+EG+GPAP+TFVPFGGGPRMCPGKEYA
Sbjct  377   FSIPKGWKLYWSANSTHRNPECFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             RLEILVFMHN+V  FK EKLVP EKI+ +   P+P  GLPVRL PH+
Sbjct  437   RLEILVFMHNLVRRFKWEKLVPKEKIIVDPM-PMPEKGLPVRLLPHK  482



>ref|XP_002528002.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34414.1| cytochrome P450, putative [Ricinus communis]
Length=471

 Score =   499 bits (1286),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 340/466 (73%), Gaps = 17/466 (4%)
 Frame = +2

Query  137   IYFITKAN-TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             + F  K+N +S+ NLPPG+TGWP+IGE+I+ +       PEK+I DRM+K+S +VFKTS+
Sbjct  16    LIFKHKSNASSRKNLPPGNTGWPLIGESIEFLSTGRKGHPEKFIFDRMEKFSSKVFKTSL  75

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             L E  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  + +
Sbjct  76    LLEPAAVFCGAAGNKFLFSNENKLVTAWWPNSVNK--IFPSSLQTSSQEESKRMRKLLPQ  133

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D +A+ H A  W   ++V V+ L+K YTF LAC+LFLS+EDR+EV+
Sbjct  134   FLKPEALQRYISIMDVIAQRHFAFGWNNKQQVTVFPLAKMYTFWLACRLFLSMEDREEVE  193

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  ++++G+ S+P++FPGT +NR +K  + VRR+L+++I++RK     N     +D
Sbjct  194   KFAKPFDVLASGIISIPIDFPGTPFNRGIKASNEVRRELIKMIEQRKIDLAENKASPTQD  253

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L+  DE   ++NE +I   I+G+L+  + + SAAITFV+K+LAE+P +Y +
Sbjct  254   ----ILSHMLTTADE---YMNEMDIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYNK  306

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V +EQ+EIAK+K   E L+WEDIQKM+YSWNVACE +RL PP QG FRE +TDFTYAGFT
Sbjct  307   VLEEQMEIAKAKAAGELLNWEDIQKMRYSWNVACEVMRLAPPLQGAFREAMTDFTYAGFT  366

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W   STH+NP+ F EP+KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  367   IPKGWKLYWGANSTHRNPECFPEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARL  426

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             EILVFMHN+V  F+ EKL+P EKI+ +   PIP  GLP+RL PH +
Sbjct  427   EILVFMHNIVKKFRWEKLLPEEKIIVDPL-PIPAKGLPLRLHPHTS  471



>ref|XP_007023620.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26242.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 331/464 (71%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             I  +  K N S+PNLPPG TG P IGE+++ +       PEK+I DRM K+S +VF+TSI
Sbjct  23    IFSYACKTNASQPNLPPGKTGLPYIGESLEFLSTGRKGHPEKFIYDRMAKFSSQVFRTSI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++     R  +  
Sbjct  83    LGEATAVFCGAAGNKFLFSNENKLVTAWWPNSVNK--VFPSSTQTSSKEEAKKMRKLLPN  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y+  +D++A+ H    W   +EV V+ L+K YTF +A K+FLS+ED   V 
Sbjct  141   FLKPEALQRYVGMMDTIAQRHFESGWEGQQEVSVFPLAKNYTFWVASKVFLSVEDPKHVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L DP  ++++G+ S+P++ PGT +NRA+K  +++R++L  +IK+RK    ++   K   
Sbjct  201   KLGDPFNVLASGIISIPIDLPGTPFNRAIKASNLIRKELTAIIKQRK----IDLAEKKAS  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  +DE G+++NE +I   I+G+L+  + + SAAITF++K+LAELP IYQ+
Sbjct  257   PTQDILSHMLLTSDENGRYMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPEIYQK  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V  EQ+EIAKSK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE + +F YAGF 
Sbjct  317   VQSEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALNEFIYAGFN  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH+NP+ F EP+KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  377   IPKGWKLYWSANSTHRNPECFPEPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EILVFMHN+V  F  EKL+P+E I+ +   P+P  GLPVRL P 
Sbjct  437   EILVFMHNIVKRFNWEKLLPDENIIVDPM-PMPAKGLPVRLLPQ  479



>ref|XP_002513183.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF49174.1| cytochrome P450, putative [Ricinus communis]
Length=477

 Score =   498 bits (1282),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 327/453 (72%), Gaps = 13/453 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG TG P IGE+++ +       PEK++SDRM+K+S +VF+TSILGE+ AV CGA G
Sbjct  31    NLPPGKTGLPYIGESLEFLSTGRKGHPEKFLSDRMEKFSRQVFRTSILGEQTAVVCGAQG  90

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP+S+ +  +FP+  Q+T+    +  R  +    K E L+ YI  
Sbjct  91    NKFLFSNENKLVTAWWPKSILR--LFPSSNQSTILAEGMRMRKMLPHFLKPEALQRYIGV  148

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D MA+ H  + W   +EV VY L+K YTF++ACK+FLS++D  EV +   P   +++G+
Sbjct  149   MDHMAQVHFQDSWENKQEVTVYPLAKMYTFSVACKVFLSMDDPKEVAKFAAPFNDMASGI  208

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              S+P+NFPGT++NR +K   ++R +++ +IK+R+     N    ++D    +L  +L  T
Sbjct  209   ISIPINFPGTSFNRGLKASKIIRNEMLRMIKQRRKDLAENKATPMQD----ILSHMLVAT  264

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DEEGQ L E  I   II +L+  + + SA ITFV+KFLAELP IY QV KEQ+EIAKSK 
Sbjct  265   DEEGQRLGEVGIADKIISLLIGGHDTASATITFVVKFLAELPDIYDQVLKEQLEIAKSKE  324

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+WEDIQKMKYSWNVACE +RL PP QG FRE + DF YAGF+IPKGWK +W+ ++
Sbjct  325   PGELLTWEDIQKMKYSWNVACEVMRLAPPLQGSFREALHDFDYAGFSIPKGWKLYWSTHT  384

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             THKNP+YFS+P+KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLEILVFMHN+   F
Sbjct  385   THKNPEYFSDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNIAKRF  444

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             K  K++P+EKIV +   PIP  GLPV L P ++
Sbjct  445   KWNKVIPDEKIVVDPM-PIPAKGLPVHLYPQKH  476



>ref|XP_010058451.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=474

 Score =   498 bits (1281),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 334/453 (74%), Gaps = 11/453 (2%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+L PG+ GWPV+GE ++ M       PEK++ DR   +S +VF+T++ G  +AVFCGA+
Sbjct  27    PHLLPGTKGWPVVGETLEYMTAGRSGRPEKFVKDRAAWHSSDVFRTNLYGADMAVFCGAS  86

Query  332   GNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIP  511
             GNKF F++EN  ++ WWP S+ K  MFP        +     R+ + E  K E L+HYIP
Sbjct  87    GNKFLFSSENKHVSPWWPDSMKKIFMFPEALGKLKNEDAKKRRSFMLEFLKPEALRHYIP  146

Query  512   TIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTG  691
              +DS+ ++H+A +W+P +EV+V+ L K YT ALAC+LF++I D + V++  DP   V+ G
Sbjct  147   VMDSVTRDHLATDWSPHKEVRVFPLLKSYTLALACRLFMNIRDPEIVRKFADPFARVAPG  206

Query  692   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSV  871
               ++P+N PGT +NRA++GG ++R++L+++++ RK   M  S GK +   RD L RLL  
Sbjct  207   FVTVPINIPGTPFNRAVEGGKVLRQELLDLVRRRK---MEISEGK-DANARDFLSRLLLE  262

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
               ++G  L E +    I+G+L  ++ +TS +IT ++ +LA+ PH+Y++V++EQ+EIA+SK
Sbjct  263   GGDDGTALYEMDTSTKIMGLLNASHDTTSTSITAIVNYLAQFPHVYERVHQEQLEIARSK  322

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
             GP+E L+W+D+QKMKYSWNVACE++RL PP QG +R  +TDF++AG+TIPKGWKTFW V+
Sbjct  323   GPDEFLNWDDVQKMKYSWNVACESMRLLPPAQGAYRVAMTDFSFAGYTIPKGWKTFWTVH  382

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
             ST+KNPKYF +P+KFDPSR+EGNGPAPF +VPFGGGP MCPGKEYARLEILVFMHN+VT 
Sbjct  383   STNKNPKYFPDPEKFDPSRFEGNGPAPFIYVPFGGGPHMCPGKEYARLEILVFMHNLVTK  442

Query  1412  FKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             FK+ K++PNEK +Y + SP+PV GL +RL PH 
Sbjct  443   FKLMKVIPNEKFIY-TPSPVPVEGLHIRLLPHN  474



>ref|NP_001268115.1| cytochrome P450 CYP716A15 [Vitis vinifera]
 dbj|BAJ84106.1| cytochrome P450 [Vitis vinifera]
Length=480

 Score =   496 bits (1277),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 239/465 (51%), Positives = 338/465 (73%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22    LLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++     R  + +
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDK--VFPSSTQTSSKEEAKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ YI  +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIED   V 
Sbjct  140   FFKPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  ++++G+ ++P++ PGT ++RA+K  + +R++L  +IK+RK      + GK   
Sbjct  200   KFEKPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKA-S  255

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             + +D+L  +L  TDE+G H+NE EI   I+G+L+  + + SAAITF++K++AELPHIY++
Sbjct  256   QNQDILSHMLLATDEDGCHMNEMEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEK  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIA SK P E L+W+D+Q M+YSWNVACE +RL PP QG FRE +TDF + GF+
Sbjct  316   VYEEQMEIANSKAPGELLNWDDVQNMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFS  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+P+ F +P+ FDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKSPECFPQPENFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHNVV  FK +KL+P+EKI+ +   P+P  GLPVRL PH+
Sbjct  436   EILVFMHNVVKRFKWDKLLPDEKIIVDPM-PMPAKGLPVRLHPHK  479



>ref|XP_010696134.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
 dbj|BAP59950.1| cytochrome P450 monooxygenase CYP716A49 [Beta vulgaris]
Length=483

 Score =   496 bits (1276),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 246/451 (55%), Positives = 327/451 (73%), Gaps = 14/451 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP-EVFKTSILGEKVAVFCGAAG  334
             +PPG+ GWPV+GE+++ +       PEK+I DR+ KY+P ++FKTSILGEKVAV CGAAG
Sbjct  34    VPPGTMGWPVVGESLEFLSTGWKGYPEKFIFDRLSKYAPNQIFKTSILGEKVAVICGAAG  93

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF ++NEN L+  WWP SV K  +FP+  Q + ++ +   R  +    K E L+ YIP 
Sbjct  94    NKFLYSNENKLVQAWWPSSVDK--IFPSSTQTSSKEESKKMRKLLPNFLKPEALQRYIPI  151

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D++A  H+   W    +V+V+ L+K YTF LAC+LFLSIED D V +  +P   ++ G+
Sbjct  152   MDTIAIRHMESGWDGKDKVEVFPLAKRYTFWLACRLFLSIEDPDHVAKFAEPFNDIAAGI  211

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              SLP+N PGT +NR +K  ++VR++L  +IK+RK      + GK     +D+L  +L   
Sbjct  212   ISLPVNLPGTPFNRGIKSSNVVRKELRAIIKQRKLDL---ADGKASTT-QDILSHMLLTA  267

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE+G+ + E +I   I+G+L+  + + SAA TFV+K+LAELPH+Y+ V KEQ+EIAKSK 
Sbjct  268   DEDGRFMTEMDIADKILGLLIGGHDTASAACTFVVKYLAELPHVYEAVCKEQMEIAKSKA  327

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L+WEDIQKMKYSWNVACE +RL PP QGGFRE ++DF Y GF +PKGWK +W+  S
Sbjct  328   EGELLNWEDIQKMKYSWNVACEVMRLAPPLQGGFREAISDFMYGGFQVPKGWKLYWSANS  387

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+NP+ F EP+KFDPSR+EG GPAP+T+VPFGGGPRMCPGKEYARLEILVFMHNVV  F
Sbjct  388   THRNPECFPEPEKFDPSRFEGKGPAPYTYVPFGGGPRMCPGKEYARLEILVFMHNVVKRF  447

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             K EK++PNEK++ N   PIP NGLPVRL PH
Sbjct  448   KWEKVLPNEKVIVNPM-PIPENGLPVRLFPH  477



>ref|XP_007020151.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17376.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   495 bits (1275),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 333/463 (72%), Gaps = 19/463 (4%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  289
             +IY + K  +  + PN PPG  G P +GE +D ++      PEK+++DR  KYSP+VF+T
Sbjct  22    VIYLVYKYKSRPATPNFPPGRKGLPYLGETLDYVLASRRGTPEKFVTDRTTKYSPDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
             S+LGE +A+FCGAAGNKF F+ +N  +T+WWP S+ K LM P+   N+ ++ +   R  +
Sbjct  82    SLLGEDMAIFCGAAGNKFLFSGQNKYVTSWWPHSIKKALMDPSSVDNSSKEESTKLRAYL  141

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                 K E+L+HYIP +D MAKEH+ + W+P+ +V+V+ LSK YTF+LAC+LF+S+ D++E
Sbjct  142   PPFLKPESLQHYIPVMDIMAKEHLDQHWSPYNQVQVFPLSKKYTFSLACRLFMSVHDQEE  201

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             +++   P  L + G+ S+P++ PG+ +NRA+K G ++R++L+ +I ++K         ++
Sbjct  202   IEKFAKPFALATAGLISVPIDLPGSTFNRAVKAGKLIRQELLALITKKK--------NEL  253

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
              ++G  V   L+     +G  + E EI + I+G  + ++ +TS AITF++ +L +   IY
Sbjct  254   SEKGLTVASDLVDSMLMDG--MTEIEIGNKIVGFFIASHDTTSTAITFIVSYLTDYRDIY  311

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +V +EQ++I ++KGP E L WEDIQKMKY+W VACEA+RL PP  G FRE +TDFTYAG
Sbjct  312   NRVLEEQMDILRTKGPGEPLRWEDIQKMKYTWCVACEAMRLAPPANGAFREAITDFTYAG  371

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             +TIPKGWK FW V+ST+KNP YF +P+KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTNKNPNYFPDPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYA  431

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             RLEIL F+HN+VT FK EKL PNEKI Y   SPIP  GLP++L
Sbjct  432   RLEILTFIHNLVTRFKWEKLNPNEKISY-IPSPIPEEGLPIKL  473



>ref|XP_006338129.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=476

 Score =   495 bits (1274),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/459 (53%), Positives = 327/459 (71%), Gaps = 15/459 (3%)
 Frame = +2

Query  158   NTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVF  319
             N S   LPPG TGWPV GE+++ +       PEK+I DR+ KYS  VFKT +LGE+ AVF
Sbjct  24    NKSGEGLPPGKTGWPVFGESLEFLSTGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVF  83

Query  320   CGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             CGA+GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   FK E L+
Sbjct  84    CGASGNKFLFSNENKLVQAWWPNSVNK--VFPSSTQTSSKEEAIKMRKMLPNFFKPEALQ  141

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              Y+  +D + + H A  W    +V V+ L+K YTF LAC+LFLS+ED + V +  DP  +
Sbjct  142   RYVGIMDHITQRHFASGWENKEQVVVFPLTKRYTFWLACRLFLSVEDPNHVAKFADPFDV  201

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG-RDVLG  856
             +++G+ S+P++ PGT +NRA+K    +R++LV +IK+RK       LG+ +    +D+L 
Sbjct  202   LASGLISIPIDLPGTPFNRAIKASIFIRKELVRIIKQRKI-----DLGEGKASSTQDILS  256

Query  857   RLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIE  1036
              +L   DE G+ + + +I   I+G+L+  + + S+A  F++K+LAELPHIYQ+VY EQ+E
Sbjct  257   HMLLTCDENGKFMGDLDIADKILGLLIGGHDTASSACAFIVKYLAELPHIYQRVYTEQME  316

Query  1037  IAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKT  1216
             IAKSKGP E L WEDIQKMKYSWNVACE LRL PP QG FRE ++DF + GF+IPKGWK 
Sbjct  317   IAKSKGPGELLRWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFIFNGFSIPKGWKI  376

Query  1217  FWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMH  1396
             +W+  STHK+ ++F +P+KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLEILVFMH
Sbjct  377   YWSANSTHKSGEFFPDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMH  436

Query  1397  NVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ++V  FK EK++P+EKI+ N   PIP  GLPVRL PH +
Sbjct  437   HLVKRFKFEKIIPDEKIIVNPM-PIPAKGLPVRLYPHHH  474



>ref|XP_010048517.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80785.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
 gb|KCW80786.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
Length=480

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 332/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
              +++  +++ + PNLPPGS G P IGE++D +       PE++I DR+ +YS  VFKTS+
Sbjct  22    FLFYKHRSHYAGPNLPPGSIGLPFIGESLDFLSTGWKGHPERFIFDRIARYSSHVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  A+FCGAAGNKF F+NEN L+ +WWP SV K  +FP+  Q + ++     R  +  
Sbjct  82    LGEPAAIFCGAAGNKFLFSNENKLVVSWWPNSVNK--VFPSSTQTSSKEEAKKMRKMLPN  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ YI  +D +A+ H A  W    EV V+ L+K YTF LA +LFLS+ED   V 
Sbjct  140   FFKPEALQRYIGIMDDIARRHFAMGWEGKDEVTVFPLAKRYTFWLAARLFLSVEDPSHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R  DP  L+++G+ S+P++ PGT +NRA+K  + + ++L  +IK+RK      + GK   
Sbjct  200   RFADPFHLLASGIISIPIDLPGTPFNRAIKASNFIGKELRVIIKQRKVDL---AEGKASS  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  TDE+G+H+ E +I   I+G+L+  + + SAA TFV+K+LAELP IY+Q
Sbjct  257   T-QDILSHMLLATDEDGKHMTELDIADKILGLLIGGHDTASAACTFVVKYLAELPEIYEQ  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK P E L+W+DIQKMKYSWNVACE +RL PP QGGFRE + DF + GF+
Sbjct  316   VYEEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGGFREVINDFIFNGFS  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+ +YF EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKIYWSANSTHKSAEYFPEPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  F+ EKL+P+EKIV +   P+P  GLPVRL  H+
Sbjct  436   EILVFMHNLVKRFRWEKLLPDEKIVVDPM-PMPAKGLPVRLYAHK  479



>ref|XP_011031513.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=476

 Score =   493 bits (1270),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 332/460 (72%), Gaps = 12/460 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             I F  +   S   LPPG+ GWP+IGE ++  +      PE ++ DRM KYSPEVFKTS+ 
Sbjct  18    IMFFRRRKLSGLRLPPGNKGWPIIGETLEFAMNHRRGCPENFVIDRMCKYSPEVFKTSLF  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK+ VFCGA+GNKF FTN N  +T+WWP S+ K   FP + +NT+     + R+ + E 
Sbjct  78    GEKIVVFCGASGNKFLFTNHNKYVTSWWPPSMAKVWYFPENQENTVEVCNKM-RSVLPEF  136

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K + L+ YIP +DSMAKE +  +W+P ++V+V++LSK YTFA ACK+F+++ D +++ R
Sbjct  137   LKPDALQDYIPVMDSMAKEQLETDWSPHKQVRVFSLSKKYTFASACKVFMNLIDPEQLTR  196

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L +P   +  G+ S+P+  PGTA++RA++GG +VR +L+ +I++RK + + N   K    
Sbjct  197   LSNPFTQIVAGLISIPIKIPGTAFSRAVEGGRIVREELLAIIRQRKRELLENKGLK----  252

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
               D+L RLL  + E G+  +E +I + IIG+L+ ++ + S A+T +L +LAE P +Y+ V
Sbjct  253   SIDLLTRLLLASYENGETNDEKQIANKIIGLLVASHDTMSTALTCILNYLAEYPKVYEDV  312

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              +EQIEIAKSK P E L+W+D++KMKYSW VACEA+RL PP  G FRE +TDFTYAGFTI
Sbjct  313   LQEQIEIAKSKSPGELLNWDDVKKMKYSWCVACEAMRLSPPVPGTFREAITDFTYAGFTI  372

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWKTFW  YST++NP YF +P+KFDPSR+EG GPAP++FVPFGGGPRMCPGKEYARL 
Sbjct  373   PKGWKTFWTSYSTNRNPNYFPDPEKFDPSRFEGRGPAPYSFVPFGGGPRMCPGKEYARLA  432

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
              LVFMHNVVT FK  K+ P+EKI+YN  +P P NGL + L
Sbjct  433   TLVFMHNVVTKFKWRKVNPDEKIIYN-PTPTPANGLLIHL  471



>ref|XP_002263499.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Vitis vinifera]
 emb|CAN67793.1| hypothetical protein VITISV_001314 [Vitis vinifera]
Length=483

 Score =   493 bits (1270),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 329/467 (70%), Gaps = 12/467 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  19    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+    TL +      T + 
Sbjct  79    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTRDNFRPPTFLP  138

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             E  K E L+HYI T+DSMA EHI   W+P REV V+ L++ Y+FALA +LF+SI D + V
Sbjct  139   EFLKPEALQHYIVTMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIADPEYV  198

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             + +     +++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK    M    K +
Sbjct  199   EMICHHFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRK----MELEQKGD  254

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                RD+L  +L  +DE     +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y 
Sbjct  255   SATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  314

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+EIA+SKGP   L W+DIQKMKY+WNVA E +RL PP QG FRE +TDFTYAGF
Sbjct  315   KVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFTYAGF  374

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIPKGWK  WNV +TH++PKYF +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR
Sbjct  375   TIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  434

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ++L F+HNVVT FK EK+ P EK+ YN  SPIP  G P+RL P QN
Sbjct  435   AQVLAFIHNVVTRFKWEKVDPCEKVAYN-PSPIPSKGFPIRLQPLQN  480



>emb|CBI39273.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   508 bits (1309),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 346/470 (74%), Gaps = 23/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +++ + +  ++   LPPG+ GWP+IGE +   +      P ++I +RM KYSP+VF+TS+
Sbjct  19    VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GEKVAVFCG AGNKF F+N N L+ TW P+S+ K L+F +  +   R +    R+ + E
Sbjct  79    VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSMEKILLFESPPKVEPRGL----RSYVLE  134

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               + + L+ YI  +DSMA+EHI  +WAP REVKVY LSK YTFALAC+LF+SI+D ++V 
Sbjct  135   FLRPDVLQRYIQIMDSMAREHIEMDWAPNREVKVYPLSKKYTFALACRLFMSIKDPEQVA  194

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             ++  P  L+++G+ S+P++FPGT +NRA KGG M+R +LV +IK+R+         ++ D
Sbjct  195   KVAHPFHLITSGLVSVPIDFPGTPFNRAKKGGKMLRDELVAIIKQRR--------NELSD  246

Query  836   EGRDVLGRLLSVTD----EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
             EG   +  LLS       E G+ LN+ EI   I+G+ L ++ STSA +TFVL +LAE P 
Sbjct  247   EGEPEVQDLLSSLLLQSDENGKGLNDMEISDKIVGLFLASFDSTSATLTFVLNYLAEFPD  306

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             +Y +V KEQ+EIAKSK P E L W DIQKMKY+W+VA E +RL PP QG FRE +TDFTY
Sbjct  307   VYDKVLKEQMEIAKSKDPGEFLKWNDIQKMKYTWSVANETMRLAPPAQGTFREVITDFTY  366

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKE  1363
              GFTIPKGWKT+W+V++T++NPK+F +P+KFDPSR+EG GPAP+TFVPFGGGPR+CPGKE
Sbjct  367   EGFTIPKGWKTYWSVHTTNRNPKHFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKE  426

Query  1364  YARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             Y+RL+ILVF+HN+VT FK EK+ PNEK++YN  SPIPVNGLP+RL P +N
Sbjct  427   YSRLQILVFIHNMVTRFKWEKVDPNEKVIYN-PSPIPVNGLPIRLHPREN  475


 Score =   501 bits (1289),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 253/451 (56%), Positives = 323/451 (72%), Gaps = 14/451 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  GWP+IGE  +  +      PE++I+DRMKKYSP VF+TS+LGEKVAVFCG AGN
Sbjct  490   LPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSLLGEKVAVFCGPAGN  549

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+N N L+TTW P S+ K L+F +       +     R+ + E  + + L+  I  +
Sbjct  550   KFLFSNHNKLITTWKPPSMEKALLFQSSPPKAEPRGM---RSFVLEFLRPDALQRNIHIM  606

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             DSMA ++I  +WAP +EV VY LSK YTF LAC LF+SI+D + + R+  P   + +G+ 
Sbjct  607   DSMAHQNINTDWAPHKEVNVYPLSKKYTFTLACHLFISIKDPEHIARIARPFHQMLSGLV  666

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             SLP++FPGTA+N A KGG M+R +LV +IK+R+ +       K E   RD+L  LL  TD
Sbjct  667   SLPIDFPGTAFNSAKKGGKMLRHELVAIIKQRRKELS----EKEESVARDLLSSLLLATD  722

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G  LN+ EI   I+GI L ++ STS  +TF+  +LAE PH Y +V KEQ+EIA SK P
Sbjct  723   ENGAVLNDMEISDKIVGIFLASFDSTSTTLTFIFNYLAEFPHAYDKVLKEQMEIAMSKDP  782

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L W DIQKMKY+W V  E +RL PP QG FRE +TDFT+ GFTIPKGWKT+W+V+ST
Sbjct  783   EEFLKWNDIQKMKYTWCVVKETMRLAPPAQGTFREAITDFTFEGFTIPKGWKTYWSVHST  842

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             +KNPKYF +P+KFDPSR+EG GPAP+TFVPFGGGPR+CPGKEY RL ILVF+HN+VT FK
Sbjct  843   NKNPKYFPDPEKFDPSRFEGKGPAPYTFVPFGGGPRLCPGKEYVRLVILVFIHNMVTRFK  902

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
               K+VPNEKI+YN  SP PVNGLP+RL PH+
Sbjct  903   WAKVVPNEKIIYN-PSPFPVNGLPIRLQPHE  932



>emb|CBI39948.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   493 bits (1270),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 329/467 (70%), Gaps = 12/467 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  24    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  83

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+    TL +      T + 
Sbjct  84    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTRDNFRPPTFLP  143

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             E  K E L+HYI T+DSMA EHI   W+P REV V+ L++ Y+FALA +LF+SI D + V
Sbjct  144   EFLKPEALQHYIVTMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIADPEYV  203

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             + +     +++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK    M    K +
Sbjct  204   EMICHHFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRK----MELEQKGD  259

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                RD+L  +L  +DE     +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y 
Sbjct  260   SATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  319

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+EIA+SKGP   L W+DIQKMKY+WNVA E +RL PP QG FRE +TDFTYAGF
Sbjct  320   KVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFTYAGF  379

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIPKGWK  WNV +TH++PKYF +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR
Sbjct  380   TIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  439

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ++L F+HNVVT FK EK+ P EK+ YN  SPIP  G P+RL P QN
Sbjct  440   AQVLAFIHNVVTRFKWEKVDPCEKVAYN-PSPIPSKGFPIRLQPLQN  485



>ref|XP_011078182.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score =   493 bits (1269),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 331/464 (71%), Gaps = 15/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I++ TK  +    LPPG TGWPVIGE+++ +       PEK+I DRM +YS  VFKT +
Sbjct  22    LIFYKTKPASGA--LPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMVRYSSYVFKTHL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE+ AVFCGAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +  
Sbjct  80    LGEQAAVFCGAAGNKFLFSNENKLVQAWWPSSVDK--IFPSSTQTSSKEEAIKMRKMLPN  137

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L  Y+  +D +A+ H A+ W    EV V+ L+K YTF LAC+LF+SIED  +V 
Sbjct  138   FLKPEALHRYVGIMDHIARRHFADGWENKEEVVVFPLAKNYTFWLACRLFVSIEDPQQVD  197

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  +P  L+++G+ S+P++ PGT +N+ +K  + +R++LV +IK+RK      + GK   
Sbjct  198   KFAEPFNLLASGLISIPIDLPGTPFNKGIKASNYIRKELVSIIKQRKVDL---AEGKASP  254

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY  
Sbjct  255   T-QDILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYDG  313

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSKGP E L+W+D+QKMKYSWNVACE LRL PP QG FRE + DF+Y GF+
Sbjct  314   VYKEQMEIAKSKGPGELLNWDDLQKMKYSWNVACEVLRLAPPLQGAFREAIADFSYNGFS  373

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKNP+ F EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  374   IPKGWKLYWSANSTHKNPECFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  433

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EILVFMH++V  F+ EK +P+EKIV +   PIP  GLPVRL PH
Sbjct  434   EILVFMHHLVKRFRWEKTMPDEKIVVDPM-PIPAKGLPVRLYPH  476



>ref|XP_004243906.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=482

 Score =   493 bits (1269),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 326/451 (72%), Gaps = 14/451 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG++GWPVIGE ++ +       PEK+I DR+ KY   +FKT +LGEK  VFCGA+ N
Sbjct  37    LPPGNSGWPVIGETLEFLSTGWKGHPEKFIFDRISKYKSSIFKTHLLGEKAVVFCGASSN  96

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+ TWWP SV K  +FP+  Q + ++  I  R  +    K E L+ YI  +
Sbjct  97    KFLFSNENKLVQTWWPSSVDK--VFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRYIRIM  154

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D +A++H  + W   +EV V+ L+K YTF LAC+LF+S+ED + V RL DP  ++++G+ 
Sbjct  155   DHIAQKHF-QSWENQQEVVVFPLAKRYTFWLACRLFVSVEDPNHVARLADPFDVLASGLI  213

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P+N PGT +NRA+K  + +R++LV +IK+RK      + GK  D  +D+L  +L  +D
Sbjct  214   SIPINLPGTPFNRAIKASNFIRKELVAIIKQRKIDL---TEGKASD-SQDILSHMLLTSD  269

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY QVYKEQIEIAKSKGP
Sbjct  270   ENGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDQVYKEQIEIAKSKGP  329

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E LSWEDI+KMKYSWNVACE LRL PP QG FRE + DFT+ GF+IPKGWK +W+  ST
Sbjct  330   GELLSWEDIKKMKYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWKIYWSANST  389

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             H NP+ F +P KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V  F 
Sbjct  390   HINPEVFVDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFS  449

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              +K++ +EKIV N   PIP NGLP+RL PH 
Sbjct  450   WKKIIRDEKIVVNPM-PIPANGLPIRLYPHH  479



>ref|XP_007020143.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17368.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 331/463 (71%), Gaps = 19/463 (4%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  289
             +IY + K  +  + P LPPG  G P IGE +D ++      PEK+++DR  KYS +VF+T
Sbjct  22    VIYLVYKYKSRAATPKLPPGRKGLPYIGETLDYVLASRRGTPEKFVTDRNTKYSSDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
             S+LGE +AVFCGAAGNKF F+ +N  +T+WWP+ + K  + P+   N+  + +   R  +
Sbjct  82    SLLGEDMAVFCGAAGNKFLFSGQNKYVTSWWPRPMKKAFLDPSSVDNSSAEESTKLRAYL  141

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
               + K E+L+HY+P +D MAKEH+ + W+P+ +V+V+ LSK YTF+LAC+LF+S+ DR+E
Sbjct  142   PSLLKPESLQHYVPVMDRMAKEHLDQHWSPYNQVQVFPLSKKYTFSLACRLFMSVRDREE  201

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             +++   P  + + G+ S+P++ PGT +NRA+K G ++R++L  +I ++K + +       
Sbjct  202   IEKFAKPFSIATAGLVSVPIDLPGTTFNRAVKAGRVIRQELFALITKKKNELL-------  254

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
              ++ R V   L+     +G  + E EI + I+G  + ++ +TS AITF + +L++ P +Y
Sbjct  255   -EKRRTVASDLVDNMLLDG--MTEIEIGNKIVGFFIASHDTTSTAITFTVSYLSDYPDVY  311

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +V +EQ++I +SKGP E L WEDIQKMKY+W VACEA+RL PP  G FRE +TDFTYAG
Sbjct  312   NKVLEEQMDILRSKGPEEPLRWEDIQKMKYTWCVACEAMRLAPPANGAFREAITDFTYAG  371

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             +TIPKGWK FW V+STHKNP YF +P+KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTHKNPNYFPDPEKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYA  431

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             RLEIL F+HN+VT FK EKL PNEKI Y   SPIP  GLP++L
Sbjct  432   RLEILTFIHNLVTKFKWEKLNPNEKISY-IPSPIPEEGLPIKL  473



>ref|XP_004239296.1| PREDICTED: beta-amyrin 28-oxidase [Solanum lycopersicum]
Length=476

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 242/456 (53%), Positives = 324/456 (71%), Gaps = 13/456 (3%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             S   LPPG TGWPV GE+++ +       PEK+I DR+ KYS  VFKT +LGE+ AVFCG
Sbjct  26    SGEGLPPGKTGWPVFGESLEFLSSGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVFCG  85

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
             A+ NKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   FK E L+ Y
Sbjct  86    ASANKFLFSNENKLVQAWWPNSVNK--VFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRY  143

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             +  +D + + H A  W    +V V+ L+K YTF LAC+LFLS+ED   V +  DP  +++
Sbjct  144   VGIMDHITQRHFATGWENKEQVVVFPLTKRYTFWLACRLFLSVEDPKHVAKFADPFDVLA  203

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
             +G+ S+P++ PGT +NRA+K  + +R++LV +IK+RK        GKV    +D+L  +L
Sbjct  204   SGLISIPIDLPGTPFNRAIKASNFIRKELVRIIKQRKIDL---GEGKVSST-QDILSHML  259

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
                DE G+ L + +I   I+G+L+  + + S+A +F++K+LAELPHIYQ+VY EQ+EIAK
Sbjct  260   LTCDENGKFLGDLDIADKILGLLIGGHDTASSACSFIVKYLAELPHIYQRVYTEQMEIAK  319

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             SKGP E L WEDIQKMKYSWNVACE LRL PP QG FRE ++DF + GF IPKGWK +W+
Sbjct  320   SKGPGELLRWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMFNGFYIPKGWKIYWS  379

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
               STHK  ++F +P+KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V
Sbjct  380   ANSTHKREEFFPDPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLV  439

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
               FK EK++P+EKI+ N   PIP NGLP+RL PH +
Sbjct  440   KRFKFEKIIPHEKIIVNPM-PIPANGLPLRLYPHHH  474



>ref|XP_002325964.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
 gb|EEF00346.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
Length=476

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 332/460 (72%), Gaps = 12/460 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             I F  +   S   LPPG+TGWP+IGE ++  +      PEK++ DRM K+SPEVFKTS+ 
Sbjct  18    IIFFHRRKLSGFRLPPGNTGWPIIGETLEFAMNHRRGCPEKFVIDRMCKFSPEVFKTSLF  77

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK+ VFCGA+GNKF FT+ N  +T+WWP S+ K   FP + +NT+     + R+ + E 
Sbjct  78    GEKIVVFCGASGNKFLFTSHNKSVTSWWPPSMAKVWFFPENQENTVEVCNKM-RSVLPEF  136

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K + L+ YIP +DSMAKE +  +W+P ++V+V++LSK YTFA ACK+F+++ D +++ R
Sbjct  137   LKPDALQDYIPVMDSMAKEQLETDWSPHKQVQVFSLSKKYTFASACKVFMNLIDPEQLTR  196

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L +P   +  G+ S+P+  PGTA++R ++GG + R +L+ +I++RK + + N     E +
Sbjct  197   LSNPFTHIVAGLISIPIKIPGTAFSRGVEGGKIAREELLAIIRQRKRELLENK----ELK  252

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
               D+L RLL  + E G+  +E +I + IIG+L+ ++ + S A+T +L +LAE P +Y+ V
Sbjct  253   SIDLLTRLLLASYENGETNDEKQIANKIIGLLVASHDTMSTALTCILNYLAEYPRVYEDV  312

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
               EQ+EIAKSK P E L+W+D++KMKYSW VACEA+RL PP  G FRE +TDFTYAGFTI
Sbjct  313   LHEQMEIAKSKNPGELLNWDDVKKMKYSWCVACEAMRLSPPVPGTFREAITDFTYAGFTI  372

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK FW  YST++NPKYF +P+KFDPSR+EG GPAP++FVPFGGGPRMCPGKEYARL 
Sbjct  373   PKGWKAFWTTYSTNRNPKYFPDPEKFDPSRFEGRGPAPYSFVPFGGGPRMCPGKEYARLA  432

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
              LVFMHNVVT FK  K+ P+EKI+YN  +P P NGL + L
Sbjct  433   TLVFMHNVVTKFKWRKVNPDEKIIYN-PTPTPENGLLIHL  471



>ref|XP_007160209.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
 gb|ESW32203.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
Length=480

 Score =   491 bits (1265),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 240/466 (52%), Positives = 332/466 (71%), Gaps = 15/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             I++   ++  S PNLPPG+TG PVIGE++  +       PEK+I DRM KYS ++FKTSI
Sbjct  22    ILFHKHRSPFSAPNLPPGATGLPVIGESLQFLSTGWKGHPEKFIFDRMIKYSSDLFKTSI  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE   VFCGAA NKF F+NEN L+T WWP SV K  +FP+  Q+  ++ +   R  + +
Sbjct  82    LGEPAVVFCGAASNKFLFSNENKLVTAWWPDSVNK--VFPSTLQSNSKEESKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K + L+ Y+P +D++A+ H A  W     + V+ L+K YTF LAC+LF+S+ED + V 
Sbjct  140   FLKPQALQGYVPIMDAIAQTHFASHWDNHTHLTVFPLAKRYTFLLACRLFMSVEDENHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  L++ G+ S+P++ PGT +N+A+K    +R++L+++I+ERK       LG+ + 
Sbjct  200   KFEKPFQLLAAGIISVPIDVPGTPFNKAIKAAKDIRKELLKIIRERKV-----DLGEGKA  254

Query  836   EGR-DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
               R D+L  +L   DE G+ +NE +I   I+G+L+  + + SAA TF++K+LAELPHIY 
Sbjct  255   TARQDILSHMLLTCDENGEFMNELDIADKILGLLIGGHDTASAACTFLVKYLAELPHIYD  314

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
              VY+EQ+EIAKSK   E L+W+DI KMKYSWNVACE +R+ PP QGGFRE + DF + GF
Sbjct  315   AVYQEQMEIAKSKSAGELLNWDDINKMKYSWNVACEVMRIAPPLQGGFREAINDFVFNGF  374

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  +THKNP+YF EP+KFDPSR+EG GP P++FVPFGGGPRMCPGKEYAR
Sbjct  375   SIPKGWKLYWSANATHKNPEYFGEPEKFDPSRFEGQGPVPYSFVPFGGGPRMCPGKEYAR  434

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LEILVFMHN+V  FK EK++P+EKI+ N   PIP + LP+RL PH+
Sbjct  435   LEILVFMHNLVKRFKWEKMIPDEKIIVNPL-PIPAHNLPIRLYPHK  479



>ref|XP_009609682.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=480

 Score =   491 bits (1265),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 249/467 (53%), Positives = 328/467 (70%), Gaps = 16/467 (3%)
 Frame = +2

Query  137   IYFI-TKANTSK--PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  289
             IYFI  K N+S     LPPG TGWP IGE+ + +       PEK+I DRM KYS  VFKT
Sbjct  20    IYFIFYKRNSSSLIGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFIFDRMSKYSSSVFKT  79

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
              +LGEK AVFCG   NKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +
Sbjct  80    HLLGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSVNK--VFPSSTQTSSKEEAIKMRKML  137

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                FK E L+ Y+  +D +A+ H A  W    +++V+ L+K YTF LAC+LF+S+E+ + 
Sbjct  138   PNFFKPEALQRYVGIMDHIAQRHFASSWENKSQIEVFPLAKRYTFWLACRLFVSVENPNH  197

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V +  DP  ++++G+ S+P++ PGT +NRA+K  + +R++L+  IK+RK      +LGK 
Sbjct  198   VAKFADPFNVLASGLISIPIDLPGTPFNRAIKASNFIRKELLLNIKQRKVDL---ALGKA  254

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
                 +D+L  +L  +DE G+ +NE +I   I+G+L+  + + S+A TF++K+LAELP IY
Sbjct  255   SPT-QDILSHMLLTSDENGKFMNELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIY  313

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
             + VYKEQ+EIAKSK   E L W+DIQKMKYSWNVACE LRL  P QG FRE + DF + G
Sbjct  314   EGVYKEQMEIAKSKAAGELLRWDDIQKMKYSWNVACEVLRLASPLQGAFREAINDFMFNG  373

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             F IPKGWK +W+  STHKNP+YF EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYA
Sbjct  374   FYIPKGWKLYWSANSTHKNPEYFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYA  433

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             RLEILVFMH++V  FK EK++PNEKIV +   PIP  GLPVRL PHQ
Sbjct  434   RLEILVFMHHLVKRFKWEKVIPNEKIVVDPM-PIPAKGLPVRLYPHQ  479



>gb|AHL46848.1| cytochrome P450, partial [Betula platyphylla]
Length=481

 Score =   491 bits (1264),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 243/466 (52%), Positives = 334/466 (72%), Gaps = 16/466 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  +++ + PNLPPG TG+P+IGE+++ +       PEK+I DRM K+S EVFKTS+L
Sbjct  23    LFYKHRSHFTGPNLPPGKTGYPMIGESLEFLSTGWKGHPEKFIFDRMTKFSSEVFKTSLL  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILN-RTNIHE  475
             G+  AVFCGAA NKF F+NEN L+T WWP SV K  +FP+  Q +  K      R  + +
Sbjct  83    GQPAAVFCGAACNKFLFSNENKLVTAWWPDSVNK--IFPSSTQTSNSKEEAKKMRKLLPQ  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H A  W   +EV V+ L+K YTF LAC+LFLS+ED + + 
Sbjct  141   FLKPEALQKYISIMDTIAQRHFASGWEGQKEVTVFPLAKRYTFWLACRLFLSLEDPNHIA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R  DP   V++G+ S+P++ PGT +NR +K  + +R++L  +IK+R+       LG+ + 
Sbjct  201   RFADPFHSVASGIISIPIDLPGTPFNRGIKASNFIRKELSLIIKQRRV-----DLGEGKA  255

Query  836   E-GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                +D+L  +L  +DE GQ++ E +I   I+G+L+  + + SAA TF++K+LAELPHIY+
Sbjct  256   SPTQDILSHMLLTSDESGQYMTELDIADKILGLLIGGHDTASAACTFIVKYLAELPHIYE  315

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
              VY EQ+EIA SK P E L+WEDIQKM+YSWNVACE LRL PP QG FRE + DF + GF
Sbjct  316   GVYNEQMEIANSKAPGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREAINDFIFNGF  375

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  STH++ +YF EP+KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYAR
Sbjct  376   SIPKGWKLYWSANSTHRSAEYFPEPEKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYAR  435

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LEILVFMHN+V  F+ EK++P+EKIV +   P+P  GLPVRL PH+
Sbjct  436   LEILVFMHNLVKRFRWEKMIPDEKIVVDPM-PMPAKGLPVRLYPHK  480



>ref|XP_009759030.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score =   491 bits (1263),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 328/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
              I++   + +    LPPG TGWP IGE+ + +       PEK++ DRM KYS  VFKT +
Sbjct  22    FIFYKRNSGSLTGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFVFDRMTKYSSSVFKTHL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGEK AVFCG   NKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +  
Sbjct  82    LGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSVNK--VFPSSTQTSSKEEAIKMRKMLPN  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H A  W    +++V+ L+K YTF LAC+LF+S+ED + V 
Sbjct  140   FFKPEALQRYVGIMDHIAQRHFASSWENKNQIEVFPLAKRYTFWLACRLFVSVEDPNHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  ++++G+ S+P++ PGT +NRA+K  +++R++L+ +IK+RK      + GK   
Sbjct  200   KFADPFNVLASGLISIPIDLPGTPFNRAIKASNLIRKELLLIIKQRKVDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  +DE G++++E +I   I+G+L+  + + S+A TF+LK+LAELP IY+ 
Sbjct  257   T-QDILSHMLLTSDENGKYMHELDIADKILGLLIGGHDTASSACTFILKYLAELPEIYEG  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIA SK P E L+W+DIQKMKYSWNVACE LRL  P QG FRE + DF + GF 
Sbjct  316   VYKEQMEIAMSKSPGELLNWDDIQKMKYSWNVACEVLRLASPLQGAFREAINDFIFNGFY  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKNP+YF EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKNPEYFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMH++V  FK EK++PNEKIV +   PIP  GLPVRL PH+
Sbjct  436   EILVFMHHLVKRFKWEKVIPNEKIVVDPM-PIPAKGLPVRLYPHK  479



>gb|AJD25248.1| cytochrome P450 CYP716A89 [Salvia miltiorrhiza]
Length=479

 Score =   490 bits (1262),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 335/467 (72%), Gaps = 16/467 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++ TK  +    LPPG TGWPVIGE+++ +       PEK+I DRM +YS  VF+T +
Sbjct  22    LLFYKTKPASG--GLPPGKTGWPVIGESLEFLSTGWKGHPEKFIFDRMARYSSHVFRTHL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTD-AQNTLRKITILNRTNIH  472
             LGE  AV CG+AGNKF F+NEN L+  WWP SV K  +FP D AQ + ++  I  R  + 
Sbjct  80    LGEPAAVLCGSAGNKFLFSNENKLVQAWWPSSVDK--IFPNDNAQTSSKEEAIKMRRMLP  137

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
               FK E L  Y+  +D +A+ H A+ W    EV V+ L+K YTF LAC+LFLS+ED  +V
Sbjct  138   TFFKPEALHRYVGIMDHIARRHFADGWDNKSEVVVFPLAKNYTFWLACRLFLSVEDPAQV  197

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              +   P  L+++G+ S+P++ PGT +N+ +K  + +R++LV +IK+RKA     + GK  
Sbjct  198   DKFAAPFNLLASGLISIPIDLPGTPFNKGIKASAYIRKELVAIIKQRKADL---ADGKAS  254

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                +D+L  +L  ++E+G+ + E +I + I+G+L+  + + S+A TF++KFLAELP +Y+
Sbjct  255   PT-QDILSHMLLTSNEDGKFMQESDIANKILGLLIGGHDTASSACTFIVKFLAELPQVYE  313

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
              VYKEQ+EIAKSKG  E LSWED+QKMKYSWNVACE LRL PP QG FRE + DF++ GF
Sbjct  314   GVYKEQMEIAKSKGEGELLSWEDLQKMKYSWNVACEVLRLAPPLQGAFREALADFSFNGF  373

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  STHKN ++F EP+KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYAR
Sbjct  374   SIPKGWKLYWSANSTHKNKEFFPEPEKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYAR  433

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             LEILVFMH++V  FK EK++P+EKIV +   PIP  GLPVRL PH +
Sbjct  434   LEILVFMHHLVKRFKWEKMIPDEKIVVDPM-PIPAKGLPVRLYPHTS  479



>ref|XP_011093941.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 333/464 (72%), Gaps = 14/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  K+ +  P LPPG TGWPV+GE+++ +       PEK+I DR+ KYS  VF+T +L
Sbjct  23    LFYKNKSASGGP-LPPGRTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSSVFRTHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK  VFCGA+GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   
Sbjct  82    GEKAVVFCGASGNKFLFSNENKLVQAWWPSSVDK--VFPSSTQTSSKEEAIKMRKMLPNF  139

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ Y+  +D +A+ H A+ W    E+ V+ L+K YTF LAC+LF+S+ED D V +
Sbjct  140   LKPEALQRYVGIMDHIARRHFADGWENKDEIVVFPLAKNYTFWLACRLFISVEDPDHVNK  199

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
               +P  L+++G+ S+P++ PGT + +A+K  + +R++LV +IK+RK      + GK    
Sbjct  200   FAEPFNLLASGLISIPIDLPGTPFYKAIKASNFIRKELVSIIKQRKIDL---AEGKATPT  256

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY+ V
Sbjct  257   -QDILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYEGV  315

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EIA SK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE ++DF Y GF+I
Sbjct  316   YKEQMEIANSKKPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMYNGFSI  375

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STH+NP++F EP+KFDPSR+EG+GPAP++FVPFGGGPRMCPGKEYARLE
Sbjct  376   PKGWKIYWSANSTHRNPEFFREPEKFDPSRFEGSGPAPYSFVPFGGGPRMCPGKEYARLE  435

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMH++V  F+ EK++P+EKIV N   PIP  GLPVRL PH 
Sbjct  436   ILVFMHHLVKRFRWEKIIPDEKIVVNPM-PIPAKGLPVRLHPHN  478



>ref|XP_003530525.1| PREDICTED: cytochrome P450 716B2 [Glycine max]
Length=482

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 337/465 (72%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE   +FCGA  NKF F+NEN L+  WWP SV K  +FPT   +  ++ +   R  + +
Sbjct  84    LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  141

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIED + V 
Sbjct  142   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  201

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  +P  L+++G+ S+P++ PGT +N+A+K  + +R++L+++I++RK      + GK   
Sbjct  202   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKASP  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  259   T-QDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  317

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAK K P E L+W+D+ +M+YSWNVACE +R+ PP QGGFRE + DF + GF+
Sbjct  318   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  377

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+P+YF EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  378   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  437

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK +KL+P+EKI+ +   PIP   LP+RL PH+
Sbjct  438   EILVFMHNLVKRFKWQKLIPDEKIIVDPL-PIPAKNLPIRLHPHK  481



>ref|XP_002279472.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score =   489 bits (1260),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 326/466 (70%), Gaps = 11/466 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  21    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP+   N   +  I   + + E
Sbjct  81    MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLPE  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E LKHY+  +D MA  HI  +WAP+REVKV+ L K Y FAL+C+LF+ ++D   V 
Sbjct  141   FLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDDPQCVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R+  P  L+  G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK    M    K   
Sbjct  201   RISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRK----MELGQKGNS  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD L  +L   ++ G+ ++E EI  ++I +LL T+ STSA ITFVLK+LAE P IY +
Sbjct  257   AARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFPSIYNE  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V+KEQ+EIAK KG  E L+W+DIQKM+YSWNVA E +RL PP QG FRE + +FTYAGFT
Sbjct  317   VFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFTYAGFT  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             +PKGWKT WNV +TH+NPKYF + +KFDPSR+EG GP PFTFVPFGGGPRMCPG+EYAR 
Sbjct  377   MPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGREYARA  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ++LVF+HN+VT FK E++ PNEKI YN  SPIP  G P+ L P +N
Sbjct  437   QVLVFIHNIVTKFKWERVDPNEKISYN-PSPIPEKGFPICLQPLEN  481



>ref|XP_007020144.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17369.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/463 (50%), Positives = 327/463 (71%), Gaps = 19/463 (4%)
 Frame = +2

Query  134   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  289
             +IY + K  +  + PNLPPG  G P IGE +D ++      P K+I+DR  KYSP+VF+T
Sbjct  22    VIYLVYKYKSRAATPNLPPGRKGLPYIGETLDYVLGLRRGTPVKFINDRSTKYSPDVFRT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNI  469
             S+LGE +AVFCGAAGNKF F+  N  +T WWP+S+ K L+ P+   N+  + + + RT +
Sbjct  82    SLLGEDMAVFCGAAGNKFLFSGHNKYVTAWWPRSMKKALLDPSSVDNSSEEESTILRTYL  141

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
               + K E+L+ Y+P +D MAKEH+ + W+P+ +V+V  LSK Y F+LAC+LF+S++ ++E
Sbjct  142   LPLLKPESLQRYVPVMDVMAKEHLDQYWSPYNQVQVSPLSKKYGFSLACRLFMSVQQKEE  201

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             ++    P    + G+ S+P++ PGT +NRA+K G ++RR+L+  I ++K + +   +   
Sbjct  202   IENFAKPFAFATAGLISVPIDLPGTTFNRAVKAGKVIRRELLAFITKKKNELLKKGM---  258

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
                  D++  +L         + E EI + I+G  + ++ +TS AITF + +L++ P +Y
Sbjct  259   -TVASDIVDSMLM------DGMTEIEILNKIVGFFIASHDTTSTAITFTVSYLSDYPDVY  311

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
              +V +EQ +I +SKGP E L WEDIQKMKY+W V CEA+RL PP  G FRE +TDFTYAG
Sbjct  312   NRVLEEQKDILRSKGPGEPLGWEDIQKMKYTWCVVCEAMRLAPPANGAFREAITDFTYAG  371

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             +TIPKGWK FW V+ST+KNPKYF +P+KFDPSR+EGNGPAP+T+VPFGGGPRMCPGKEYA
Sbjct  372   YTIPKGWKAFWTVHSTNKNPKYFPDPEKFDPSRFEGNGPAPYTYVPFGGGPRMCPGKEYA  431

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             RLEIL F+HN+VT FK EKL PNEKI Y S SPIP  GLP++L
Sbjct  432   RLEILTFIHNLVTRFKWEKLNPNEKIFY-SPSPIPEEGLPIKL  473



>ref|XP_002266024.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=480

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 334/464 (72%), Gaps = 13/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+L
Sbjct  23    LFYKHRSHFTGPNLPPGRIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSLL  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE  AVF GAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++     R  +   
Sbjct  83    GEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDK--VFPSSTQTSSKEEAKKMRKLLPRF  140

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D +A+ H A+ W    EV V+ LSK +TF LAC+LF+SIED D + +
Sbjct  141   LKPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLSKRFTFWLACRLFMSIEDPDHIAK  200

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
                P  ++++G+ ++P++ PGT ++RA+K  + +R++L  +IK+RK      + GK    
Sbjct  201   FEKPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKASPT  257

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  LL  TDE+G+H+NE  I   I+G+L+  + + S+AITF++K++AELPH+Y++V
Sbjct  258   -QDILSDLLLATDEDGRHMNEINIADKILGLLIGGHDTASSAITFIVKYMAELPHMYEKV  316

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             Y+EQ+EIA SK P E L+W+D+QKM+YSWNVACE +RL PP QG FRE +TDF + GF+I
Sbjct  317   YEEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSI  376

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STHK+PK F EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  377   PKGWKLYWSTSSTHKSPKCFPEPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARLE  436

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMHNVV  FK +KL+P+EKI+ +    +P  GLPVRL  H+
Sbjct  437   ILVFMHNVVKRFKWDKLLPDEKIIIDPMR-MPAKGLPVRLRLHK  479



>ref|XP_006372247.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP50044.1| cytochrome P450 family protein [Populus trichocarpa]
Length=481

 Score =   489 bits (1258),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 328/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I++  ++  S PNLPPG  G P++GE+ + +       PEK+I DR+ KYS  +FKT+I
Sbjct  23    LIFYNHRSQNSHPNLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIAKYSSHIFKTNI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG+   VFCG A NKF F+NEN L+ +WWP SV K  +FP+  Q + ++     R  + +
Sbjct  83    LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSVNK--IFPSSLQTSSKEEAKKMRKLLPQ  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H A EW    +V V+ LSK YTF LAC+LFLSIED   V 
Sbjct  141   FLKPEALQGYIGIMDTIAQRHFASEWEHKEQVLVFPLSKNYTFRLACRLFLSIEDPSHVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L+++G+ S+P++ PGT +NRA+K  + +R +L+  I++RK      + GK   
Sbjct  201   KFSDPFNLLASGIISIPIDLPGTPFNRAIKASNFIRTELLAFIRQRKKDL---AEGKASP  257

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE G+ +NE +I   IIG+L+  + + SAA TF++K+LAELPHIY++
Sbjct  258   T-QDILSHMLLTCDENGKCMNELDIADKIIGLLIGGHDTASAACTFIVKYLAELPHIYEE  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK P E L+W+DIQKMKYSW VACE +R+ PP QG FRE + DF + GFT
Sbjct  317   VYKEQMEIAKSKTPGEFLNWDDIQKMKYSWKVACEVMRISPPLQGAFREALNDFIFNGFT  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH++P YF EP+KFDP R+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  377   IPKGWKLYWSTNSTHRDPVYFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK +KL+ +EKIV N   PIP  GLPVRL PH+
Sbjct  437   EILVFMHNLVRRFKFDKLIQDEKIVVNPL-PIPDKGLPVRLHPHK  480



>ref|XP_003525322.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=482

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/453 (52%), Positives = 328/453 (72%), Gaps = 13/453 (3%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI GE   +FCGA 
Sbjct  36    PNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSIFGEPAVIFCGAT  95

Query  332   GNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIP  511
              NKF F+NEN L+  WWP SV K  +FP+  Q+  ++ +   R  + +  K E L+ Y+ 
Sbjct  96    CNKFLFSNENKLVAAWWPNSVNK--VFPSTLQSNSKEESKKMRKLLPQFLKPEALQRYVG  153

Query  512   TIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTG  691
              +D++A+ H A  W    E+ VY L+K YTF LAC+LF+S+ED + V +  +P  L+++G
Sbjct  154   IMDTIAQNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSVEDVNHVAKFENPFHLLASG  213

Query  692   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSV  871
             + S+P++ PGT +N+A+K  + +R++L+++I++RK      + GK     +D+L  +L  
Sbjct  214   IISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKASPT-QDILSHMLLT  269

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
              +E GQ +NE +I   I+G+L+  + + SAA TF++K+LAELPHIY  VY+EQ+EIAKSK
Sbjct  270   CNENGQFMNELDIADKILGLLIGGHDTASAACTFIVKYLAELPHIYDSVYQEQMEIAKSK  329

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
              P E L+W+DI +MKYSWNVACE +R+ PP QGGFRE + DF + GF+IPKGWK +W+  
Sbjct  330   LPGELLNWDDINRMKYSWNVACEVMRIAPPLQGGFREAINDFIFNGFSIPKGWKLYWSAN  389

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
             STHKNP+YF EP+KFDP+R+EG GPAPFTFVPFGGGPRMCPGKEYARLEILVFMHN+V  
Sbjct  390   STHKNPEYFPEPEKFDPTRFEGQGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNLVKR  449

Query  1412  FKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             FK EKL+P+EKI+ +   P+P   LP+RL PH+
Sbjct  450   FKWEKLIPDEKIIVDPL-PVPAKNLPIRLHPHK  481



>gb|AIT93302.1| cytochrome P450 monooxygenase CYP716A12 [Medicago sativa]
Length=479

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 331/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             ++FI   + S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKHKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDA-QNTLRKITILNRTNIHE  475
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT +  ++L++ +I  R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSSLKEESIKMRKLLPQ  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+ED + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVSHWENKDEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L++ G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+      +    +D
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRIDLAQGTASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  259   ----ILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNVACE +RL PP QGGFRE +TDF + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN + F  P+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK EK++P+EKI+ +   PIP   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIVDPF-PIPAKDLPIRLYPHK  478



>dbj|BAP59951.1| cytochrome P450 monooxygenase CYP716A50 [Coffea arabica]
Length=479

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 331/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
              +++ +++  S P LPPG TGWP++GE+++ +       PEK++ DRM KYS  VFKT +
Sbjct  22    FLFYKSRSALSGP-LPPGKTGWPMVGESLEFLSCGWKGHPEKFVFDRMAKYSSHVFKTHL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGEK AVFCGA GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +  
Sbjct  81    LGEKAAVFCGAPGNKFLFSNENKLVQAWWPASVDK--VFPSSTQTSSKEEAIKMRKMLPN  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D +A  H +  W    +VKV+ L K YTF +A +LF+S+E+  EV 
Sbjct  139   FLKPEALQRYIGIMDHIAGRHFSSGWENKDQVKVFPLCKNYTFWIASRLFVSVEEPTEVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +LL+P  ++++G+ S+P++ PGT +NRA+K  + +R+ LV +IK+RK     +     +D
Sbjct  199   KLLEPFNVLASGLISVPIDLPGTPFNRAVKASNQIRKMLVALIKQRKVDLAESKASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 ++  +L+++DE G+ ++E ++   I+G+L+  + + S+A TFV+KFLAELP IY+ 
Sbjct  259   ----IMSHMLTISDENGKFMHELDVADKILGLLIGGHDTASSACTFVIKFLAELPEIYEG  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EI KSK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE + DF Y GF+
Sbjct  315   VYKEQMEIVKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALADFMYNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  +TH+NP+ F EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKIYWSANTTHRNPECFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVF+H+VV  F+ EK++P+EKIV +   PIP  GLPVRL PH+
Sbjct  435   EILVFIHHVVKRFRWEKIIPDEKIVVDPM-PIPAKGLPVRLFPHK  478



>ref|XP_007222742.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
 gb|EMJ23941.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
Length=482

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/464 (53%), Positives = 328/464 (71%), Gaps = 13/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  +A  +  NLPPG  G+PVIGE+ + +       PEK+I DRM KYS +VFKTSI 
Sbjct  23    LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK A+FCGAA NKF F+NEN L+T WWP SV K  +FP+  + + ++     R  +   
Sbjct  83    GEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSQETSAKEEAKKMRKMLPNF  140

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D++A+ H A+ W   +EV+V+ L+K YTF LA +LF+S+ED  E+ R
Sbjct  141   MKPEALQRYIGIMDTVAQRHFADGWENRKEVEVFPLAKNYTFWLAARLFVSLEDATEIAR  200

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L DP  L+++G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK      + GK    
Sbjct  201   LGDPFALLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKASPT  257

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  +L + DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +V
Sbjct  258   -QDILSHMLLLCDEHGTHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEV  316

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EI   K P E L+W+D+QKMKYSWNVA E LRL PP QG FRE + DF + GFTI
Sbjct  317   YKEQMEILSCKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALADFVFNGFTI  376

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STHKN  YF EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  377   PKGWKLYWSANSTHKNADYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLE  436

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMHN+V  FK EK++P+EKIV +   P+P  GLPVRL PH+
Sbjct  437   ILVFMHNLVKRFKWEKILPDEKIVVDPL-PMPAKGLPVRLFPHK  479



>ref|XP_011017588.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score =   487 bits (1253),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 328/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I++  ++  S P LPPG  G P++GE+ + +       PEK+I DR+ +YS  VFKT+I
Sbjct  23    LIFYNHRSQNSHPKLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIARYSSHVFKTNI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG+   VFCG A NKF F+NEN L+ +WWP SV K  +FP+  Q +  +     R  + +
Sbjct  83    LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSVNK--IFPSSLQTSSIEEAKKMRKLLPQ  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H A EW    +V V+ L+K YTF LAC+LFLSIED   V 
Sbjct  141   FLKPEALQGYIGIMDTIAQRHFASEWEHKEQVLVFPLAKNYTFRLACRLFLSIEDPSHVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L+++G+ S+P++ PGT +NRA+K  + +R +L+ +I++RK      + GK   
Sbjct  201   KFSDPFNLLASGIISIPVDLPGTPFNRAIKASNFIRTELLAIIRQRKKDL---AEGKASP  257

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE G+ +NE +I   IIG+L+  + + SAA TF++K+LAELPHIY++
Sbjct  258   T-QDILSHMLLTCDENGKCMNELDIADKIIGLLIGGHDTASAACTFIVKYLAELPHIYEE  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ++IAKSK P E L+W+DIQKMKYSWNVACE +R+ PP QG FRE + DF + GFT
Sbjct  317   VYKEQMKIAKSKTPGELLNWDDIQKMKYSWNVACEVMRISPPLQGAFREALNDFIFNGFT  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH++P YF EP+KFDP R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  377   IPKGWKLYWSTNSTHRDPVYFPEPEKFDPRRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK +KL+ +EKIV N   PIP  GLPVRL PH+
Sbjct  437   EILVFMHNLVKRFKFDKLIQDEKIVVNPL-PIPDKGLPVRLHPHK  480



>ref|XP_003531849.1| PREDICTED: cytochrome P450 716B2 isoform X1 [Glycine max]
 gb|KHN17287.1| Cytochrome P450 716B2 [Glycine soja]
Length=482

 Score =   486 bits (1252),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 333/467 (71%), Gaps = 14/467 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             II++  ++  S PNLPPG  G+PVIGE+++ +      +PEK+ SDRM +YS +VFKTSI
Sbjct  23    IIFYRHRSPFSVPNLPPGKAGFPVIGESLEFLSAGRKGLPEKFFSDRMTEYSSKVFKTSI  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE   +FCGAA NKF F+NEN  + +WWP++V K  +FPT+ Q   ++     R  + +
Sbjct  83    LGEPTVIFCGAACNKFLFSNENKHVISWWPENVKK--LFPTNIQTNSKEEAKKLRNILPQ  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
                 + ++ Y+  +D++A+ H A EW    +V V  L+K YTF +A ++F+SI+D ++V 
Sbjct  141   FLSAKAIQRYVGIMDTVAQRHFALEWENNTQVTVLPLAKRYTFGVASRVFMSIDDLNQVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L +P+  V+ G+ S+P+NFPGT +NR +K    +RR+L+ ++K+RK + + N +     
Sbjct  201   KLAEPLNQVNAGIISMPINFPGTVFNRGIKASKFIRRELLRIVKQRKVE-LANGMS---T  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP-HIYQ  1012
               +D+L  +L   DE GQ+L E +I + I+G+L+ ++ +TS   TFV+K+LAELP +IY+
Sbjct  257   PTQDILSHMLIYCDENGQYLAEHDIVNKILGLLIGSHETTSTVCTFVVKYLAELPQNIYE  316

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
              VY+EQ+ IAKSK P E L+W+DIQKMKYSWNVACE +RL PP QG FRE + DF + GF
Sbjct  317   NVYQEQMAIAKSKAPGELLNWDDIQKMKYSWNVACEVIRLNPPAQGAFREAINDFIFDGF  376

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  STHKNP+YF EP+KFDPSR+EG GPAP+T+VPFGGGP MCPGKEYAR
Sbjct  377   SIPKGWKLYWSANSTHKNPEYFPEPEKFDPSRFEGTGPAPYTYVPFGGGPSMCPGKEYAR  436

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             +E+LVFMHN+V  FK E L PN  + YN  +PIP  GLPVRL PH++
Sbjct  437   MELLVFMHNLVKRFKCETLFPNGNVTYN-PTPIPAKGLPVRLIPHRS  482



>ref|XP_009345334.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
 ref|XP_009351212.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/464 (52%), Positives = 328/464 (71%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K  +FP+  + + ++     R  +  
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSLETSAKEEAKKMRKMLPN  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S+ED  E+ 
Sbjct  140   FMKPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLEDSVEIA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L DP  ++++G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK      + GK   
Sbjct  200   KLGDPFAVLASGIISMPLDFPGTPFYKAIKASNFIREELAKIIKQRKIDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L + DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY Q
Sbjct  257   T-QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDQ  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+E+  SK P E L+W+D+QKMKYSWNVA E LRL PP QG FRE ++DF + GFT
Sbjct  316   VYKEQMEVLSSKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREAMSDFVFNGFT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN  YF EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKNEAYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EILVFMHN+V  FK EK++P+E+IV +   P+P  GLPVRL PH
Sbjct  436   EILVFMHNLVKRFKWEKVLPDEQIVVDPL-PMPAKGLPVRLFPH  478



>ref|XP_006353745.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 242/452 (54%), Positives = 326/452 (72%), Gaps = 14/452 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG +GWPVIGE+++ +       PEK+I DR+ KYS  +FKT +LGEK  VFCGA+ N
Sbjct  36    LPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRIFKYSSNIFKTHLLGEKAIVFCGASSN  95

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +    K E L+ YI  +
Sbjct  96    KFLFSNENKLVQAWWPSSVDK--VFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRYIGIM  153

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D +A++H  + W    EV V+ L+K YTF LAC+LF+S+ED + V +L DP  ++++G+ 
Sbjct  154   DHIAQKHF-QSWENQEEVLVFPLAKRYTFWLACRLFVSVEDPNHVAKLADPFDVLASGLI  212

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P+N PGT +NRA+K  + +R++LV +IK+RK      + GK  D  +D+L  +L  +D
Sbjct  213   SIPINLPGTPFNRAIKASNFIRKELVAIIKQRKIDL---TEGKASD-SQDILSHMLLTSD  268

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G+ ++E +I   I+G+L+  + + S+A TF++K+LAELP IY  VYKEQIEIAKSKGP
Sbjct  269   ENGKFMHELDIADKILGLLIGGHDTASSACTFIVKYLAELPDIYDGVYKEQIEIAKSKGP  328

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L+ EDI+KMKYSWNVACE LRL PP QG FRE + DFT+ GF+IPKGWK +W+  ST
Sbjct  329   GELLNREDIKKMKYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWKIYWSANST  388

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             H+NP+ F +P KFDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V  F 
Sbjct  389   HRNPEVFLDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFS  448

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              +K++ +EKI+ N   PIP NGLP+RL PH N
Sbjct  449   WKKIIHDEKIIVNPM-PIPANGLPIRLYPHHN  479



>gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula]
 gb|KEH21305.1| cytochrome P450 family protein [Medicago truncatula]
Length=479

 Score =   486 bits (1251),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 330/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT-LRKITILNRTNIHE  475
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT + ++ L++ +I  R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+ED + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L++ G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+      +    +D
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  259   ----ILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNVACE +RL PP QGGFRE +TDF + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN + F  P+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK EK++P+EKI+ +   PIP   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIVDPF-PIPAKDLPIRLYPHK  478



>ref|XP_008224572.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=482

 Score =   486 bits (1251),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 243/464 (52%), Positives = 328/464 (71%), Gaps = 13/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  +A  +  NLPPG  G+PVIGE+ + +       PEK+I DRM KYS +VFKTSI 
Sbjct  23    LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK A+FCGAA NKF F+NEN L+T WWP SV K  +FP+  + + ++     R  +   
Sbjct  83    GEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSQETSAKEEAKKMRKMLPNF  140

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D++A+ H A+ W   +EV+V+ L+K YTF LA +LF+S+ED  E+ R
Sbjct  141   MKPEALQRYIGIMDTVAQRHFADGWENRKEVEVFPLAKNYTFWLAARLFVSLEDATEIAR  200

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L DP  L+++G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK      + GK    
Sbjct  201   LGDPFALLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKVDL---AEGKASPT  257

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  +L + DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +V
Sbjct  258   -QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDEV  316

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EI   K P E L+W+D+QKMKYSWNVA E LRL PP QG FRE + DF + GFTI
Sbjct  317   YKEQMEILSCKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALADFVFNGFTI  376

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STHKN  YF EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  377   PKGWKLYWSANSTHKNADYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLE  436

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVF+HN+V  FK EK++P+EKIV +   P+P  GLPVRL PH+
Sbjct  437   ILVFIHNLVKRFKWEKILPDEKIVVDPL-PMPAKGLPVRLFPHK  479



>gb|KCW72928.1| hypothetical protein EUGRSUZ_E01367, partial [Eucalyptus grandis]
Length=464

 Score =   485 bits (1249),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 227/442 (51%), Positives = 327/442 (74%), Gaps = 11/442 (2%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+L PG+ GWPV+GE ++ M       PEK++ DR   +S +VF+T++ G  +AVFCGA+
Sbjct  27    PHLLPGTKGWPVVGETLEYMTAGRSGRPEKFVKDRAAWHSSDVFRTNLYGADMAVFCGAS  86

Query  332   GNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIP  511
             GNKF F++EN  ++ WWP S+ K  MFP        +     R+ + E  K E L+HYIP
Sbjct  87    GNKFLFSSENKHVSPWWPDSMKKIFMFPEALGKLKNEDAKKRRSFMLEFLKPEALRHYIP  146

Query  512   TIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTG  691
              +DS+ ++H+A +W+P +EV+V+ L K YT ALAC+LF++I D + V++  DP   V+ G
Sbjct  147   VMDSVTRDHLATDWSPHKEVRVFPLLKSYTLALACRLFMNIRDPEIVRKFADPFARVAPG  206

Query  692   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSV  871
               ++P+N PGT +NRA++GG ++R++L+++++ RK   M  S GK +   RD L RLL  
Sbjct  207   FVTVPINIPGTPFNRAVEGGKVLRQELLDLVRRRK---MEISEGK-DANARDFLSRLLLE  262

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
               ++G  L E +    I+G+L  ++ +TS +IT ++ +LA+ PH+Y++V++EQ+EIA+SK
Sbjct  263   GGDDGTALYEMDTSTKIMGLLNASHDTTSTSITAIVNYLAQFPHVYERVHQEQLEIARSK  322

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
             GP+E L+W+D+QKMKYSWNVACE++RL PP QG +R  +TDF++AG+TIPKGWKTFW V+
Sbjct  323   GPDEFLNWDDVQKMKYSWNVACESMRLLPPAQGAYRVAMTDFSFAGYTIPKGWKTFWTVH  382

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
             ST+KNPKYF +P+KFDPSR+EGNGPAPF +VPFGGGP MCPGKEYARLEILVFMHN+VT 
Sbjct  383   STNKNPKYFPDPEKFDPSRFEGNGPAPFIYVPFGGGPHMCPGKEYARLEILVFMHNLVTK  442

Query  1412  FKMEKLVPNEKIVYNSASPIPV  1477
             FK+ K++PNEK +Y + SP+PV
Sbjct  443   FKLMKVIPNEKFIY-TPSPVPV  463



>emb|CAN72302.1| hypothetical protein VITISV_041935 [Vitis vinifera]
Length=480

 Score =   486 bits (1250),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 332/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22    LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++     R  + +
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDK--VFPSSTQTSSKEEAKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y   +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIED   V 
Sbjct  140   FLKPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  ++++G+ ++P++ PGT ++RA+K  + +R++L  +IK+RK     +   K +D
Sbjct  200   KFEKPFHVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQD  259

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  TDE+G H+NE  I   I+G+L+  + + S+AITF++K++AELPHIY++
Sbjct  260   ----ILSHMLLATDEDGCHMNEMXIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEK  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIA SK P E L+W+D+QKM+YSWNVACE +RL PP QG FRE +TDF + GF+
Sbjct  316   VYKEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFS  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+ + F +P+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKSLECFPQPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EIL+FMHN+V  FK +KL+P+EKI+ +   P+P  GLPVRL PH+
Sbjct  436   EILIFMHNLVKRFKWDKLLPDEKIIVDPM-PMPAKGLPVRLHPHK  479



>emb|CBN88268.1| cytochrome P450 monoxygenase [Medicago truncatula]
 emb|CBN88269.1| cytochrome P450 monoxygenase [Medicago truncatula]
Length=479

 Score =   486 bits (1250),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 330/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT-LRKITILNRTNIHE  475
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT + ++ L++ +I  R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H    W    E+ VY L+K YTF LAC+LF+S+ED + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L++ G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+      +    +D
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRIDLAEGTASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  259   ----ILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNVACE +RL PP QGGFRE +TDF + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN + F  P+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK EK++P+EKI+ +   PIP   LP+RL PH+
Sbjct  435   EILVFMHNLVKRFKWEKVIPDEKIIVDPF-PIPAKDLPIRLYPHK  478



>ref|NP_001268076.1| cytochrome P450 CYP716A17 [Vitis vinifera]
 dbj|BAJ84107.1| Cytochrome P450 [Vitis vinifera]
Length=480

 Score =   486 bits (1250),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 332/465 (71%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22    LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++     R  + +
Sbjct  82    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDK--VFPSSTQTSSKEEAKKMRKLLPQ  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y   +D +A+ H A+ W    EV V+ L+K +TF LAC+LF+SIED   V 
Sbjct  140   FLKPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +   P  ++++G+ ++P++ PGT ++RA+K  + +R++L  +IK+RK     +   K +D
Sbjct  200   KFEKPFHVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQD  259

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  TDE+G H+NE  I   I+G+L+  + + S+AITF++K++AELPHIY++
Sbjct  260   ----ILSHMLLATDEDGCHMNEMSIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEK  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIA SK P E L+W+D+QKM+YSWNVACE +RL PP QG FRE +TDF + GF+
Sbjct  316   VYKEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFS  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+ + F +P+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKSLECFPQPEKFDPTRFEGAGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EIL+FMHN+V  FK +KL+P+EKI+ +   P+P  GLPVRL PH+
Sbjct  436   EILIFMHNLVKRFKWDKLLPDEKIIVDPM-PMPAKGLPVRLHPHK  479



>ref|XP_009787233.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=482

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 328/465 (71%), Gaps = 24/465 (5%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKV  310
              K+  S   LPPG++GW VIGE+++ +       PE +I DR+ KYS  VFKT + GEK 
Sbjct  29    NKSTFSGGQLPPGNSGWAVIGESLEFLSTGWKGHPENFIFDRISKYSSNVFKTHLFGEKA  88

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA+GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +    K E
Sbjct  89    AVFCGASGNKFLFSNENKLVQAWWPSSVDK--IFPSSTQTSSKEEAIKMRKMLPNFLKPE  146

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D +A+ H  + W    EV V+ L+K YTF LAC+LF+S+ED + V +L DP
Sbjct  147   ALQRYIGIMDHIAQRHF-KSWENQEEVIVFPLAKRYTFWLACRLFVSVEDPNHVAKLADP  205

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERK-----AKAMMNSLGKVED  835
               ++++G+ S+P++ PGT +NRA+K  + +R++LVE+IK+RK      KA+ N       
Sbjct  206   FDVLASGLISIPIDLPGTPFNRAIKASNFIRKELVEIIKQRKIDLAEGKALPN-------  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY+ 
Sbjct  259   --QDILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYEG  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSK   E L+WEDIQKM+YSWNVACE LRL PP QG FRE + DFT+ GF+
Sbjct  317   VYKEQMEIAKSKAAGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREALADFTFNGFS  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH+NP+ F EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  377   IPKGWKIYWSANSTHRNPEVFPEPLKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARL  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMH++V  FK EK++P+EKIV N   PIP  GLPV+L PH 
Sbjct  437   EILVFMHHLVKRFKWEKIIPDEKIVVNPM-PIPAKGLPVKLYPHN  480



>gb|AEX07772.1| cytochrome P450 [Catharanthus roseus]
 gb|AEX07773.1| cytochrome P450 [Catharanthus roseus]
Length=480

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 330/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++  K+    P LPPG TGWP++GE++  +       PEK+I DRM KYS  VF++ +L
Sbjct  23    LFYKNKSTLPGP-LPPGRTGWPMVGESLQFLSAGWKGHPEKFIFDRMAKYSSNVFRSHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE  AVFCGA GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   
Sbjct  82    GEPAAVFCGAIGNKFLFSNENKLVQAWWPDSVNK--VFPSSNQTSSKEEAIKMRKMLPNF  139

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D +A++H +  W    +V+V+ L+K YTF LA +LF+S+ED  EV +
Sbjct  140   LKPEALQRYIGLMDQIAQKHFSSGWENREQVEVFPLAKNYTFWLASRLFVSVEDPIEVAK  199

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             LL+P  ++++G+ S+P++ PGT +NRA+K  + VR+ L+ +IK+RK      + GK    
Sbjct  200   LLEPFNVLASGLISVPIDLPGTPFNRAIKASNQVRKMLISIIKQRKIDL---AEGKASPT  256

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TF++KFL ELP IY+ V
Sbjct  257   -QDILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACTFIVKFLGELPEIYEGV  315

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EIA SK P E L+WEDIQKMKYSWNVACE LRL PP QG FRE + DF + GF+I
Sbjct  316   YKEQMEIANSKAPGEFLNWEDIQKMKYSWNVACEVLRLAPPLQGAFREALNDFMFHGFSI  375

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+V STH+NP+ F +P KFDPSR++G+GPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  376   PKGWKIYWSVNSTHRNPECFPDPLKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLE  435

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ILVFMHN+V  FK EK++PNEKIV +   PIP  GLPVRL PH N
Sbjct  436   ILVFMHNLVKRFKWEKIIPNEKIVVDPM-PIPEKGLPVRLYPHIN  479



>ref|XP_009591188.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=483

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 326/462 (71%), Gaps = 24/462 (5%)
 Frame = +2

Query  158   NTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVF  319
             +T    LPPG +GWPVIGE+++ +       PEK+I DR+ KYS  VFKT +LGEK AVF
Sbjct  33    STFSGQLPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRISKYSSNVFKTHLLGEKAAVF  92

Query  320   CGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             CG +GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +    K E L+
Sbjct  93    CGDSGNKFLFSNENKLVQAWWPSSVDK--IFPSSTQTSSKEEAIKMRKMLPNFLKPEALQ  150

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              YI  +D +A+ H  + W    +V V+ L+K YTF LAC+LF+S+ED + V +L DP  +
Sbjct  151   RYIGIMDDIAQRHF-KSWENQEQVFVFPLAKRYTFWLACRLFVSVEDSNHVAKLADPFDV  209

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERK-----AKAMMNSLGKVEDEGR  844
             +++G+ S+P++ PGT +NRA+K  + +R++LV +IK+RK      KA+ N         +
Sbjct  210   LASGLISIPIDLPGTPFNRAIKASNFIRKELVAIIKQRKIDLAEGKALPN---------Q  260

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY+ VYK
Sbjct  261   DILSHMLLTSDENGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYEGVYK  320

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ+EIAKSK   E L+WEDIQKM+YSWNVACE LRL PP QG FRE + DFT+ GF+IPK
Sbjct  321   EQMEIAKSKAKGELLNWEDIQKMRYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPK  380

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
             GWK +W+  STH+NP+ F EP KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYARLEIL
Sbjct  381   GWKIYWSANSTHRNPEVFPEPLKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYARLEIL  440

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             VFMH++V  FK EK++P+EKIV N   PIP  GLPV+L PH 
Sbjct  441   VFMHHLVKRFKWEKIIPDEKIVVNPM-PIPAKGLPVKLYPHN  481



>ref|XP_010048515.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80784.1| hypothetical protein EUGRSUZ_C02161 [Eucalyptus grandis]
Length=480

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/468 (52%), Positives = 326/468 (70%), Gaps = 16/468 (3%)
 Frame = +2

Query  134   IIYFITK---ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFK  286
              +++IT    A+ +  NLPPG TG P IGE ++ +       PEK+I DR+ +YS EVFK
Sbjct  19    FLFYITYKHIAHFTGANLPPGKTGLPFIGETLEFLSSGWKGHPEKFIFDRIARYSSEVFK  78

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTN  466
             TSIL E  AV CGAAGNKF F+NEN L+T WWP S+ K  +FP+  Q + ++     R  
Sbjct  79    TSILAEPTAVLCGAAGNKFLFSNENKLVTAWWPDSINK--VFPSSTQTSSKEEAKKMRKM  136

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             +    K E L+ YI  +D +A+ H A  W    E+ V+ L+K YTF LAC+LF+S+ED D
Sbjct  137   LPNFMKPEALQRYIGIMDHIAQRHFAMGWEGRDEIIVFPLAKRYTFWLACRLFMSVEDPD  196

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              V +  DP  ++++GMFS+P++ PG   NRA    + +R++L  +IK+RK      + GK
Sbjct  197   HVAKFADPFNVLASGMFSVPIDLPGMPLNRAKHASNFIRKELRVIIKQRKIDL---AEGK  253

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                  +D+L  +L  TDEEG+H+NE  I   I+G+L+  + + SAA TF++K+LAELP +
Sbjct  254   AS-ATQDILSHMLLATDEEGKHMNELNIADKILGLLVGGHDTASAACTFIVKYLAELPDV  312

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             Y  VY EQ+EIAKSK P E L+W+DIQKM+YSWNVACE +RL PP QG FRE + DF + 
Sbjct  313   YDGVYSEQMEIAKSKAPGELLNWDDIQKMRYSWNVACEVMRLAPPLQGAFREALNDFVFN  372

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
             GF+IPKGWK +W+ +S H+NP+YF EP+KFDPSR++G GPAP+T+VPFGGGPRMCPGKEY
Sbjct  373   GFSIPKGWKLYWSAHSAHRNPEYFPEPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEY  432

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ARLEILVFMHN+V  FK EKL+ +EKI+ +   P+P  GLPVRL PH+
Sbjct  433   ARLEILVFMHNLVKRFKWEKLLADEKIIVDPM-PMPAKGLPVRLHPHK  479



>ref|XP_011031249.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 327/465 (70%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             ++  + K+N S PNLPPG  G+P+IGE+++ +       PEK+I DR+ KYS +VFKT I
Sbjct  21    LLICVHKSNVSHPNLPPGKMGFPIIGESLEFLSAGRKGYPEKFIYDRIAKYSSQVFKTCI  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LG+   V CGAAGNKF F+NEN L+ +WWP SV K  +FP+  Q + ++ +   R  +  
Sbjct  81    LGQPTTVVCGAAGNKFLFSNENKLVASWWPDSVNK--IFPSSTQTSSKEESKKMRKLLPN  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E+L+ Y+  +D++A+ H+ + W   +EV V  L+K YTF +ACK+FLSI+D     
Sbjct  139   FFKPESLQRYVGMMDTIAQRHLEDSWEGKQEVTVLPLAKTYTFGIACKVFLSIDDPKHAA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L  P   +++G+ S+P++ PGT++NR +K    +R++LV +IK+RK     N     +D
Sbjct  199   KLAHPFNDLASGIISIPIDLPGTSFNRGIKASKWIRKELVSIIKQRKVDLAENRALHTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  TDE+GQ++ E +I   I+G+L+  + + SA ITF++K+LAELPHIYQ+
Sbjct  259   ----MLSHMLLTTDEDGQYMKETDIADKILGLLIGGHDTASAVITFIVKYLAELPHIYQE  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ+EIAK K P E L+W DIQKMKYSWNVACE LRL PP QG FRE + DF +AGF 
Sbjct  315   VLKEQMEIAKWKRPRELLNWNDIQKMKYSWNVACEVLRLAPPLQGAFREAINDFNFAGFH  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STH+NP+ F +P+KF P+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSASSTHRNPECFPDPEKFQPARFEGTGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  F+ EKL+P+EKI+ +    IP   LP+RL  HQ
Sbjct  435   EILVFMHNLVRRFRWEKLIPDEKIIVDPIL-IPAKQLPIRLFHHQ  478



>ref|XP_011019870.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=484

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 333/466 (71%), Gaps = 16/466 (3%)
 Frame = +2

Query  140   YFITKAN---TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             Y I K     +S  NLPPG+TG P+IGE+++ +       PEK+I DRM K+S +VFKTS
Sbjct  24    YLINKHRYSLSSLNNLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTS  83

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +  E  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R    
Sbjct  84    LFCEPTAVFCGAAGNKFLFSNENKLVTAWWPDSVNK--IFPSSQQTSSQEESKKMRKLFP  141

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
               FK E+L+ YI  +D +A+ H+A +W   +EV V+ L+K YTF LAC+LFLS+ED +EV
Sbjct  142   LFFKPESLQRYISVMDVIAQRHLASDWEGKQEVSVFPLAKTYTFWLACRLFLSMEDPEEV  201

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             ++   P   ++ G+ S+P++ P T +NR +K  ++V ++L+++IK+RK     N     +
Sbjct  202   QKFAKPFNDLAAGIISIPIDLPWTPFNRGVKASNVVHKELLKIIKQRKIDLAENKASPTQ  261

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
             D    +L  +L+  D++GQ + E +I   I+G+L+  + + SAAITF++K+LAELPH+Y 
Sbjct  262   D----ILSHMLTTADDDGQCMEEIDIADKILGLLVGGHDTASAAITFIVKYLAELPHVYS  317

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             ++ +EQ EIAK+K P E L+WEDIQ+M+YSWNVACE +R+ PP QG FRE +T+F YAGF
Sbjct  318   KLLEEQREIAKTKTPGELLNWEDIQRMRYSWNVACEVMRVAPPLQGAFREAMTEFNYAGF  377

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIPKGWK +W+  +THKNP+ F EP+ FDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYAR
Sbjct  378   TIPKGWKLYWSANTTHKNPECFPEPENFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYAR  437

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LEILVF+HN+V  F+ EKL+P E+I+ +   PIP  GLP+RL PH+
Sbjct  438   LEILVFLHNLVKKFRWEKLLPKERIIVDPL-PIPSKGLPIRLHPHK  482



>ref|XP_002522937.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39448.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 236/460 (51%), Positives = 324/460 (70%), Gaps = 15/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  + P+LPPG  G P +GE+++ +       PEK++ DR  KYS E+FKT++LG+  A
Sbjct  28    KSQYNYPSLPPGKPGLPFVGESLEFLSSGWKGHPEKFVFDRTSKYSSEIFKTNLLGQPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             VFCGA+ NKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  + +  K E 
Sbjct  88    VFCGASANKFLFSNENKLVQAWWPDSVNK--IFPSSLQTSSKEEAIKMRKLLPQFMKPEA  145

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             L+ YI  +D++A+ H A  W    EV V+ L+K YTF LAC+LF+S+ED D + +  DP 
Sbjct  146   LQRYIGIMDTIAQRHFASGWEKKNEVVVFPLAKNYTFWLACRLFVSLEDPDHIAKFADPF  205

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG-RDV  850
               +++G+ S+P++ PGT + RA+K  + +R++L+ +IK+RK       L + +  G +D+
Sbjct  206   QELASGIISVPIDLPGTPFRRAIKASNFIRKELISIIKQRKI-----DLAEGKASGTQDI  260

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L  +DE+G+ +NE +I   I+G+L+  + + SAA TF++K+LAELP IY  VYKEQ
Sbjct  261   LSHMLLTSDEDGKFMNEMDIADKILGLLIGGHDTASAACTFIIKYLAELPQIYDAVYKEQ  320

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIAKSKG  E L+WEDIQKMKYSWNVACE +R+ PP QG FRE + DF + GF IPKGW
Sbjct  321   MEIAKSKGEGELLNWEDIQKMKYSWNVACEVMRVAPPLQGAFREAINDFIFNGFYIPKGW  380

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  STHK+  YF EP+KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYARLEILVF
Sbjct  381   KLYWSANSTHKSATYFEEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARLEILVF  440

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHN+V  F  +K++P+E I+ N   PIP  GLPVRL PHQ
Sbjct  441   MHNLVKRFNFQKIIPDENIIVNPL-PIPAKGLPVRLLPHQ  479



>ref|XP_010245748.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=484

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 322/464 (69%), Gaps = 13/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  298
             + +  K+N S   LPPG  G P +GE+I  +       PEK++ DRM K+S EVF+TS+ 
Sbjct  28    LVYKRKSNPSGGKLPPGKMGLPFVGESIQFLSLGRKGTPEKFMYDRMAKFSKEVFRTSLF  87

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE  AVFCG +GNKF F+NEN L+T WWP+SV K  +FP+  Q + ++     R  + + 
Sbjct  88    GENTAVFCGPSGNKFLFSNENKLVTAWWPRSVEK--IFPSSTQTSSKEEAKKMRKLLPQF  145

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +DS+A+ H    W    EV V+ L+K YTF LAC+LFLSIED D V +
Sbjct  146   LKPEALQRYIGIMDSIAQRHFKAGWDDRDEVTVFPLAKRYTFWLACRLFLSIEDPDHVAK  205

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
               DP   +++G+FS+P++ PGT++N+ +K    +R++L+ +IK+RK     N     +D 
Sbjct  206   FADPFNALASGIFSIPIDLPGTSFNKGIKASDEIRKELLAIIKQRKIDLAENRASPTQD-  264

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
                +L  +L  TDE+G  +NE +I   I+G+L+  + + SAAITFV+K+LAELP IY QV
Sbjct  265   ---ILSHMLLYTDEDGHFMNERDIADKILGLLIGGHDTASAAITFVMKYLAELPDIYNQV  321

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              +EQ+EIAK K P ERL+W+D+QKM+YSWNVA E +RL PP QG FRE + DFT+AGF I
Sbjct  322   LQEQMEIAKCKAPGERLNWDDMQKMRYSWNVASEVMRLAPPLQGAFREALMDFTFAGFCI  381

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W   STH+NP+YF EP+KFDPSR++G GP P+T+VPFGGGPRMCPGKEYARLE
Sbjct  382   PKGWKLYWAANSTHRNPEYFPEPEKFDPSRFDGTGPVPYTYVPFGGGPRMCPGKEYARLE  441

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMHNVV  F+ EK++ +EKI+ N   P+P  G PVRL  H+
Sbjct  442   ILVFMHNVVKRFRWEKILSDEKIIVNPM-PMPAKGFPVRLHAHK  484



>ref|XP_010046875.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW78586.1| hypothetical protein EUGRSUZ_C00059 [Eucalyptus grandis]
Length=482

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 316/452 (70%), Gaps = 13/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG  G P IGE +  +       PEK+I DRM  YSP VFKTSIL E  AVFCGA G
Sbjct  37    NLPPGRFGLPFIGETLHFLRSGWNGHPEKFIFDRMSAYSPRVFKTSILAEPTAVFCGAPG  96

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++     R  +   FK E L+ YI  
Sbjct  97    NKFLFSNENKLVTAWWPDSVNK--VFPSSLQTSSKEEAKKMRKMLPNFFKPEALQRYIGM  154

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A  H    W    EV V+ L+K +TF LAC++F+S++D D V +  DP   +++G+
Sbjct  155   MDEIAHRHFTTSWENKDEVVVFPLAKRFTFWLACRVFVSVQDPDHVAKFADPFNDIASGI  214

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
             FS+P++ PGT  N+A    + +R++L  +IK+RK           +D    +L  +L  T
Sbjct  215   FSIPIDLPGTPLNKAKHASNFIRKELRAIIKQRKLDLAEGRASATQD----ILSHMLLAT  270

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE+G+H+NE +I   I+G+L+  + + SAA TF++K+LA+LP +Y+ VYKEQ+EIAKSK 
Sbjct  271   DEDGKHMNEMDIADKILGLLIGGHDTASAACTFIVKYLADLPQVYEGVYKEQMEIAKSKA  330

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+W+DIQKM+YSWNVACE LRL PP QG FRE + DF + GF+IPKGWK +W+ +S
Sbjct  331   PGELLNWDDIQKMRYSWNVACEVLRLAPPLQGAFREVLNDFIFNGFSIPKGWKIYWSTHS  390

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH++P+YF EP+KFDPSR++GNGPAP+TFVPFGGGPRMCPGKEYARLEILVFMHN+V  F
Sbjct  391   THRSPEYFPEPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRF  450

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K E L+P+EKIV +   P+P  GLPVRL PH+
Sbjct  451   KWESLIPDEKIVVDPM-PMPAKGLPVRLFPHK  481



>gb|AFK47215.1| unknown [Medicago truncatula]
Length=479

 Score =   483 bits (1244),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 236/465 (51%), Positives = 328/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT-LRKITILNRTNIHE  475
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT + ++ L++ +I  R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H    W    E  VY L+K YTF LAC+LF+S+ED + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNETTVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L++ G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+      +    +D
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  +DE G+ +NE  I   I+G+L+  + + S A TF++K+L ELPHIY +
Sbjct  259   ----ILSHMLLTSDENGKSMNELNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNVACE +RL PP QGGFRE +TDF + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN + F  P+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+   FK EK++P+EKI+ +   PIP   LP+RL PH+
Sbjct  435   EILVFMHNLAKRFKWEKVIPDEKIIVDPF-PIPAKDLPIRLYPHK  478



>ref|XP_010252179.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=485

 Score =   484 bits (1245),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 325/465 (70%), Gaps = 15/465 (3%)
 Frame = +2

Query  140   YFITKANTSKPN--LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  295
             Y + K  +  P   LPPG  G P +GE+I+        +PEK+  DRM K+S E+FKTS+
Sbjct  27    YLVYKHTSHAPGKKLPPGRMGLPFVGESIEFFSLGRKGIPEKFFFDRMAKFSKEIFKTSL  86

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AV CG  GNKF F+NEN L+T WWP+SV K  +FP+  Q + ++     R  + +
Sbjct  87    LGENTAVVCGPNGNKFLFSNENKLVTAWWPRSVDK--IFPSSTQTSSKEEAKKMRKLLPQ  144

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L  YI  +D++A+ H    W    EV V+ L+K +TF LAC+LFLSIED D V 
Sbjct  145   FLKPEALHRYIGIMDTIAQRHFKASWDDRDEVTVFPLAKRFTFWLACRLFLSIEDPDHVA  204

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP   +++G+ S+P+N PGT +N+ +K  + +R++L+ +IK+RK     N     +D
Sbjct  205   KFADPFNALASGIISIPINLPGTPFNKGIKASNEIRKELLAIIKQRKIDLAENRASPTQD  264

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  TDE+GQ +NE +I   I+G+L+  + + SAAITFV+K+LAELP IY +
Sbjct  265   ----ILSHMLLYTDEDGQFMNERDIADKILGLLIGGHDTASAAITFVMKYLAELPEIYNE  320

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EI+KSK P ERL+W+D+QKM+YSWNVA E +RL PP QG FRE + DFT+ GF+
Sbjct  321   VYKEQMEISKSKPPGERLNWDDLQKMRYSWNVASEVMRLAPPLQGAFREALMDFTFQGFS  380

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             +PKGWK +W   STH+NP+YF EP+KFDPSR++G+GPAP+T+VPFGGGPRMCPGKEYARL
Sbjct  381   VPKGWKLYWAANSTHRNPEYFPEPEKFDPSRFDGSGPAPYTYVPFGGGPRMCPGKEYARL  440

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHNVV  FK +K++PNEKI+ +   P+P  GLP+RL  H+
Sbjct  441   EILVFMHNVVKRFKWDKILPNEKIIVDPM-PMPAQGLPIRLHAHK  484



>ref|XP_009376339.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score =   483 bits (1244),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 326/464 (70%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K  +FP+  + + ++     R  +  
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSMETSAKEEAKKMRKMLPN  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S++D  E+ 
Sbjct  140   FMKPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLDDSVEIA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L DP  +++ G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK      + GK   
Sbjct  200   KLGDPFAVLAAGLLSMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L + DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +
Sbjct  257   T-QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDE  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+++  +K P E L+W+D+QKMKYSWNVA E LRL PP QG FRE ++DF + GFT
Sbjct  316   VYKEQMDVLSAKAPGELLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALSDFVFNGFT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN  YF EP KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKNAAYFPEPFKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EILVFMHN+V  FK EK++PNE++V +   P+P  GLPVRL PH
Sbjct  436   EILVFMHNLVKRFKWEKVIPNEQMVVDPM-PVPAKGLPVRLFPH  478



>ref|XP_002264643.3| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=509

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 323/465 (69%), Gaps = 13/465 (3%)
 Frame = +2

Query  134   IIYFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTS  292
             I +F+ K   +S  NLPPG  G+P IGE+++ +       PE++I DRM KYS ++FKT 
Sbjct  51    IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  110

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV K  +FP+  Q + ++ ++  R  + 
Sbjct  111   LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSVEK--IFPSSLQTSTKEESMKTRKLLP  168

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
                K E L+ Y+  +DS+AK H+   W     V V+ L+K YTF +AC+LFLSI+D   +
Sbjct  169   AFLKPEALQKYVGIMDSIAKWHLDNHWDLNETVTVFPLAKQYTFMVACRLFLSIDDPKHI  228

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              +  +P  +++ G+ S+P+NFPGT +NRA+K    VR++L  +IK+RK + +    GK  
Sbjct  229   AKFANPFHILAAGVMSIPINFPGTPFNRAIKAADSVRKELRAIIKQRKIQVLA---GKSS  285

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                 D+L  +L+ TDE GQ LNE +I   I+G+L+  + + SA ITF++K+LAELP +Y 
Sbjct  286   SSKHDILSHMLTTTDENGQFLNEMDIADKILGLLIGGHDTASAVITFIIKYLAELPQVYN  345

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+E+A  K   E L WEDIQKMKYSWNVA E +RL PP QG FRE +TDFTYAGF
Sbjct  346   EVLKEQMEVAAGKKSGEMLDWEDIQKMKYSWNVANEVMRLAPPLQGSFREAITDFTYAGF  405

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  +THKNP YF +P+KFDPSR+EGNGP P+T+VPFGGGPRMCPGKEYAR
Sbjct  406   SIPKGWKLYWSTNATHKNPDYFPDPEKFDPSRFEGNGPIPYTYVPFGGGPRMCPGKEYAR  465

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             LEILVF+HNVV  F   KL PNE ++ +   P+P  GLP+RL  H
Sbjct  466   LEILVFIHNVVRRFSWYKLHPNEDVIVDPM-PMPAKGLPIRLRHH  509



>ref|XP_002280969.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=482

 Score =   483 bits (1243),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 325/452 (72%), Gaps = 13/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLP G+TG P IGE+I  +       PEK+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37    NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  +    K E L+ YI  
Sbjct  97    NKFLFSNENKLVTAWWPSSVNK--IFPSSLQTSSQEESKKMRKLLPGFLKPEALQRYISI  154

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A+ H    W    EV V+ L+K +TF LAC+LFLS+ED D V++L +P   ++ G+
Sbjct  155   MDVIAQRHFESSWNNKEEVTVFPLAKMFTFWLACRLFLSVEDPDHVEKLAEPFNELAAGI  214

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              +LP++ PGT++N+ +K  ++VR++L  +IK+RK    MN         +D+L  +L   
Sbjct  215   IALPIDLPGTSFNKGIKASNLVRKELHAIIKKRK----MNLADNKASTTQDILSHMLLTC  270

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+++NE +I   I+G+L+  + + SA ITF++KFLAELPH+Y +V+KEQ+EIAKSK 
Sbjct  271   DENGEYMNEEDIADKILGLLVGGHDTASATITFIVKFLAELPHVYDEVFKEQMEIAKSKA  330

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+WEDI KM+YSWNVACE +RL PP QG FRE + DF + GF+IPKGWK +W+ +S
Sbjct  331   PGELLNWEDIPKMRYSWNVACEVMRLAPPVQGAFREAMNDFIFEGFSIPKGWKLYWSTHS  390

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+NP++F +P+KFDPSR++G GPAP+T+VPFGGGPRMCPGKEYARLE+LVFMHN+V  F
Sbjct  391   THRNPEFFPKPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEYARLEVLVFMHNLVRRF  450

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K EKL+P+EKI+ +   PIP  GLP+RL  HQ
Sbjct  451   KWEKLLPDEKIIVDPM-PIPAKGLPIRLHHHQ  481



>gb|ACJ84447.1| unknown [Medicago truncatula]
Length=479

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/465 (51%), Positives = 327/465 (70%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21    LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT-LRKITILNRTNIHE  475
             GE   V CGAA NKF F+NEN L+T WWP SV K  +FPT + ++ L++ +I  R  + +
Sbjct  81    GESTVVCCGAASNKFLFSNENKLVTAWWPDSVNK--IFPTTSLDSNLKEESIKMRKLLPQ  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ Y+  +D +A+ H    W    E  VY L+K YTF LAC+LF+S+ED + V 
Sbjct  139   FFKPEALQRYVGVMDVIAQRHFVTHWDNKNETTVYPLAKRYTFLLACRLFMSVEDENHVA  198

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  DP  L++ G+ SLP++ PGT +N+A+K  + +R++L+++IK+R+      +    +D
Sbjct  199   KFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQD  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                 +L  +L  +DE G+ +NE  I   I+G+L   + + S A TF++K+L ELPHIY +
Sbjct  259   ----ILSHMLLTSDENGKSMNELNIADKILGLLTGGHDTASVACTFLVKYLGELPHIYDK  314

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D++KMKYSWNVACE +RL PP QGGFRE +TDF + GF+
Sbjct  315   VYQEQMEIAKSKPAGELLNWDDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFS  374

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN + F  P+KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  375   IPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  434

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+   FK EK++P+EKI+ +   PIP   LP+RL PH+
Sbjct  435   EILVFMHNLAKRFKWEKVIPDEKIIVDPF-PIPAKDLPIRLYPHK  478



>ref|XP_008391096.1| PREDICTED: beta-amyrin 28-oxidase [Malus domestica]
Length=484

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 328/464 (71%), Gaps = 13/464 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22    VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GEK A+FCGAA NKF F+NEN L+T WWP SV K  +FP+  + + ++     R  +  
Sbjct  82    MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSLETSAKEEAKKMRKMLPN  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H AE W   +EV+V+ L+K YTF LA +LF+S+ED  E+ 
Sbjct  140   FMKPEALQRYIGIMDTVARRHFAEGWENKKEVEVFPLAKNYTFWLAARLFVSLEDSVEIA  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L DP  ++++G+ S+PL+FPGT + +A+K  + +R +L ++IK+RK      + GK   
Sbjct  200   KLGDPFAVLASGIISMPLDFPGTPFYKAIKASNFIREELTKIIKQRKIDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L + DE G H+ E +I   I+G+L+  + + SA  TF++K+LAELPHIY +
Sbjct  257   T-QDILSHMLLLCDEHGSHMKEHDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDE  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+E+  +K P + L+W+D+QKMKYSWNVA E LRL PP QG FRE ++DF + GFT
Sbjct  316   VYKEQMEVLSAKAPGDLLNWDDLQKMKYSWNVAQEVLRLAPPLQGAFREALSDFVFNGFT  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN  YF EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  376   IPKGWKLYWSANSTHKNAAYFPEPFKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EILVFMHN+V  FK EK++P+E+IV +   P+P  GLPVRL PH
Sbjct  436   EILVFMHNLVKRFKWEKVLPDEQIVVDPL-PMPAKGLPVRLFPH  478



>ref|XP_002309057.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
 gb|EEE92580.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
Length=484

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 332/463 (72%), Gaps = 17/463 (4%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  301
             Y+++  N    NLPPG+TG P+IGE+++ +       PEK+I DRM K+S +VFKTS+  
Sbjct  31    YYLSSLN----NLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTSLFC  86

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIF  481
             E  AVFCGAAGNKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R      F
Sbjct  87    EPTAVFCGAAGNKFLFSNENKLVTAWWPDSVNK--IFPSSQQTSSQEESKKMRKLFPLFF  144

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
             K E+L+ YI  +D +A+ H+A +W   +EV V+ L+K YTF LAC+LFLS+ED +EV++ 
Sbjct  145   KPESLQRYISVMDVIAQRHLASDWEGKQEVSVFPLAKTYTFWLACRLFLSMEDPEEVQKF  204

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
               P   ++ G+ S+P++ P T +NR +K  ++V ++L+++IK+RK     N     +D  
Sbjct  205   AKPFNDLAAGIISIPIDLPWTPFNRGVKASNVVHKELLKIIKQRKIDLAENKASPTQD--  262

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
               +L  +L+  D+ GQ + + +I   I+G+L+  + + SAAITF++K+LAELPH+Y ++ 
Sbjct  263   --ILSHMLTTADDNGQCMKKIDIADKILGLLVGGHDTASAAITFIVKYLAELPHVYNKLL  320

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
             +EQ EIAK+K P E L+WEDIQ+M+YSWNVACE +R+ PP QG FRE +T+F YAGFTIP
Sbjct  321   EEQREIAKTKTPGELLNWEDIQRMRYSWNVACEVMRVAPPLQGAFREAMTEFNYAGFTIP  380

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEI  1381
             KGWK +W+  +THKNP+ F EP+ FDPSR+EGNGPAP+TFVPFGGGPRMCPGKEYARLEI
Sbjct  381   KGWKLYWSANTTHKNPECFPEPENFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEI  440

Query  1382  LVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LVF+HN+V  F+ EKL+P E+I+ +   PIP  GLP+RL PH+
Sbjct  441   LVFLHNLVKKFRWEKLLPKERIIVDPM-PIPSKGLPIRLHPHE  482



>gb|EYU25770.1| hypothetical protein MIMGU_mgv1a005482mg [Erythranthe guttata]
Length=482

 Score =   481 bits (1239),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 238/451 (53%), Positives = 321/451 (71%), Gaps = 13/451 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPV+GE+++ +       PEK+I DR+ KYS  VF+T +LGEK AVFCGA GN
Sbjct  38    LPPGKTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSTVFRTHLLGEKAAVFCGAGGN  97

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   FK E L+ Y+  +
Sbjct  98    KFLFSNENKLVQAWWPSSVDK--VFPSSNQTSSKEEAIKMRKMLPNFFKPEALQRYVGIM  155

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D +A+ H A+ W    EV V+ L+K YTF LAC+LF+S+ED   V    +P  L+++G+ 
Sbjct  156   DHIARRHFADGWENKSEVVVFPLAKNYTFWLACRLFVSVEDPHLVDEFAEPFNLLASGLI  215

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P++ PGT +N+A+K  + +R++L+ +IK+RK      + GK     +D+L  +L   D
Sbjct  216   SIPVDLPGTPFNKAIKASNFIRKKLITIIKQRKVDL---AEGKASPT-QDILSHMLLTCD  271

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G+ ++E +I   I+G+L+  + + S+A  F++K+LAELP IY  VYKEQ+EIAKSK  
Sbjct  272   ESGKFMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDGVYKEQMEIAKSKKE  331

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L+W+DIQKMKYSWNVACE LRL PP QG FRE ++DF Y GF+IPKGWK +W+  ST
Sbjct  332   GELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMYNGFSIPKGWKIYWSANST  391

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             H NP+ F +P KFDPSR++G+GPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V  FK
Sbjct  392   HINPECFPDPKKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFK  451

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              EK++P+EKIV N   PIP  GLPVRL PH+
Sbjct  452   FEKMIPDEKIVVNPM-PIPAKGLPVRLFPHK  481



>emb|CBI39253.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 245/469 (52%), Positives = 326/469 (70%), Gaps = 38/469 (8%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             +I F+     S   LPPG  G P+IGE+I+  +      P+ +I+DRM +YSP+VF+TS+
Sbjct  20    LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT--DAQNTLRKITILN-RTN  466
             +GE +AV CGAAGNKF F+NEN L+ +WWP+SV K L FP+  D  ++     ++N ++ 
Sbjct  80    MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSVYKVLYFPSPNDKDSSGAADLMMNMKSY  139

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             + E  K + L+ YIP +DSMA+EHI  +WAP REVKV+ L + YTFALAC+LF+ I+  +
Sbjct  140   LIEFVKPDALQQYIPVMDSMAREHIDMDWAPNREVKVFQLVQKYTFALACRLFMYIQGEE  199

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + ++  P  L+  G  S+P++ PGT +NR  KG S V                      
Sbjct  200   NIAKIAHPFHLIVQGFMSVPIDLPGTGFNRE-KGVSKV----------------------  236

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                   D+L R+L   DE+G+HLN+ EI  Y++G+LL ++ +TS+AITF LK+LA  P +
Sbjct  237   -----PDLLSRMLLSPDEKGRHLNDIEINSYMVGLLLASHDTTSSAITFTLKYLALFPDV  291

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             + +V KEQ+EIA+SKGP E L+W DIQKMKY+W VA E++RL PP QG FRE  TDFT+A
Sbjct  292   HNKVLKEQMEIAQSKGPGELLNWSDIQKMKYTWCVARESMRLAPPAQGAFREATTDFTFA  351

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
             GFTIPKGWKT W V+STHKNPKYF  P+KFDPSR+EG GP P+TFVPFGGGPRMC GKEY
Sbjct  352   GFTIPKGWKTHWCVHSTHKNPKYFPNPEKFDPSRFEGKGPEPYTFVPFGGGPRMCVGKEY  411

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ARLEILVF+HNVVT FK+E ++ NEKI++   S +P  GLP+RL PHQN
Sbjct  412   ARLEILVFIHNVVTKFKLETVLENEKILF-GLSALPAKGLPIRLQPHQN  459



>emb|CAN67939.1| hypothetical protein VITISV_013692 [Vitis vinifera]
Length=484

 Score =   481 bits (1237),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 239/467 (51%), Positives = 326/467 (70%), Gaps = 12/467 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG+ GWP+IGE ++  +      P ++++DRM KYSP+VFKTS
Sbjct  20    IVFLITYRHKSSNPNLPPGTMGWPIIGETLEFSLACQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+    TL        T + 
Sbjct  80    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLP  139

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             E  K E L+HY+ T+DSMA EHI   W+  REV V+ L++ Y+FALA +LF+SI+D + V
Sbjct  140   EFLKPEALQHYLATMDSMASEHIELNWSSNREVLVFPLARKYSFALAFRLFMSIDDPEYV  199

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             + +  P  +++ G  S+P++ PGT +NRA+K    +  +L+ +I  RK K  +   G + 
Sbjct  200   EMISHPFQILNEGFLSVPIDIPGTTFNRALKASKFIHNELLAII--RKXKMELEQKGDLA  257

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                RD+L  +L  +DE     +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y 
Sbjct  258   T--RDLLSHMLLASDENCDVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  315

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+EIAKSKGP   L W+DIQKMKY+WNVA E +RL PP QG FRE +TD TYAGF
Sbjct  316   KVLKEQMEIAKSKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGF  375

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIP+GWK  WNV +TH++PKYF +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR
Sbjct  376   TIPRGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  435

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ++L F+H+VVT FK EK+ P EK+ YN  SPIP  G P+RL P QN
Sbjct  436   AQVLAFIHHVVTRFKWEKVDPCEKVAYN-PSPIPSKGFPIRLQPLQN  481



>sp|I7C6E8.1|C7A52_PANGI RecName: Full=Beta-amyrin 28-oxidase; AltName: Full=Cytochrome 
P450 CYP716A52v2 [Panax ginseng]
 gb|AFO63032.1| cytochrome P450 CYP716A52v2 [Panax ginseng]
Length=481

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 317/452 (70%), Gaps = 15/452 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWP+IGE+ + +       PEK+I DRM KYS  VFKTSI GE  AVFCGAA N
Sbjct  37    LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAACN  96

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   FK E L+ YI  +
Sbjct  97    KFLFSNENKLVQAWWPDSVNK--VFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYIGLM  154

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D +A  H    W    EV V+ L+K YTF +ACK+F+S+E+  +V  LL+P   +++G+ 
Sbjct  155   DQIAANHFESGWENKNEVVVFPLAKSYTFWIACKVFVSVEEPAQVAELLEPFSAIASGII  214

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG-RDVLGRLLSVT  874
             S+P++ PGT +N A+K   +VRR+LV +IK+RK       LG+ +    +D+L  +L  +
Sbjct  215   SVPIDLPGTPFNSAIKSSKIVRRKLVGIIKQRKI-----DLGEGKASATQDILSHMLLTS  269

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+ + E +I   I+G+L+  + + S+A TFV+KFLAELP IY+ VY+EQ+EI KSK 
Sbjct  270   DESGKFMGEGDIADKILGLLIGGHDTASSACTFVVKFLAELPQIYEGVYQEQMEIVKSKK  329

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L WEDIQKMKYSWNVACE LRL PP QG FRE ++DFTY GF+IPKGWK +W+  S
Sbjct  330   AGELLKWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANS  389

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH N + F EP KFDPSR++G GP PF+FVPFGGGPRMCPGKEYARLEILVFMH++V  F
Sbjct  390   THINSEVFPEPLKFDPSRFDGAGPPPFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRF  449

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K EK++P+EKIV N   PIP NGLPVRL PH+
Sbjct  450   KWEKVIPDEKIVVNPM-PIPANGLPVRLFPHK  480



>emb|CBI39268.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/467 (51%), Positives = 325/467 (70%), Gaps = 12/467 (3%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG+ GWP+IGE ++  +      P ++++DRM KYSP+VFKTS
Sbjct  20    IVFLITYRHKSSYPNLPPGTMGWPIIGETLEFALSCQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +L   +AV CG +GNKF F+NE+ L+ +WW +S+ K L FP+    TL        T + 
Sbjct  80    LLEANMAVMCGPSGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLP  139

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             E  K E L+HYI T+DSMA EHI   W+P REV V+ L++ Y+FALA +LF+SI+D + V
Sbjct  140   EFLKPEALQHYIATMDSMASEHIELNWSPNREVLVFPLARKYSFALAFRLFMSIDDPEYV  199

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
             + +  P  +++ G  S+P++ PGT +N A+K    +  +L+ +I++RK    M    K +
Sbjct  200   EMISHPFQILNEGFLSVPIDIPGTTFNWALKASKFIHNELLAIIRKRK----MELEQKGD  255

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                RD+L  +L  +DE     +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y 
Sbjct  256   SAARDLLSHMLLASDENCYVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  315

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ EIAKSKGP   L W+DIQKMKY+WNVA E +RL PP QG FRE +TD TYAGF
Sbjct  316   KVLKEQKEIAKSKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGF  375

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIP+GWK  WNV +TH++PKYF +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR
Sbjct  376   TIPRGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  435

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ++L F+H+VVT FK EK+ P EK+ YN  SPIP  G P+RL P QN
Sbjct  436   AQVLAFIHHVVTRFKWEKVDPCEKVAYN-PSPIPSKGFPIRLQPLQN  481



>gb|EYU26567.1| hypothetical protein MIMGU_mgv1a005379mg [Erythranthe guttata]
Length=486

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/455 (52%), Positives = 318/455 (70%), Gaps = 19/455 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +LPPG TGWPVIGE+++ +       PEK++ DRM KYS +VF+T +LGEK AVFCGA G
Sbjct  41    SLPPGKTGWPVIGESLEFLSTGWKGHPEKFVFDRMAKYSSQVFRTHLLGEKAAVFCGANG  100

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+ +WWP SV K  +FP+  Q + ++  I  R  +    K E L+ YI T
Sbjct  101   NKFLFSNENKLVQSWWPVSVNK--VFPSSTQTSSKEEAIRMRKMLPNFLKPEALRRYIGT  158

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A+ H  ++W   +E+ V+ L+K YTF LAC++FLS+ED   V R  DP   +++G+
Sbjct  159   MDRIAQRHFTDQWENKKEIIVFDLAKSYTFWLACRVFLSVEDPKHVARFADPFNALASGL  218

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG---RDVLGRLL  865
               +P++ P T +NRA+K    +R++LV +I+ RK +         E E    +D+L  +L
Sbjct  219   IGIPVDLPWTPFNRAIKASKYIRKELVLIIRRRKIEL-------AEGEALPSQDILSHML  271

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
                DE+G+ ++E EI   I+G+L+  + + S+  T ++K+LAELP IY  VY EQ+EIA 
Sbjct  272   VTGDEDGKFMDEMEIADKILGLLVGGHDTASSTCTLIVKYLAELPEIYVGVYNEQMEIAN  331

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
              K P E L+W+DIQKMKYSWNVACE LRL PP QG FRE + DF Y GF+IPKGWK +W+
Sbjct  332   GKTPGELLNWDDIQKMKYSWNVACEVLRLSPPLQGAFREALADFVYNGFSIPKGWKIYWS  391

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
               STH+NP+ F EP+K DPSR+EG GPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V
Sbjct  392   ASSTHRNPEIFPEPEKLDPSRFEGTGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLV  451

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
               F+ EK++P+EKIV N   PIP  GLPVRL PH+
Sbjct  452   KRFRCEKIIPDEKIVVNPM-PIPAKGLPVRLYPHK  485



>ref|XP_004503562.1| PREDICTED: cytochrome P450 716B2-like [Cicer arietinum]
Length=478

 Score =   479 bits (1232),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 329/463 (71%), Gaps = 13/463 (3%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  301
             +F+   + S  NLPPG  G+PVIGE+++ +       PEK+I DRM KYS E+FKTSILG
Sbjct  22    FFLFYKHKSPWNLPPGKMGYPVIGESLEFLSTGWKGHPEKFIFDRMIKYSSELFKTSILG  81

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIF  481
             +   V CGAA NKF F+NEN L+T WWP+SV K  +FPT  Q   ++ ++  R  I +  
Sbjct  82    QPTVVCCGAACNKFLFSNENKLVTVWWPESVIK--IFPTSLQTNFKEESLKMRKLIPQFL  139

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
             K E L+ Y+  +DS+A++H A  W    EV VY L+K YTF LAC+LF+S+ED + V + 
Sbjct  140   KPEALQRYVGIMDSIAQKHFASLWENKTEVTVYPLAKRYTFLLACRLFMSVEDENHVAKF  199

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
              DP  L++ G+ SLP++ PGT +N+A+K  + ++++L+++I++RK    M+    V    
Sbjct  200   SDPFHLLAAGIISLPIDLPGTPFNKAIKASNFIKKELLKIIRQRK----MDLAKGVASAT  255

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
             +D+L  +L   +E G+ ++E +I   I+G+L+  + + S A TF++K+LA+LPHIY  V+
Sbjct  256   QDILSHMLLTCNENGEFMSELDIADKILGLLIGGHDTASVACTFIVKYLADLPHIYDTVF  315

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
             +EQ+EIAKSK   E L+W+D++KM+YSWNVACE +R+ PP QGGFRE +TDF + GF+IP
Sbjct  316   QEQMEIAKSKSQGELLNWDDLKKMRYSWNVACEVMRVAPPLQGGFREAITDFMFNGFSIP  375

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEI  1381
             KGWK +W+  STHKNP+ F  P+KFDP+R+EGNGP P+T+VPF GGPRMCPGKEYARLEI
Sbjct  376   KGWKLYWSANSTHKNPECFPMPEKFDPTRFEGNGPPPYTYVPFDGGPRMCPGKEYARLEI  435

Query  1382  LVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LVFMHN+V  FK EKL+P+E+IV +   PIP   LP+RL PH 
Sbjct  436   LVFMHNLVKRFKWEKLIPDEEIVVDPF-PIPAKDLPIRLYPHD  477



>dbj|BAP59949.1| cytochrome P450 monooxygenase CYP716A48 [Olea europaea]
Length=479

 Score =   478 bits (1230),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 328/464 (71%), Gaps = 15/464 (3%)
 Frame = +2

Query  137   IYFITKANTSK--PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             ++F+   N S     +PPG TGWPVIGE+++ +       PEK+I DR+ KYS  VF+T 
Sbjct  20    LHFLFYKNKSSFSGQIPPGKTGWPVIGESLEFLSNGWKGHPEKFIFDRIAKYSSYVFRTH  79

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             + GE  AVFCGA GNKF F+NEN L+  WWP SV K  +FP+  Q + ++  +  R  + 
Sbjct  80    LFGEPAAVFCGANGNKFLFSNENKLVQAWWPASVDK--VFPSSNQTSSKEEAVKMRKMLP  137

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
               FK E L+ Y+  +D +A+ H ++ W    EV V+ L+K YTF LAC+LF+S+ED   V
Sbjct  138   TFFKPEALQRYVGIMDHIAQRHFSDGWDNKNEVVVFPLAKRYTFWLACRLFVSVEDPAHV  197

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              +  DP   +++G+ S+P++ PGT ++RA+K  + +R++LV +IK+RK      + GK  
Sbjct  198   AKFADPFNELASGLISIPIDLPGTPFHRAIKSSNFIRKELVSIIKQRKIDL---AEGKAS  254

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                +D+L  +L  +DE G+ ++E +I   I+G+L+  + + S+A TFV+K+LAELP IY+
Sbjct  255   PT-QDILSHMLLTSDESGKFMHELDIADKILGLLVGGHDTASSACTFVVKYLAELPEIYE  313

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
              VY+EQ+EIAKSK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE +TDF + GF
Sbjct  314   GVYQEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREAITDFMFNGF  373

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  STH+N ++F EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYAR
Sbjct  374   SIPKGWKLYWSANSTHRNSEFFPEPLKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYAR  433

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             LEILVFMH++V  FK EKL+P+EKIV +   PIP  GLP+RL P
Sbjct  434   LEILVFMHHLVKRFKWEKLIPDEKIVVDPM-PIPAKGLPIRLYP  476



>gb|AED99868.1| cytochrome P450 [Panax notoginseng]
Length=481

 Score =   478 bits (1229),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 316/452 (70%), Gaps = 15/452 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWP+IGE+ + +       PEK+I DRM KYS  VFKTSI GE  AVFCGA  N
Sbjct  37    LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAXCN  96

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   FK E L+ YI  +
Sbjct  97    KFLFSNENKLVQAWWPDSVNK--VFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRYIGLM  154

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D +A +H    W    EV V+ L+K YTF +ACK+F+S+E+  +V  LL+P   +++G+ 
Sbjct  155   DQIAAKHFESGWENKDEVVVFPLAKSYTFWIACKVFVSVEEPAQVAELLEPFSAIASGII  214

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE-GRDVLGRLLSVT  874
             S+P++ PGT +N A+K   +VRR+LV +I +RK       LG+ +    +D+L  +L  +
Sbjct  215   SVPIDLPGTPFNSAIKSSKIVRRKLVGIINQRKI-----DLGEGKASPTQDILSHMLLTS  269

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+ + E EI   I+G+L+  + + S+A TFV+KFLAELP IY  VY+EQ+EI KSK 
Sbjct  270   DESGKFMGEGEIADKILGLLIGGHDTASSACTFVVKFLAELPQIYXGVYQEQMEIVKSKK  329

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L WEDIQKMKYSWNVACE LRL PP QG FRE ++DFTY GF+IPKGWK +W+  S
Sbjct  330   AGELLKWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANS  389

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+N + F EP KFDPSR++G GP PF+FVPFGGGPRMCPGKEYARLEILVFMH++V  F
Sbjct  390   THRNSEVFPEPLKFDPSRFDGAGPPPFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRF  449

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K EK++P+EKIV N   PIP NGLPVRL PH+
Sbjct  450   KWEKVIPDEKIVVNPM-PIPANGLPVRLFPHK  480



>gb|AHF22088.1| CYP716A75 [Maesa lanceolata]
Length=487

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 237/456 (52%), Positives = 322/456 (71%), Gaps = 13/456 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKV  310
             T+AN +  NLPPG TGWPV+GE+   +       PEK+I DR+ KYS  V+KT+++ E+ 
Sbjct  34    TEANKNSANLPPGLTGWPVVGESFQFLAAGWRGNPEKFIFDRIAKYSSYVYKTNLMLERT  93

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AVFCGA  +KF F+NEN L+ +WWP SV K  +FP+  Q + ++  +  R  +   FK E
Sbjct  94    AVFCGAPAHKFLFSNENKLVQSWWPSSVNK--IFPSSNQTSSKEEAMKMRKMLPNFFKPE  151

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D++A+ H A +W     + V+ L K YTF LACK+F+SIED  +V R L  
Sbjct  152   ALQGYIGIMDTIAQRHFAADWDNKDYIVVFPLCKRYTFWLACKIFMSIEDPKDVDRFLAR  211

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               LV+ G+ S+P++ PGT ++ ++K    +R  LV +IK+RK      + GK     +D+
Sbjct  212   FNLVAEGLLSIPIDLPGTPFHHSIKAAEFIREHLVAIIKQRKIDL---AEGKASPT-QDI  267

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             +  +L   DE+G+ + E++I   I+G+L+  + + S+A  F++K+LAELP +YQ VYKEQ
Sbjct  268   MSYMLLTPDEDGKFMKEYDIADKILGLLVGGHDTASSACAFIVKYLAELPQVYQGVYKEQ  327

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIAKSKGP E L+W+DIQKMKYSWNVACE LRL PP QG FR+ + DF Y GF IPKGW
Sbjct  328   MEIAKSKGPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFRDVLKDFMYEGFYIPKGW  387

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+ +STHKNP+YF EP KFDPSR++G+GPAP+TFVPFGGGPRMCPGKEYARLEILVF
Sbjct  388   KVYWSAHSTHKNPEYFPEPYKFDPSRFDGSGPAPYTFVPFGGGPRMCPGKEYARLEILVF  447

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             MHN+V  F+ EKL+P+EKIV N   P+P  GLP+RL
Sbjct  448   MHNLVKRFRWEKLIPDEKIVVNPM-PVPEKGLPIRL  482



>gb|EYU26566.1| hypothetical protein MIMGU_mgv1a021994mg [Erythranthe guttata]
Length=469

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 317/451 (70%), Gaps = 25/451 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG TGWPVIGE+++ +       PEK+I DRM KYS  +F+T +LGE+ AV CGAAG
Sbjct  32    TLPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMAKYSIHIFRTHLLGEQAAVLCGAAG  91

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+  WWP SV K  +FP+ AQ++ ++  I  R  +   FK E L  Y+  
Sbjct  92    NKFLFSNENKLVQAWWPSSVDK--IFPSSAQSSSKEEAIKMRKMLPNFFKPEALHRYVGV  149

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A+ H ++ W    EV V+ L+K YTF LAC+LF+SIED   V++  +P  L++ G+
Sbjct  150   MDHIAQRHFSDGWENRDEVVVFPLAKNYTFWLACRLFVSIEDPSHVEKFAEPFNLLAAGL  209

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              S+P++ PG             R +LV++IK+RK      + GK     +D+L  +L  +
Sbjct  210   ISIPVDLPGR------------RSELVKIIKQRKVDL---AEGKASPT-QDILSHMLLAS  253

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+ + E +I   I+G+L+  + + S+A TF++K+LAELP IY  VYKEQ+EIAK+KG
Sbjct  254   DENGKFMQELDIADKILGLLIGGHDTASSACTFIVKYLAELPEIYDGVYKEQMEIAKTKG  313

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+WED+QKMKYSWNVACE LRL PP QG FRE + DF Y GF+IPKGWK +W+  S
Sbjct  314   PGELLNWEDLQKMKYSWNVACEVLRLAPPLQGAFREAIADFAYNGFSIPKGWKLYWSANS  373

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             THKNP++F EP KFDPSR+EG+GPAP+TFVPFGGGPRMCPGKEYARLEILVFMH++V  F
Sbjct  374   THKNPEFFPEPQKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRF  433

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             K EK++P+EKIV +   PIP  GLPVRL PH
Sbjct  434   KWEKVIPDEKIVVDPM-PIPAKGLPVRLYPH  463



>emb|CDP14237.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   476 bits (1225),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 237/464 (51%), Positives = 329/464 (71%), Gaps = 14/464 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  298
             ++F +K+ +S   LPPG +GWPVIGE+ + +       PEK+I DR+ KYS  VF+T +L
Sbjct  23    LFFKSKSGSSG-RLPPGKSGWPVIGESYEFLSTGWKGYPEKFILDRIAKYSSNVFRTHLL  81

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK AVFCGAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++  I  R  +   
Sbjct  82    GEKAAVFCGAAGNKFLFSNENKLVQAWWPDSVNK--VFPSSTQTSSKEEAIKMRKMLPNF  139

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D +A  H +  W    +V+V+ L K YTF +A +LF+S+E+  EV +
Sbjct  140   LKPEALQRYIGIMDHIAGRHFSSGWENKDQVEVFPLCKNYTFWIASRLFVSVEEPTEVAK  199

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             LL+P  ++++G+ S+P++ PGT +N+A+K  + +R+ LV +IK+R+      + GK    
Sbjct  200   LLEPFNVLASGLISVPVDLPGTPFNKAIKASNEIRKMLVSIIKQRQIDL---ADGKASPT  256

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D++  +L+ +DE G+ + E ++   I+G+L+  + + S+A TF++K+LAELP IY+ V
Sbjct  257   -QDIMSHMLTTSDENGKFMQELDVADKILGLLIGGHDTASSACTFIVKYLAELPEIYEGV  315

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EIA SK P E L+WEDIQKMKYSWNVACE LRL PP QG FRE + DF + GF+I
Sbjct  316   YKEQMEIANSKAPGELLNWEDIQKMKYSWNVACEVLRLAPPLQGAFREALNDFMFNGFSI  375

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  STH+NP+ F EP KFDP+R+ G+GPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  376   PKGWKIYWSANSTHRNPECFPEPLKFDPTRFVGSGPAPYTFVPFGGGPRMCPGKEYARLE  435

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMH+VV  FK EK++ +EKIV +   PIP  GLPVRL PH+
Sbjct  436   ILVFMHHVVKRFKWEKIIADEKIVVDPM-PIPAKGLPVRLYPHR  478



>ref|XP_010095208.1| Cytochrome P450 [Morus notabilis]
 gb|EXB58669.1| Cytochrome P450 [Morus notabilis]
Length=490

 Score =   476 bits (1226),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 329/463 (71%), Gaps = 13/463 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  +++ S  NLPPG  G+PVIGE ++ +       PEK+I DRM K+S EVFKTS+
Sbjct  25    VVFYKHRSHYSGANLPPGKIGYPVIGETMEFLSTGWRGHPEKFIFDRMTKFSTEVFKTSL  84

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             +GE  AVFCGAA NKF F+NEN L+T WWP SV K  +FP+  Q + +      R  +  
Sbjct  85    VGEPAAVFCGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSMQTSSQDEAKKMRKLLPG  142

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D++A+ H A +W     +  + L+K YTF LA KLF+S++D  E++
Sbjct  143   FMKPEALQRYIGVMDTIAQRHFAADWDNHNHILTFPLAKRYTFWLAAKLFVSLDDPKEIR  202

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  +P  L+++G+ S+P++FPGT ++RA+K  + +R++L+++IK+RK      + GK   
Sbjct  203   KFEEPFQLLASGIISMPIDFPGTPFHRAIKASNFIRKELLKIIKQRKIDL---AEGKASP  259

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L    ++GQ++NE +I   I+G+L+  + + SAA TF++K+LAELPHIY  
Sbjct  260   T-QDILSHMLLTCTDDGQYMNELDIADKILGLLVGGHDTASAACTFIVKYLAELPHIYDA  318

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK   E L+W+D+QKMKYSWNVA E LRL PP QG FRE +TDF + GF+
Sbjct  319   VYQEQMEIAKSKAEGELLNWDDVQKMKYSWNVAQEVLRLAPPLQGAFREAMTDFVFNGFS  378

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKNP YF EP+KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  379   IPKGWKLYWSANSTHKNPSYFPEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPGKEYARL  438

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EILVFMHN+V  +K EK++P E I+ +   P+P  GLPVRL P
Sbjct  439   EILVFMHNLVKRYKWEKILPEENIIVDPM-PMPAKGLPVRLFP  480



>ref|XP_009778451.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=483

 Score =   471 bits (1212),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 326/467 (70%), Gaps = 16/467 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++YF  K++     LPPG TGWPVIGE ++ +       PEK+I DRM KYS  VFKT +
Sbjct  24    LLYF-NKSSVLAGTLPPGKTGWPVIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFKTHL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTD-AQN-TLRKITILNRTNI  469
             L EK AVFCGA GNKF F+NEN L+  WWP S+ K  +FP++  QN ++ +  I  R  +
Sbjct  83    LMEKSAVFCGATGNKFLFSNENKLVQVWWPNSIKK--IFPSNLTQNFSINEQGIKIRRLL  140

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                 K E L+ Y+  +D +A+ H A  W    +V+VY L+K YTF LAC+LF+SIED   
Sbjct  141   PNFLKPEALQRYVGIMDKIAQRHFATCWENKGQVQVYPLAKSYTFWLACRLFVSIEDPQH  200

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V     P  +++ G+ S+P++ PGTAYNR++K  +++R++L+ +IK+RK      + GK 
Sbjct  201   VAEFAKPFSVLAAGLISIPIDLPGTAYNRSIKASNLIRKELLRIIKQRKIDL---AEGKA  257

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
                 +D+L  +L  +DE G+ +++ EI   I+G+L+  + + S+A T ++KFLAELP +Y
Sbjct  258   SPT-QDILSHMLLTSDESGKFIHDLEIASNILGLLVGGHDTASSACTSIVKFLAELPQVY  316

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
             + VY EQ+EIAKSK   E L+W D++KMKYSWNVACE LRL PP QG FRE ++D  + G
Sbjct  317   EAVYNEQMEIAKSKSAGELLTWYDLRKMKYSWNVACEVLRLAPPLQGAFREAISDLNFNG  376

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             F+IPKGWK +W+  +TH+NP+ F EP KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYA
Sbjct  377   FSIPKGWKLYWSSNTTHRNPECFPEPMKFDPSRFEGRGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             RLEILVFMH++V  FK +K++PNEKI+ +   P+P NG PV+L PHQ
Sbjct  437   RLEILVFMHHLVKRFKWQKIIPNEKIIVDPM-PVPANGFPVKLYPHQ  482



>ref|XP_006488697.1| PREDICTED: cytochrome P450 716B2-like [Citrus sinensis]
Length=534

 Score =   473 bits (1217),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/454 (52%), Positives = 321/454 (71%), Gaps = 13/454 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  84    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  143

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++     R  +    K E L  Y+  +
Sbjct  144   KFLFSNENKLVQAWWPDSVNK--IFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMM  201

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             DS+A++H    W   ++V V+AL+K +TF++ACK+FLSIED   V +L  P   +++G+ 
Sbjct  202   DSIAQKHFESGWEGKQQVTVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGII  261

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDVLGRLLS  868
             S+P++ PGT +NRA+K    +R++L+ +IK+RK +   A  +S        +D+L  +L 
Sbjct  262   SVPIDLPGTPFNRAIKASKFIRKELMAIIKQRKTELAAAAASSTTTAHHRHQDILSHMLL  321

Query  869   VTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1048
              TDE GQH++E ++   I+G+L+  + + SAAITF++KFLA LPHIY QV  EQ+EIAK 
Sbjct  322   ATDENGQHMSELDVADKILGLLIGGHDTASAAITFIVKFLAGLPHIYNQVLNEQMEIAKR  381

Query  1049  KGPNERL-SWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             KG  E+L +WEDIQKMKYSWNVACE +RL PP QG FRE + DF ++GFTIPKGWK +W+
Sbjct  382   KGEGEQLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWS  441

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
             V STH+NP+ F EP+KFDP+R++G GPAP+T+VPFGGGPRMCPGKEYARLEILVF+HN+V
Sbjct  442   VNSTHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIV  501

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
               F   +++P+EKI+ +   P+P +GLPVRL PH
Sbjct  502   RRFSWLQILPHEKIIVDPL-PMPAHGLPVRLFPH  534



>gb|KDO67048.1| hypothetical protein CISIN_1g037867mg [Citrus sinensis]
Length=495

 Score =   471 bits (1213),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 320/453 (71%), Gaps = 13/453 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  45    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  104

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++     R  +    K E L  Y+  +
Sbjct  105   KFLFSNENKLVQAWWPDSVNK--IFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMM  162

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             DS+A++H    W   ++V V+AL+K +TF++ACK+FLSIED   V +L  P   +++G+ 
Sbjct  163   DSIAQKHFESGWEGKQQVAVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGII  222

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDVLGRLLS  868
             S+P++ PGT +NRA+K    +R++L+ +IK+RK +   A  +S        +D+L  +L 
Sbjct  223   SVPIDLPGTPFNRAIKASKFIRKELIAIIKQRKTELAAAAASSTTPAHHHHQDILSHMLL  282

Query  869   VTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1048
              TDE GQH++E ++   I+G+L+  + + SAAITF++KFLA LPHIY QV  EQ+EIAK 
Sbjct  283   ATDENGQHMSELDVADKILGLLIGGHDTASAAITFIVKFLAGLPHIYNQVLNEQMEIAKR  342

Query  1049  KGPNERL-SWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             KG  E+L +WEDIQKMKYSWNVACE +RL PP QG FRE + DF ++GFTIPKGWK +W+
Sbjct  343   KGEGEQLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWS  402

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
             V STH+NP+ F EP+KFDP+R++G GPAP+T+VPFGGGPRMCPGKEYARLEILVF+HN+V
Sbjct  403   VNSTHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIV  462

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
               F   +++P+EKI+ +   P+P +GLPVRL P
Sbjct  463   RRFSWLQILPHEKIIVDPL-PMPAHGLPVRLFP  494



>gb|KHN16705.1| Cytochrome P450 716B2 [Glycine soja]
Length=472

 Score =   470 bits (1210),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 225/465 (48%), Positives = 326/465 (70%), Gaps = 23/465 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE   +F     NK            WWP SV K  +FPT   +  ++ +   R  + +
Sbjct  84    LGEPKFLFSNE--NKLVAA--------WWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  131

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIED + V 
Sbjct  132   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  191

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  +P  L+++G+ S+P++ PGT +N+A+K  + +R++L+++I++RK      + GK   
Sbjct  192   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKASP  248

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  249   T-QDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  307

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAK K P E L+W+D+ +M+YSWNVACE +R+ PP QGGFRE + DF + GF+
Sbjct  308   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  367

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+P+YF EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  368   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  427

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK +KL+P+EKI+ +   PIP   LP+RL PH+
Sbjct  428   EILVFMHNLVKRFKWQKLIPDEKIIVDPL-PIPAKNLPIRLHPHK  471



>ref|XP_007139495.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
 gb|ESW11489.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
Length=481

 Score =   470 bits (1210),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 232/465 (50%), Positives = 328/465 (71%), Gaps = 14/465 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++   A +S PNLPPG+ G+PVIGE+I+ +       PEK+I +RM KYS +VFKTS+ 
Sbjct  23    LFYSHHAQSSHPNLPPGNMGFPVIGESIEFLSLGWKGHPEKFIYERMAKYSSKVFKTSLF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GEK  +FCGAA NKF F+NEN L+ +WWP SV K  +FP+  + + +      R  + + 
Sbjct  83    GEKTVMFCGAACNKFLFSNENKLVVSWWPDSVNK--VFPSSLETSSKVEAKKLRQMLPQF  140

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
                + L+ Y+  +D++A+ H A EW     V V+ L+K YTF +AC+LFL+++D   V  
Sbjct  141   LSAQALQGYVGIMDTVAQRHFASEWENNTSVIVFPLAKSYTFWVACRLFLNVDDPIHVAN  200

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L +   ++  G+ S+P++ PGT +N+A+K   +++ +L+++I++RK + + N    V   
Sbjct  201   LAESFNVIVPGIMSVPIDLPGTPFNKAIKASVVIKEKLLKIIRQRK-EDLANGTASVT--  257

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP-HIYQQ  1015
              +D+L  +LS  DE GQ++ +  I   I+G+L+  + + S+A TFV+K+LAELP +IY  
Sbjct  258   -QDILSHMLSSCDENGQYMADRYIADKILGLLIGGHDTASSACTFVVKYLAELPPNIYDN  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAKSK P E L+W+DIQKMKYSWNVACE +RL PP QG FRE + DF + GF+
Sbjct  317   VYQEQMEIAKSKAPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGAFREAMNDFMFNGFS  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +WN  STH+NP+ F EP+KFDPSR+EG GPAP+TFVPFGGGPRMCPGKEYAR+
Sbjct  377   IPKGWKLYWNASSTHRNPECFPEPEKFDPSRFEGTGPAPYTFVPFGGGPRMCPGKEYARM  436

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK E ++PNEK++ +   P+P  GLPVRL PHQ
Sbjct  437   EILVFMHNLVKRFKWEAIIPNEKVIIDPL-PVPAKGLPVRLYPHQ  480



>ref|XP_006425177.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
 gb|ESR38417.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
Length=495

 Score =   470 bits (1209),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 321/453 (71%), Gaps = 13/453 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKT+ILGE   V CGA  N
Sbjct  45    LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTAILGEPTVVVCGAIAN  104

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K  +FP+  Q + ++     R  +    K E L  Y+  +
Sbjct  105   KFLFSNENKLVQAWWPDSVNK--IFPSSTQTSSKEEAKKMRKLLPNFLKPEALMRYVGMM  162

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             DS+A++H    W   ++V V+AL+K +TF++ACK+FLSIED   V +L  P   +++G+ 
Sbjct  163   DSIAQKHFESGWEGKQQVTVFALAKRFTFSVACKVFLSIEDSQHVAKLAVPFDALASGII  222

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDVLGRLLS  868
             S+P++ PGT +NRA+K    +R++L+ +IK+RK +   A  +S        +D+L  +L 
Sbjct  223   SVPIDLPGTPFNRAIKASKFIRKELIAIIKQRKTELAAAAASSTTPAHHHHQDILSHMLL  282

Query  869   VTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1048
              TDE GQH++E ++   I+G+L+  + + SAAITF++K+LAELPHIY+QV  EQ+EIAK 
Sbjct  283   ATDENGQHMSELDVADKILGLLIGGHDTASAAITFIVKYLAELPHIYKQVLNEQMEIAKR  342

Query  1049  KGPNERL-SWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             KG  E+L +WEDIQKMKYSWNVACE +RL PP QG FRE + DF ++GFTIPKGWK +W+
Sbjct  343   KGEGEKLLNWEDIQKMKYSWNVACEVMRLAPPLQGSFREALNDFVFSGFTIPKGWKLYWS  402

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
             V STH+NP+ F EP+KFDP+R++G GPAP+T+VPFGGGPRMCPGKEYARLEILVF+HN+V
Sbjct  403   VNSTHRNPECFVEPEKFDPTRFQGRGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIV  462

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
               F   +++P+EKI+ +   P+P +GLPVRL P
Sbjct  463   RRFSWLQILPHEKIIVDPL-PMPAHGLPVRLFP  494



>ref|XP_006353795.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=486

 Score =   469 bits (1207),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 319/470 (68%), Gaps = 22/470 (5%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  301
             YF   ++     LPPG TGWP IGE ++ +       PEK+I DRM KYS  VF+T +L 
Sbjct  24    YFNKNSSVLPGTLPPGKTGWPFIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFRTHLLL  83

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDA-QNTLRKITILNRTNIH--  472
             E  AVFCGA+GNKF F+NEN L+  WWP S+ K  +FP+   QNT  K T +N   I   
Sbjct  84    ENSAVFCGASGNKFLFSNENKLVQVWWPDSINK--IFPSSVDQNT--KTTSINEQGIRMR  139

Query  473   ----EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                   FK E L+ Y+  +DS+A+ H    W    +V+VY L+K YTF LAC+LF+SIED
Sbjct  140   RLLPNFFKPEALQRYVGIMDSIAQRHFESFWEKKSQVQVYPLAKSYTFWLACRLFVSIED  199

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
                V +   P  +++ G+ S+P+N PGT+YNR++K  +++R++L+ +IK+RK        
Sbjct  200   PKHVAKFAKPFDVLAAGLISIPINLPGTSYNRSIKASNLIRKELLMIIKQRKVDLCEGKA  259

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
                +D    +L  +L  +DE G+ + + +I   I+G+L+  + + S+A T ++K+LAELP
Sbjct  260   SATQD----ILSHMLLTSDENGKFMPDLDIACKILGLLVGGHDTASSACTSIVKYLAELP  315

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
             H+YQ VY EQ+EI+KSK   E L+W+D+QKMKYSWNV CE LRL PP QG FRE + DF 
Sbjct  316   HVYQAVYNEQMEISKSKAAGELLTWDDLQKMKYSWNVVCEVLRLAPPLQGAFREAIVDFI  375

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGK  1360
             + GF+IPKGWK +WN  +TH+NP+YF EP  FDPSR+EG+GPAP+TFVPFGGGPRMCPGK
Sbjct  376   FNGFSIPKGWKLYWNSNTTHRNPEYFPEPLNFDPSRFEGSGPAPYTFVPFGGGPRMCPGK  435

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EYARLEILVFMH++V  FK  K++ +EKI+ +   P+P  GLP++L PHQ
Sbjct  436   EYARLEILVFMHHIVKRFKWNKVIHDEKIIIDPM-PVPAKGLPIKLYPHQ  484



>emb|CBI39252.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/413 (57%), Positives = 307/413 (74%), Gaps = 10/413 (2%)
 Frame = +2

Query  272   PEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITI  451
             P+VF+TS++GE +AV CGA+GNKF F+NE+ L+T+WWP  + K L FP+     L   + 
Sbjct  24    PKVFRTSLMGENMAVMCGASGNKFLFSNEDKLVTSWWPNLIKKILYFPS----LLNDAST  79

Query  452   LNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLS  631
              + T  H    L+ LK Y+  +D MA +HI  +WAP ++VKVY LSK YTFAL+C+LFL 
Sbjct  80    RDLTKPHRAL-LQFLKQYVEIMDLMAHKHIDMDWAPNKKVKVYLLSKKYTFALSCRLFLK  138

Query  632   IEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMM  811
             IED + V R+ +    +  G  SLP++ PGT +NRA+K  +++ ++L+E+IK+RK +   
Sbjct  139   IEDSEWVARISNDFDHIMAGFISLPIDIPGTTFNRAIKAKNILHKELIEIIKKRKKELT-  197

Query  812   NSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLA  991
                 K +   +D+L  +L V DE G+ LNE EI  YI+G+LL ++ +TS AITFVLK+L+
Sbjct  198   ---EKRDLAAQDLLSHMLLVPDENGKVLNEMEISTYILGVLLASHETTSTAITFVLKYLS  254

Query  992   ELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVT  1171
             E P +Y  V KEQ+EIAKSKGP E L+W DIQ MK+SWNVA E++RL PPG GGFRE +T
Sbjct  255   EFPDVYDAVLKEQMEIAKSKGPEEFLNWNDIQNMKHSWNVARESMRLSPPGIGGFREALT  314

Query  1172  DFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMC  1351
             DFTY GFT+PKGWKT W V+STHKNP+YF +P+KFDPSR+EG GP P+TFVPFGGGP MC
Sbjct  315   DFTYEGFTVPKGWKTHWTVHSTHKNPEYFPDPEKFDPSRFEGEGPVPYTFVPFGGGPHMC  374

Query  1352  PGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              GKEYARLE+LVFM+NVV+ FK+EK+VPNEKI YN  SPIP NGLP+RL PH+
Sbjct  375   HGKEYARLELLVFMYNVVSRFKLEKVVPNEKITYN-PSPIPANGLPMRLQPHK  426



>dbj|BAP59952.1| cytochrome P450 monooxygenase CYP716A51 [Lotus japonicus]
Length=481

 Score =   468 bits (1205),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 322/456 (71%), Gaps = 13/456 (3%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + PNLPPG  G+PVIGE+++ +       PEK+I DRM KY   +FKTSI+GE   VFCG
Sbjct  33    TAPNLPPGRMGFPVIGESLEFLSTGWNGHPEKFIFDRMTKYCSHIFKTSIVGEPAVVFCG  92

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
              A NKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  + +  K + L+ Y
Sbjct  93    PACNKFLFSNENKLVTAWWPNSVNK--VFPSSLQTSSKEESKKMRKMLPQFLKPQALQRY  150

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             +  +D +A+ H    W    EV VY L+K YTF LA +LF+SIED   V +L D   L++
Sbjct  151   VGIMDDIAQRHFESHWENKTEVTVYPLTKRYTFLLASRLFMSIEDDTHVAKLRDTFHLLA  210

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
             +G+ S+P++ PGT + +A+   +++R++L+++I++RK    +N  GK     +D+L  +L
Sbjct  211   SGIISVPVDLPGTPFRKAINASNVIRKELLKIIRQRKVD--LNE-GKASPT-QDILSHML  266

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
                +E GQ +NE +I   I+G+L+  + + SA  TF++K+LAELPHIY +VY EQ+EIAK
Sbjct  267   LTCNESGQFMNELDIADKILGLLIGGHDTASATCTFIVKYLAELPHIYDKVYHEQMEIAK  326

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
              K P E L+W+D+ KM+YSWNVACE +R+ PP QGGFRE + DF + GF+IPKGWK +W+
Sbjct  327   LKSPGELLNWDDVNKMRYSWNVACEVMRVAPPLQGGFREALHDFMFNGFSIPKGWKLYWS  386

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
               STHK+P+YF EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARLEILVFMHN+V
Sbjct  387   ANSTHKSPEYFPEPEKFDPTRFEGEGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNLV  446

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
               FK EKL+P+E+I+ +   PIP   LPVRL PH++
Sbjct  447   KRFKWEKLIPDERIIVDPL-PIPAKDLPVRLFPHKS  481



>ref|XP_004296643.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   466 bits (1198),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 236/467 (51%), Positives = 326/467 (70%), Gaps = 15/467 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
              +++  ++  +  NLPPG  G+PVIGE+ + +       PEK+I DRM K+S EVFKTS+
Sbjct  23    FLFYRHRSQFTGNNLPPGKVGYPVIGESYEFLSTGWKGHPEKFIFDRMNKFSSEVFKTSL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQN--TLRKITILNRTNI  469
              GEK  +F GAA NKF F+NEN L+T WWP SV K  +FP+  ++  + ++     R  +
Sbjct  83    FGEKACIFAGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSVEDNSSAKEEAKKMRKML  140

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                   + L+ YI  +D++A+ H A  W   +EV +Y L+K YTF LA +LF+S+ED ++
Sbjct  141   PNFMNPQALQRYIGIMDTIAQRHFALGWENKKEVVIYPLAKNYTFWLAARLFVSVEDPED  200

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V RL DP  L+++G+ S+P++ PGTA+N+A+K  + +R +L ++IK+RK      + GK 
Sbjct  201   VDRLGDPFQLLASGLLSMPIDLPGTAFNKAIKASNWIRGELYKIIKQRKIDL---AEGKA  257

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
                 +D+L  +L ++DEEG H+ E +I   I+G+L+  + + SA  TF++K+L ELPHIY
Sbjct  258   SPT-QDILSHMLLLSDEEGAHMKEMDIADKILGLLIGGHDTASATCTFIVKYLGELPHIY  316

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
               VYKEQ+EIA SK P E L+W+D+QKMKYSWNVA E LR+ PP QG FRE + DF + G
Sbjct  317   DAVYKEQMEIANSKPPGELLNWDDLQKMKYSWNVAQEVLRVAPPLQGAFREALQDFVFNG  376

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             FTIPKGWK +W+  STHKN   F EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYA
Sbjct  377   FTIPKGWKLYWSANSTHKNAAVFPEPYKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             RLEILVFMHN+V  FK E ++P+EK+V +   P+P  GLPVRL PH+
Sbjct  437   RLEILVFMHNLVKRFKWEAVIPDEKVVIDPM-PMPEKGLPVRLFPHK  482



>ref|XP_002279492.2| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=445

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 310/446 (70%), Gaps = 11/446 (2%)
 Frame = +2

Query  194   GWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP+IGE ++  +      P ++++DRM KYSP+VFKTS+L   +AV CG +GNKF F+N
Sbjct  2     GWPIIGETLEFALSCQGGNPGRFLNDRMNKYSPQVFKTSLLEANMAVMCGPSGNKFLFSN  61

Query  356   entllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKE  535
             E+ L+ +WW +S+ K L FP+    TL        T + E  K E L+HYI T+DSMA E
Sbjct  62    EDKLVVSWWQRSMKKILCFPSVFNETLTGDKFRPPTFLPEFLKPEALQHYIATMDSMASE  121

Query  536   HIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNF  715
             HI   W+P REV V+ L++ Y+FALA +LF+SI+D + V+ +  P  +++ G  S+P++ 
Sbjct  122   HIELNWSPNREVLVFPLARKYSFALAFRLFMSIDDPEYVEMISHPFQILNEGFLSVPIDI  181

Query  716   PGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHL  895
             PGT +N A+K    +  +L+ +I++RK    M    K +   RD+L  +L  +DE     
Sbjct  182   PGTTFNWALKASKFIHNELLAIIRKRK----MELEQKGDSAARDLLSHMLLASDENCYVK  237

Query  896   NEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSW  1075
             +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y +V KEQ EIAKSKGP   L W
Sbjct  238   SEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYSKVLKEQKEIAKSKGPEGFLKW  297

Query  1076  EDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKY  1255
             +DIQKMKY+WNVA E +RL PP QG FRE +TD TYAGFTIP+GWK  WNV +TH++PKY
Sbjct  298   DDIQKMKYTWNVANETMRLTPPVQGTFREAITDITYAGFTIPRGWKMHWNVNTTHRDPKY  357

Query  1256  FSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVP  1435
             F +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR ++L F+H+VVT FK EK+ P
Sbjct  358   FPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYARAQVLAFIHHVVTRFKWEKVDP  417

Query  1436  NEKIVYNSASPIPVNGLPVRLTPHQN  1513
              EK+ YN  SPIP  G P+RL P QN
Sbjct  418   CEKVAYN-PSPIPSKGFPIRLQPLQN  442



>ref|XP_011017728.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/452 (51%), Positives = 312/452 (69%), Gaps = 13/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG  G P +GE++D +       PE +I D ++KYS E FKT++  + V +  G AG
Sbjct  33    NLPPGHLGLPFVGESLDFLSKGWKGCPENFIFDHIRKYSSETFKTNLFLQPVVILNGVAG  92

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+ TWWP+ V K  +FP+  + + ++     R       K + L+ YI T
Sbjct  93    NKFLFSNENRLVETWWPEFVNK--IFPSAVETSPKEEAKRMRRLFPLFLKPDALRRYIGT  150

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D + + H A +W    EV V+ L+K YTF LAC+LFLSIED   + R   P   +S+G+
Sbjct  151   MDIVTRRHFALQWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHISSGI  210

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
             F++P++FPGT +NRA+K   ++R +L+ +I++RK      + GK     +D+L  +L   
Sbjct  211   FTIPIDFPGTPFNRAIKAAKLIRIELLAIIRQRKKDL---AEGKASPT-QDILSHMLLSN  266

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             D +GQ++NE EI   II +LL  + ST  A TF++K+LAE+PHIY+ VYKEQ EI KSK 
Sbjct  267   DADGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEIIKSKA  326

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+W+DIQ MKYSWNVACE LRL PP  G F+E + DFT+ GF IPKGWK +W+  S
Sbjct  327   PGELLNWDDIQNMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKLYWSASS  386

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+NP+YFSEP+KFDPSR+EG GPAP+TF+PFGGGPRMCPG EYARLEILVFMHN+V  F
Sbjct  387   THRNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMHNLVKRF  446

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K +KL+ +EKIV++  +P P  GLPVRL PH+
Sbjct  447   KFDKLILDEKIVFD-PTPKPEMGLPVRLLPHK  477



>gb|AFK79029.1| cytochrome P450 CYP716A41 [Bupleurum chinense]
Length=482

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 317/455 (70%), Gaps = 13/455 (3%)
 Frame = +2

Query  164   SKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             S  +LPPG TG+ +IGE+++ +       PEK+I DRM KY+ ++FK+S+ GEK  VFCG
Sbjct  34    SYKSLPPGETGYFLIGESLEFLSTGRKGHPEKFIFDRMTKYASKIFKSSLFGEKTIVFCG  93

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHY  505
             AA NKF F++EN L+ +WWP SV K  +FP+  Q + ++  I  R  +   FK E L+ Y
Sbjct  94    AANNKFLFSDENKLVQSWWPNSVNK--LFPSSTQTSSKEEAIKMRKMLPNFFKPEALQRY  151

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             +  +D +A++H    W     V V  L+K +TF LAC+LF+S+ED  +V +  +P  L++
Sbjct  152   VGVMDEIAQKHFDSCWENKHTVIVAPLTKRFTFWLACRLFVSLEDPTQVAKFAEPFNLLA  211

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
             +G+FS+P++ PGTA+NRA+K  + +R+ L+ +IK+RK      +    +D    +L  +L
Sbjct  212   SGVFSIPIDLPGTAFNRAIKASNFIRKTLIGIIKKRKVDLEDGTASATQD----ILSHML  267

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
               +DE G+ + E +I   I+G+L+  + + S+A   ++K+LAELPHIY  VY+EQ+EIAK
Sbjct  268   LTSDETGKFMTEADIADKILGLLIGGHDTASSACALIVKYLAELPHIYDGVYREQMEIAK  327

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             SK P E L+W+D+QKMKYSWNVACE LRL PP QG FRE ++DF + GF+IPKGWK +W+
Sbjct  328   SKSPGELLNWDDVQKMKYSWNVACEVLRLAPPLQGSFREVLSDFMHNGFSIPKGWKIYWS  387

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVV  1405
               STHK+ +YF EP+KFDP R+EG+GPAP+TFVPFGGGPRMCPGKEY RLEILVFMH++V
Sbjct  388   ANSTHKSSEYFPEPEKFDPRRFEGSGPAPYTFVPFGGGPRMCPGKEYGRLEILVFMHHLV  447

Query  1406  TNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
               F+ +K+ P EKI  N   P P   LP+RL PH+
Sbjct  448   KRFRWQKIYPLEKITVNPM-PFPDKDLPIRLFPHK  481



>ref|XP_002324669.1| hypothetical protein POPTR_0018s13390g [Populus trichocarpa]
 gb|EEF03234.1| hypothetical protein POPTR_0018s13390g [Populus trichocarpa]
Length=484

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 318/458 (69%), Gaps = 19/458 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N+PPG+ G P +GE++D +       PE +I DR++KYS E+FKT++  + V +  G AG
Sbjct  33    NVPPGNLGLPFVGESLDFLSKGWKGCPENFIFDRIRKYSSEIFKTNLFLQPVVMLNGVAG  92

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+ TWWP  V +  +FP+  + + ++     R       K E L+ YI T
Sbjct  93    NKFLFSNENRLVETWWPDFVNR--IFPSAVETSPKEEAKRMRRLFPRFLKPEALQRYIGT  150

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D + K H A EW    EV V+ L+K YTF LAC+LFLSIED   + R   P   +++G+
Sbjct  151   MDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNQITSGI  210

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
             F++P++FPGT +NRA+K   ++R +L+ +I++RK      + GK     +D+L  +L   
Sbjct  211   FTIPIDFPGTPFNRAIKASKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHMLLSN  266

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             D +G+++NE +I   I+ +L+  + ST+A+ TF++K+LAELPHIY+ VYKEQ EI KSK 
Sbjct  267   DADGKYMNEVQISDKILALLMGGHESTAASCTFIVKYLAELPHIYEAVYKEQAEIIKSKA  326

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKT------  1216
             P E L+W+DIQKMKYSWNVACE LRL PP  G F+E + DFT+ GF+IPKGWK       
Sbjct  327   PGELLNWDDIQKMKYSWNVACETLRLSPPLIGNFKEAIKDFTFNGFSIPKGWKASHFLTL  386

Query  1217  FWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMH  1396
             +W+  STHKNP+YFSEP+KFDPSR+EG GPAP+TF+PFGGGPRMCPG EYARLEILVFMH
Sbjct  387   YWSASSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMH  446

Query  1397  NVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             N+V  FK E+L+ +EKIV++  +P P  GLPVRL PH+
Sbjct  447   NLVKRFKFERLILDEKIVFD-PTPKPEMGLPVRLLPHK  483



>emb|CDP19704.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   457 bits (1177),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 230/462 (50%), Positives = 314/462 (68%), Gaps = 19/462 (4%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVA  313
             YFI ++   K  LPPG++ +P++GE +   +  PEK+I  RMKKYS EVF TS++G+ +A
Sbjct  37    YFIHESKKYK--LPPGASRFPLVGETLHFFLSGPEKFIHHRMKKYSDEVFATSLVGQNMA  94

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFP--TDAQNTLRKITILNRTNIHE--IF  481
             V CGAAGNKF     N  ++ W P S+   LMF    D+    RK         H+  I 
Sbjct  95    VICGAAGNKFLLCTANDFVSPWLPDSL---LMFFNWVDSPGKSRKDVFSKIRGFHQAVIM  151

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
             + E LK YIP +DS+ ++H+  +W PF+ VKV+  S+  T ALACKL L +E  ++ +R 
Sbjct  152   RPEALKKYIPIMDSLTRQHLKTDWDPFQVVKVHPASRKITLALACKLVLGLEP-EQTQRF  210

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
              D   +   G+FSLP+N PGT YNRA+K    ++++ + +I +RK   + N     E  G
Sbjct  211   SDSFTVSLQGLFSLPINLPGTTYNRALKEIEKLKQEFLNIILKRKKMVLENG----EKAG  266

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
              D+L R  ++ DE    L++ EI  Y++ +++P+Y STSAAITFVLK+LAELPHIY  VY
Sbjct  267   SDILSR--TLLDENAHLLSDLEIALYLVSLMMPSYESTSAAITFVLKYLAELPHIYDMVY  324

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
             KEQ+EIAKSK P E L+WED++KMKYSWNV CEA+RL PP  G FRE  TD  +AG TIP
Sbjct  325   KEQMEIAKSKDPEELLNWEDVKKMKYSWNVICEAMRLTPPAVGAFREAETDIHFAGVTIP  384

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEI  1381
             KGWK  W+ ++T+KNPKYF EP+ FDP+R+EG+ P P TF+PF  GPRMCPGKEY+R  I
Sbjct  385   KGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDEPTPCTFIPFSTGPRMCPGKEYSRFLI  444

Query  1382  LVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             LV+MHNVV  +K++KL+P+EK++Y+   P P +GLP+RL PH
Sbjct  445   LVYMHNVVRKYKLQKLIPDEKVLYH-GGPYPASGLPMRLQPH  485



>ref|XP_004139087.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus]
 gb|KGN66615.1| hypothetical protein Csa_1G649550 [Cucumis sativus]
Length=483

 Score =   457 bits (1176),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 230/460 (50%), Positives = 313/460 (68%), Gaps = 15/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  S PN PPG+ G P++GE+++ +       PEK+I DR+ KY  +VFKTSI+G   A
Sbjct  28    KSLFSYPNTPPGAIGLPILGESVEFLSSGWKGHPEKFIFDRLNKYKSDVFKTSIVGVPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             +FCG   NKF F+NEN L+T WWP SV K  +FP+  Q + ++     +  + +  K E 
Sbjct  88    IFCGPICNKFLFSNENKLVTPWWPDSVNK--IFPSTTQTSTKEEAKKLKKLLPQFLKPEA  145

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             L+ YI  +D +A+ H    W    EV V+ L+K +TF++AC+LF+S+ED   V+RL  P 
Sbjct  146   LQRYIGIMDELAERHFNSFWKNREEVLVFPLAKSFTFSIACRLFMSVEDEIHVERLSGPF  205

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK-AMMNSLGKVEDEGRDV  850
               ++ G+ S+P++ PGT +NRA+K    +R+++V ++++RK   A   +L       +D+
Sbjct  206   EHIAAGIISMPIDLPGTPFNRAIKASKFIRKEVVAIVRQRKQDLAEGKALAT-----QDI  260

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L   DE G ++NE +I   I+G+L+  + + S A TF++KFLAELPHIY  VY EQ
Sbjct  261   LSHMLLTCDENGVYMNESDITDKILGLLIGGHDTASVACTFIVKFLAELPHIYDAVYTEQ  320

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIA++K   E L WEDI+KMKYSWNVACE LR+  P QG FRE ++DF + GF IPKGW
Sbjct  321   MEIARAKAEGETLKWEDIKKMKYSWNVACEVLRIASPLQGAFREALSDFVFNGFFIPKGW  380

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  STHKNP+YF EP KFDP R+EGNGP P+TFVPFGGGPRMCPGKEYA+LEILVF
Sbjct  381   KLYWSANSTHKNPEYFPEPYKFDPGRFEGNGPLPYTFVPFGGGPRMCPGKEYAKLEILVF  440

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHN+V  FK  KL+ NE I+ N   PIP  GLPVRL PHQ
Sbjct  441   MHNLVKRFKWTKLLENENIIVNPM-PIPQKGLPVRLFPHQ  479



>gb|KCW72929.1| hypothetical protein EUGRSUZ_E01368, partial [Eucalyptus grandis]
Length=441

 Score =   455 bits (1171),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 319/469 (68%), Gaps = 58/469 (12%)
 Frame = +2

Query  194   GWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWPV+GE ++ M       PE++++DR  +YS +VF+T++ GE +AVFCGA+GNK     
Sbjct  1     GWPVVGETLEYMAAGRGGCPERFMNDRATRYSSDVFRTNLYGEDMAVFCGASGNK-----  55

Query  356   entllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKE  535
                              +F  D +  L +     R+ + E  K E L+HYIP ++++ ++
Sbjct  56    ----------------FLFSGDNKYKLDRKK--KRSFLLEFLKPEALQHYIPVMETVTRD  97

Query  536   HIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNF  715
             H+A +W+P ++V+V+ LSK YTFALAC+LF++I D + V +  +    V+ G  +LP+N 
Sbjct  98    HLAMDWSPHKKVQVFPLSKSYTFALACRLFMNIRDPEIVSKFANSFARVAPGFVALPINI  157

Query  716   PGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHL  895
             PGT +NRAM+ G ++R++L+ +I+ RK   M  + GK +    D+L RLL   D++G   
Sbjct  158   PGTPFNRAMEAGKVMRQELLNIIRRRK---MEIAEGK-DANATDLLSRLLLEGDDDGSVF  213

Query  896   NEFEIYHYIIGILLPTYHSTSAAITFVLKFLAE-----------------LP--HIYQQV  1018
              E ++ + I+G+L+ ++ +TS +IT V+ +LA                  LP   +Y Q 
Sbjct  214   YEMDVANKIMGLLIASHDTTSTSITAVVNYLARGFIKVMNFEFDFANTPGLPVKSVYSQQ  273

Query  1019  YK-----EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             Y      EQ+EIAKSKGP+E L+WED+QKMKYSWNVACE++RL PP QG +RE +T+FT+
Sbjct  274   YTCLMSIEQMEIAKSKGPDEFLNWEDVQKMKYSWNVACESIRLLPPAQGAYREAMTNFTF  333

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKE  1363
             AG+TIPKGWKTFW V+STHKNPKYF +P+KFDPSR+EGNGPAPFTFVPFGGGPRMCPGKE
Sbjct  334   AGYTIPKGWKTFWTVHSTHKNPKYFPDPEKFDPSRFEGNGPAPFTFVPFGGGPRMCPGKE  393

Query  1364  YARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             YARLEIL+FMHN+V  FK+EK++ +EK +YN  SP+PV GL +RL PH+
Sbjct  394   YARLEILIFMHNLVNKFKLEKVILDEKFIYN-PSPVPVEGLRIRLLPHK  441



>gb|KDP43440.1| hypothetical protein JCGZ_16727 [Jatropha curcas]
Length=462

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/451 (49%), Positives = 317/451 (70%), Gaps = 30/451 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TG P +GE+++ +       PEK+I +RM KYS ++F+TSILGE+ A+ CG  GN
Sbjct  34    LPPGKTGLPYVGESLEFLSTGRKGHPEKFILERMTKYSCQIFRTSILGEQTAILCGPQGN  93

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+T WWP+SV K  +FP+  Q+T+    I  R  +    K E L+ YI  +
Sbjct  94    KFLFSNENKLVTAWWPKSVLK--LFPSSQQSTISAEGIRIRKMLPMFLKPEALQRYIGVM  151

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             DS+A+EH  ++W                  +ACK+FLS+ED+++V +   P   +++G+ 
Sbjct  152   DSIAREHFQDKWE-----------------VACKVFLSLEDKEQVAKFATPFNDMASGII  194

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P++ PGT+++R MK   ++R++++ +I+ R+ +   N    ++D    +L  +L  TD
Sbjct  195   SIPVDLPGTSFHRGMKASKVIRKEMLGMIERRRKEIAENKASPMQD----ILSHMLVATD  250

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E+G+ L +  I   II +L+  + + SA+ITFV+K L+ELP IY++V KEQ+EIA SK P
Sbjct  251   EDGKRLGDIGIADKIISLLIGGHDTASASITFVVKVLSELPEIYKKVLKEQMEIANSKAP  310

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L+WEDIQKMKYSWNVACE +R+ PP QG FRE + DF YAGF+IPKGWK +W+ +ST
Sbjct  311   GELLNWEDIQKMKYSWNVACEVMRIAPPLQGSFREALYDFNYAGFSIPKGWKLYWSTHST  370

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HKNP+YF EP+KFDPSR+EG+GPAP+T+VPFGGGPRMCPGKEYARLEILVF+HN+V  FK
Sbjct  371   HKNPEYFPEPEKFDPSRFEGSGPAPYTYVPFGGGPRMCPGKEYARLEILVFIHNIVKRFK  430

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              EK++P+EKI+ +   P+P  GLP+ L PH+
Sbjct  431   WEKMLPDEKIIVDPI-PMPAKGLPIYLYPHK  460



>gb|AHF22083.1| CYP716A14v2 [Artemisia annua]
Length=474

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 229/451 (51%), Positives = 316/451 (70%), Gaps = 25/451 (6%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPVIGE ++ +       PEK+I DRM ++SP VFKTS++ E  AVFCG+AGN
Sbjct  38    LPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFKTSLMLEDAAVFCGSAGN  97

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K L     A+ T  +  +L+R+     F+ E+L+ Y+P +
Sbjct  98    KFLFSNENKLVKAWWPASVEKIL---PSAKETTNQRKMLSRS-----FRPESLRQYVPVM  149

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D MA+ H   EW    ++  + +++ +TF+LACK+F+SIED +EVK L  P    + G+F
Sbjct  150   DMMAQRHFKTEWDGMDQIVTHEVTQNFTFSLACKIFVSIEDPEEVKHLSGPFEKFAPGIF  209

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P++ P T   RA+  G+ +R++++ +IK+RK      + GK     +D+L ++L   D
Sbjct  210   SIPIDLPWTPLRRAIHAGNFIRKEIIAIIKQRKIDL---ADGKASPT-QDILSQML--CD  263

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             EE Q++ E +I   IIG+L+  + + S+   F++KFLA+LP IY+ V KEQ+EIAKSK P
Sbjct  264   EESQNIAEADIADVIIGLLIGGHDNASSTCAFIVKFLADLPEIYEGVLKEQLEIAKSKAP  323

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L+WED+ KMKYSWNVACE LRL PP QG FRE +TDF Y G++IPKGWK +W+  ST
Sbjct  324   GELLNWEDLSKMKYSWNVACEVLRLAPPLQGSFREAMTDFVYNGYSIPKGWKLYWSALST  383

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HKNP+ F+EP K DPSR++G GPAP+TFVPFGGGP MCPG+EYARLEILVFMH++V  +K
Sbjct  384   HKNPEVFTEPQKLDPSRFDGKGPAPYTFVPFGGGPHMCPGREYARLEILVFMHHLVIKYK  443

Query  1418  MEKLVPNEKIVYNSASPIP--VNGLPVRLTP  1504
              EK++PNE+I+ N   P+P    GLP+RL P
Sbjct  444   WEKVIPNEQIIVN---PMPKLAKGLPLRLYP  471



>ref|XP_008443638.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Cucumis melo]
Length=483

 Score =   456 bits (1172),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 312/460 (68%), Gaps = 15/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             K+  S PN PPG+ G P++GE+++ +       PEK+I DR+ KY  +VFKTSI+G   A
Sbjct  28    KSLFSYPNTPPGAIGLPILGESLEFLSSGWRGHPEKFIFDRLNKYKSDVFKTSIVGVPAA  87

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             +FCG   NKF F+NEN L+T WWP SV K  +FP+  Q + ++     +  + +  K E 
Sbjct  88    IFCGPICNKFLFSNENKLVTPWWPDSVNK--IFPSTTQTSSKEEAKKLKKLLPQFLKPEA  145

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             L+ YI  +D +A+ H    W    EV V+ L+K +TF+LAC+LF+S+ED   V+RL  P 
Sbjct  146   LQRYIGIMDELAERHFNSFWKNREEVLVFPLAKSFTFSLACRLFMSVEDEIHVERLSGPF  205

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK-AMMNSLGKVEDEGRDV  850
               ++ G+ S+P++ PGT +NRA+K    +R+++V ++++RK   A   +L       +D+
Sbjct  206   EHIAAGIISMPIDLPGTPFNRAIKASKFIRKEVVAIVRQRKQDLAEGKALAT-----QDI  260

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L   DE G ++NE +I   I+G+L+  + + S A TF++KFLAELPHIY  VY EQ
Sbjct  261   LSHMLLTCDENGVYMNESDITDKILGLLIGGHDTASVACTFIVKFLAELPHIYDAVYTEQ  320

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIA++K   E L WEDI+KMKYSWNVACE LRL  P QG FRE + DF + GF IPKGW
Sbjct  321   MEIARAKAEGETLKWEDIKKMKYSWNVACEVLRLASPLQGAFREALNDFVFNGFFIPKGW  380

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  STHKNP+YF EP KF+P R+EGNGP P+TFVPFGGGPRMCPGKEYA+LEILVF
Sbjct  381   KLYWSANSTHKNPEYFPEPYKFEPGRFEGNGPLPYTFVPFGGGPRMCPGKEYAKLEILVF  440

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHN+V  FK  KL+ NE I+ N   PIP  GLPVRL PHQ
Sbjct  441   MHNLVKRFKWTKLLENENIIVNPM-PIPQKGLPVRLFPHQ  479



>gb|EYU25767.1| hypothetical protein MIMGU_mgv1a025883mg [Erythranthe guttata]
Length=462

 Score =   455 bits (1170),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 225/460 (49%), Positives = 314/460 (68%), Gaps = 12/460 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  310
             + A  +   LPPG+TGWP++GE++  +       PEK++ DR+ KYS  VFKT ++GEK 
Sbjct  8     SSAAAAGGPLPPGNTGWPLVGESLHFLWAGCKGHPEKFVLDRVAKYSSTVFKTHLVGEKA  67

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV  GA+GNKF F+NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K E
Sbjct  68    AVLSGASGNKFLFSNENKLVRAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLKTE  125

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D MA++H  E W    EV V  L+K YTF LAC+LF S+ED  +V RL  P
Sbjct  126   ALRRYIGKMDRMAQKHFEEGWENKNEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKP  185

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               L+++ +F++P++ PGT +N+ +K   +VR++L+ +IK+RK      + GK     +D+
Sbjct  186   FNLLASSLFAIPIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKASPT-QDI  241

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L  +DE G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ
Sbjct  242   LSHMLLTSDENGKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQ  301

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EI KSK P + L+WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+
Sbjct  302   MEILKSKAPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIVDFSYKGYSIPKGF  361

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  +THKNP+ F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVF
Sbjct  362   KLYWSATATHKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVF  421

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MH++V  FK EK++PN+        PIP  GLP+RL PH+
Sbjct  422   MHHLVKRFKFEKMIPNDGKFVVDPMPIPAKGLPIRLIPHE  461



>gb|EYU26851.1| hypothetical protein MIMGU_mgv1a005213mg [Erythranthe guttata]
Length=493

 Score =   456 bits (1173),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 309/461 (67%), Gaps = 12/461 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  310
             +   T+   LPPG  GWP++GE++  +       PEK++ DR+ KYS  VF+T ++GEK 
Sbjct  39    STTTTAAGPLPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSTVFRTHLVGEKA  98

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV  GA+GNKF F+NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K E
Sbjct  99    AVLSGASGNKFLFSNENKLVKAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLKTE  156

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D MA+ H  E W   +EV V  L+K YTF LAC+LF S+ED  +V RL  P
Sbjct  157   ALRRYIGKMDHMAQTHFEEGWENKKEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKP  216

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               L+++ +F++P++ PGT +++ +K   +VR++LV +IK+RK           +D    +
Sbjct  217   FNLLASSLFAIPIDLPGTPFSKGIKASKIVRQELVSIIKQRKIDLAQGKASPTQD----I  272

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L  +DE G  + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ
Sbjct  273   LSHMLLTSDENGNFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQ  332

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EI KSK P + L+WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+
Sbjct  333   MEILKSKSPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYSIPKGF  392

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  +THKNPK F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVF
Sbjct  393   KLYWSATATHKNPKIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVF  452

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             MH++V  FK EK++PN+        PIP  GLP+RL PHQN
Sbjct  453   MHHLVKRFKFEKVIPNDGKFVVDPMPIPAKGLPIRLFPHQN  493



>gb|ACU20818.1| unknown [Glycine max]
Length=445

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 215/428 (50%), Positives = 311/428 (73%), Gaps = 12/428 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++++  ++  + PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24    VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE   +FCGA  NKF F+NEN L+  WWP SV K  +FPT   +  ++ +   R  + +
Sbjct  84    LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNK--VFPTTLLSNSKQESKKMRKLLPQ  141

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC+LF+SIED + V 
Sbjct  142   FLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNHVA  201

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +  +P  L+++G+ S+P++ PGT +N+A+K  + +R++L+++I++RK      + GK   
Sbjct  202   KFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDL---AEGKASP  258

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE+GQ +NE +I   I+G+L+  + + SAAITF++K+LAELPHIY +
Sbjct  259   T-QDILSHMLLTCDEKGQFMNELDIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDR  317

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIAK K P E L+W+D+ +M+YSWNVACE +R+ PP QGGFRE + DF + GF+
Sbjct  318   VYQEQMEIAKLKSPGELLNWDDVNRMQYSWNVACEVMRIAPPLQGGFREAINDFIFDGFS  377

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+P+YF EP+KFDP+R+EG GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  378   IPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFEGQGPAPYTFVPFGGGPRMCPGKEYARL  437

Query  1376  EILVFMHN  1399
             EILVFM+N
Sbjct  438   EILVFMYN  445



>gb|KHM99864.1| Cytochrome P450 716B2 [Glycine soja]
Length=412

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/418 (52%), Positives = 302/418 (72%), Gaps = 7/418 (2%)
 Frame = +2

Query  257   MKKYSPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTL  436
             M +YS ++FKTSI GE   +FCGA  NKF F+NEN L+  WWP SV K  +FP+  Q+  
Sbjct  1     MIRYSSQLFKTSIFGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNK--VFPSTLQSNS  58

Query  437   RKITILNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALAC  616
             ++ +   R  + +  K E L+ Y+  +D++A+ H A  W    E+ VY L+K YTF LAC
Sbjct  59    KEESKKMRKLLPQFLKPEALQRYVGIMDTIAQNHFASLWDNKTELTVYPLAKRYTFLLAC  118

Query  617   KLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERK  796
             +LF+S+ED + V +  +P  L+++G+ S+P++ PGT +N+A+K  + +R++L+++I++RK
Sbjct  119   RLFMSVEDVNHVAKFENPFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRK  178

Query  797   AKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFV  976
                   + GK     +D+L  +L   +E GQ +NE +I   I+G+L+  + + SAA TF+
Sbjct  179   VDL---AEGKASPT-QDILSHMLLTCNENGQFMNELDIADKILGLLIGGHDTASAACTFI  234

Query  977   LKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGF  1156
             +K+LAELPHIY  VY+EQ+EIAKSK P E L+W+DI +MKYSWNVACE +R+ PP QGGF
Sbjct  235   VKYLAELPHIYDSVYQEQMEIAKSKLPGELLNWDDINRMKYSWNVACEVMRIAPPLQGGF  294

Query  1157  RETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGG  1336
             RE + DF + GF+IPKGWK +W+  STHKNP+YF EP+KFDP+R+EG GPAPFTFVPFGG
Sbjct  295   REAINDFIFNGFSIPKGWKLYWSANSTHKNPEYFPEPEKFDPTRFEGQGPAPFTFVPFGG  354

Query  1337  GPRMCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             GPRMCPGKEYARLEILVFMHN+V  FK EKL+P+EKI+ +   P+P   LP+RL PH+
Sbjct  355   GPRMCPGKEYARLEILVFMHNLVKRFKWEKLIPDEKIIVDPL-PVPAKNLPIRLHPHK  411



>gb|EYU25763.1| hypothetical protein MIMGU_mgv1a024885mg [Erythranthe guttata]
Length=461

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/451 (50%), Positives = 310/451 (69%), Gaps = 12/451 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG+TGWP++GE++  +       PEK++ DR+ KYS  VF+T ++GEK AV  GA+GN
Sbjct  16    LPPGNTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGEKAAVLSGASGN  75

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K E L+ YI  +
Sbjct  76    KFLFSNENKLVRAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLKTEALRRYIGKM  133

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D MA++H  E W    EV V  L+K YTF LAC+LF S+ED  +V RL  P  L+++ +F
Sbjct  134   DRMAQKHFEEGWENKNEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLF  193

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             ++P++ PGT +N+ +K   +VR++L+ +IK+RK      + GK     +D+L  +L  +D
Sbjct  194   AIPIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKASPT-QDILSHMLLTSD  249

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+EI KSK P
Sbjct  250   ENGKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMEILKSKAP  309

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              + L+WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G+ IPKG+K +W+  +T
Sbjct  310   GDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYFIPKGFKLYWSATAT  369

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HKNP+ F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVFMH++V  FK
Sbjct  370   HKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFK  429

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              EK+VPN+        PIP  GLP+RL PH+
Sbjct  430   FEKMVPNDGKFVVDPMPIPAKGLPIRLLPHE  460



>ref|XP_004296583.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   454 bits (1167),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 323/469 (69%), Gaps = 19/469 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
              +++  ++  +  NLPPG  G+PVIGE+ + +       PEK+I DRM K+S +VFKTS+
Sbjct  23    FLFYKHRSQFTGNNLPPGKVGYPVIGESYEFLSSGWKGHPEKFIFDRMNKFSSQVFKTSL  82

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT--LRKITILNRTNI  469
              GEK  +F GAA NKF F+NEN L+T WWP SV K  +FP+  ++    ++     R  +
Sbjct  83    FGEKACIFTGAACNKFLFSNENKLVTAWWPSSVNK--VFPSSVEDNSNAKEEAKKMRKML  140

Query  470   HEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDE  649
                   + L+ YI  +D++A+ H A  W   +EV +Y L+K YTF LA +LF+S+ED ++
Sbjct  141   PSFMNPQALQRYIGIMDTIAQRHFALGWENKKEVVIYPLAKNYTFWLAARLFVSLEDPED  200

Query  650   VKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKV  829
             V RL  P  L+++G+ S+P++ PGT +N+A+K  + +R +L ++IK+RK      + GK 
Sbjct  201   VDRLGGPFQLLASGIMSMPIDLPGTPFNKAIKASNWIRGELYKIIKQRKIDL---AEGKA  257

Query  830   EDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIY  1009
                 +D+L  +L ++DEEG H+ E +I   I+G+L+  + + SA  TF++K+L ELPHIY
Sbjct  258   SPT-QDILSHMLLLSDEEGTHMKEMDIADKILGLLIGGHDTASATCTFIVKYLGELPHIY  316

Query  1010  QQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAG  1189
               VYKEQ+EIA  K P E L+W+D+QKMKYSWNVA E LR+ PP QG FRE + DF + G
Sbjct  317   DAVYKEQMEIANLKAPGELLNWDDLQKMKYSWNVAQEVLRVAPPLQGAFREALQDFVFNG  376

Query  1190  FTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             FTIPKGWK +W+  STHKN   F EP KFDP+R+EGNGPAP+TFVPFGGGPRMCPGKEYA
Sbjct  377   FTIPKGWKLYWSANSTHKNAAVFPEPYKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYA  436

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPV--NGLPVRLTPHQ  1510
             RLEILVFMHN+V  FK E ++P+EK+V +   P+P+   GLPVRL PH+
Sbjct  437   RLEILVFMHNLVKRFKWEAVIPDEKVVID---PMPMLEKGLPVRLFPHK  482



>gb|EYU38301.1| hypothetical protein MIMGU_mgv1a005334mg [Erythranthe guttata]
Length=488

 Score =   452 bits (1164),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 223/452 (49%), Positives = 309/452 (68%), Gaps = 12/452 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG  GWP++GE++  +       PEK++ DRM KYS  VF+T ++GEK AVF  A+GN
Sbjct  43    LPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGCASGN  102

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  W+P  + +  +FP+  +++  +  I  R  +H   K E L+ YI  +
Sbjct  103   KFLFSNENKLVRVWFPSGIDR--IFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKM  160

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D MA+ H AE W    +V V  L+K YTF LAC+LF S+ED  +V RL  P  L+++ +F
Sbjct  161   DHMAQLHFAEGWENKTQVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLF  220

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             ++P++ PGT +N+ +K   +VR++LV +IK+RK      + GK     +D+L  +L  +D
Sbjct  221   AIPIDLPGTPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKASPT-QDILSHMLLTSD  276

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             E G+ + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P
Sbjct  277   ENGKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAP  336

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              + L+WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+K +W+  +T
Sbjct  337   GDSLNWEDLQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATAT  396

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HKNP+ F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVFMH++V  FK
Sbjct  397   HKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFK  456

Query  1418  MEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              EK++PN+        PIP  GLP+ L PHQN
Sbjct  457   FEKVIPNDGKFVVDPMPIPAKGLPIHLFPHQN  488



>gb|ABC94483.1| putative taxadiene 5-alpha-hydroxylase cytochrome P450 [Artemisia 
annua]
Length=474

 Score =   452 bits (1162),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 227/451 (50%), Positives = 314/451 (70%), Gaps = 25/451 (6%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  337
             LPPG TGWPVIGE ++ +       PEK+I DRM ++SP VFKTS++ E  AVFCG+AGN
Sbjct  38    LPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFKTSLMLEDAAVFCGSAGN  97

Query  338   KffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTI  517
             KF F+NEN L+  WWP SV K L     A+ T  +  +L+R+     F+ E+L+ Y+P +
Sbjct  98    KFLFSNENKLVKAWWPASVEKIL---PSAKETTNQRKMLSRS-----FRPESLRQYVPVM  149

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D MA+ H   EW    ++  + +++ +TF+LACK+F+SIED +EVK L  P    + G+F
Sbjct  150   DMMAQRHFKTEWDGMDQIVTHEVTQNFTFSLACKIFVSIEDPEEVKHLSGPFEKFAPGIF  209

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             S+P++ P T   RA+  G+ +R++++ +IK+RK      + GK     +D+L ++L   D
Sbjct  210   SIPIDLPWTPLRRAIHAGNFIRKEIIAIIKQRKIDL---ADGKASPT-QDILSQML--CD  263

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             EE Q++ E +    IIG+L+  + + S+   F++KFLA+LP IY+ V KEQ+EIAK K P
Sbjct  264   EESQNIAEADTADVIIGLLIGGHDNASSTCAFIVKFLADLPEIYEGVLKEQLEIAKFKAP  323

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
              E L+WED+ KMKYSWNVACE LRL PP QG FRE +TDF Y G++IPKGWK +W+  ST
Sbjct  324   GELLNWEDLSKMKYSWNVACEVLRLAPPLQGSFREAMTDFVYNGYSIPKGWKLYWSALST  383

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HKNP+ F+EP K DPSR++G GPAP+TFVPFGGGP MCPG+EYARLEILVFMH++V  +K
Sbjct  384   HKNPEVFTEPQKLDPSRFDGKGPAPYTFVPFGGGPHMCPGREYARLEILVFMHHLVIKYK  443

Query  1418  MEKLVPNEKIVYNSASPIP--VNGLPVRLTP  1504
              EK++PNE+I+ N   P+P    GLP+RL P
Sbjct  444   WEKVIPNEQIIVN---PMPKLAKGLPLRLYP  471



>gb|KDP42282.1| hypothetical protein JCGZ_01606 [Jatropha curcas]
Length=440

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 317/448 (71%), Gaps = 37/448 (8%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMVPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffft  352
             NLPPGSTGWP+IGE+I+ +                       G K       AGNKF F+
Sbjct  29    NLPPGSTGWPLIGESIEFLT---------------------TGRK-------AGNKFLFS  60

Query  353   nentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAK  532
             NEN L+T WWP SV K  +FP+  Q + ++ ++  R  + +  K E L+ YI  +D +A+
Sbjct  61    NENKLVTAWWPSSVNK--IFPSSKQTSSQEESMRMRKLLPQFLKPEALQRYIGIMDVVAQ  118

Query  533   EHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLN  712
              H A  W   ++V V+ L+K YTF+LAC+LFLS+EDR++V++   P  ++++ + ++P++
Sbjct  119   SHFAFNWDNKQQVTVFPLAKMYTFSLACRLFLSMEDREQVEKFAKPFDVLASAIIAIPID  178

Query  713   FPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE-DEGRDVLGRLLSVTDEEGQ  889
             FPGT++NR +K  ++VR++L+++IK+RK     N LG+ +  + +D+L  +L+  D++GQ
Sbjct  179   FPGTSFNRGIKASNLVRKELLKIIKQRK-----NDLGENKASQTQDILSHMLTTADDKGQ  233

Query  890   HLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERL  1069
              ++E EI   I+G+L+  + + SAAITFV+K+LAE+P +Y++V++EQ+ IAK+KG  E L
Sbjct  234   FMSEIEIADKILGLLIGGHDTASAAITFVVKYLAEMPQVYEKVFEEQMRIAKTKGAGELL  293

Query  1070  SWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNP  1249
             +WEDIQKMKYSWNVACE +RL PP QG FRE +TDFTYA +TIPKGWK +W+  STH+NP
Sbjct  294   NWEDIQKMKYSWNVACEVMRLAPPLQGAFREAITDFTYADYTIPKGWKLYWSANSTHRNP  353

Query  1250  KYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKL  1429
             + F +P+KFDPSR++GNGPAP+TFVPFGGGPRMCPGKEYARLEIL+FMHN+V  FK EK 
Sbjct  354   ECFPDPEKFDPSRFDGNGPAPYTFVPFGGGPRMCPGKEYARLEILIFMHNIVKKFKWEKW  413

Query  1430  VPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             +P E I+ +   PIP  GLP+ L PH +
Sbjct  414   LPQENIIVDPL-PIPAKGLPIVLHPHAH  440



>ref|XP_010661150.1| PREDICTED: beta-amyrin 28-oxidase isoform X2 [Vitis vinifera]
Length=447

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/467 (49%), Positives = 306/467 (66%), Gaps = 48/467 (10%)
 Frame = +2

Query  134   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  292
             I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  19    IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +L   +AV CGA+GNKF F+NE+ L+ +WW +S+ K L FP+    TL +      T + 
Sbjct  79    LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSMKKILCFPSVFNETLTRDNFRPPTFLP  138

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
             E  K E L+HYI T+DSMA EHI   W+P RE+                           
Sbjct  139   EFLKPEALQHYIVTMDSMASEHIELNWSPNREI---------------------------  171

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
                      ++ G  S+P++ PGT +NRA+K    +  +L+EVI++RK    M    K +
Sbjct  172   ---------LNEGFLSVPIDIPGTTFNRALKASKFIHNELLEVIRKRK----MELEQKGD  218

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                RD+L  +L  +DE     +E EI   +I +L  T+H+TS+ ITF+LK+LAE P +Y 
Sbjct  219   SATRDLLSHMLLASDENCNVKSEMEISTQVICLLFATHHTTSSVITFILKYLAEFPDVYS  278

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+EIA+SKGP   L W+DIQKMKY+WNVA E +RL PP QG FRE +TDFTYAGF
Sbjct  279   KVLKEQMEIAESKGPEGFLKWDDIQKMKYTWNVANETMRLTPPVQGTFREAITDFTYAGF  338

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             TIPKGWK  WNV +TH++PKYF +P+KF+PSR+EG GP PFTFVPFGGGPRMCPG+EYAR
Sbjct  339   TIPKGWKMHWNVNTTHRDPKYFPDPEKFNPSRFEGKGPQPFTFVPFGGGPRMCPGREYAR  398

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
              ++L F+HNVVT FK EK+ P EK+ YN  SPIP  G P+RL P QN
Sbjct  399   AQVLAFIHNVVTRFKWEKVDPCEKVAYN-PSPIPSKGFPIRLQPLQN  444



>gb|EYU38302.1| hypothetical protein MIMGU_mgv1a006499mg [Erythranthe guttata]
Length=441

 Score =   449 bits (1156),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 307/446 (69%), Gaps = 12/446 (3%)
 Frame = +2

Query  194   GWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP++GE++  +       PEK++ DRM KYS  VF+T ++GEK AVF GA+GNKF F+N
Sbjct  2     GWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGGASGNKFLFSN  61

Query  356   entllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKE  535
             EN L+  W+P  + +  +FP+  +++  +  I  R  +H   K E L+ YI  +D MA+ 
Sbjct  62    ENKLVRVWFPSGIDR--IFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKMDHMAQL  119

Query  536   HIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNF  715
             H AE W    EV V  L+K YTF LAC+LF S+ED  +V RL  P  L+++ +F++P++ 
Sbjct  120   HFAEGWENKTEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAIPIDL  179

Query  716   PGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHL  895
             PGT +N+ +K   +VR++LV +IK+RK      + GK     +D+L  +L  +DE G+ +
Sbjct  180   PGTPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKASPT-QDILSHMLLTSDENGKFM  235

Query  896   NEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSW  1075
              EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P + L+W
Sbjct  236   QEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAPGDSLNW  295

Query  1076  EDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKY  1255
             ED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+K +W+  +THKNP+ 
Sbjct  296   EDLQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATATHKNPEI  355

Query  1256  FSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVP  1435
             F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVFMH++V  FK EK++P
Sbjct  356   FPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKVIP  415

Query  1436  NEKIVYNSASPIPVNGLPVRLTPHQN  1513
             N+        PIP  GLP+RL PHQN
Sbjct  416   NDGKFVVDPMPIPAKGLPIRLFPHQN  441



>sp|I7CT85.1|C7A53_PANGI RecName: Full=Protopanaxadiol 6-hydroxylase; Short=P6H; AltName: 
Full=Cytochrome P450 CYP716A53v2; AltName: Full=Protopanaxatriol 
synthase [Panax ginseng]
 gb|AFO63031.1| cytochrome P450 CYP716A53v2 [Panax ginseng]
Length=469

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 225/454 (50%), Positives = 314/454 (69%), Gaps = 19/454 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE ++ +       PEK+++ RM KYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMNKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             GA+GNKF F+NEN L+ +WWP +++K L   T    ++ K   L R+ I E  K E L  
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISKIL---TATIPSVEKSKAL-RSLIVEFLKPEALHK  141

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             +I  +D   ++H  ++W    EVK +A+S+  TF LAC L  SI D  +V++L      V
Sbjct  142   FISVMDRTTRQHFEDKWNGSTEVKAFAMSESLTFELACWLLFSINDPVQVQKLSHLFEKV  201

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
               G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R++  +           +D+L  +
Sbjct  202   KAGLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSDKLQTR--------KDLLSHV  253

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             +    E  +  +E +I   ++ +L+ ++ +TS+A+  V+ FLA+ PHIY +V  EQ+EIA
Sbjct  254   MLSNGEGEKFFSEMDIADVVLNLLIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIA  313

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSKG  E LSWEDI++MKYS NV  EA+RL PP QGGF+   + F+YA F IPKGWK FW
Sbjct  314   KSKGAEELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFW  373

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +VYSTHK+PKYF  P++FDPSR+EG+GP PFTF+PFGGGPRMCPG E+ARLE+L+FMH++
Sbjct  374   SVYSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHL  433

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             VTNFK EK+ PNEKI+Y +  P P NGLP+RL+P
Sbjct  434   VTNFKWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>gb|AHK23636.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 226/454 (50%), Positives = 314/454 (69%), Gaps = 19/454 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISWGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             GA+GNKF F+NEN L+ +WWP +++K L   T    ++ K   L R+ I E  K E L  
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISKIL---TATIPSVEKSKAL-RSLIVEFLKPEALHK  141

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             +I  +D   ++H   +W    EVK +A+S+  TF LAC L  SI D  +V++L      V
Sbjct  142   FISVMDRTTRQHFEAKWNGSTEVKAFAMSETLTFELACWLLFSINDPVQVQKLSHLFEKV  201

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
               G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R++           +  +D+L  +
Sbjct  202   KAGLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSDK--------SETRKDLLSHV  253

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             +    E  +  +E +I   ++ IL+ ++ +TS+A+  V+ FLA+ PHIY +V  EQ+EIA
Sbjct  254   MISNGEGEKFFSEMDIADVVLNILIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIA  313

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSKG  E LSWEDI++MKYS NV  EA+RL PP QGGF+   + F+YA F IPKGWK FW
Sbjct  314   KSKGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFW  373

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +VYSTHK+PKYF  P++FDPSR+EG+GP PFTF+PFGGGPRMCPG E+ARLE+L+FMH++
Sbjct  374   SVYSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHL  433

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             VTNF+ EK+ PNEKI+Y +  P P NGLP+RL+P
Sbjct  434   VTNFRWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>emb|CBI24045.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   448 bits (1152),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 319/465 (69%), Gaps = 46/465 (10%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  1     MLRYEIESHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  60

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE  AVF GAAGNKF F+NEN L+  WWP SV K  +FP+  Q + ++     R  + +
Sbjct  61    LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDK--VFPSSTQTSSKEEAKKMRKLLPQ  118

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
              FK E L+ YI  +D +A+ H A+ W                           ++RDE  
Sbjct  119   FFKPEALQRYIGIMDHIAQRHFADSW---------------------------DNRDE--  149

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
                 P  ++++G+ ++P++ PGT ++RA+K  + +R++L  +IK+RK      + GK   
Sbjct  150   ----PFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDL---AEGKA-S  201

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             + +D+L  +L  TDE+G H+NE EI   I+G+L+  + + SAAITF++K++AELPHIY++
Sbjct  202   QNQDILSHMLLATDEDGCHMNEMEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEK  261

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY+EQ+EIA SK P E L+W+D+QKM+YSWNVACE +RL PP QG FRE +TDF + GF+
Sbjct  262   VYEEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFS  321

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHK+P+ F +P+ FDP+R+EG+GPAP+TFVPFGGGPRMCPGKEYARL
Sbjct  322   IPKGWKLYWSANSTHKSPECFPQPENFDPTRFEGDGPAPYTFVPFGGGPRMCPGKEYARL  381

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHNVV  FK +KL+P+EKI+ +   P+P  GLPVRL P +
Sbjct  382   EILVFMHNVVKRFKWDKLLPDEKIIVDPM-PMPAKGLPVRLHPRK  425



>gb|EYU26852.1| hypothetical protein MIMGU_mgv1a005293mg [Erythranthe guttata]
Length=490

 Score =   450 bits (1157),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 222/461 (48%), Positives = 307/461 (67%), Gaps = 12/461 (3%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  310
             +   T+   LPPG  GWP++GE++  +       PEK++ DR+ KYS  VF+T ++GEK 
Sbjct  36    STTTTAAGPLPPGKMGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSTVFRTHLVGEKA  95

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV  GA+GNKF F+NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K E
Sbjct  96    AVLSGASGNKFLFSNENKLVKAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLKTE  153

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D MA+ H  E W   +EV V  L+K YTF LAC+LF S+ED  +V RL  P
Sbjct  154   ALRRYIGKMDHMAQTHFEEGWENKKEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKP  213

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               L+++ +F++P++ PGT +++ +K   +VR++LV +IK+RK           +D    +
Sbjct  214   FNLLASSLFAIPIDLPGTPFSKGIKASKIVRQELVSIIKQRKIDLAQGKASPTQD----I  269

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  +L  +DE G  + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ
Sbjct  270   LSHMLLTSDENGNFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQ  329

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EI KSK P + L+WED+QKMKYSWNVACE +RL  P  G FRE   DF+Y G++IPKG+
Sbjct  330   MEILKSKSPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAFADFSYKGYSIPKGF  389

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  +THKNP+ F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVF
Sbjct  390   KLYWSATATHKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVF  449

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             MH++V  FK EK++PN+        PIP  GLP+RL PH N
Sbjct  450   MHHLVKRFKFEKVIPNDGKFVVDPMPIPAKGLPIRLFPHLN  490



>gb|AED99872.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/454 (50%), Positives = 313/454 (69%), Gaps = 19/454 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS  GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSXAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             GA+GNKF F+NEN L+ +WWP +++K L   T    ++ K   L R+ I E  K E L  
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISKIL---TATIPSVEKSKAL-RSLIVEFLKPEALHK  141

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             +I  +D   ++H   +W    EVK +A+S+  TF LAC L  SI D  +V++L      V
Sbjct  142   FISVMDRTTRQHFEAKWNGSTEVKAFAMSETLTFELACWLLFSISDPVQVQKLSHLFEKV  201

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
               G+ SLPLNFPGTA+NR +K  +++R++L  VIK+R++           +  +D+L  +
Sbjct  202   KAGLLSLPLNFPGTAFNRGIKAANLIRKELSVVIKQRRSDK--------SETRKDLLSHV  253

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             +    E  +  +E +I   ++ IL+ ++ +TS+A+  V+ FLA+ PHIY +V  EQ+EIA
Sbjct  254   MISNGEGEKFFSEMDIADVVLNILIASHDTTSSAMGSVVYFLADHPHIYAKVLAEQMEIA  313

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSKG  E LSWEDI++MKYS NV  EA+RL PP QGGF+   + F+YA F IPKGWK FW
Sbjct  314   KSKGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFW  373

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +VYSTHK+PKYF  P++FDPSR+EG+GP PFTF+PFGGGPRMCPG E+ARLE+L+FMH++
Sbjct  374   SVYSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHL  433

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             VTNF+ EK+ PNEKI+Y +  P P NGLP+RL+P
Sbjct  434   VTNFRWEKVFPNEKIIY-TPFPFPENGLPIRLSP  466



>gb|EYU38303.1| hypothetical protein MIMGU_mgv1a025102mg [Erythranthe guttata]
Length=441

 Score =   445 bits (1145),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/446 (49%), Positives = 306/446 (69%), Gaps = 12/446 (3%)
 Frame = +2

Query  194   GWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKffftn  355
             GWP++GE++  +       PEK++ DRM KYS  VF+T ++GEK AVF  A+GNKF F+N
Sbjct  2     GWPLVGESLHFLWAGWKGHPEKFVLDRMAKYSSSVFRTHLVGEKAAVFGCASGNKFLFSN  61

Query  356   entllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKE  535
             EN L+  W+P  + +  +FP+  +++  +  I  R  +H   K E L+ YI  +D MA+ 
Sbjct  62    ENKLVRVWFPSGIDR--IFPSSTRSSSEEEGIKLRRMLHNFLKTEALRRYIGKMDHMAQL  119

Query  536   HIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNF  715
             H AE W    +V V  L+K YTF LAC+LF S+ED  +V RL  P  L+++ +F++P++ 
Sbjct  120   HFAEGWENKTQVVVLPLAKDYTFQLACRLFASVEDPQQVDRLSKPFNLLASSLFAIPIDL  179

Query  716   PGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHL  895
             PGT +N+ +K   +VR++LV +IK+RK      + GK     +D+L  +L  +DE G+ +
Sbjct  180   PGTPFNKGIKASKIVRQELVSIIKQRKIDL---ADGKASPT-QDILSHMLLTSDENGKFM  235

Query  896   NEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSW  1075
              EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ++I KSK P + L+W
Sbjct  236   QEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMDILKSKAPGDSLNW  295

Query  1076  EDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKY  1255
             ED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+K +W+  +THKNP+ 
Sbjct  296   EDLQKMKYSWNVACEVMRLATPVTGTFREAIADFSYKGYSIPKGFKLYWSATATHKNPEI  355

Query  1256  FSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVP  1435
             F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVFMH++V  FK EK++P
Sbjct  356   FPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKVIP  415

Query  1436  NEKIVYNSASPIPVNGLPVRLTPHQN  1513
             N+        PIP  GLP+RL PHQN
Sbjct  416   NDGKFVVDPMPIPAKGLPIRLFPHQN  441



>ref|XP_010533078.1| PREDICTED: beta-amyrin 28-oxidase-like [Tarenaya hassleriana]
Length=469

 Score =   444 bits (1141),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 322/462 (70%), Gaps = 14/462 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSILGEK  307
             I++   ++ S PNLPPG+ G+P +GE +  +    PEK++SDR++++S  VFKT I+G  
Sbjct  19    IFYKHLSHFSYPNLPPGNIGFPFLGETLSFLSSGRPEKFVSDRVRRFSSAVFKTHIVGSP  78

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKL  487
              AV  G+ GNKF FTNE+ L+ +WWP SV K  +FP+  + +  +     R  + +  K 
Sbjct  79    AAVVSGSLGNKFLFTNEDKLVVSWWPDSVNK--IFPSSMKTSSIEEAKNLRNLLPQFLKP  136

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E L+ Y+  +D +A+ H  EEWA    V V+ L+K +TF LAC+LFL+IED+D+V++L +
Sbjct  137   EALQSYVGVMDEIARRHFDEEWANKDRVLVHLLTKRFTFRLACRLFLNIEDQDKVEKLGE  196

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
             P  L+ +G+FS+P++FPGT YNRA+K   +VR++L+E+I  R    +  ++GK     +D
Sbjct  197   PFNLIGSGIFSVPIDFPGTPYNRAIKAAKLVRKELIEII--RSQMRIDPTVGKASS-NQD  253

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
              L  +LS++D +     E ++   I+G+L+  + + S   TF++K+LAELPH+Y+ V  E
Sbjct  254   FLSHMLSLSDAK-----EEDVADKILGLLIAGHDTASTVCTFIVKYLAELPHVYELVLHE  308

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+EI K KG  E L WEDI+KMKYSWNVACE +RL PP  G FR+ +  F++ GF IPKG
Sbjct  309   QMEIEKEKGRGELLKWEDIKKMKYSWNVACEVMRLTPPVPGAFRQAIHPFSFDGFFIPKG  368

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WK +W+  +TH+NP+YF EP++F+P R+EGNGPAP+T++PFGGGPRMCPGKEYARLEILV
Sbjct  369   WKLYWSANATHRNPEYFPEPERFEPRRFEGNGPAPYTYIPFGGGPRMCPGKEYARLEILV  428

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             F+HN+V  F+ EK+ P+E  V+N   P P NGLP+R+ P+ +
Sbjct  429   FIHNLVKRFRWEKVFPHENTVFNPF-PFPSNGLPIRIFPYSS  469



>gb|EYU25766.1| hypothetical protein MIMGU_mgv1a005367mg [Erythranthe guttata]
Length=487

 Score =   443 bits (1139),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 307/447 (69%), Gaps = 12/447 (3%)
 Frame = +2

Query  188   STGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKfff  349
             +TGWP++GE++  +       PEK++ DR+ KYS  VF+T ++GEK AV  GA GNKF F
Sbjct  46    NTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGEKAAVLSGARGNKFLF  105

Query  350   tnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPTIDSMA  529
             +NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K E L+ YI  +D MA
Sbjct  106   SNENKLVRAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLKTEALRRYIGKMDLMA  163

Query  530   KEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPL  709
             ++H  E W    EV V  L+K YTF LAC+LF S+E+  +V RL  P  L+++ +F++P+
Sbjct  164   QKHFEEGWENKTEVVVLPLAKDYTFQLACRLFASVENPQQVDRLSKPFNLLASSLFAIPI  223

Query  710   NFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQ  889
             +FPGT +N+ +K   +VR++L+ +IK+RK      + GK     +D+L  +L  +DE G+
Sbjct  224   DFPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKASPT-QDILSHMLLTSDENGK  279

Query  890   HLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGPNERL  1069
              + EF+I   I+G+L+    S S A TF++K+LAELPHIY  VY EQ+EI KSK P + L
Sbjct  280   FMQEFDIADKILGLLIGGRDSASVACTFIVKYLAELPHIYDGVYNEQMEILKSKAPGDSL  339

Query  1070  SWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNP  1249
             +WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPKG+K +W+  +THKNP
Sbjct  340   NWEDLQKMKYSWNVACEVMRLATPVPGTFREAIVDFSYKGYSIPKGFKLYWSATATHKNP  399

Query  1250  KYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKL  1429
             + F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EILVFMH++V  FK EK+
Sbjct  400   EIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEILVFMHHLVKRFKFEKI  459

Query  1430  VPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             +PN+        PIP  GLP+RL PH+
Sbjct  460   IPNDGKFVVDPMPIPAKGLPIRLFPHE  486



>gb|AFU93031.1| cytochrome P450 [Panax quinquefolius]
Length=482

 Score =   442 bits (1137),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 307/460 (67%), Gaps = 16/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  30    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             + CG  GNKF ++ E  L+  W+P SV K  MFP     +        R  +  + K++ 
Sbjct  90    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRCKMMFLLKVDG  147

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             +K Y+  +D + K+ +  +W   +++ V+   K YT  ++C++F+SI+D ++V RL   I
Sbjct  148   MKKYVGLMDRVMKQFLESDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  207

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               +  G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK   + N   K   + +D+L
Sbjct  208   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLLEN---KQASQPQDLL  264

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               LL   +++GQ L+E +I  ++IG++   Y + +  ITFVL +LAE P +Y QV KEQ+
Sbjct  265   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  324

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA SK P E L+WED++KMKYSWNVA E LR+ PPG G FRE +TDFTYAG+ IPKGWK
Sbjct  325   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  384

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
                  + THKNP YF  P+KFDP+R+EGNGPAP+TF PFGGGPRMCPG EYARL IL+FM
Sbjct  385   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  444

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIP--VNGLPVRLTPH  1507
             HNVVTNF+ EKL+PNEKI+     PIP   +GLP+ L PH
Sbjct  445   HNVVTNFRWEKLIPNEKIL---TDPIPRFAHGLPIHLHPH  481



>gb|AEY75213.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=482

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 307/460 (67%), Gaps = 16/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  30    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             + CG  GNKF ++ E  L+  W+P SV K  MFP     +        R  +  + K++ 
Sbjct  90    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  147

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             +K Y+  +D + K+ +  +W   +++ V+   K YT  ++C++F+SI+D ++V RL   I
Sbjct  148   MKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  207

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               +  G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK   + N   K   + +D+L
Sbjct  208   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLLEN---KQASQPQDLL  264

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               LL   +++GQ L+E +I  ++IG++   Y + +  ITFVL +LAE P +Y QV KEQ+
Sbjct  265   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  324

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA SK P E L+WED++KMKYSWNVA E LR+ PPG G FRE +TDFTYAG+ IPKGWK
Sbjct  325   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  384

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
                  + THKNP YF  P+KFDP+R+EGNGPAP+TF PFGGGPRMCPG EYARL IL+FM
Sbjct  385   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  444

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIP--VNGLPVRLTPH  1507
             HNVVTNF+ EKL+PNEKI+     PIP   +GLP+ L PH
Sbjct  445   HNVVTNFRWEKLIPNEKIL---TDPIPRFAHGLPIHLHPH  481



>sp|H2DH16.2|C7A47_PANGI RecName: Full=Dammarenediol 12-hydroxylase; AltName: Full=Cytochrome 
P450 CYP716A47; AltName: Full=Protopanaxadiol synthase; 
Short=PgDDS [Panax ginseng]
 gb|AEY75212.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=486

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 307/460 (67%), Gaps = 16/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  34    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  93

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             + CG  GNKF ++ E  L+  W+P SV K  MFP     +        R  +  + K++ 
Sbjct  94    ILCGPEGNKFLYSTEKKLVQVWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  151

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             +K Y+  +D + K+ +  +W   +++ V+   K YT  ++C++F+SI+D ++V RL   I
Sbjct  152   MKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVTRLGSSI  211

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               +  G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK   + N   K   + +D+L
Sbjct  212   QNIEAGLLAVPINIPGTAMNRAIKTVKLLTREVEAVIKQRKVDLLEN---KQASQPQDLL  268

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               LL   +++GQ L+E +I  ++IG++   Y + +  ITFVL +LAE P +Y QV KEQ+
Sbjct  269   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVLNYLAEFPDVYNQVLKEQV  328

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA SK P E L+WED++KMKYSWNVA E LR+ PPG G FRE +TDFTYAG+ IPKGWK
Sbjct  329   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  388

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
                  + THKNP YF  P+KFDP+R+EGNGPAP+TF PFGGGPRMCPG EYARL IL+FM
Sbjct  389   MHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFM  448

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIP--VNGLPVRLTPH  1507
             HNVVTNF+ EKL+PNEKI+     PIP   +GLP+ L PH
Sbjct  449   HNVVTNFRWEKLIPNEKIL---TDPIPRFAHGLPIHLHPH  485



>emb|CAN63680.1| hypothetical protein VITISV_036273 [Vitis vinifera]
Length=467

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 293/421 (70%), Gaps = 10/421 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  21    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP+   N   +  I   + + E
Sbjct  81    MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLPE  140

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E LKHY+  +D MA  HI  +WAP+REVKV+ L K Y FAL+C+LF+ ++D   V 
Sbjct  141   FLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDDPQCVA  200

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R+  P  L+  G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK    M    K   
Sbjct  201   RISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRK----MELGQKGNS  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD L  +L   ++ G+ ++E EI  ++I +LL T+ STSA ITFVLK+LAE P IY +
Sbjct  257   AARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFPSIYNE  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V+KEQ+EIAK KG  E L+W+DIQKM+YSWNVA E +RL PP QG FRE + +FTYAGFT
Sbjct  317   VFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFTYAGFT  376

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             +PKGWKT WNV +TH+NPKYF + +KFDPSR+EG GP PFTFVPFGGGPRMCPG+EYAR 
Sbjct  377   MPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGREYARA  436

Query  1376  E  1378
             +
Sbjct  437   Q  437



>emb|CBI39267.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 293/421 (70%), Gaps = 10/421 (2%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  54    IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  113

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             + E +AV CGA GNKFFF+NEN L+T+WW +S+ K L FP+   N   +  I   + + E
Sbjct  114   MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSMKKILYFPSLFDNPATQDQIKTPSFLPE  173

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E LKHY+  +D MA  HI  +WAP+REVKV+ L K Y FAL+C+LF+ ++D   V 
Sbjct  174   FLKPEALKHYVAIMDLMAGMHIDMDWAPYREVKVFPLVKKYAFALSCRLFMKVDDPQCVA  233

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R+  P  L+  G  S+PL+ PGTA+NRA+K  ++V ++L+ +I +RK    M    K   
Sbjct  234   RISHPFELIMAGFLSVPLDIPGTAFNRAIKARNIVHKELLAIINKRK----MELGQKGNS  289

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               RD L  +L   ++ G+ ++E EI  ++I +LL T+ STSA ITFVLK+LAE P IY +
Sbjct  290   AARDFLSHMLLEANKNGEIMSETEISTHLICLLLATHDSTSAVITFVLKYLAEFPSIYNE  349

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V+KEQ+EIAK KG  E L+W+DIQKM+YSWNVA E +RL PP QG FRE + +FTYAGFT
Sbjct  350   VFKEQMEIAKGKGSEEYLNWDDIQKMRYSWNVANETMRLTPPVQGAFREVIKNFTYAGFT  409

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             +PKGWKT WNV +TH+NPKYF + +KFDPSR+EG GP PFTFVPFGGGPRMCPG+EYAR 
Sbjct  410   MPKGWKTHWNVNTTHRNPKYFPDHEKFDPSRFEGRGPEPFTFVPFGGGPRMCPGREYARA  469

Query  1376  E  1378
             +
Sbjct  470   Q  470



>gb|EYU26126.1| hypothetical protein MIMGU_mgv1a017761mg, partial [Erythranthe 
guttata]
Length=452

 Score =   439 bits (1128),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 220/463 (48%), Positives = 310/463 (67%), Gaps = 19/463 (4%)
 Frame = +2

Query  143   FITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGE  304
             F + A  +   LPPG+TGWP++GE++  +       PEK++ DR+ KYS  VF+T ++GE
Sbjct  3     FSSAAAAATGPLPPGNTGWPLVGESLHFLWAGWKGHPEKFVLDRVAKYSSSVFRTHLVGE  62

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFK  484
             K AV  GA+GNKF F+NEN L+  W+P  + K  +FP+  +++  +  I  R  +H   K
Sbjct  63    KAAVLSGASGNKFLFSNENKLVRAWFPSGIDK--IFPSSTRSSSEEEGIKLRRMLHTFLK  120

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLL  664
              E L+ YI  +D MA++H  E W    EV V  L+K YTF LAC+LF S+ED  +V RL 
Sbjct  121   TEALRRYIGKMDRMAQKHFEEGWENKSEVVVLPLAKDYTFQLACRLFASVEDPQQVDRLS  180

Query  665   DPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGR  844
              P  L+++ +F++P++ PGT +N+ +K   +VR++L+ +IK+RK      + GK     +
Sbjct  181   KPFNLLASSLFAIPIDLPGTPFNKGIKASKIVRQELLSIIKQRKIDL---AEGKASPT-Q  236

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  +L  +DE G+ + EF+I   I+G+L+    S S A TF++K+LAE        Y 
Sbjct  237   DILSHMLLTSDENGKFMQEFDIADKILGLLIGGRDSASVACTFIVKYLAEF-------YN  289

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ+EI KSK P + L+WED+QKMKYSWNVACE +RL  P  G FRE + DF+Y G++IPK
Sbjct  290   EQMEILKSKAPGDSLNWEDLQKMKYSWNVACEVMRLATPVPGTFREAIADFSYKGYSIPK  349

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
             G+K +W+  +THKNP+ F EP+KFDPSR++G GPAP+TFVPFGGGPRMCPG EYAR EIL
Sbjct  350   GFKLYWSATATHKNPEIFPEPEKFDPSRFQGAGPAPYTFVPFGGGPRMCPGLEYARFEIL  409

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             VFMH++V  FK EK++PN+        PIP  GLP+RL PH+N
Sbjct  410   VFMHHLVKRFKFEKMIPNDGKFVVDPMPIPAKGLPIRLIPHEN  452



>gb|AGC31652.1| cytochrome P450 CYP6H [Panax quinquefolius]
Length=469

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 312/456 (68%), Gaps = 23/456 (5%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             GA+GNKF F+NEN L+ +WWP +++K L   T    ++ K   L R+ I E  K E L  
Sbjct  86    GASGNKFIFSNENKLVVSWWPPAISKIL---TATIPSVEKSKAL-RSLIVEFLKPEALHK  141

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             +I  +D   ++H  ++W    EVK +A+S+  TF LAC L  SI D  +V++L      V
Sbjct  142   FISVMDRTTRQHFEDKWNGSTEVKAFAMSESLTFELACWLLFSINDPVQVQKLSHLFEKV  201

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
               G+ SLPLNFPGTA+NR +K  +++R++L  +IK+R++  +           +D+L  +
Sbjct  202   KAGLLSLPLNFPGTAFNRGIKAANLIRKELSVMIKQRRSDKLQTR--------KDLLSHV  253

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             +    E  +  +E +I   ++ +L+ ++ +TS+A+  V+ FLA+ PHIY +V  EQ+EIA
Sbjct  254   MLSNGEGEKFFSEMDIADVVLNLLIASHDTTSSAMGSVVYFLADHPHIYAKVLTEQMEIA  313

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSKG  E LSWEDI++MKYS NV  EA+RL PP QGGF+   + F+YA F IPKGWK FW
Sbjct  314   KSKGAGELLSWEDIKRMKYSRNVINEAMRLVPPSQGGFKVVTSKFSYANFIIPKGWKIFW  373

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +VYSTHK+PKYF  P++FDPSR+EG+GP PFTF+PFGGGPRMCPG E+ARLE+L+FMH++
Sbjct  374   SVYSTHKDPKYFKNPEEFDPSRFEGDGPMPFTFIPFGGGPRMCPGSEFARLEVLIFMHHL  433

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPV--NGLPVRLTP  1504
             VTNF+ +K+ PNEKI+Y   +P P   N   +RL+P
Sbjct  434   VTNFRWDKVFPNEKIIY---TPFPSTENSRTIRLSP  466



>ref|XP_002325238.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
 gb|EEF03803.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
Length=475

 Score =   437 bits (1123),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 310/466 (67%), Gaps = 15/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II    ++    PNLPPGS+G P IGE ++L++      P+K+  DR  KY+ EVFKT++
Sbjct  17    IIVHKHRSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNL  76

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
               +  AV CGAAGNKF F+NEN +L  W+P  V K  +FP+  Q +L +     RT + E
Sbjct  77    FCQPAAVLCGAAGNKFLFSNENKVLKAWYPDFVCK--IFPSSVQRSLIEQVDRLRTLLPE  134

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               + + LK Y+   D++A  H A EW     V V+ L+K +TF LAC LFLSIED D + 
Sbjct  135   FLRPDALKRYVGIFDTVAGRHFASEWENKEVVVVFPLAKSFTFGLACSLFLSIEDPDHIA  194

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L  P  LV +G+FS+P++ PGT  NRA+K  + +R +L  +IK+RK      + GK   
Sbjct  195   KLASPFNLVVSGIFSIPIDLPGTPLNRAIKAANFIRTELFAIIKQRKKDL---AEGKASP  251

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             + +D+L  +L   DE+G  ++E  I   I+ +L   + STSAA  F++K+LAELPHIY+ 
Sbjct  252   K-QDILSHMLLACDEKGAFMSELSIADTILALLASAHESTSAACAFIVKYLAELPHIYEG  310

Query  1016  VYKEQIEIAKSKGP-NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             VYKEQ+EI+++K P +E L+W DIQKM+YSWNV  E LRL P      RE +  F + GF
Sbjct  311   VYKEQMEISETKAPGDELLNWNDIQKMRYSWNVIREVLRLCPTFPN-VREAILGFDFNGF  369

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +WN  STH+NP+YF EP++FDPSR+EG GP P+TFVPFGGGP MCPG+ +AR
Sbjct  370   SIPKGWKVYWNANSTHRNPEYFPEPERFDPSRFEGTGPVPYTFVPFGGGPMMCPGQGFAR  429

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             LE+L+FMHN+V  FK +K V  EKI++ S  PIP  G+P+RL PH+
Sbjct  430   LEMLIFMHNLVKRFKFDKFVAEEKIMF-SPMPIPEKGVPIRLFPHR  474



>emb|CDP12479.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 313/464 (67%), Gaps = 21/464 (5%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             + F  K   SK  LPPG TGWP++GE ++         PEK+  DRM KYS EVFKTS+L
Sbjct  25    LSFKLKEPISKLQLPPGKTGWPIVGETLEFAAMGRNGTPEKFFKDRMSKYSQEVFKTSLL  84

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNT-LRKITILNRTNIHE  475
              E++AVFCG A NKF F+NEN L+   WP S  K  +FP+   +T LR + +        
Sbjct  85    CEQIAVFCGPAANKFVFSNENKLVALSWPSSAKK--IFPSSNSSTKLRAVAL-------T  135

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
             + K +NL  Y+  +DS+AK H+  +W   +EV V +L + + F  AC+LFLSI D  +++
Sbjct  136   LLKPDNLHKYVAIVDSIAKSHLETQWNFQKEVNVLSLVRQFDFTAACRLFLSINDPHQIE  195

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
                 P  +++ G+F+LP+N PG++YNR +K  + VR++L+ +IK+RK + M   L  V D
Sbjct  196   DCAKPFEVMAAGIFTLPINLPGSSYNRGIKAANSVRQKLLGIIKQRKGEVMDKQL--VHD  253

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
             E  D+L   L+  DE G+ ++E EI  +++  LL +  ST+A+ITF +K+LAE P IY +
Sbjct  254   E--DLLSLFLTKPDENGKFMSEPEIADHLLAALLASQDSTTASITFTMKYLAEFPDIYDE  311

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V KEQ  IA+ K P E L+W+D+QKM+Y+WNV  E LRL PP QG FRE +TDFTY+ F 
Sbjct  312   VLKEQRSIAQEKIPGEPLNWKDLQKMRYAWNVVSEVLRLVPPVQGNFREVLTDFTYSTFF  371

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W   STHKNP+YFS+P+KFDPSR+EG+GP P TFVPFGGG R+CPGK++AR+
Sbjct  372   IPKGWKIYWTPNSTHKNPQYFSDPEKFDPSRFEGSGPMPHTFVPFGGGSRICPGKDFARV  431

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
              ILVFM+NV+  F+ EKL+P+EK V     P+P  GLPV L PH
Sbjct  432   VILVFMYNVIGKFRWEKLLPDEKTVVLPI-PLPAKGLPVVLHPH  474



>gb|AED99867.1| cytochrome P450 [Panax notoginseng]
Length=500

 Score =   437 bits (1124),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 308/460 (67%), Gaps = 16/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE ++ +        E ++  R +KYSP+VF+TS+LGE +A
Sbjct  48    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  107

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             + CG  GNKF ++ E  L+ TW+P SV K  MFP     +        R  +  + K++ 
Sbjct  108   ILCGPEGNKFLYSTEKKLVQTWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  165

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             LK Y+  +D + K+ +  +W   +++ V+   K YT  ++C++F+SI+D ++V+RL   I
Sbjct  166   LKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVRRLGSSI  225

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               +  G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK   + N   K   + +D+L
Sbjct  226   QNIEAGLLAVPINIPGTAMNRAIKTVKLLSREVEAVIKQRKVDLLEN---KQASQPQDLL  282

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               LL   +++GQ L+E +I  ++IG++   Y + +  ITFV+ +LAE P +Y QV KEQ+
Sbjct  283   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVINYLAEFPDVYNQVLKEQV  342

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA SK P E L+WED++KMKYSWNVA E LR+ PPG G FRE +TDFTYAG+ IPKGWK
Sbjct  343   EIANSKHPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  402

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
                  + THKNP YF  P+KFDP+R+EGNGPAP+TF PFGGGPRMCPG EYARL IL+F+
Sbjct  403   MHLIPHDTHKNPTYFPNPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFI  462

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIP--VNGLPVRLTPH  1507
             HNVVTNF+ EKL+P+EKI+     PIP   +GLP+ L PH
Sbjct  463   HNVVTNFRWEKLIPSEKIL---TDPIPRFAHGLPIHLHPH  499



>gb|AIN44011.1| cytochrome P450, partial [Panax notoginseng]
Length=506

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 308/460 (67%), Gaps = 16/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  313
             K N SK  LPPG TGWP+IGE ++ +        E ++  R +KYSP+VF+TS+LGE +A
Sbjct  54    KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  113

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             + CG  GNKF ++ E  L+ TW+P SV K  MFP     +        R  +  + K++ 
Sbjct  114   ILCGPEGNKFLYSTEKKLVQTWFPSSVEK--MFPRSHGESNADNFSKVRGKMMFLLKVDG  171

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             LK Y+  +D + K+ +  +W   +++ V+   K YT  ++C++F+SI+D ++V+RL   I
Sbjct  172   LKKYVGLMDRVMKQFLETDWNRQQQINVHNTVKKYTVTMSCRVFMSIDDEEQVRRLGSSI  231

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               +  G+ ++P+N PGTA NRA+K   ++ R++  VIK+RK   + N   K   + +D+L
Sbjct  232   QNIEAGLLAVPINIPGTAMNRAIKTVKLLSREVEAVIKQRKVDLLEN---KQASQPQDLL  288

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               LL   +++GQ L+E +I  ++IG++   Y + +  ITFV+ +LAE P +Y QV KEQ+
Sbjct  289   SHLLLTANQDGQFLSESDIASHLIGLMQGGYTTLNGTITFVINYLAEFPDVYNQVLKEQV  348

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA SK P E L+WED++KMKYSWNVA E LR+ PPG G FRE +TDFTYAG+ IPKGWK
Sbjct  349   EIANSKQPKELLNWEDLRKMKYSWNVAQEVLRIIPPGVGTFREAITDFTYAGYLIPKGWK  408

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
                  + THKNP YF  P+KFDP+R+EGNGPAP+TF PFGGGPRMCPG EYARL IL+F+
Sbjct  409   MHLIPHDTHKNPTYFPNPEKFDPTRFEGNGPAPYTFTPFGGGPRMCPGIEYARLVILIFI  468

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIP--VNGLPVRLTPH  1507
             HNVVTNF+ EKL+P+EKI+     PIP   +GLP+ L PH
Sbjct  469   HNVVTNFRWEKLIPSEKIL---TDPIPRFAHGLPIHLHPH  505



>emb|CBI24076.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 303/465 (65%), Gaps = 46/465 (10%)
 Frame = +2

Query  134   IIYFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTS  292
             I +F+ K   +S  NLPPG  G+P IGE+++ +       PE++I DRM KYS ++FKT 
Sbjct  81    IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  140

Query  293   ILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH  472
             +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV K  +FP+  Q + ++ ++  R  + 
Sbjct  141   LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSVEK--IFPSSLQTSTKEESMKTRKLLP  198

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
                K E L+ Y+  +DS+A                                 +I+D   +
Sbjct  199   AFLKPEALQKYVGIMDSIA---------------------------------NIDDPKHI  225

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              +  +P  +++ G+ S+P+NFPGT +NRA+K    VR++L  +IK+RK + +    GK  
Sbjct  226   AKFANPFHILAAGVMSIPINFPGTPFNRAIKAADSVRKELRAIIKQRKIQVLA---GKSS  282

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                 D+L  +L+ TDE GQ LNE +I   I+G+L+  + + SA ITF++K+LAELP +Y 
Sbjct  283   SSKHDILSHMLTTTDENGQFLNEMDIADKILGLLIGGHDTASAVITFIIKYLAELPQVYN  342

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V KEQ+E+A  K   E L WEDIQKMKYSWNVA E +RL PP QG FRE +TDFTYAGF
Sbjct  343   EVLKEQMEVAAGKKSGEMLDWEDIQKMKYSWNVANEVMRLAPPLQGSFREAITDFTYAGF  402

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
             +IPKGWK +W+  +THKNP YF +P+KFDPSR+EGNGP P+T+VPFGGGPRMCPGKEYAR
Sbjct  403   SIPKGWKLYWSTNATHKNPDYFPDPEKFDPSRFEGNGPIPYTYVPFGGGPRMCPGKEYAR  462

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             LEILVF+HNVV  F   KL PNE ++ +   P+P  GLP+RL  H
Sbjct  463   LEILVFIHNVVRRFSWYKLHPNEDVIVDPM-PMPAKGLPIRLRHH  506



>ref|XP_008340177.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=485

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/464 (48%), Positives = 312/464 (67%), Gaps = 17/464 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             ++ +  ++  +  NLPPG+ G+PVIGE+   +       PEK+  DR+ K+S +VFKTS+
Sbjct  26    VLLYRHRSQFTSENLPPGNVGYPVIGESFKFLASGWKGQPEKFFFDRITKFSSQVFKTSL  85

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
              GE+ A+FCGAA NKF F+NEN L+  W+P S+ K  +FP+  + + +K     R  I +
Sbjct  86    FGEQAAIFCGAACNKFLFSNENKLVAVWYPSSIQK--VFPSSTETSKKKF----RKLIPK  139

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L+ YI  +D+ A+ H A+ W    +V+ + L+  YTF LA +LFLS+E+  E++
Sbjct  140   FMKPEVLQRYIGIMDTSARTHFADAWENKNQVQAFPLTNDYTFGLAVRLFLSLENPKEME  199

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
              +   I L++ G+ S+P++FPGT ++ A+K    +R +L ++IK+RK      + GK   
Sbjct  200   EIGHSIHLLNAGIISMPIDFPGTPFHTAIKSSKFIRDKLHKIIKQRKIDL---AEGKASP  256

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   DE G    E EI  +I G+L+  + +TSA   F++K+LAELPH+Y  
Sbjct  257   T-QDILSHMLLTCDEHGTSATELEIADWINGLLIAGHETTSATCAFIVKYLAELPHVYDA  315

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VY EQ+EIA SK P + L+W+D++KMKYSWNVA E LR+  P QGG+RE +TDF + G  
Sbjct  316   VYNEQMEIANSKSPGKLLNWDDLKKMKYSWNVASEVLRMSSPVQGGWREPLTDFMFHGLY  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +W+  STHKN  YF EP+KFDPSR+EG+GPAP+T+VPFGGG RMCPGKEYARL
Sbjct  376   IPKGWKLYWSATSTHKNEAYFPEPEKFDPSRFEGSGPAPYTYVPFGGGVRMCPGKEYARL  435

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
              ILVFMHN+V  FK EK+V +E IV N   P+P  GLP+RL PH
Sbjct  436   AILVFMHNLVKRFKFEKVVADETIVVNPL-PVPAEGLPIRLYPH  478



>ref|XP_011074924.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Sesamum indicum]
Length=319

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 256/333 (77%), Gaps = 14/333 (4%)
 Frame = +2

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D++A+EH+  EW P   V V  LSK YTF LACKLFL + D +++KRL DP  L + GM
Sbjct  1     MDALAREHMDREWTPNALVNVVPLSKKYTFDLACKLFLDVVDVEDIKRLSDPFSLATQGM  60

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
               +P+N PG AYNRA++GG M+R++L+ +I ER+ K     L K E   +D+L ++L VT
Sbjct  61    LGVPINLPGMAYNRAIRGGKMIRKELIRIINERRKKL----LEKKETRHQDLLSKMLLVT  116

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE GQ  +E EI + I+G L+ ++ +TS+A++ V+ +LA LPHIY+QV KEQ+EIAKSKG
Sbjct  117   DENGQFYSEMEISNNIVGFLVASFDATSSAVSSVINYLAHLPHIYEQVLKEQMEIAKSKG  176

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P+E L+WEDIQKMKYSWNVA E+LRL P  QGGFRET T+FTYAGFTIPKGWKT W V+S
Sbjct  177   PDELLTWEDIQKMKYSWNVARESLRLGPSSQGGFRETTTEFTYAGFTIPKGWKTHWTVHS  236

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             +H+NP+YF EP+KFDPSR++G+GP P+TFVPFGGGPRMCPG+EYA+LEILVFMHNVV  F
Sbjct  237   SHRNPEYFPEPEKFDPSRFDGSGPPPYTFVPFGGGPRMCPGREYAKLEILVFMHNVVRRF  296

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             K+EK +PNE          PV+GL VRL PH+N
Sbjct  297   KLEKAIPNE----------PVDGLAVRLQPHEN  319



>ref|XP_002325242.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
 gb|EEF03807.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
Length=461

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 304/460 (66%), Gaps = 33/460 (7%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             ++    PNLPPGS+G P IGE ++L+V      P+K+  DR  KY+ EVFKT++  +  A
Sbjct  27    RSKFKHPNLPPGSSGLPYIGETLELLVTGCKGHPQKFFLDRKAKYASEVFKTNLFCQPAA  86

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             VFCGAAGNKF F+NEN +L  W+P  V K  +FP+  Q +L +                 
Sbjct  87    VFCGAAGNKFLFSNENKVLKAWYPDFVCK--IFPSSVQRSLIE-----------------  127

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
              + Y+   D++A  H A EW     V V+ L+K +TF LAC LFLSIED D + +L  P 
Sbjct  128   -QRYVGIFDTVAGRHFASEWENKEVVVVFPLTKSFTFGLACSLFLSIEDPDHIAKLASPF  186

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
              LV +G+FS+P++ PGT  NRA+K  + +R +L  +IK RK      + GK   + +D+L
Sbjct  187   NLVVSGIFSIPIDLPGTPLNRAIKASNFIRTELFAIIKRRKKDL---AEGKASPK-QDIL  242

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               +L   DE+G  +NE  I   I+ +L   + STSAA  F++K+LAELPHIY+ VYKEQ+
Sbjct  243   SHMLLACDEKGSFMNELNIADTILALLASAHESTSAACAFIVKYLAELPHIYEGVYKEQM  302

Query  1034  EIAKSKGP-NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             EI+++K P +E L+W DIQKM+YSW V  E LRL P      RE + DF + GF IPKGW
Sbjct  303   EISETKAPGDELLNWNDIQKMRYSWKVIREVLRLCPTFPN-VREAIHDFDFNGFLIPKGW  361

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +WN  STH+NP+YF EP++FDPSR+EGNGPAP+TFVPFGGGP MCPG+ +ARLE+L+F
Sbjct  362   KVYWNANSTHRNPEYFPEPERFDPSRFEGNGPAPYTFVPFGGGPMMCPGQGFARLEMLIF  421

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHN+V  FK +KL+ +EKIV+N   P+P  G+P+RL PH+
Sbjct  422   MHNLVKRFKFDKLIADEKIVFNPM-PVPEKGVPIRLIPHR  460



>gb|AHA50080.1| cytochrome P450 [Eleutherococcus senticosus]
Length=469

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 310/454 (68%), Gaps = 19/454 (4%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +S+  LPPG TGWP+IGE ++ +       PEK+I+ RM KYSP VF TS+ GEK+A+FC
Sbjct  26    SSQNKLPPGKTGWPIIGETLEYLSWGQKGCPEKFITQRMNKYSPHVFTTSLAGEKMAIFC  85

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             GA+GNKF F+NEN L+ +WWP +++K +      + ++ K   + R  I E  K E L  
Sbjct  86    GASGNKFMFSNENKLVVSWWPPAISKIV---NSTKPSVEKSKAV-RNLIVEFLKPEALHK  141

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             +IP +D   + H   EW    EVK +ALS+  TF LAC+L  SI+D   VK L      V
Sbjct  142   FIPVMDRTTRLHFEAEWGGTTEVKAFALSEMLTFELACRLLCSIDDPVHVKTLSCLFAKV  201

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
               G+ SLP++FPGTA+N  +K  +++R+ L  +I++R++        K++  G D+L  +
Sbjct  202   KAGLMSLPIDFPGTAFNSGIKAANLIRKDLSVLIEQRRSD-------KLQIRG-DLLSHI  253

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             L    E+ + L+E +I   ++G+L+ ++ +TS+ +  V+ FL + P IY +V  EQ+EIA
Sbjct  254   LISNGEDEKILSEMDIADVVLGLLIASHDTTSSVMASVVYFLTDHPGIYAKVLTEQMEIA  313

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSK   + L+WE+IQ+MKYS NV  E +RL PP QGGF+E +++F+YA F IPKGWK FW
Sbjct  314   KSKRAGDLLTWENIQRMKYSRNVINEVMRLVPPSQGGFKEVISEFSYADFIIPKGWKIFW  373

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +V+STHK+PKYF  P++FDP R+EG+GP PFTF+PFGGGPRMCPG E+AR+E+L+FMH++
Sbjct  374   SVHSTHKDPKYFKNPEEFDPPRFEGDGPMPFTFIPFGGGPRMCPGNEFARMEVLIFMHHL  433

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             V NF+ EK+ PNEKI+Y S  P P  GLP+RL+P
Sbjct  434   VMNFRWEKVFPNEKIIYTSF-PFPEKGLPIRLSP  466



>ref|XP_007139496.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
 gb|ESW11490.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
Length=475

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 317/465 (68%), Gaps = 20/465 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             +++   A +S PNLPPG+ G+P IGE+I+ +       PEK+I +RM KYS +VFKTS+ 
Sbjct  23    LFYSHYAQSSDPNLPPGNMGFPAIGESIEYLSLGWKGHPEKFIYERMAKYSSKVFKTSLF  82

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE   + C A  NKF F+NEN L+ +WWP +V K  +FP+  + + +      R  + + 
Sbjct  83    GESTVMLCEAECNKFLFSNENKLVVSWWPDNVNK--IFPSSLETSSKVEAKKLRQMLPQF  140

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
                + L+ Y+  +D++A+ H A EW     V V+ L+K YTF +AC+LFL+++D   V  
Sbjct  141   LSAQALQGYVGIMDTVAQRHFASEWENNTSVIVFPLAKSYTFWVACRLFLNVDDPIHVAN  200

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L +    ++ G+ S+P++ PGT +N+A+K   +++ +L+++I++RK + + N    V   
Sbjct  201   LAESFNKIAPGIMSVPIDLPGTPFNKAIKASVIIKEKLLKIIRQRK-EDLANGTASVT--  257

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP-HIYQQ  1015
              +D+L  +LS  DE GQ++ +  I   I+G+L+  + + S+A TFV+K+LAELP +IY  
Sbjct  258   -QDILSHMLSSCDENGQYMADRYIADKILGLLIGGHDTASSACTFVVKYLAELPPNIYDN  316

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             VYKEQ+EIAKSKGP E L+W+DIQKMKYSWNVACE +RL PP QG FRE + DF + GF 
Sbjct  317   VYKEQMEIAKSKGPGELLNWDDIQKMKYSWNVACEVMRLAPPLQGSFREAMNDFMFNGF-  375

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARL  1375
             IPKGWK +WN  STH+NP+ F EP+KF     EG GPAP+TFVPFGGGPRMCP KEYA++
Sbjct  376   IPKGWKLYWNASSTHRNPECFPEPEKF-----EGRGPAPYTFVPFGGGPRMCPEKEYAQM  430

Query  1376  EILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             EILVFMHN+V  FK E ++PNEK++ +   P+P  GLPVRL PH+
Sbjct  431   EILVFMHNLVKRFKWEAMIPNEKVIIDPL-PVPAKGLPVRLYPHK  474



>emb|CDP04721.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 302/459 (66%), Gaps = 11/459 (2%)
 Frame = +2

Query  143   FITKANTSKPN-LPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVA  313
             F+++   SK + LP G+ G PV+GE +      PEK+I  RM+KYS EVF TS+ G+KVA
Sbjct  23    FLSQRFKSKTSILPTGTFGLPVVGETLHFFSSGPEKFIHQRMEKYSAEVFATSLFGKKVA  82

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH-EIFKLE  490
             V CGAAGNKF     N  L  W P + +K +        ++R++    RT +H E+   +
Sbjct  83    VVCGAAGNKFLLYTANDQLAPWLPSAASKLMDLVDSPGQSVRQVISKCRTFLHNEVLNPK  142

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ YI  +D++A+EHI  EW P + ++VY L + Y  +L+C+L L +ED  +++R+ D 
Sbjct  143   TLRQYITIMDALAREHIKTEWDPSKVIQVYPLCQMYALSLSCRLLLGLEDACQIQRISDS  202

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               ++  G+FS+P+N PGT YNRA+K    V+ Q + +I +++     ++       G DV
Sbjct  203   FWIIMQGLFSMPINMPGTRYNRALKEVKRVKHQFLNIIAKKRDMVFQDT----GSAGSDV  258

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L R+L   +     +++ EI  Y++ ++LP+Y   SA ITF L  LAELPHIY+ VYKE 
Sbjct  259   LSRIL--LEGNAYSMSDSEIGAYLLTLMLPSYEGISATITFALNHLAELPHIYEGVYKEL  316

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIA+SK P E L+WED++KMKYSWNV CE++RL PP  G FRE + D  +AG TIP+GW
Sbjct  317   MEIARSKAPEELLNWEDVKKMKYSWNVICESMRLTPPSMGTFREALIDINFAGITIPRGW  376

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K  W+ ++T+KN KYF +P+ FDP+RYEG+GP   TF+PF  GPRMCPGK+Y+   ILV+
Sbjct  377   KMHWSPFTTNKNHKYFPDPEAFDPTRYEGDGPTSCTFLPFSAGPRMCPGKDYSMFLILVY  436

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             ++NVVT FK++KL+ +EK+ Y    P+P NGLP+RL  H
Sbjct  437   VYNVVTRFKLQKLIQDEKMRYR-VGPVPANGLPMRLQTH  474



>gb|EPS63621.1| hypothetical protein M569_11161, partial [Genlisea aurea]
Length=476

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/451 (47%), Positives = 303/451 (67%), Gaps = 13/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
              LPPG++GWPV+GE+I  +       P K+  DR+ +YS +VF+T+I GEK AVF GAAG
Sbjct  33    QLPPGTSGWPVLGESIPFLSTTWKGHPHKFFFDRIDRYSSKVFRTNIFGEKAAVFSGAAG  92

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NK+ F++EN  + +W   S  K  +FP+      R+  +  R  +    K E L  YI  
Sbjct  93    NKYLFSHENKTVQSWLMPSFDK--IFPSTINIPPRQEGLRLRKLLPGYVKAEALSGYIGI  150

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +   H AE W     V V   +K +TF +AC+LFLSI+D   V     P  ++++G+
Sbjct  151   MDEIGNRHFAEFWENKESVVVVPTTKRFTFLIACRLFLSIDDPVAVAEFAKPFNVLNSGL  210

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              S P+N PGTA+NRA+K    +R  L   I+ R+ + +  +        +D+L  ++S T
Sbjct  211   ISFPINLPGTAFNRAIKASKQIRNDLALRIRRRREEMLAGN----TQVPKDILTHMVSTT  266

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE+G+ ++E +I   I+G+L+  + +TS   TF++KFLAELPH+Y+ VY+E ++I ++K 
Sbjct  267   DEDGKLMDEMDIACKIVGLLVAGHDTTSTICTFIVKFLAELPHVYEAVYQEHMKILETKK  326

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L WED+QKMKYSWNVACEALRL+PP QGGFRE + DF Y GF IPKGWK +W+  S
Sbjct  327   QGEPLKWEDMQKMKYSWNVACEALRLYPPVQGGFREAIDDFNYNGFHIPKGWKIYWSTTS  386

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             +H+NP++F +P+KF+PSR+EG GP P++F+PFGGGPRMCPGKEY+RLE+L+F+H++V  +
Sbjct  387   SHRNPEHFPDPEKFEPSRFEGAGPEPYSFIPFGGGPRMCPGKEYSRLEVLIFIHHLVKRY  446

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             + EK++P+EKI  N   P PV GLP+RL PH
Sbjct  447   RWEKIIPDEKITINPF-PAPVKGLPIRLFPH  476



>emb|CDP19705.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   427 bits (1099),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 220/487 (45%), Positives = 303/487 (62%), Gaps = 43/487 (9%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENID---LMVPEKYISDRMKKYSPEVFKTSILGEKV  310
             +   ++++ K  LPPG++G P++GE +    L  PEK+I  RMKKYS EVF TS++G+ +
Sbjct  22    FLCHRSDSKKCKLPPGTSGLPLVGETLHFFYLSGPEKFIHQRMKKYSDEVFATSLIGQNM  81

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE-----  475
             AV CGAAGNKF     N  ++ W P   ++   +      + + +     T IH      
Sbjct  82    AVICGAAGNKFLLCTANDFVSPWLPAVQSRFSNWVVSLGKSRKDV----HTKIHGFHQAV  137

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
             I   E LK YIP +DS+ ++H+  +W PF+ VKVY  S+  T  LACKL L + D D  +
Sbjct  138   IMSPEALKQYIPIMDSLTRQHLQTDWDPFQVVKVYPASQKLTLILACKLVLGL-DPDRAQ  196

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R  D   +   G FSLP+N PGT YNRA+K    +++  +++I ERK   + N     E 
Sbjct  197   RFSDSFAVAQQGFFSLPINLPGTTYNRAVKEVEKLKQGFLKIILERKKMVLENR----EK  252

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
              G D+L R L   DE    L++ EI  Y++ +++P+Y  TS++ITFVLK L+ELPHIY  
Sbjct  253   AGSDILSRTL--LDENVHLLSDLEIALYLVSLMIPSYEPTSSSITFVLKHLSELPHIYDM  310

Query  1016  VYK-----------------------EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEAL  1126
             VYK                       + +EIAKSK P E L+WED++KMKYSWNV CEA+
Sbjct  311   VYKGTLRGNKIFFINYSISAGVVRSEQHMEIAKSKDPEELLNWEDVKKMKYSWNVICEAM  370

Query  1127  RLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGP  1306
             RL PP  G +R   TD  +AG TIPKGWK  W+ ++T+KNPKYF EP+ FDP+R+EG+GP
Sbjct  371   RLTPPAIGSYRVAKTDIHFAGITIPKGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDGP  430

Query  1307  APFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGL  1486
              P TF+PF  GPRMCPGKEY+R  ILV+M+NVV  FK++KL+P+EK++Y  A P P +GL
Sbjct  431   TPCTFIPFSTGPRMCPGKEYSRFLILVYMYNVVRKFKLQKLIPDEKVLYRGA-PYPASGL  489

Query  1487  PVRLTPH  1507
             P+ L PH
Sbjct  490   PMSLQPH  496



>ref|XP_006372166.1| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
 gb|ERP49963.1| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
Length=393

 Score =   421 bits (1082),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 214/396 (54%), Positives = 277/396 (70%), Gaps = 7/396 (2%)
 Frame = +2

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             G AGNKF F+NEN L+ TWWP+ V K  +FP+  + + ++     R       K E L+ 
Sbjct  4     GVAGNKFLFSNENRLVETWWPEFVNK--IFPSAVEKSPKEEAKRMRRLFPPFLKPEALRR  61

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             YI T+D + K H A EW    EV V+ L+K YTF LAC+LFLSIED   + R   P   +
Sbjct  62    YIGTMDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHI  121

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
             ++G+F++P+ FPGT +NRA+K   ++R +L+ +I++RK      + GK     +D+L  +
Sbjct  122   TSGIFTIPIAFPGTPFNRAIKATKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHM  177

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             L   D  GQ++NE EI   II +LL  + ST  A TF++K+LAE+PHIY+ VYKEQ EI 
Sbjct  178   LLSNDANGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEII  237

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
             KSK P E L+W DIQKMKYSWNVACE LRL PP  G F+E + DFT+ GF IPKGWK +W
Sbjct  238   KSKAPGELLNWVDIQKMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKLYW  297

Query  1223  NVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             +  STHKNP+YFSEP+KFDPSR+EG GPAP+TF+PFGGGPRMCPG EYARLEILVFMHN+
Sbjct  298   SASSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEILVFMHNL  357

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             V  FK E+LV +EKIV++  +P P  GLPVRL PH+
Sbjct  358   VKRFKFERLVLDEKIVFDP-TPKPERGLPVRLLPHK  392



>ref|XP_011017724.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 302/466 (65%), Gaps = 16/466 (3%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  295
             II    ++     NLPPGS+G P IGE ++++       P+K+  DR+ KY  +VFKT++
Sbjct  21    IIVHKHRSKFKHSNLPPGSSGLPYIGETLEVLSTGWKGHPQKFFLDRIDKYESQVFKTNL  80

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
               +   V CGA+GNKF F+ EN +L  W+P  V K  +FP+ AQ +  +     RT + E
Sbjct  81    FCQTAVVLCGASGNKFMFSKENKVLKAWYPDFVCK--IFPSSAQRSPIEQVDRLRTLLPE  138

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               + E LK Y+   D++A  H   EW   +EV V+ L+K  TF LAC+LFLSIED D + 
Sbjct  139   FLRPEALKRYVGIFDTVAGRHFESEWEN-KEVVVFPLAKSLTFGLACRLFLSIEDPDHIA  197

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             +L  P  LV +G+FS+P++ PGT  NRA+   + +R +L  +IK+RK         +   
Sbjct  198   KLASPFNLVVSGIFSIPIDLPGTPLNRAITASNFIRTELFAIIKQRKKDLAEGKAAR---  254

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
               +D+L  +L   D++G  ++E  I   I+ +L   + STSAA  F++K+LAELPHIY+ 
Sbjct  255   -KQDILSHMLLACDDKGAFMSELSIADTILALLASAHESTSAACAFIVKYLAELPHIYEG  313

Query  1016  VYKEQIEIAKSKGP-NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             VYKEQ+EI+++K P +E L+W DIQKMKYS  V  E LRL P      RE + DF +  F
Sbjct  314   VYKEQMEISETKAPGDELLNWNDIQKMKYSRKVIREVLRLCPTFPN-VREAIHDFDFNCF  372

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYAR  1372
              IPKGWK +WN  STH+NP+YF EP++FDPSR+EGNGPAP+TFVPFGGGP MCPG ++AR
Sbjct  373   LIPKGWKVYWNANSTHRNPEYFPEPERFDPSRFEGNGPAPYTFVPFGGGPMMCPGHQFAR  432

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             +E+LVF+HN+V  FK +K V  EKIV+N   PIP  G+P+RL PH+
Sbjct  433   IEMLVFIHNLVKRFKFDKFVAEEKIVFNPM-PIPEKGVPIRLFPHR  477



>ref|XP_004308257.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   421 bits (1081),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 221/474 (47%), Positives = 308/474 (65%), Gaps = 32/474 (7%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP----EVFKTSILGEKVAVFC  322
              LPPGSTGWP+IGE ++ +      VPEK+I+DR  K+S     +VFKTS+L E +AV C
Sbjct  40    QLPPGSTGWPIIGETLEYLSTAKQGVPEKFIADRRNKHSSSVPCKVFKTSLLQESMAVLC  99

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
              AAGNKF F+NEN L+ +WWP +  K  +F    +    + +I  R  +    K + L  
Sbjct  100   TAAGNKFLFSNENKLVKSWWPANFEK--IFANSEKTDTTQESIRLRKVLSPFLKPDALHR  157

Query  503   YIPTIDSMAKEHIAEEWAPFREV------------KVYALSKYYTFALACKLFLSIEDRD  646
             YI  +D + K+H+   W+    V            KV+ L+K YTF LACKLFL+IED  
Sbjct  158   YIGAMDEVTKQHLNMYWSCSSSVDYVKEEDESVIIKVHPLAKKYTFTLACKLFLNIEDPK  217

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKA------KAM  808
              V +L + I  +S+G  SLP+NFPGT +NRA++    +++++ E++K+R+          
Sbjct  218   LVAKLEELIRHISSGFISLPINFPGTKFNRAIRASKQIKKEIEEMVKQRRIDLHPHLSDT  277

Query  809   MNSLGKVEDEGRDVLGRLLSVTDEEGQHL-NEFEIYHYIIGILLPTYHSTSAAITFVLKF  985
              NS        +D+L RLL  T  +G+ L  E +I + + G+++  Y + S  +  ++ F
Sbjct  278   SNSNHHHHYHDQDLLSRLLVETYSDGKELMTESDIANKLYGLIVGAYDNISTTLVSIIMF  337

Query  986   LAELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRET  1165
             L++LPH+Y  V KEQ+EIA+SK   E L+WE++QKMKYSW+VACEALRL PP  G FRE 
Sbjct  338   LSKLPHVYDAVLKEQMEIAESKAEGELLNWEELQKMKYSWSVACEALRLLPPILGTFREA  397

Query  1166  VTDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPR  1345
             +TDF+Y G+ IPKG K  WN Y+THKNP+YF EP+KFDPSR++  GPAP+++VPFGGGPR
Sbjct  398   ITDFSYEGYIIPKGMKLHWNTYATHKNPEYFPEPEKFDPSRFQRQGPAPYSYVPFGGGPR  457

Query  1346  MCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             MCPGKEYAR +ILVFMHNVVT FK E + P+EK++ +    +P  GL +RL PH
Sbjct  458   MCPGKEYARFKILVFMHNVVTRFKWEMVFPDEKMIMDPVL-VPTKGLTIRLFPH  510



>ref|XP_009364167.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=415

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/415 (50%), Positives = 282/415 (68%), Gaps = 7/415 (2%)
 Frame = +2

Query  269   SPEVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKIT  448
             S ++FKTS+ G++ A F GAAGNKF F+NEN L+  WWP  V K  +FPT A  +  K  
Sbjct  6     SSQIFKTSLFGKQAAFFYGAAGNKFLFSNENRLVNVWWPDHVNK--IFPTSADVSATKEA  63

Query  449   ILNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFL  628
             I  +  I    K E LK YI  +D++ ++H A  W   ++V V+ L+K YT A+A +LFL
Sbjct  64    IKLKKLIPNFMKPEALKRYIGIMDAITQKHFANSWENKQQVHVFPLAKNYTLAIAARLFL  123

Query  629   SIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAM  808
             S+ED+ ++ +L   + L + G+ S+P++FPGT   +A+K   ++   L E+IK+RKA   
Sbjct  124   SLEDQKDIDKLGHYLYLANAGVISMPIDFPGTPLRKAIKASKLINGMLTEIIKQRKADL-  182

Query  809   MNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFL  988
               + GK     +D+L  +L   DE+G ++ E +I   I+G+L+  Y +T A  T ++KFL
Sbjct  183   --ANGKASPT-QDILSHMLMTCDEDGTYMKELDISTKIMGLLIGGYEATGAVCTLIVKFL  239

Query  989   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETV  1168
             AELPHIY  VYKEQ+EIA SK   E L+W+DIQKMKYSWNVA E +RL PP QG FRE  
Sbjct  240   AELPHIYDAVYKEQMEIANSKALGELLNWDDIQKMKYSWNVAQEVMRLTPPIQGSFREAT  299

Query  1169  TDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRM  1348
             TDF + G+TIP GW  +W+  +THK+  YF EPDKFDPSR+EG GPAP T+VPFGGGP M
Sbjct  300   TDFVFNGYTIPNGWILYWSSITTHKSADYFQEPDKFDPSRFEGTGPAPCTYVPFGGGPMM  359

Query  1349  CPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             CPGKEYAR+EILVFMHN+V  FK E+L+P EKIV +  + +P  GLP+RL PH +
Sbjct  360   CPGKEYARMEILVFMHNLVKRFKCERLLPQEKIVMDPLA-MPAKGLPIRLFPHNH  413



>ref|XP_002324668.2| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
 gb|EEF03233.2| hypothetical protein POPTR_0018s13380g [Populus trichocarpa]
Length=399

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 214/402 (53%), Positives = 277/402 (69%), Gaps = 13/402 (3%)
 Frame = +2

Query  323   GAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKH  502
             G AGNKF F+NEN L+ TWWP+ V K  +FP+  + + ++     R       K E L+ 
Sbjct  4     GVAGNKFLFSNENRLVETWWPEFVNK--IFPSAVEKSPKEEAKRMRRLFPPFLKPEALRR  61

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             YI T+D + K H A EW    EV V+ L+K YTF LAC+LFLSIED   + R   P   +
Sbjct  62    YIGTMDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARFSHPFNHI  121

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
             ++G+F++P+ FPGT +NRA+K   ++R +L+ +I++RK      + GK     +D+L  +
Sbjct  122   TSGIFTIPIAFPGTPFNRAIKATKLIRIELLAIIRQRKKDL---AEGKA-SPTQDILSHM  177

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             L   D  GQ++NE EI   II +LL  + ST  A TF++K+LAE+PHIY+ VYKEQ EI 
Sbjct  178   LLSNDANGQYMNEVEIADKIIALLLGAHDSTGTACTFIVKYLAEMPHIYEAVYKEQAEII  237

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKT--  1216
             KSK P E L+W DIQKMKYSWNVACE LRL PP  G F+E + DFT+ GF IPKGWK   
Sbjct  238   KSKAPGELLNWVDIQKMKYSWNVACETLRLSPPFIGNFKEAIKDFTFNGFAIPKGWKASH  297

Query  1217  ----FWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
                 +W+  STHKNP+YFSEP+KFDPSR+EG GPAP+TF+PFGGGPRMCPG EYARLEIL
Sbjct  298   FLTLYWSASSTHKNPEYFSEPEKFDPSRFEGKGPAPYTFIPFGGGPRMCPGNEYARLEIL  357

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             VFMHN+V  FK E+LV +EKIV++  +P P  GLPVRL PH+
Sbjct  358   VFMHNLVKRFKFERLVLDEKIVFDP-TPKPERGLPVRLLPHK  398



>gb|KFK23969.1| hypothetical protein AALP_AAs58682U000100 [Arabis alpina]
Length=473

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 308/459 (67%), Gaps = 18/459 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMVP------EKYISDRMKKYSPEVFKTSILGEKVAV  316
             ++ S P LPPG  G+P++GE+   +        EK+I+DR+ ++S +VFKT I G   AV
Sbjct  26    SHFSYPKLPPGKIGFPLVGESFSFLSAGRKGHQEKFITDRVSRFSSDVFKTHIFGSPTAV  85

Query  317   FCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENL  496
               GA+GNKF FTNEN L+ +WWP SV K  +FP+  + + ++     RT +    K E L
Sbjct  86    VTGASGNKFLFTNENKLVVSWWPDSVNK--IFPSSMETSSKEEAKKMRTLLLPFLKPEGL  143

Query  497   KHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPII  676
             + Y+  +D +A+ H   EWA   ++ V  L+K +TF++AC+LFLS++D + V++L +P  
Sbjct  144   RSYVGVMDEIARRHFETEWANQDQLIVLPLTKKFTFSIACRLFLSMDDPERVRKLEEPFN  203

Query  677   LVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLG  856
              V+ G+FS+P+NFPGT +NRA+K   ++R+++  ++++RK +      GKV  E +D+L 
Sbjct  204   TVAIGVFSIPINFPGTRFNRAIKASRLLRKEVSAIMRKRKEEV---KAGKVLAE-QDILS  259

Query  857   RLL-SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
              +L ++ + +  H+ +      IIG+L+  Y + S   TF++ FLA+ P +Y++V  EQ 
Sbjct  260   HMLMNIGETKDDHVAD-----KIIGLLIGGYDTASIVCTFIVSFLADFPDVYKRVLHEQQ  314

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EI   K  NE L WEDI+KM+YSWNVACE +R+ PP  G FRE +  F++ GF IPKGWK
Sbjct  315   EILTEKEGNEGLRWEDIEKMRYSWNVACEVMRIVPPLSGTFREAIEHFSFKGFYIPKGWK  374

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFM  1393
              +W+  +THKNP YF EP++F+P+R+EG+GP P+T+VPFGGGPRMCPG+EYARLEIL+FM
Sbjct  375   LYWSATATHKNPDYFPEPERFEPNRFEGSGPKPYTYVPFGGGPRMCPGREYARLEILIFM  434

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             H++VT +K EK+ P E  +     P+P  GLPVR++P  
Sbjct  435   HHLVTRYKWEKVFPKENKIVVDPLPLPAKGLPVRISPQS  473



>ref|XP_010098502.1| Cytochrome P450 [Morus notabilis]
 gb|EXB75162.1| Cytochrome P450 [Morus notabilis]
Length=479

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/470 (47%), Positives = 296/470 (63%), Gaps = 23/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             +I+  TK++ +   LPPGS GWP+IGE I+ +   PE ++  RM KYSP++FKT+ILGEK
Sbjct  20    LIFKSTKSSENSKTLPPGSMGWPIIGETIEFLFGKPENFVFKRMNKYSPDIFKTNILGEK  79

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG  G+KF F+NE   LT + P+S+ +       + N   K   L   +  E    
Sbjct  80    TAVICGPNGHKFLFSNEQKYLTAFRPRSMQRLF----RSYNKQHKAAQLQHASDEEAKKV  135

Query  476   -----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +D++ +E +   W    EVK Y L+K  T  LAC+ FL I D
Sbjct  136   LRSPGFLKPEGLIRYLSKMDAVTQEQMKNYWEGKNEVKAYPLAKILTLTLACRFFLGIGD  195

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              + + RL+D    V+ GM SL +NFPGT + RAMK  + +R++L  VI E+K KAM    
Sbjct  196   PERIARLVDNFDNVTVGMHSLIVNFPGTTFYRAMKAANTLRKELKAVIGEKK-KAMAAG-  253

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
                 +  +D+L  ++  +D  G+H+ E EI   I+G+L   Y + + A+ F +K++ E P
Sbjct  254   ----EAMQDILAHMIVASDASGKHMAEAEIADKIMGLLTAGYSTVATAMAFFMKYVGERP  309

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              +YQ+V  EQ EIA+SK   + L WEDI KMKYSWNV CE +RL PP QG FRE +TDFT
Sbjct  310   DVYQKVLAEQKEIAESKKRGDMLEWEDINKMKYSWNVLCEVMRLTPPLQGTFREALTDFT  369

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYE-GNGPAPFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V +T++NP+YF EP+KF+PSR++  N   PFTFVPFGGGPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNQNPEYFPEPEKFNPSRHDNANAFPPFTFVPFGGGPRMCPG  429

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEYARL IL F+HN+V  F+ E + PNEKI      P P  GLP+RL  H
Sbjct  430   KEYARLSILTFVHNIVKRFQWELVFPNEKI-EGDMMPTPEKGLPIRLRSH  478



>gb|KDP33425.1| hypothetical protein JCGZ_06996 [Jatropha curcas]
Length=473

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 309/474 (65%), Gaps = 36/474 (8%)
 Frame = +2

Query  134   IIYFITK-------ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP  274
             +IYF+ +       A TS P  PPGSTGWP+IGE ++ +      +PEK+I+DR  KYS 
Sbjct  20    VIYFLRQKPRKNGEARTSPP--PPGSTGWPLIGETMEYLSTTREGIPEKFINDRRNKYSS  77

Query  275   EVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLR-KITI  451
             ++FKTS+LG+ + + C A GNKF F+NEN L+++WWP SV K  +F  D+QN  + ++  
Sbjct  78    KLFKTSLLGQPMVLLCNAEGNKFVFSNENRLVSSWWPSSVDK--LF--DSQNESKGELAT  133

Query  452   LNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLS  631
               R  +  + K + L+ Y+  +D+  ++H+   W   + V+V+  +K  TF LAC+L L 
Sbjct  134   KMRKFVTPVLKSDMLRKYVDVVDAKTRQHLQNHWDGKQVVEVHPFAKDLTFVLACRLLLG  193

Query  632   IEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMM  811
             I+D + + +L       S G+ SLP++ PGT + RA+K    +R +   +IK+ KA    
Sbjct  194   IDDEEAIAQLQKSFEHFSAGLLSLPIDLPGTNFRRAIKEAKKLREEFEVMIKQWKANP--  251

Query  812   NSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLA  991
                     + + +L + L   +EEGQ   E EI   I+ ++  +Y + S AITFV+K+LA
Sbjct  252   -------SKSQGLLSQHL--INEEGQSSTESEIATRILALISASYDNVSTAITFVVKYLA  302

Query  992   ELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVT  1171
             E+P +Y+ V +EQ EIA++K   E L+W D+QKM+YSWNVA E LRL PP  G FRE + 
Sbjct  303   EMPDVYEAVLREQQEIARAKSSEELLNWHDVQKMRYSWNVASEVLRLHPPANGAFREVIA  362

Query  1172  DFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMC  1351
             DFTYAGF+IPKGWK  WN ++THK+P+YF +P+KFDPSR++GNG  P+++VPFGGG  MC
Sbjct  363   DFTYAGFSIPKGWKLHWNAFATHKSPEYFPDPEKFDPSRFDGNGIVPYSYVPFGGGAHMC  422

Query  1352  PGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPI--PVNGLPVRLTPH  1507
             PGKEYAR+ ILV MH+VV  FK+EK+ P+EKI+     P+  P  GLPVRL P+
Sbjct  423   PGKEYARIAILVLMHHVVIKFKLEKVFPDEKII---GLPVLRPAKGLPVRLIPN  473



>ref|XP_008227229.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=511

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 305/471 (65%), Gaps = 32/471 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY----------SPEVFKTSILGEK  307
             LPPGSTGWP+IGE ++ +      VPEK+I+DR  KY          + +VFKTS+L E 
Sbjct  40    LPPGSTGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSSANCKVFKTSLLFED  99

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILN-----RTNIH  472
             +AV C AAGNKF F+NE  L+ +WWP  + K L+F   A +   K  I       R  + 
Sbjct  100   MAVLCTAAGNKFLFSNEKKLVKSWWPPHLDK-LIFADSAPDKKAKAFITEESTRFRNTMA  158

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKYYTFALACKLFLSIED  640
                K   L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y F +AC+L L  ED
Sbjct  159   PYLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQVIKAHPLAKKYAFTMACRLMLDTED  218

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
             +    +L + +  +S+G  SLP++ PGT +NRA++G   +R ++  ++ +R+      S 
Sbjct  219   QQVFTKLENLMKDLSSGFTSLPIDLPGTQFNRAIQGSRQLREEIKNIVTQRRTHL---ST  275

Query  821   GKVEDE--GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAE  994
              KV+++  G D+L  L+  T   GQ L++ EI   + G+++  Y + S+ +  ++ +LAE
Sbjct  276   RKVDEDVDGLDILSSLIMDTSSNGQGLSDSEIASKLYGVIVSGYDNFSSTLATIVMYLAE  335

Query  995   LPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTD  1174
             LPH+Y  V KEQ +IA+SK   E L+W DIQKMKYSW+VACE +RL PP  G FRE ++D
Sbjct  336   LPHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREAISD  395

Query  1175  FTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCP  1354
             F Y G+ IPKG K  WNV+STHKNP+YF +P+KFDPSR+EG GP P++FVPFGGGPRMCP
Sbjct  396   FVYEGYLIPKGMKLNWNVHSTHKNPEYFPDPEKFDPSRFEGQGPPPYSFVPFGGGPRMCP  455

Query  1355  GKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             GKEY+RL++LVFMHNVV  ++ EK+ P+EK V++ A  +P  GLP+R+ PH
Sbjct  456   GKEYSRLKMLVFMHNVVNRYRWEKVFPDEKFVWDPAL-VPTKGLPIRVFPH  505



>ref|XP_002527982.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34394.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/454 (45%), Positives = 298/454 (66%), Gaps = 25/454 (6%)
 Frame = +2

Query  179   PPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  340
             PPG+TGWP+IGE ++ +      +PEK+I+DR K+YS ++FKTS+LG+   + C A GNK
Sbjct  40    PPGTTGWPLIGETLEYLSTTKAGIPEKFINDRRKRYSSKLFKTSLLGQPTVLLCNADGNK  99

Query  341   ffftnentllttWWPQSVTKPLMFPTDAQNTLR-KITILNRTNIHEIFKLENLKHYIPTI  517
             F F+NEN L+T+WWP SV K      D QN  + + ++  R  +  + K + L+ Y+  +
Sbjct  100   FIFSNENKLVTSWWPSSVDKFF----DTQNASKTEESMKMRKFVTPVLKPDTLRKYVHIV  155

Query  518   DSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGMF  697
             D++ ++H+ + W   + V+VY  +K  TF LAC+L L I+D + + +L  P    S G+ 
Sbjct  156   DAITRQHLRDHWGGKQVVEVYPFAKDLTFVLACRLLLGIDDEEAISQLQKPFAHFSAGLL  215

Query  698   SLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVTD  877
             SLPL+ PGT + RA+K    +R +   +IK  K             + + +L + L   +
Sbjct  216   SLPLDLPGTNFRRAIKAAKQLRNEFEVMIKRWKTDT---------SQSQGILSQHLVEIN  266

Query  878   EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKGP  1057
             EEGQ  +E E+   I+ ++  +Y + S A+TFV+K+LAE+P++Y  V +EQ+ IAK+K  
Sbjct  267   EEGQSTSESEMATRILALISASYDNVSTAMTFVIKYLAEMPNVYDAVLREQMGIAKAKEA  326

Query  1058  NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYST  1237
                L+W+DIQKM+YSWNVA E LRL PP  G FRE + +F YAG+ IPKGWK  WN ++T
Sbjct  327   EVGLNWDDIQKMRYSWNVASEVLRLHPPANGAFREVIHNFMYAGYLIPKGWKLHWNAFAT  386

Query  1238  HKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNFK  1417
             HK+ +YF EP+KF+PSR+EGNG  P+++VPFGGG  MCPGKEYAR+ +LV MHNVVTNFK
Sbjct  387   HKSAEYFPEPEKFEPSRFEGNGLVPYSYVPFGGGAHMCPGKEYARIAMLVLMHNVVTNFK  446

Query  1418  MEKLVPNEKIVYNSASPI--PVNGLPVRLTPHQN  1513
             +EK+ PNEK++     P+  P  GLP+RL P  +
Sbjct  447   LEKVFPNEKVI---GLPVLRPAKGLPLRLHPQHS  477



>ref|XP_011048168.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=497

 Score =   407 bits (1047),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 215/473 (45%), Positives = 301/473 (64%), Gaps = 25/473 (5%)
 Frame = +2

Query  134   IIYFITKANTSK----PNLPPGSTGWPVIGENIDLMV----PEKYISDRMKKYSPEVFKT  289
             ++YF+ K    +    P+LPPGS GWP++GE +  +     PE +++ RMKKY   VFKT
Sbjct  35    LLYFVIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  94

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT-----DAQNTLRKITIL  454
             S+ GE VAVF G AGNKF F+NEN L+  WWP SV K +         D    LRKI + 
Sbjct  95    SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSVKKLMRLSLANVVGDKAKRLRKILM-  153

Query  455   NRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSI  634
               T++      + LK YI  +D +A+ HI   W    +VKV+  +  YTF L+C+LF SI
Sbjct  154   --TSVDR----DALKSYIDRMDLVAQNHIRTHWEGKEQVKVHPTANLYTFELSCRLFASI  207

Query  635   EDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMN  814
             +D   + +L     +   G+   P+  PGT + RA K G  ++ ++  V ++R+A   +N
Sbjct  208   DDPIHISKLAHHFDIFLKGVIHFPIYIPGTTFYRASKSGDALKEEIRLVARQRRAA--LN  265

Query  815   SLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAE  994
                K+E   +D+L  LL   DE G+ L+E EI   ++ +L  ++ +T++A+T V+K+LAE
Sbjct  266   K--KMESHRKDLLSHLLVTADESGKLLSESEIVDNMLMLLFVSHETTTSAMTCVMKYLAE  323

Query  995   LPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTD  1174
             +P +Y+ V +EQ++IAKSK   E L WEDIQKMKYSW V  E LR+ PP  G FR+ + D
Sbjct  324   MPEVYEMVLREQLDIAKSKEAGELLKWEDIQKMKYSWRVVSEVLRMIPPISGTFRQAIVD  383

Query  1175  FTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCP  1354
             FTYAG+TIPKGWK +W+  +T K+P +F   + FDPSRYEG GPAP+T VPFGGGPRMC 
Sbjct  384   FTYAGYTIPKGWKLYWSPNTTTKDPAHFPNAEDFDPSRYEGEGPAPYTHVPFGGGPRMCL  443

Query  1355  GKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             G EY R +ILVF+HN+V  FK + L+P+EK+ YN   P P NGLP+R+ PHQ+
Sbjct  444   GYEYVRPKILVFLHNIVKRFKWDLLIPDEKVPYNPL-PAPSNGLPIRIQPHQS  495



>ref|XP_011048169.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score =   406 bits (1044),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 300/468 (64%), Gaps = 21/468 (4%)
 Frame = +2

Query  137   IYFITKANTSK----PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFK  286
             +Y ITK    +    P+LPPGS GWP+IGE ++ +       P+ ++ DRM+K  P++FK
Sbjct  18    LYIITKTLKERLIPNPHLPPGSLGWPLIGETLNYLGACLAGRPDWFLRDRMEKLDPQIFK  77

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPL--MFPTDAQNTLRKITILNR  460
             TS+ GE VAVFCG AGNKF F+NEN L+  WWP+SV K L       A +  ++I    R
Sbjct  78    TSLFGETVAVFCGPAGNKFLFSNENKLVNLWWPRSVKKLLKSSLVNVAGDEAKRI----R  133

Query  461   TNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
             + +      + LK YI  +D + + HI+  W    EVKV+     YTF L+C+LF+SI+D
Sbjct  134   SILLTFLNPDALKKYIERMDLVTQHHISTLWEGKEEVKVHPTVNLYTFELSCRLFISIDD  193

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
                + +L     +   G+   P+N PGT + RA K    ++ +L  +I  R+  A+    
Sbjct  194   PLHISKLAHQFDVFLKGVIHFPINIPGTRFYRASKAAVAIKEEL-RLISRRRRAALDK--  250

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
              K+    +D+L  LL  +D  G+ L+E EI   I+ +L  ++ +T++ IT V+K+LAELP
Sbjct  251   -KMASPTQDLLSHLLVTSDASGKFLSETEIVDNILLLLFASHDTTTSVITCVMKYLAELP  309

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              +YQ+V +EQI+IAKSK P E L WEDIQKM+YSWNV  E LRL PP +G FRE + DFT
Sbjct  310   EVYQKVMREQIDIAKSKEPGELLKWEDIQKMRYSWNVVSEILRLMPPVRGAFREAIVDFT  369

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGK  1360
             YAG+TIPKGWK +W+  +T K+P  F   ++FD SRY+G GPAP+++VPFGGGPR+C G 
Sbjct  370   YAGYTIPKGWKVYWSPMTTSKDPTLFPNAEQFDASRYDGAGPAPYSYVPFGGGPRICLGN  429

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             EYAR +ILVF+HN+V  FK + ++P+EKI Y+   P P  GLP+RL P
Sbjct  430   EYARPQILVFLHNIVKRFKWDLMIPDEKIPYDPM-PAPSQGLPIRLRP  476



>ref|XP_006405735.1| hypothetical protein EUTSA_v10027740mg [Eutrema salsugineum]
 gb|ESQ47188.1| hypothetical protein EUTSA_v10027740mg [Eutrema salsugineum]
Length=475

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 299/460 (65%), Gaps = 18/460 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEV--FKTSILGEKV  310
             ++ S PNLPPG+ G+P IGE+   +       PEK+I+DR+ ++S  V  FKT I G   
Sbjct  26    SHFSYPNLPPGNAGFPFIGESFSFLSAGRKGHPEKFITDRVHRFSSSVGIFKTHIFGTPT  85

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV  GA+GNKF FTNEN L+ +WWP+SV K  +FP+  +  + + +   RT +    K E
Sbjct  86    AVVMGASGNKFLFTNENKLVVSWWPESVKK--IFPSTVKMNINEGSKKLRTLVTPFLKPE  143

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ Y+  +D +A  H   EWA   ++ V+ L+K +TF++AC+L LS++D + V++L +P
Sbjct  144   ALRRYVGIMDEIASRHFETEWANQDQLIVFPLTKKFTFSIACRLLLSMDDPERVRKLEEP  203

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               +V  GMFS+P++ PGT ++RA+K   ++R++++ +++ RK +       +      D+
Sbjct  204   FRMVIVGMFSVPIDLPGTRFSRAIKASRLIRKEVIAIMRMRKEELK----ARKASAEHDI  259

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  LL    E        ++   IIG+L+  Y + S   TFV+ +LAE PH+Y+ V +EQ
Sbjct  260   LSHLLMSIGETKDE----DVADKIIGLLVGGYDTASIVCTFVVHYLAEYPHVYEHVLQEQ  315

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
              EI K K   E L WEDI+KM++SWNVACE +R+ PP  G FRE +  F++ GF IPKGW
Sbjct  316   KEILKGKQEKEGLRWEDIEKMRFSWNVACEVMRMVPPISGTFREAIDHFSFKGFYIPKGW  375

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+  +THKNP YF EP+KF+P+R+EG+GP P+T+VPFGGGP+MCPGKEYARLEIL+F
Sbjct  376   KLYWSANATHKNPDYFPEPEKFEPNRFEGSGPRPYTYVPFGGGPKMCPGKEYARLEILIF  435

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             +H++V  FK EK+ P E  +     P+P  GLP+R+ P  
Sbjct  436   IHHLVKRFKWEKVFPKETKIVFDPLPVPAKGLPIRIFPQS  475



>ref|XP_007206798.1| hypothetical protein PRUPE_ppa025666mg [Prunus persica]
 gb|EMJ07997.1| hypothetical protein PRUPE_ppa025666mg [Prunus persica]
Length=524

 Score =   405 bits (1040),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 210/466 (45%), Positives = 303/466 (65%), Gaps = 31/466 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY---------SPEVFKTSILGEKV  310
             LPPGSTGWP+IGE ++ +      VPEK+I+DR  KY         + +VFKTS+L E +
Sbjct  40    LPPGSTGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSANCKVFKTSLLFEDM  99

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILN-----RTNIHE  475
             AV C AAGNKF F+NE  L+ +WWP  + K L+F   A +   K  I       R  +  
Sbjct  100   AVLCTAAGNKFLFSNEKKLVKSWWPPHLDK-LIFADSAPDEKAKAFITEESTRFRNTMAP  158

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKYYTFALACKLFLSIEDR  643
               K   L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y F +AC+L L  ED+
Sbjct  159   YLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQVIKAHPLAKKYAFTMACRLMLDTEDQ  218

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
                 +L + +  +S+G  SLP++ PGT +NRA++G   +R ++  ++ +R+      S  
Sbjct  219   QVFTKLENLMKDLSSGFTSLPIDLPGTQFNRAIRGSRQLREEIKNIVTQRRIHL---STR  275

Query  824   KVEDE--GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAEL  997
             KV+++  G D+L  L+  T  +G  L++ EI   + G+++  Y + S+ +  ++ +LAEL
Sbjct  276   KVDEDVDGLDMLSSLIMDTGSDGLGLSDSEIASKLYGVIVSGYDNFSSTLATIVMYLAEL  335

Query  998   PHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
             PH+Y  V KEQ +IA+SK   E L+W DIQKMKYSW+VACE +RL PP  G FRE ++DF
Sbjct  336   PHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREAISDF  395

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              Y G+ IPKG K  WNV+STHKNP+YF +P+KFDPSR+EG GP P++FVPFGGGPRMCPG
Sbjct  396   VYEGYLIPKGMKLNWNVHSTHKNPEYFPDPEKFDPSRFEGQGPPPYSFVPFGGGPRMCPG  455

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVR  1495
             KEY+RL++LVFMHNVVT ++ EK+ P+EK V++ A  +P  GLP+R
Sbjct  456   KEYSRLKMLVFMHNVVTRYRWEKVFPDEKFVWDPAL-VPTKGLPIR  500



>ref|XP_009758679.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=476

 Score =   403 bits (1035),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 294/459 (64%), Gaps = 14/459 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + +++K  LPPGS GWPVIGE ID +   PEK++SDRMKKYSP++F T I+GEK AV CG
Sbjct  25    RLSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSDRMKKYSPDIFMTKIMGEKTAVICG  84

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIH----EIFKLEN  493
               G+KF F+NE  L T +   S+ K         ++    +    T +        K E 
Sbjct  85    PNGHKFLFSNEEKLFTAFRTHSMQKLFQSYQSNSSSSPSPSPSQSTRVMIRQPGFLKPEA  144

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             L  Y+  +D + +E +   W    E+K Y  +K+ T  LAC+ FL   + + + +L++  
Sbjct  145   LTRYLGEMDLITQELLQSHWEGKNEIKTYPFAKFLTLTLACRFFLGTNNSERITKLVNYF  204

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
               ++ G+ ++ LNFPGTA+ RA K    VRR+L+ VIKE+K + M N +     + +D+L
Sbjct  205   DDITLGLHAMLLNFPGTAFYRANKAAIAVRRELIGVIKEKKEE-MANGV-----KMQDIL  258

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               ++ VTD +G+ + E EI   I+G+L+  Y + +  ITF++K++ +   IY+++  EQ 
Sbjct  259   CHMIVVTDSKGKFMPENEIADKIMGLLVAGYSTVATTITFLMKYVGQRSDIYEKILIEQK  318

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EIA +K   E L WED+QKMKYSWNV CE +RL PP QG FR+ +TDFTYAG++IPKGWK
Sbjct  319   EIAGAKKAGEVLEWEDMQKMKYSWNVICETMRLTPPLQGTFRQVLTDFTYAGYSIPKGWK  378

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
              +W   ST+KNP YF +P++FDPSRYE  + P P+T+VPFGGGPRMCPGKEYARL IL F
Sbjct  379   VYWTASSTNKNPAYFQDPEEFDPSRYEKRDEPTPYTYVPFGGGPRMCPGKEYARLAILTF  438

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +HNVV  +K E L P+EK+V     P P  GLP+RL  H
Sbjct  439   LHNVVMKYKWELLAPDEKVV-GDMMPTPEKGLPIRLHQH  476



>ref|XP_002299097.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
 gb|EEE83902.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
Length=483

 Score =   403 bits (1035),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 299/473 (63%), Gaps = 25/473 (5%)
 Frame = +2

Query  134   IIYFITKANTSK----PNLPPGSTGWPVIGENIDLMV----PEKYISDRMKKYSPEVFKT  289
             ++YF  K    +    P+LPPGS GWP++GE +  +     PE +++ RMKKY   VFKT
Sbjct  21    LLYFAIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  80

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT-----DAQNTLRKITIL  454
             S+ GE VAVF G AGNKF F+NEN L+  WWP SV K +         D    LRKI + 
Sbjct  81    SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSVKKLMKLSLANVVGDEAKRLRKILM-  139

Query  455   NRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSI  634
               T++      + LK YI  +D +A+ HI   W   ++VKV+  +  YTF L+C+LF SI
Sbjct  140   --TSVDR----DALKSYIDRMDLVAQNHIRTRWEGKQQVKVHPTANLYTFELSCRLFASI  193

Query  635   EDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMN  814
             +D   + +L     +   G+   P+  PGT + RA K G  ++ ++  V ++R+A     
Sbjct  194   DDPIHISKLAHHFDIFLKGVIHFPIYIPGTTFYRASKSGDALKEEIRLVARQRRAALD--  251

Query  815   SLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAE  994
                K+E   +D+L  LL   DE G+ L+E EI   ++ +L  ++ +T++A+T V+K+LAE
Sbjct  252   --KKMESHRKDLLSHLLVTADESGKLLSESEIVDNMLMLLFVSHETTTSAMTCVIKYLAE  309

Query  995   LPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTD  1174
             +P +Y+ V +EQ++IAKSK   E L WEDIQKMKYSW V  E LR+ PP  G FR+ + D
Sbjct  310   MPEVYEMVLREQLDIAKSKEAGELLKWEDIQKMKYSWRVVSEVLRMIPPISGTFRQAIVD  369

Query  1175  FTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCP  1354
             FTYAG+TIPKGWK +W+  +T K+P +F   + FDPSRYEG GPAP+T VPFGGGPRMC 
Sbjct  370   FTYAGYTIPKGWKLYWSPNTTTKDPAHFPNAEDFDPSRYEGAGPAPYTHVPFGGGPRMCL  429

Query  1355  GKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             G EY R +ILVF+HN+V  FK + L+P+EK+ YN   P P +GLP+R+ PHQ+
Sbjct  430   GYEYVRPKILVFLHNIVKRFKWDLLIPDEKVPYNPL-PAPSHGLPIRIRPHQS  481



>gb|KHG26601.1| Cytochrome P450 protein [Gossypium arboreum]
Length=486

 Score =   403 bits (1035),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/481 (45%), Positives = 301/481 (63%), Gaps = 38/481 (8%)
 Frame = +2

Query  134   IIYFITKANTSKPN------LPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKT  289
             I++ +T A   KP       LPPGS GWP++GE ++ +   PE ++ +RM+KYSP +FKT
Sbjct  22    IVFVVTFALRPKPKSSLAKELPPGSLGWPIVGETLEFLFGNPENFVFNRMRKYSPRIFKT  81

Query  290   SILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPL-------------MFPTDAQN  430
              ILGE+  V CG  G+KF F+NE  L T +   S  K                F  D++ 
Sbjct  82    RILGEETVVICGPEGHKFLFSNEQKLFTAFRLHSTQKLFRSYQSSSAASVQSSFDADSKK  141

Query  431   TLRKITILNRTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFAL  610
              LR    L         K E L  Y+  +D++ ++ + + W    +VK + L+K  T  L
Sbjct  142   ILRSPGFL---------KPEALMRYLGKMDAITQQQMEKYWEKNDQVKAFPLAKTLTLTL  192

Query  611   ACKLFLSIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKE  790
             AC+ FL I++ + + RL+     ++ GM S+PL+FPGTA+ +A K  + +RR+L EVIKE
Sbjct  193   ACRFFLGIDEPERISRLVKRFDDITLGMHSIPLDFPGTAFYKANKAAAAIRRELKEVIKE  252

Query  791   RKAKAMMNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAIT  970
             +KA AM+  +       +D+L  ++  TD+ G+++ E EI   I+G+L+  Y + + A+T
Sbjct  253   KKA-AMVTGVVM-----QDILCHMIVATDKTGKYMAEAEIADKIMGLLVAGYSTVATAMT  306

Query  971   FVLKFLAELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQG  1150
             F +K++ E PHIY ++  EQ+++   K   E L W+DIQKMKYSWNV  E +RL PP QG
Sbjct  307   FFMKYVGERPHIYAKILAEQLQVEGDKKAGEMLEWDDIQKMKYSWNVMYEVMRLTPPLQG  366

Query  1151  GFRETVTDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRY-EGNGPAPFTFVP  1327
              FR  +TDFTYAG+T+PKGWK +W V +T+KNP+YFSEP+KFDPSRY EGN   PFT+VP
Sbjct  367   TFRVALTDFTYAGYTVPKGWKIYWTVSTTNKNPEYFSEPEKFDPSRYDEGNKLPPFTYVP  426

Query  1328  FGGGPRMCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             FGGG RMCPGKEYARL IL F+HNVV  F+ E + P EKIV     P P NGLP+RLTP 
Sbjct  427   FGGGLRMCPGKEYARLAILTFVHNVVKRFQWELVNPKEKIV-GDMMPTPDNGLPIRLTPR  485

Query  1508  Q  1510
              
Sbjct  486   H  486



>ref|XP_009337414.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=524

 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/460 (45%), Positives = 297/460 (65%), Gaps = 16/460 (3%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE ++ +      VPE ++ DR+ KY      S +VFKTS+L + +AV 
Sbjct  63    LPPGSTGWPIIGETLEYLSTGKKGVPENFVLDRINKYLSSAGNSCKVFKTSLLLQDMAVL  122

Query  320   CGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             C A GNKF F+NE  L+ +WWP  + K ++  ++    + + +   R  +    K   L+
Sbjct  123   CTAGGNKFLFSNEEKLVKSWWPAYLDKLIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  182

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              YI T+DS+ K+++   W    +VKV+  +K Y F LACKL L  ED   +  L   +  
Sbjct  183   KYIGTMDSVTKKYLVTYWDHKDQVKVHQHAKKYAFTLACKLMLDTEDPQLLGILQRLLKD  242

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDV  850
             +S+G  +LP++ PGT +NRA++    +R ++ +++ ER+ K   A  NS+   + +  D+
Sbjct  243   LSSGFTALPIDLPGTTFNRAIRASRQLREEIEKIVVERRIKLSTASANSMVDKDGDHGDM  302

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  LL  T  +G+ + E EI   + G+++  +   S+A+T ++ +LAELP +Y  V+KEQ
Sbjct  303   LSSLLMETYSDGKQITESEIADKLYGVIVAGHDGLSSALTTIMMYLAELPQVYDTVFKEQ  362

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIA SK   E L+W D+QKMKYSW+VACEA+RL PP  G FRE  TDF Y G  IPKG 
Sbjct  363   MEIANSKAAEELLNWGDVQKMKYSWSVACEAMRLLPPSLGTFREATTDFVYEGHLIPKGM  422

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +W+ +STHKNP+ F  P+KFDPSR+EG GP PF FVPFGGGPRMCPGKEYARL+ILVF
Sbjct  423   KLYWHPHSTHKNPECFPNPEKFDPSRFEGQGPPPFAFVPFGGGPRMCPGKEYARLKILVF  482

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHNVVT +K +K+ P+EK ++     +P  GLP++L PH 
Sbjct  483   MHNVVTKYKWDKVFPDEKFIWTPVL-LPTKGLPIKLFPHN  521



>emb|CDO98601.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   402 bits (1032),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 219/473 (46%), Positives = 297/473 (63%), Gaps = 33/473 (7%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
              LPPGS GWP+IGE ++ +   PEK++ DRMKKYSP++FKT ILGEK AV CG  G+KF 
Sbjct  14    KLPPGSFGWPIIGETMEFLFGKPEKFVGDRMKKYSPDIFKTKILGEKTAVICGPNGHKFL  73

Query  347   ftnentllttWWP---QSVTKPLMFPTDAQNTL--------------RKITILNRTNIHE  475
             F+NE  L T + P   Q + +       A  TL              RK  I   T +  
Sbjct  74    FSNEQKLFTAFRPHPTQRLFRSYQTKAGAGATLPPRPPPSTPVAADQRKPRIDEETKVIR  133

Query  476   ---IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
                  K E L  ++  I+S+ +  +        EVKV+ L+K  T  ++CK FL  ++ +
Sbjct  134   QPGFLKPEALARFLGKIESITRHLLQTHLEGKDEVKVFPLAKTVTLTISCKFFLGTDNPE  193

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + RL+D    V+ GM S+ +NFPGT +NRA +  + +R++L++VIKE+K +AM  + GK
Sbjct  194   RIARLVDHFDDVTVGMHSIMVNFPGTIFNRANQAAAAIRKELLDVIKEKK-EAM--AAGK  250

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                  +D+L  ++ VTD  G+ + E EI   I+G++   Y + +  ITF++K++ E P I
Sbjct  251   ---PMQDILSHMIVVTDATGKRMPEAEIADKIMGLITAGYSTVATTITFLMKYVGERPDI  307

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             Y ++  EQ+EIA SK P E L WED+QKMKYSW V CE +RL PP QG FRE +TDFTYA
Sbjct  308   YSKIRAEQMEIAASKKPGEFLEWEDMQKMKYSWTVICETMRLTPPLQGTFREVLTDFTYA  367

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRY----EGNGPAPFTFVPFGGGPRMCP  1354
             G+TIPKGWK +W V +T+ NP YF +P+KFDPSRY    EG G A +T+VPFGGGPR+CP
Sbjct  368   GYTIPKGWKVYWTVSTTNMNPAYFKDPEKFDPSRYDSSGEGRGVAAYTYVPFGGGPRLCP  427

Query  1355  GKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             GKEYARL IL F+HNVV N+K E L P+EKI      P P  GLP+RL P  +
Sbjct  428   GKEYARLAILAFVHNVVKNYKWEVLFPDEKIT-GDMMPTPEKGLPIRLQPASS  479



>gb|KCW87056.1| hypothetical protein EUGRSUZ_B03598 [Eucalyptus grandis]
Length=485

 Score =   402 bits (1032),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 198/462 (43%), Positives = 291/462 (63%), Gaps = 17/462 (4%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSILGEKVA  313
             K  TS+P+LPPGS GWPV+GE+++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  29    KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  88

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPL--MFPTDAQNTLRKITILNRTNIHEIFKL  487
             V CG AGNKF F+NE   +  WWP SV + +     T A +  R     +R  +   F  
Sbjct  89    VLCGPAGNKFLFSNEGKKVALWWPSSVRRLIGTSLITKAGDEGRS----DRKMLMSFFNP  144

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E L  ++ T+D + + H+  +W    +V+ Y   K YTF LAC+LF+SI D   V RL  
Sbjct  145   EALMRFVGTMDEVTRHHLRTQWQGKDQVEAYPTLKLYTFELACRLFMSITDPQLVTRLAH  204

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
                +   G+ SLPL+FPGT ++RA +    +R++L  ++++R+ +       K+    +D
Sbjct  205   HFEVFLKGLISLPLDFPGTRFHRARRATDSIRKELRALVRQRRVELEQ----KLARPSQD  260

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             V+  LL+  DE G+ + E EI + ++ +L   + ++S+ +  +LK+L+ELPH+  ++  E
Sbjct  261   VMSHLLANGDENGKLMPEAEIINNMLNLLFAGHDTSSSTLMLLLKYLSELPHVLDKILAE  320

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q EIA SK P E L W+D+Q+MKYSWNV CE +R+ PP  G FRE V DFT+ G+T+PKG
Sbjct  321   QREIAASKAPGELLQWDDLQRMKYSWNVICEVMRMTPPVGGSFREAVVDFTFEGYTVPKG  380

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WK +W+   TH++  +      FD SR+EG+GP P++FVPFGGGPRMC GKE+AR+E+LV
Sbjct  381   WKLYWSAAVTHEDLNFHPRAASFDESRFEGSGPLPYSFVPFGGGPRMCLGKEFARVEMLV  440

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             F+HN+V  F  +  +PNEKI+Y+   P PV GLPVRL P Q 
Sbjct  441   FLHNLVNLFDWDTAIPNEKIIYDPM-PTPVKGLPVRLRPRQG  481



>emb|CBI20810.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   399 bits (1025),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 286/452 (63%), Gaps = 75/452 (17%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLP G+TG P IGE+I  +       PEK+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37    NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP SV K  +FP+  Q + ++ +   R  +    K E L+ YI  
Sbjct  97    NKFLFSNENKLVTAWWPSSVNK--IFPSSLQTSSQEESKKMRKLLPGFLKPEALQRYI--  152

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
                                                     +D D V++L +P   ++ G+
Sbjct  153   ----------------------------------------KDPDHVEKLAEPFNELAAGI  172

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              +LP++ PGT++N+ +K  ++                            +D+L  +L   
Sbjct  173   IALPIDLPGTSFNKGIKASNLASTT------------------------QDILSHMLLTC  208

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+++NE +I   I+G+L+  + + SA ITF++KFLAELPH+Y +V+KEQ+EIAKSK 
Sbjct  209   DENGEYMNEEDIADKILGLLVGGHDTASATITFIVKFLAELPHVYDEVFKEQMEIAKSKA  268

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
             P E L+WEDI KM+YSWNVACE +RL PP QG FRE + DF + GF+IPKGWK +W+ +S
Sbjct  269   PGELLNWEDIPKMRYSWNVACEVMRLAPPVQGAFREAMNDFIFEGFSIPKGWKLYWSTHS  328

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+NP++F +P+KFDPSR++G GPAP+T+VPFGGGPRMCPGKEYARLE+LVFMHN+V  F
Sbjct  329   THRNPEFFPKPEKFDPSRFDGKGPAPYTYVPFGGGPRMCPGKEYARLEVLVFMHNLVRRF  388

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             K EKL+P+EKI+ +   PIP  GLP+RL  HQ
Sbjct  389   KWEKLLPDEKIIVDPM-PIPAKGLPIRLHHHQ  419



>ref|XP_010044931.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=509

 Score =   402 bits (1033),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 198/462 (43%), Positives = 291/462 (63%), Gaps = 17/462 (4%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSILGEKVA  313
             K  TS+P+LPPGS GWPV+GE+++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  53    KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  112

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPL--MFPTDAQNTLRKITILNRTNIHEIFKL  487
             V CG AGNKF F+NE   +  WWP SV + +     T A +  R     +R  +   F  
Sbjct  113   VLCGPAGNKFLFSNEGKKVALWWPSSVRRLIGTSLITKAGDEGRS----DRKMLMSFFNP  168

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E L  ++ T+D + + H+  +W    +V+ Y   K YTF LAC+LF+SI D   V RL  
Sbjct  169   EALMRFVGTMDEVTRHHLRTQWQGKDQVEAYPTLKLYTFELACRLFMSITDPQLVTRLAH  228

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
                +   G+ SLPL+FPGT ++RA +    +R++L  ++++R+ +       K+    +D
Sbjct  229   HFEVFLKGLISLPLDFPGTRFHRARRATDSIRKELRALVRQRRVELEQ----KLARPSQD  284

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             V+  LL+  DE G+ + E EI + ++ +L   + ++S+ +  +LK+L+ELPH+  ++  E
Sbjct  285   VMSHLLANGDENGKLMPEAEIINNMLNLLFAGHDTSSSTLMLLLKYLSELPHVLDKILAE  344

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q EIA SK P E L W+D+Q+MKYSWNV CE +R+ PP  G FRE V DFT+ G+T+PKG
Sbjct  345   QREIAASKAPGELLQWDDLQRMKYSWNVICEVMRMTPPVGGSFREAVVDFTFEGYTVPKG  404

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WK +W+   TH++  +      FD SR+EG+GP P++FVPFGGGPRMC GKE+AR+E+LV
Sbjct  405   WKLYWSAAVTHEDLNFHPRAASFDESRFEGSGPLPYSFVPFGGGPRMCLGKEFARVEMLV  464

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             F+HN+V  F  +  +PNEKI+Y+   P PV GLPVRL P Q 
Sbjct  465   FLHNLVNLFDWDTAIPNEKIIYDPM-PTPVKGLPVRLRPRQG  505



>emb|CDP14240.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   396 bits (1017),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 253/344 (74%), Gaps = 5/344 (1%)
 Frame = +2

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L+ YI  +D +A  H +  W    +VKV+ L K YTF +A +LF+S+E+  EV +
Sbjct  6     LKPEALQRYIGIMDHIAGRHFSSGWENKDQVKVFPLCKNYTFWIASRLFVSVEEPTEVAK  65

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             LL+P  ++++G+ S+P++ PGT +NRA+K  + +R+ LV +IK+RK     +     +D 
Sbjct  66    LLEPFNVLASGLISVPIDLPGTPFNRAVKASNQIRKMLVALIKQRKVDLAESKASPTQD-  124

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
                ++  +L+++DE G+ ++E ++   I+G+L+  + + S+A TFV+KFLAELP IY+ V
Sbjct  125   ---IMSHMLTISDENGKFMHELDVADKILGLLIGGHDTASSACTFVIKFLAELPEIYEGV  181

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
             YKEQ+EI KSK P E L+W+DIQKMKYSWNVACE LRL PP QG FRE + DF Y GF+I
Sbjct  182   YKEQMEIVKSKAPGELLNWDDIQKMKYSWNVACEVLRLAPPLQGAFREALADFMYNGFSI  241

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W+  +TH+NP+ F EP KFDP+R+EG+GPAP+TFVPFGGGPRMCPGKEYARLE
Sbjct  242   PKGWKIYWSANTTHRNPECFPEPQKFDPARFEGSGPAPYTFVPFGGGPRMCPGKEYARLE  301

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVF+H+VV  F+ EK++P+EKIV +   PIP  GLPVRL PH+
Sbjct  302   ILVFIHHVVKRFRWEKIIPDEKIVVDPM-PIPAKGLPVRLFPHK  344



>ref|XP_002325241.2| hypothetical protein POPTR_0018s13450g [Populus trichocarpa]
 gb|EEF03806.2| hypothetical protein POPTR_0018s13450g [Populus trichocarpa]
Length=467

 Score =   400 bits (1029),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 212/460 (46%), Positives = 299/460 (65%), Gaps = 27/460 (6%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             ++    PNLPPGS+G P IGE ++L++      P+K+  DR  KY+ EVFKT++  +  A
Sbjct  27    RSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNLFCQPAA  86

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             V CGAAGN+F F+N+N +L  W+P  V K  +FP+  Q  L +     RT + E+ + + 
Sbjct  87    VLCGAAGNRFLFSNKNKVLKAWYPDFVCK--IFPSSVQRPLIEQVDRLRTLLPELLRPDA  144

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             LK Y+   D  A  H A EW   + V V+ L+K +TF LAC LFLSIED D + +L  P 
Sbjct  145   LKRYVGIFDKAAGRHFASEWENKKVVVVFPLAKRFTFGLACSLFLSIEDPDHIAKLASPF  204

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
              LV +G+FS+P++ PGT  +RA+K  +++R +L  +IK+RK      + GK   + +D+L
Sbjct  205   NLVVSGIFSIPIDLPGTPLSRAIKASTIIRTELFAIIKQRKKDL---AKGKASPK-QDIL  260

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               +L+  DE+G  ++E +I   I+ +L   + STSAA  F++K+LAELP IY  VYKEQ+
Sbjct  261   SHMLA-CDEKGAFMSELDIADTILALLASAHESTSAACAFIVKYLAELPLIYNAVYKEQM  319

Query  1034  EIAKSKGP-NERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +I+++K P ++ L+W DIQ M YSWNV  E LRL P      RE + DF + GF+IPKGW
Sbjct  320   KISETKAPGDDLLNWNDIQNMTYSWNVIREVLRLCPTFPN-VREAIHDFDFNGFSIPKGW  378

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K            KYF EP++FDPSR+EG GPAP+TFVPFGGGP MCPG+ +ARLE+L+F
Sbjct  379   KA-----------KYFPEPERFDPSRFEGTGPAPYTFVPFGGGPMMCPGQGFARLEMLIF  427

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             MHN+V  FK +K V  EKI++ S  PIP  G+P+RL PH+
Sbjct  428   MHNLVKRFKFDKFVAEEKIMF-SPMPIPEKGVPIRLFPHR  466



>ref|XP_008385453.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Malus domestica]
Length=502

 Score =   402 bits (1032),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 205/462 (44%), Positives = 299/462 (65%), Gaps = 20/462 (4%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE ++ +      VPE ++ DR+ +Y      S +VFKTS+L + +AV 
Sbjct  41    LPPGSTGWPIIGETLEYLRTAKKGVPEMFMLDRINRYLSSAGNSCKVFKTSLLLQDMAVL  100

Query  320   CGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             C A GNKF F+NE  L+ +WWP  + K ++  ++    + + +   R  +    K   L+
Sbjct  101   CTAGGNKFLFSNEEKLVKSWWPAHLDKIIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  160

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              Y+ T+DS+ K+++   W    +VKV+  +K Y F LACKL L +ED   + +L   +  
Sbjct  161   QYVGTMDSVTKKYLVTFWDHKDQVKVHQHAKKYAFTLACKLMLDVEDPQVLDKLEGLLKD  220

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDV  850
             +S+G  +LP++ PGT +NRA++G + +R ++ +++ ER+ K   A  NS+   + +  D+
Sbjct  221   LSSGFTALPIDLPGTTFNRAIRGSTQLREEIEKIVVERRIKLSTASANSMVDEDGDHGDM  280

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  LL  T  +GQ ++E EI   + G+++  Y + S+ +  ++ +LAE P +Y  V KEQ
Sbjct  281   LSSLLMETYSDGQQISESEIADKLYGVIVAGYDNLSSVLATIIMYLAEFPQVYDAVLKEQ  340

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
             +EIA SK   E L+W D+QKMKYSW+V+CE +RL PP  G FRE  T+F Y G  IPKG 
Sbjct  341   MEIANSKAAGELLNWGDVQKMKYSWSVSCEVMRLLPPNLGTFREATTNFVYEGHLIPKGM  400

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K  WNV STHKNP+ F  P+KFDPSR+EG GP PF FVPFGGGPRMCPGKEY+RL+ILVF
Sbjct  401   KLHWNVNSTHKNPECFPNPEKFDPSRFEGKGPPPFAFVPFGGGPRMCPGKEYSRLKILVF  460

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPI--PVNGLPVRLTPHQ  1510
             MHNVVT +K +K+ P+EK ++   +P+  P  GLP++L PH 
Sbjct  461   MHNVVTKYKWDKVFPDEKFIW---APVLRPTKGLPIKLFPHN  499



>gb|KDP42301.1| hypothetical protein JCGZ_01625 [Jatropha curcas]
Length=350

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 256/351 (73%), Gaps = 5/351 (1%)
 Frame = +2

Query  458   RTNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIE  637
             R  + +  K E L+ YI  +D++A+ H A +W    +V V++L+K YTF +AC+LF+SIE
Sbjct  4     RKLLPQFLKPEALQRYIGIMDTIAQRHFASDWENKEQVNVFSLAKKYTFWVACRLFVSIE  63

Query  638   DRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNS  817
             D   + +  DP  ++++G+FS+P++ PGT ++RA+K    +R++L  +IK+RK +    +
Sbjct  64    DPHHIAKFADPFNVLASGIFSVPIDLPGTPFHRAIKASKFIRKELFSIIKKRKVEL---A  120

Query  818   LGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAEL  997
              GK     +D+L  +L+  DE G+++NE +I   I+G+L+  + + S+A T ++K LAEL
Sbjct  121   EGKAS-TSQDILSHMLTTCDENGKYMNEMDIADKILGLLIGGHDTASSACTSIVKCLAEL  179

Query  998   PHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
             PHIY  VY+EQI+IAKSKG  E L+W+DIQKMKYSWNVACE +RLFPP +G FRE + DF
Sbjct  180   PHIYDGVYQEQIDIAKSKGEGELLNWKDIQKMKYSWNVACEVMRLFPPLRGAFREAIDDF  239

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              + GF++PKGWK +W   STHK+ +YF EP+KFDPSR+EG+GPAP+TFVPFGGGPRMCPG
Sbjct  240   IFNGFSVPKGWKVYWCANSTHKSGEYFPEPEKFDPSRFEGDGPAPYTFVPFGGGPRMCPG  299

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             KEYARLEILVFMHN++  F+  K+ P+EKI+ +   P+P  GLPV L PH 
Sbjct  300   KEYARLEILVFMHNLIKRFRFHKIFPDEKIIVDPM-PMPAKGLPVYLHPHN  349



>ref|XP_003532790.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=481

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 285/466 (61%), Gaps = 17/466 (4%)
 Frame = +2

Query  137   IYFITK----ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFK  286
             +YFITK          NLPPG  GWP++GE  D M         ++I +R++KY   VFK
Sbjct  20    LYFITKVVRLGKHPNLNLPPGRLGWPIVGETFDFMRTMNEGNVLRFIQERVEKYDARVFK  79

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTN  466
             TS+ G+ V VFCG AGNKF F+NEN  +  WWP SV K L       N +     + R  
Sbjct  80    TSMFGDPVVVFCGPAGNKFLFSNENKNVQVWWPSSVRKLLRL--SLVNKVGDEAKMVRRL  137

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             +      E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIED D
Sbjct  138   LMSFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVFVYPIVQLYTFELACCLFLSIEDSD  197

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + +L         GM   PLN PGT ++RAMK    +R+++  ++K+RK    ++   K
Sbjct  198   HISKLSLKFDEFLKGMIGFPLNIPGTRFHRAMKAADAIRKEIRMILKKRK----VDLEEK  253

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                  +D+L  +L  +D  G+   E EI   I+ +L   + ++ + ++ V+K+L +LPH+
Sbjct  254   RASATQDLLSHMLVTSDPSGRFTTEMEIIDNILLLLFAGHDTSRSVLSLVMKYLGQLPHV  313

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             ++ V KEQ+EI++ K   + L  ED+QKMKYSWNVA E +RL PP  G +RE   DFTYA
Sbjct  314   FEHVLKEQLEISQGKEAGQLLQLEDVQKMKYSWNVASEVMRLSPPVSGAYREAKEDFTYA  373

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
              + IPKGWK  WN  S+HK+P  FS P+ FD SR+EG GP PF++VPFGGGPRMC G+E+
Sbjct  374   DYNIPKGWKLHWNTGSSHKDPALFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGQEF  433

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             ARLEILVFMHN+V  FK + ++P+EK  Y+     PV GL +RL P
Sbjct  434   ARLEILVFMHNIVKRFKWDLVIPDEKFKYDPMLE-PVEGLAIRLHP  478



>ref|XP_011040561.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=482

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 215/471 (46%), Positives = 294/471 (62%), Gaps = 29/471 (6%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE +D +   PEK++SDRMK+YS ++FKT ILGE+ 
Sbjct  21    IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVTK---------PLMFPTDAQN-TLRKITILNR  460
             AV CG  G+KF F+NE  L T + P ++ K         P   P +A++  LR    L  
Sbjct  81    AVICGPRGHKFLFSNELKLFTAFRPHAMQKIFRSYQAAAPAQIPREAESKILRSPGFL--  138

Query  461   TNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ + H+   W    EVK +AL+K  T +LAC+ FL  +D
Sbjct  139   -------KPEALVRYLGKMDSITQLHMQTYWEGKDEVKAFALAKTLTLSLACRFFLGSDD  191

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              + + RL+     ++ GM S+PLN  GT + RA K  + +R++L  +I E++A   M+  
Sbjct  192   PERIARLVSNFDDMTLGMHSIPLNVYGTTFYRANKAAAAIRKELRIIIDEKRAA--MSKG  249

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
              +V+D    +L  ++  TD  G+H+ E EI   I+G+L+  Y + + A+TF +K + E P
Sbjct  250   TQVQD----ILSHMILATDPSGKHMAEAEIADKIMGLLVAGYSTVATAMTFFMKNVGERP  305

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY ++  EQIE+A  K   E L W+DIQKMKYSWNV  E +RL PP QG FRE +TDFT
Sbjct  306   DIYAKILAEQIEVAADKKAGELLGWDDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFT  365

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGP-APFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W+V +T+K+P+YF +P+KFDPSRY+      PFTFVPFGGGPRMCPG
Sbjct  366   YAGYTIPKGWKIYWSVSTTNKDPQYFPDPEKFDPSRYDDEKAFPPFTFVPFGGGPRMCPG  425

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             KEYARL IL F+HNVV  F+ E   P EKI      P P  GLP+RL   Q
Sbjct  426   KEYARLAILTFVHNVVKRFRWEVAFPAEKIA-GDMMPTPEKGLPIRLQSRQ  475



>ref|XP_004293194.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   400 bits (1028),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 209/469 (45%), Positives = 301/469 (64%), Gaps = 28/469 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP-------------EVFKTSI  295
              LPPGSTGWP+IGE ++ +      VPEK+I+DR KKYS              +VFKT +
Sbjct  36    QLPPGSTGWPIIGETLEYLSTARDGVPEKFIADRRKKYSDASASSAAATEGSCKVFKTLL  95

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +A+ C AAGNKF F+NEN L+ TWWP    K  +F    +    K+TI NR  I  
Sbjct  96    LGEPMAMLCTAAGNKFLFSNENKLVKTWWPAIFQK--LFTDSTKLEYSKVTIHNRKAIFP  153

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFRE---VKVYALSKYYTFALACKLFLSIEDRD  646
               K + ++ +I  +D + KEH  + W+   +   +K ++L K YT AL+ +LFL++ED  
Sbjct  154   FLKPDAVRKHIGVMDQVTKEHFGKHWSLQDQKQVIKFHSLVKKYTLALSSRLFLNLEDPQ  213

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAM---MNS  817
              + +L + I  ++ G+ SLP++ PGT +NRA++    +++++  ++ +RK   M   M  
Sbjct  214   VIAKLQESIRHINEGLVSLPVDLPGTNFNRAIRASRKMKKEIDSMVAQRKNDLMNLNMID  273

Query  818   LGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAEL  997
               ++E+  +D++   L  T  +GQ L E EI  Y+ GI+L  + +    +   +  L++L
Sbjct  274   REQLENAPQDLMSSFLLETRSDGQELTEEEISKYLCGIMLAGFDAIINTLCATVIVLSQL  333

Query  998   PHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
             P +Y  V KEQ+EIA+SK   E L+W D++KMKY+WNV CE LRL PP  G FRE +TDF
Sbjct  334   PEVYDAVLKEQMEIAESKDEGELLNWGDVRKMKYTWNVVCEVLRLQPPTGGTFREAMTDF  393

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              Y G+ IPKG K  WNV++THKNP+YF +P KFDPSR+EG+GP P+++VPFGGGPRMCPG
Sbjct  394   VYEGYLIPKGMKIHWNVHATHKNPEYFPDPHKFDPSRFEGHGPPPYSYVPFGGGPRMCPG  453

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             KE+AR EILVF+HN+VT FK E + P+EK+V +   P P  GLP+ + P
Sbjct  454   KEHARYEILVFLHNLVTRFKWEMVFPDEKMVVDPV-PFPSKGLPLHVFP  501



>ref|XP_008227237.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=510

 Score =   400 bits (1027),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 301/470 (64%), Gaps = 31/470 (7%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY---------SPEVFKTSILGEKV  310
             LPPGS GWP+IGE ++ +      VPEK+I+DR  KY         + +VFKTS+L E +
Sbjct  40    LPPGSPGWPIIGETLEYLRTGKKGVPEKFIADRRNKYKNSSSSSSANCKVFKTSLLFEDM  99

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILN-----RTNIHE  475
             AV C AAGNKF F+NE  L+ +WWP  + K L+F   A +   K  I       R  +  
Sbjct  100   AVLCTAAGNKFLFSNEKKLIKSWWPPHLDK-LIFADSAPDKKAKAFITEESTRFRNTMAP  158

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFRE----VKVYALSKYYTFALACKLFLSIEDR  643
               K   L+ Y+ T+D+  K+H+   W   ++    +K + L+K Y   +AC+L L  ED+
Sbjct  159   YLKPAGLQKYVGTMDTFTKKHLDMYWEDGKDDDQGIKAHPLAKRYAVTMACRLMLDTEDQ  218

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
                 +L +    +S+G  SLP++ PGT +NRA++G   +R ++  ++ +R+      S  
Sbjct  219   QVFNKLENLTKDLSSGFTSLPIDLPGTQFNRAIRGSRQLREEIKNIVTQRRIHL---STR  275

Query  824   KVEDE--GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAEL  997
             KV+++  G D+L  L+  T  +GQ L++ EI   + G+++  Y + S+ +  ++  LAEL
Sbjct  276   KVDEDVDGLDILSSLIMDTSSDGQGLSDSEIASKLYGVIVSGYDTFSSTLAAIVMCLAEL  335

Query  998   PHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
             PH+Y  V KEQ +IA+SK   E L+W DIQKMKYSW+VACE +RL PP  G FRE  +DF
Sbjct  336   PHVYDAVLKEQRQIAESKAAGELLNWADIQKMKYSWSVACEVMRLLPPNSGTFREATSDF  395

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              Y G+ IPKG K  W+V+STHKNP++F +P+KFDPSR++G GP P++FVPFGGGPRMCPG
Sbjct  396   VYEGYLIPKGMKLKWSVHSTHKNPEHFPDPEKFDPSRFDGQGPPPYSFVPFGGGPRMCPG  455

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEY+RL++LVFMHNVVT ++ EK+ P+EK V+N A  +   GLP+R+ PH
Sbjct  456   KEYSRLKMLVFMHNVVTRYRWEKVFPDEKFVWNPAL-VSTKGLPIRVFPH  504



>ref|XP_002317072.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
 gb|EEE97684.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
Length=482

 Score =   399 bits (1024),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 216/471 (46%), Positives = 293/471 (62%), Gaps = 29/471 (6%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE +D +   PEK++SDRMK+YS ++FKT ILGE+ 
Sbjct  21    IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVTK---------PLMFPTDAQN-TLRKITILNR  460
             AV CG  G+KF F+NE  L T + P ++ K         P   P +A++  LR    L  
Sbjct  81    AVICGPGGHKFLFSNEQKLFTAFRPHAMQKIFRSYQAAAPAQIPREAESKILRSPGFL--  138

Query  461   TNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ + H+   W    EVK +AL+K  T +LAC+ FL  +D
Sbjct  139   -------KPEALVRYLGKMDSITQLHMQTCWEGKDEVKAFALAKTLTLSLACRFFLGSDD  191

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              + + RL+     ++ GM S+PLN  GT + RA K  + +R++L  +I E++A   M+  
Sbjct  192   PERIARLVSNFDDMTLGMHSIPLNVYGTTFYRANKAAAAIRKELRIIIDEKRAD--MSKG  249

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
              +V+D    +L  ++  TD  G+H+ E EI   I+G+L+  Y + + A+TF +K + E P
Sbjct  250   AQVQD----ILCHMILATDPSGKHMAEAEIADKIMGLLVAGYSTVATAMTFFMKNVGERP  305

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY ++  EQIE+A  K   E L W DIQKMKYSWNV  E +RL PP QG FRE +TDFT
Sbjct  306   DIYAKILAEQIEVAADKKAGELLDWNDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFT  365

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGP-APFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V +T+K+P+YF +P+KFDPSRY+      PFTFVPFGGGPRMCPG
Sbjct  366   YAGYTIPKGWKIYWTVSTTNKDPEYFPDPEKFDPSRYDDEKVFPPFTFVPFGGGPRMCPG  425

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             KEYARL IL F+HNVV  F+ E   P EKIV     P P  GLP+RL   Q
Sbjct  426   KEYARLAILTFVHNVVKRFRWEVAFPAEKIV-GDMMPTPEKGLPIRLRSRQ  475



>ref|XP_003531282.1| PREDICTED: cytochrome P450 716B2-like isoformX1 [Glycine max]
Length=481

 Score =   398 bits (1023),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 203/466 (44%), Positives = 290/466 (62%), Gaps = 17/466 (4%)
 Frame = +2

Query  137   IYFITKANTSKP----NLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFK  286
             ++FITKA+  +     NLPPG  G P++GE ++ +         ++I +R++KY   VFK
Sbjct  20    LHFITKADRLRKHPNLNLPPGRLGCPIVGETLEFLRTMNEGNVLRFIQERVEKYDARVFK  79

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTN  466
             TS+ G+ V VFCG AGNKF F+NEN  +  WWP SV K L       N +     + R  
Sbjct  80    TSMFGDPVVVFCGPAGNKFLFSNENKNVQVWWPSSVRKLLRL--SLVNKVGDEAKMVRRL  137

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             +      E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIED D
Sbjct  138   LMSFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVLVYPIVQLYTFELACCLFLSIEDSD  197

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + +L         G+  LPLN PGT ++RAMK   ++R ++  ++K+RK    ++   K
Sbjct  198   HISKLSLKFDEFLKGIIGLPLNIPGTRFHRAMKAADVIRNEIEMILKKRK----VDLEEK  253

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                  +D+L  +L  +D  G+ + E EI   I+ +L   + S+ + ++ V+K+L +LP +
Sbjct  254   RASPTQDLLSHMLVTSDPNGRFMTEMEIIDNILLLLFAGHDSSRSVLSLVMKYLGQLPQV  313

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             Y+ V KEQ+EI++ K   + L WED+QKMKYSWNVA E +RL PP  G +RE + DFTY 
Sbjct  314   YEHVLKEQLEISQGKEAGQLLQWEDVQKMKYSWNVASEVMRLSPPVSGAYREAIKDFTYG  373

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
              + IPKGWK  WN  S+H++P  FS P+ FD SR+EG GP PF++VPFGGGPRMC G+E+
Sbjct  374   DYNIPKGWKLHWNTGSSHEDPALFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGQEF  433

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             ARLEILVFMHN+V  FK + ++P+EK  Y+     PV GL +RL P
Sbjct  434   ARLEILVFMHNIVKRFKWDLVIPDEKFKYDPLLE-PVKGLAIRLHP  478



>ref|XP_002868459.1| CYP716A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44718.1| CYP716A1 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 297/461 (64%), Gaps = 20/461 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPE----VFKTSILGE  304
             +N S PNLPPG TG+P+IGE+   +       PEK+I+DR++++S      VFKT + G 
Sbjct  27    SNFSYPNLPPGKTGFPLIGESFSFLSAGRQGHPEKFITDRVRRFSSSSSSCVFKTHLFGS  86

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFK  484
               AV  GA+GNKF FTNEN L+ +WWP SV K  +FP+  Q + ++     R  + +  K
Sbjct  87    PTAVVTGASGNKFLFTNENKLVVSWWPDSVNK--IFPSSMQTSSKEEAKKLRMLLSQFMK  144

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLL  664
              E L+ Y+  +D +A+ H   EWA   ++ V+ L+K +TF++AC+ FLS++D   V++L 
Sbjct  145   PEALRRYVGVMDEIAQRHFETEWANHDQLIVFPLTKKFTFSIACRSFLSMDDPARVRQLE  204

Query  665   DPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGR  844
             +    V+ G+FS+P++ PGT +NRA+K   ++R+++  ++++RK +      GK  +E  
Sbjct  205   EQFNTVAVGIFSIPIDLPGTRFNRAIKASRLLRKEVSAIVRQRKEEL---KSGKALEE-H  260

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  +L    E        ++   IIG+L+  + + S   TFV+ +LAE  H+YQ+V +
Sbjct  261   DILSHMLMNIGETKDE----DLADKIIGLLIGGHDTASIVCTFVVNYLAEFSHVYQRVLQ  316

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ EI   K   E L WEDI+KM+YSWNVACE +R+ PP  G FRE +   ++ GF IPK
Sbjct  317   EQKEILNEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLPGTFREAIDHISFKGFYIPK  376

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
             GWK +W+  +TH NP YF EP++F+P R+EG+GP  +T+VPFGGGPRMCPG+EYARLEIL
Sbjct  377   GWKLYWSATATHMNPDYFPEPERFEPKRFEGSGPKAYTYVPFGGGPRMCPGREYARLEIL  436

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +FMHN+V  FK EK+ P E  +     PIP  GLP+R+ P 
Sbjct  437   IFMHNLVKRFKWEKVFPKENKIVVDPLPIPGKGLPIRIFPQ  477



>ref|XP_009617496.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 295/459 (64%), Gaps = 11/459 (2%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  310
             T+  T   NLPPGS GWPVIGE  + +       PEK+++DR++KY  ++FKT I+GEKV
Sbjct  25    TRNRTKTLNLPPGSYGWPVIGETPEFLRSRRDGSPEKFVTDRIEKYQSQIFKTCIVGEKV  84

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV CG AGNKF F NEN L+  WWP SV + L+    +  +  +  ++ +   + +    
Sbjct  85    AVLCGPAGNKFLFGNENKLVNVWWPSSV-RQLLGSCLSTISGEEAKLMRKMLTYFVSPDA  143

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
               K YI T++   ++HI   W    E+KV+   K +TF LAC+LF+S+ED + +  L + 
Sbjct  144   FSKLYIKTMELSTQQHIKNYWQGKEELKVFPTIKLHTFELACRLFMSLEDTNRISNLFNL  203

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
               +   G+ SL LNFPGT +  A K  + +R++LV ++++R+ +A+   L  +    +D+
Sbjct  204   FNIFLKGVLSLALNFPGTRFYHAKKATNSIRKELVLIVQQRR-EALEQKL--LVCPPQDL  260

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  LL   DE G+ ++E E+ + I+ +L   + +TS  IT V+K+L ELPH+Y +V +EQ
Sbjct  261   LSHLLLFPDENGKFMSELELANNILLLLFAGHDTTSVTITLVMKYLGELPHVYDKVLQEQ  320

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
              EIA  KG  E L+W+D+QKMKY+W+V  E LRL  P  G FRE + +  Y G+ IPKGW
Sbjct  321   KEIASLKGGREYLNWDDMQKMKYTWDVVSEVLRLTSPITGSFREALVNLDYQGYIIPKGW  380

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVF  1390
             K +WN   TH +PK+F     FDPSR+EG GP PF++VPFGGGPRMC GKE+ARLEILVF
Sbjct  381   KLYWNGAVTHMDPKFFLNTKNFDPSRFEGAGPTPFSYVPFGGGPRMCLGKEFARLEILVF  440

Query  1391  MHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +HNVV +F+ + L+P EKI Y+   P P+ GLPV L PH
Sbjct  441   IHNVVKDFRWKLLIPTEKIEYDPM-PTPIEGLPVLLQPH  478



>ref|NP_198460.1| cytochrome P450, family 716, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 dbj|BAA96885.1| cytochrome P450-like [Arabidopsis thaliana]
 gb|AED94045.1| cytochrome P450, family 716, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=477

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 303/460 (66%), Gaps = 19/460 (4%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPE---VFKTSILGEK  307
             ++ S PNLPPG+TG P+IGE+   +       PEK+I+DR++++S     VFKT + G  
Sbjct  27    SHFSYPNLPPGNTGLPLIGESFSFLSAGRQGHPEKFITDRVRRFSSSSSCVFKTHLFGSP  86

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKL  487
              AV  GA+GNKF FTNEN L+ +WWP SV K  +FP+  Q + ++     R  + +  K 
Sbjct  87    TAVVTGASGNKFLFTNENKLVVSWWPDSVNK--IFPSSMQTSSKEEARKLRMLLSQFMKP  144

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E L+ Y+  +D +A+ H   EWA   +V V+ L+K +TF++AC+ FLS+ED   V++L +
Sbjct  145   EALRRYVGVMDEIAQRHFETEWANQDQVIVFPLTKKFTFSIACRSFLSMEDPARVRQLEE  204

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
                 V+ G+FS+P++ PGT +NRA+K   ++R+++  ++++RK +      GK  +E  D
Sbjct  205   QFNTVAVGIFSIPIDLPGTRFNRAIKASRLLRKEVSAIVRQRKEEL---KAGKALEE-HD  260

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             +L  +L    E        ++   IIG+L+  + + S   TFV+ +LAE PH+YQ+V +E
Sbjct  261   ILSHMLMNIGETKDE----DLADKIIGLLIGGHDTASIVCTFVVNYLAEFPHVYQRVLQE  316

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q EI K K   E L WEDI+KM+YSWNVACE +R+ PP  G FRE +  F++ GF IPKG
Sbjct  317   QKEILKEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLSGTFREAIDHFSFKGFYIPKG  376

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             WK +W+  +TH NP YF EP++F+P+R+EG+GP P+T+VPFGGGPRMCPGKEYARLEIL+
Sbjct  377   WKLYWSATATHMNPDYFPEPERFEPNRFEGSGPKPYTYVPFGGGPRMCPGKEYARLEILI  436

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             FMHN+V  FK EK+ PNE  +     PIP  GLP+R+ P 
Sbjct  437   FMHNLVNRFKWEKVFPNENKIVVDPLPIPDKGLPIRIFPQ  476



>ref|XP_009598096.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/460 (45%), Positives = 293/460 (64%), Gaps = 15/460 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  325
             + +++K  LPPGS GWPVIGE ID +   PEK++S+RMKKYSP++FKT I+GEK AV CG
Sbjct  25    RRSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSNRMKKYSPDIFKTKIMGEKTAVICG  84

Query  326   AAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITIL---NRTNIHE--IFKLE  490
               G+KF F+NE  L T++   S+ +          +           R  I +    K E
Sbjct  85    PNGHKFLFSNEEKLFTSFRTHSMQRIFQSYQSNSPSPSSSPSPSQSTRVIIRQPGFLKPE  144

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L  Y+  +D + +E +   W    E+K Y  +K+ T  LAC+ FL   + D + +L++ 
Sbjct  145   ALTRYLGEMDLITQELLKSHWEGRNEIKTYPFAKFLTLTLACRFFLGTNNTDRITKLVNY  204

Query  671   IILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDV  850
                ++ G+ ++ LNF GTA+ RA K    VRR+L+ VIKE+K + M N +     + +D+
Sbjct  205   FDDITLGLHAMILNFRGTAFYRANKAAFAVRRELIGVIKEKKEE-MANGV-----KMQDI  258

Query  851   LGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQ  1030
             L  ++ VTD +G+ + E EI   I+G+L+  Y + +  ITF++K++ +   IY+++  EQ
Sbjct  259   LCYMIVVTDSKGKFMPENEIADKIMGLLVAGYSTVATTITFLMKYVGQRSDIYEKILIEQ  318

Query  1031  IEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGW  1210
              EI  +K P E L+WED+ KMKYSWNV CE +RL PP QG FR+ +TDFTYAG++IPKGW
Sbjct  319   KEIVAAKKPGEVLTWEDMLKMKYSWNVICETMRLTPPLQGTFRQVLTDFTYAGYSIPKGW  378

Query  1211  KTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             K +W   ST+KNP YF  P++FDPSRYE  + P P+T+VPFGGGPRMCPGKEYARL IL 
Sbjct  379   KVYWTASSTNKNPAYFQNPEQFDPSRYEKRDEPTPYTYVPFGGGPRMCPGKEYARLAILT  438

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             F+HNVV  +K E L P+EK+V     P P  GLP+RL  H
Sbjct  439   FLHNVVLKYKWELLAPDEKVV-GDMMPTPEKGLPIRLHQH  477



>ref|XP_008358591.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Malus domestica]
Length=477

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 218/469 (46%), Positives = 291/469 (62%), Gaps = 21/469 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG +G+KF F+NE    T + P S+ K  MF +          +   +   E    
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAAAPTAPAVAQPSRDEEAKVI  135

Query  476   ----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDR  643
                   K E L  Y+  +DS+ +E +   W    EV+VY L+K  T  LAC+ FL I++ 
Sbjct  136   RSPGFLKPEALVRYLGRMDSITQEQMKVYWEGKDEVQVYPLAKTLTLGLACRFFLGIDEP  195

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
             + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M + G
Sbjct  196   ERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAGG  253

Query  824   KVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
              + D    +L  +++ +D  G+ + E E+   I+G+L   Y + + A+TF +K++ E P 
Sbjct  254   PMHD----ILSHMIAASDPSGKLMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERPD  309

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             IY +V  EQ+EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFTY
Sbjct  310   IYAKVLAEQMEIANSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFTY  369

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGK  1360
             AG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRY+  N    FTFVPFGGGPRMCPGK
Sbjct  370   AGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPGK  429

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EYARL IL F+HNVV  FK E L P EKI      P P  GLPVRLT H
Sbjct  430   EYARLAILTFVHNVVKRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLTRH  477



>ref|XP_007022977.1| Cytochrome P450 716B1 [Theobroma cacao]
 gb|EOY25599.1| Cytochrome P450 716B1 [Theobroma cacao]
Length=557

 Score =   399 bits (1026),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 295/463 (64%), Gaps = 29/463 (6%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFC  322
             +  ++   +LPPGS GWPV+GE ++ +   PEK++ DRMKKYSP +FKT ILGE+ AV C
Sbjct  31    SSTSSGAKDLPPGSLGWPVMGETLEFLFGKPEKFVFDRMKKYSPHIFKTKILGEETAVIC  90

Query  323   GAAGNKffftnentllttWWPQSVTK---------PLMFPTDAQ-NTLRKITILNRTNIH  472
             G  G+KF F+NE  L T + P S+ K         P+    DA+   LR    L      
Sbjct  91    GPEGHKFLFSNEQKLFTAFRPHSMQKLFRSYQAAAPVQIARDAEAKILRSPGFL------  144

Query  473   EIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
                K E L  Y+  +DS+ ++ + + W    EVK +AL+K  T  LAC+ FL I+D + +
Sbjct  145   ---KPEALVRYLGKMDSITQQQMEKYWQGKDEVKAFALAKTLTLTLACRFFLGIDDPERI  201

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              RL+     ++ GM S+P+NFPGT + RA +  + +R++L EVIKE+K      +     
Sbjct  202   SRLVTNFDDITLGMHSIPVNFPGTIFYRANRAAAAIRKELREVIKEKKTAMATGA-----  256

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
                +D+L  ++  TD  G+++ E EI   I+G+L+  Y + + A+TF +K++ E P IY 
Sbjct  257   -PMQDILSHMIVATDPSGKYMPEAEIADKIMGLLVAGYSTVATAMTFFMKYVGEWPDIYD  315

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             ++  EQ E+A +K P E L W+DIQKMKYSWNV  E +RL PP QG FRE +T+FTYAGF
Sbjct  316   KILAEQSEVAAAKKPGELLDWDDIQKMKYSWNVLYEVMRLTPPLQGTFREALTEFTYAGF  375

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRY-EGNGPAPFTFVPFGGGPRMCPGKEYA  1369
             TIPKGWK +W V + ++NP++F EPDKFDPSRY EGN   PFTFVPFGGGPRMCPGKEYA
Sbjct  376   TIPKGWKVYWTVSTANRNPEFFPEPDKFDPSRYDEGNTFPPFTFVPFGGGPRMCPGKEYA  435

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             RL IL F+HNVV  FK E + P EKI+     P P  GLP+RL
Sbjct  436   RLAILTFVHNVVKRFKWELVEPKEKII-GDMMPTPEKGLPIRL  477



>gb|AHF49536.1| CYP450 716-like protein (mitochondrion) [Ginkgo biloba]
Length=485

 Score =   397 bits (1019),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/453 (44%), Positives = 294/453 (65%), Gaps = 24/453 (5%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N PPG+ G P+IGE ++ +       P ++   R+ KY  E+FKTSI+G   A+FC  AG
Sbjct  39    NAPPGTFGLPLIGETLEFLGCQRSGKPAEFFDTRINKYG-EIFKTSIVGHPTAMFCSPAG  97

Query  335   NKffftnentllttWWPQSVTKP-----LMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             N+  F+NEN L+ + WP SV K      L    D    LR++ ++         + E L+
Sbjct  98    NRLLFSNENKLVVSSWPSSVGKLFGKSILTATGDEAKRLRRMLMM-------FLRPEALQ  150

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              ++  +D +A+ H+A+EW    EV+V+ L ++YTF+LAC LF S++D  E+ +L    ++
Sbjct  151   TFVGRVDLIARRHLADEWIGKEEVRVFPLMEHYTFSLACNLFASVDDEGEIAKLSHHFMV  210

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGR  859
             +  G+  +P++ PGT YN+A    S +RR+L  +I  R+  A+ +    +E   +D++  
Sbjct  211   LLKGVLQIPIDLPGTRYNKAKHAASAIRRELQSIIDHRRI-ALAHGNASLE---QDLMSY  266

Query  860   LLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEI  1039
             LLS  DEEG+ L + EI   I+ +   ++ ++SA +T +LK+LAE P  Y+++ KEQ+EI
Sbjct  267   LLSNVDEEGKSLTDEEIKDNILQLFFASHDTSSATLTLLLKYLAEHPDCYERILKEQLEI  326

Query  1040  AKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTF  1219
             A SK   + L WE++QKMKYSW  A E LR+ PP QG FRE +TDFTY GFTIP+GWK +
Sbjct  327   AGSKAGGQLLEWEELQKMKYSWRAAQETLRMTPPVQGSFREAITDFTYGGFTIPRGWKCY  386

Query  1220  WNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHN  1399
             W V STHK  +YF +P+KFDPSR+EG GPAP+TFVPFGGG RMCPG E+AR+E+LVF+HN
Sbjct  387   WTVNSTHKKAEYFEDPEKFDPSRFEGAGPAPYTFVPFGGGHRMCPGNEFARMEMLVFLHN  446

Query  1400  VVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             +  +FK E +  +EKI  +   P PVNGLP++L
Sbjct  447   IAKSFKWELVDKDEKISVDPM-PAPVNGLPIKL  478



>ref|XP_010060835.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW67713.1| hypothetical protein EUGRSUZ_F01453 [Eucalyptus grandis]
Length=479

 Score =   396 bits (1018),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 288/459 (63%), Gaps = 16/459 (3%)
 Frame = +2

Query  161   TSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +S P LPPGS GWP++GE ++ +   P+K++ DRM+KYS  VFKT ILGEKVAVFCG AG
Sbjct  27    SSGPKLPPGSFGWPILGETVEFLFGNPDKFVGDRMRKYSSTVFKTKILGEKVAVFCGPAG  86

Query  335   NKffftnentllttWWPQSVTKPLM-FPTDAQNTLRKITILNRTNIHE---IFKLENLKH  502
             NKF F+NE  L+T W P S+ K +  +  ++          ++T +       K E L  
Sbjct  87    NKFIFSNEQKLVTEWRPHSMQKLMRSYEANSPPPPSANPNESKTKVLRQPGFLKPEALCR  146

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             ++  +DS A++H+   W    +V V+ LSK +T +LA K FL + + D + RL +    V
Sbjct  147   FMEQMDSTAQQHMKLHWEGQSKVLVFPLSKNFTLSLASKFFLGLNEHDRITRLANEFDDV  206

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
             S G+ S+P  FPGT +  A +G   +R+ L+ VI+E+K      +        +D+L  +
Sbjct  207   SLGLHSIPWKFPGTIFYNASRGAVAIRKALLSVIREKKEALASGA------RSQDILTYM  260

Query  863   LSVTD-EEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEI  1039
             ++  D   G+ + E EI   ++G+L   Y + + AITF++KF+ E P IY+++  EQ+ I
Sbjct  261   VAAADPATGRMMPETEIADKMMGLLTAGYSTVAIAITFLMKFVGERPDIYEKILAEQLAI  320

Query  1040  AKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTF  1219
              KSK P E L+WEDIQKMKYSWNV  E LRL PP QG FRE +TD TY G+TIPKGWK +
Sbjct  321   KKSKNPGETLAWEDIQKMKYSWNVTSEVLRLTPPLQGTFREAMTDITYEGYTIPKGWKIY  380

Query  1220  WNVYSTHKNPKYFSEPDKFDPSRYEGNGPA--PFTFVPFGGGPRMCPGKEYARLEILVFM  1393
             W V ST+ +P YF  P  FDP+RYE    A  P+T+VPFGGGPR+CPGKEYARL +L F+
Sbjct  381   WTVSSTNNDPTYFPNPATFDPTRYEEGNAALPPYTYVPFGGGPRLCPGKEYARLVVLTFL  440

Query  1394  HNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             HN V  FK E + P EKI+ +   P P  GLPVRL PH 
Sbjct  441   HNTVNRFKWELVDPKEKIIVD-MMPTPSKGLPVRLIPHS  478



>ref|XP_004504209.1| PREDICTED: cytochrome P450 716B1-like [Cicer arietinum]
Length=479

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 203/464 (44%), Positives = 288/464 (62%), Gaps = 14/464 (3%)
 Frame = +2

Query  140   YFITK-ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSIL  298
             +FIT+     K NLP GS GWP+IGE  + +         ++I +RMKKY   VFKTS+ 
Sbjct  21    HFITRIVKLKKLNLPLGSLGWPIIGETFEFVKASVEGKQIRFIEERMKKYDKRVFKTSMF  80

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             GE +AVFCG  GNKF F+NEN  +  WWP SV + L       N +     + R  +   
Sbjct  81    GEHIAVFCGPLGNKFLFSNENKNVQVWWPSSVKRLLRL--SIVNKVGDEAKVTRKLLMSF  138

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
                E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLS+ED  +V  
Sbjct  139   LNPETLRNYLPKMDSIARHHINTHWKGNEQVVVYPIIQLYTFELACSLFLSMEDPIQVSN  198

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L         G+    +NFPGT ++++MK  +++R ++  ++K+RK    ++   K    
Sbjct  199   LSPHFDEFLKGIIGFSINFPGTTFHKSMKAANIIREEIKMIMKKRK----VDLEEKKASP  254

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  LL  +D  G+ LNE EI   I+ +L   + ++ + ++ V+K+L +LP +Y+QV
Sbjct  255   TQDLLSHLLVTSDTNGKFLNEVEIIDNILLLLFAGHDTSRSVLSSVMKYLGQLPEVYEQV  314

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              KEQ+EI       E L WEDIQKMK+SWNVA E +RL PP  G +R+ + DFTYA + I
Sbjct  315   LKEQLEIXXXXXXXELLQWEDIQKMKFSWNVASEVMRLAPPVGGAYRKAIKDFTYADYNI  374

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             P  WK  WN ++TH +P  F+ P+KFD SR+EG GP P+++VPFGGGPRMC G+E+ARLE
Sbjct  375   PNEWKLHWNTHTTHMDPTLFTNPEKFDASRFEGEGPTPYSYVPFGGGPRMCLGQEFARLE  434

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             ILVFMHN+V  FK + ++P+EK  Y+     P NGLP+RL PHQ
Sbjct  435   ILVFMHNMVKRFKWDLVIPHEKFKYDPMLE-PENGLPIRLQPHQ  477



>ref|XP_004299475.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   397 bits (1020),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 209/472 (44%), Positives = 304/472 (64%), Gaps = 28/472 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP---------EVFKTSILGEK  307
              LPPGS+GWP+IGE +  +      VPEK+I DR  K+S          +VF TS+L E 
Sbjct  41    QLPPGSSGWPIIGEGLAFLMTAKRGVPEKFIGDRRIKFSSSSHSKSSICKVFTTSLLRES  100

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKL  487
             VAV C AAGNKF F+NEN L+ +WWP+++    +F    +    + +I  R  +   F  
Sbjct  101   VAVLCTAAGNKFLFSNENKLVHSWWPENIYT--IFAGSDRPESHEESIRLRKVLSPFFSP  158

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
               L+ Y+  +D+  K H+   W+  ++VKV AL+K +TFAL CK+FL++ED   + +L +
Sbjct  159   NCLQKYVGIMDAFTKRHLDVFWSDKKQVKVLALTKMHTFALVCKIFLNVEDPSVIAKLEE  218

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKA----MMNSLGKVED  835
             PI  ++ G  +LP+N PGTA+NRA+K    VR+ L E++++R+          +   V +
Sbjct  219   PIQHIAAGFIALPINLPGTAFNRAIKASMQVRKDLEEMVQQRRIDLDRFRQTATASDVNE  278

Query  836   EG--RDVLGRLLSVTDEEGQHLNE---FEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
                 +D++ +LL  T  +G+ + E    +I + + G+L+  Y +    +  ++ +L+EL 
Sbjct  279   NSNYQDLMSKLLMDTYSDGRQMKETDIADIANKLNGLLIAAYDNVFITLCSIVMYLSELS  338

Query  1001  HIYQQVYKEQIEIAKS-KGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
              +Y  V KEQ+EIA S K   E L+W DIQKMKY+WNV CE LRL PP  G FRE ++DF
Sbjct  339   TVYDAVLKEQMEIASSSKAEGELLNWGDIQKMKYTWNVVCEVLRLEPPNPGTFREAMSDF  398

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              Y G+ IPKG K +W+V+STHK+P+YF +P KFDPSR++G GPAP+++VPFGGGPRMCPG
Sbjct  399   VYEGYLIPKGMKLYWSVFSTHKDPEYFPDPKKFDPSRFDGGGPAPYSYVPFGGGPRMCPG  458

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             +EYARL ILVFMHN++T F+ EK+ P+EK+V  +   +P  GLPVRL PH +
Sbjct  459   REYARLTILVFMHNLITRFRWEKVFPDEKMVM-TPFLLPTKGLPVRLYPHTS  509



>ref|XP_004306884.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   397 bits (1019),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 210/469 (45%), Positives = 300/469 (64%), Gaps = 28/469 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP-------------EVFKTSI  295
              LPPGSTGWP+IGE ++ +      VPEK+I+DR KKYS              +VFKT +
Sbjct  36    QLPPGSTGWPIIGETLEYLRTARNGVPEKFIADRRKKYSDVSVPSAAATEGSCKVFKTLL  95

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE  475
             LGE +A+ C AAGNKF F+NEN L+ TWWP    K  +F    +    K+TI NR  I  
Sbjct  96    LGEPMAMLCTAAGNKFLFSNENKLVKTWWPAIFQK--LFIDSTKLEYSKVTIHNRKAIFP  153

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKV---YALSKYYTFALACKLFLSIEDRD  646
               K + ++ +I  +D + K+H  + W+   + +V   ++L K YT AL+ +LFL++ED  
Sbjct  154   FLKPDAVRKHIGVMDQVTKDHFGKHWSLQDQKQVSKFHSLVKKYTLALSSRLFLNLEDPQ  213

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAM---MNS  817
              + +L + I  VS G+ SLP++ PGT +NRA++    +++++  ++ +RK   M   M  
Sbjct  214   VIAKLEESIRHVSEGLVSLPIDLPGTNFNRAIRASRKMKKEIDSMVAQRKNDLMNLNMID  273

Query  818   LGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAEL  997
               ++E+  +D++   L  T  +GQ L E EI  Y+ GI+L  + +    +   +  L++ 
Sbjct  274   REQLENAPQDLMSSFLLETRFDGQELTEEEISKYLCGIMLAGFDNIINTLCATVIVLSQF  333

Query  998   PHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDF  1177
             P +Y  V KEQ+EIA+SK   E L+W D++KMKY+WNV CE LRL PP  G FRE +TDF
Sbjct  334   PEVYDAVLKEQMEIAESKDEGELLNWGDVRKMKYTWNVVCEVLRLHPPIGGTFREAMTDF  393

Query  1178  TYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPG  1357
              Y G  IPKG K  WNVY+THKNP+YF +P KFDPSR+EG+GP P+++VPFGGGPRMCPG
Sbjct  394   VYEGHLIPKGMKIHWNVYATHKNPEYFPDPHKFDPSRFEGHGPPPYSYVPFGGGPRMCPG  453

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             KE+AR EILVF+HN+VT FK E + P+EK+V +   P+P  GLP+ + P
Sbjct  454   KEHARYEILVFLHNLVTRFKWEMVFPDEKMVVDPV-PLPSKGLPLHVFP  501



>ref|XP_007159554.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
 gb|ESW31548.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
Length=478

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 207/472 (44%), Positives = 289/472 (61%), Gaps = 32/472 (7%)
 Frame = +2

Query  137   IYFITK-ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSI  295
             ++FIT+       NLPPG  GWP++GE  + M         +++ +R++KY   VFKTS+
Sbjct  20    LHFITRRVRLRNLNLPPGRLGWPIVGETFEFMHAMLEGNVLRFLKERVEKYDSRVFKTSM  79

Query  296   LGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT-----DAQNTLRKITILNR  460
              G+ VAVFCG AGNKF F+NEN  +  WWP SV K L         D    +RK+ ++N 
Sbjct  80    FGDPVAVFCGPAGNKFLFSNENKNVQVWWPSSVKKLLRLSLVNKVGDEAKMVRKL-LMNF  138

Query  461   TNIHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
              N       E LK+Y+P +D +A+ HI   W    +V V+   K YTF LAC LFLSIED
Sbjct  139   LNA------ETLKNYLPKMDRIAQHHIDTYWKGKEQVFVHPTVKLYTFELACCLFLSIED  192

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              D++ +L         G+    LN PGT ++RAMK    +R+++  ++++RK        
Sbjct  193   SDQISKLSLKFNAFLKGIIGFTLNIPGTRFHRAMKAADEIRKEIKMILEKRK--------  244

Query  821   GKVEDE----GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFL  988
             G +E++     +D+L  +L  +D  G+ + E EI    + +L   + +  + ++ V+K+L
Sbjct  245   GDLEEKRASPTQDLLSHMLVTSDPSGRFMTEMEILDNTLLLLFAGHDTARSVLSLVMKYL  304

Query  989   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETV  1168
              +LPH+Y+ V KEQ+EI + K   + L WEDIQKMKYSWNV  E +RL PP  G +RE +
Sbjct  305   GQLPHVYEHVLKEQLEIIQGKEVGQLLQWEDIQKMKYSWNVVSEVMRLSPPVSGAYREAI  364

Query  1169  TDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRM  1348
              DFTYA + IPKGWK  WN  S+H +P  FS P+ FD SR+EG+GP PF+ VPFGGGPRM
Sbjct  365   KDFTYADYNIPKGWKLHWNTGSSHNDPTIFSNPETFDASRFEGSGPTPFSHVPFGGGPRM  424

Query  1349  CPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             C G+EYARLEILVFMHN+V  FK E ++P+EK+ Y+     PV GL VRL P
Sbjct  425   CLGQEYARLEILVFMHNIVKRFKWELVIPDEKLKYDPMLE-PVKGLAVRLHP  475



>ref|XP_007213882.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
 gb|EMJ15081.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
Length=471

 Score =   395 bits (1015),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 220/465 (47%), Positives = 281/465 (60%), Gaps = 20/465 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK 
Sbjct  19    IFAVKGKSDDGKNLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMF-----PTDAQNTLRKITILNRTNIHE  475
             AV CG  G+KF F+NE    T + P S+ K  MF     P        +  +L       
Sbjct  79    AVICGPNGHKFLFSNEQKYCTAFRPHSMQK--MFRSYKAPAAQPAHDEEAKVLRSPGF--  134

Query  476   IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVK  655
               K E L  Y+  +DS+ +E +   W    EVKVY L+K  T  LAC+ FL I++   + 
Sbjct  135   -LKPEALVRYLGIMDSITQEQMKAYWEGKDEVKVYPLAKTLTLGLACRFFLGIDEPGRIA  193

Query  656   RLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED  835
             R +     V+ GM SL LNFPGT + +A K    +RR+L  VI E+KA AM +       
Sbjct  194   RFVSYFDDVTLGMHSLILNFPGTTFYKATKAADALRRELKTVIPEKKA-AMASGASM---  249

Query  836   EGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQ  1015
                +VL  +L  TD+ G+H+ E EI   I+G+L   Y + + A+TF +K + E P IY +
Sbjct  250   --HNVLSHMLEATDQTGKHMPEAEIADKIMGLLTAGYSTVATAMTFFMKHVGERPDIYAK  307

Query  1016  VYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFT  1195
             V  E  EIA SK P E L WEDI KMKYSWNV  E +R  PP QG FRE +TDFTYAG+T
Sbjct  308   VLAEHKEIAYSKKPGEFLEWEDINKMKYSWNVMYEVMRFTPPLQGTFREALTDFTYAGYT  367

Query  1196  IPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAP-FTFVPFGGGPRMCPGKEYAR  1372
             IPKGWK +W V +T+ NP+YF  P+KFDPSRY+     P FTFVPFGGGPRMCPGKEYAR
Sbjct  368   IPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLSTFPAFTFVPFGGGPRMCPGKEYAR  427

Query  1373  LEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             + IL F+HNVV  FK E L P EKI      P P  GLPVRL  H
Sbjct  428   IAILTFVHNVVMRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLIRH  471



>emb|CDP19706.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 282/459 (61%), Gaps = 55/459 (12%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVA  313
             +   ++ + K  LPPGS+G+P++GE +  ++  PEK+I  RM+KYS EVF TS++G+ +A
Sbjct  22    FLCHRSKSKKSKLPPGSSGFPLVGETLHFLMSGPEKFIHQRMEKYSDEVFATSLMGQNLA  81

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFP--TDAQNTLRKITILNRTNIHE--IF  481
             V CGAAGNKF     N  ++ W P S+   LMF    ++    RK         H+  I 
Sbjct  82    VICGAAGNKFLLCTANDFVSPWLPDSL---LMFLNWVESPGKSRKDLFSKIRGFHQAVIM  138

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
             + E LK YIP +DS+ ++H+  +W PF  VKV+  S+  T  LACKL L ++        
Sbjct  139   RPEALKQYIPIMDSLTRQHLQTDWDPFHVVKVHPASQKITLILACKLLLEVDK-------  191

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
                                             ++++ +++I ERK   + N     E  G
Sbjct  192   --------------------------------LKQEFLKIILERKKMVLENR----EKAG  215

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
              DVL R L   DE    L++ E   Y++ +++PTY S SA+ITFVLK LAELPHIY  VY
Sbjct  216   SDVLSRTL--LDENAHLLSDLEFAVYLVSLMIPTYESGSASITFVLKHLAELPHIYDMVY  273

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
             KE +EIAKSK P E L+WED++KMKYSWNV CEA+RL PP  G FRE  TD  +AG TIP
Sbjct  274   KEHMEIAKSKDPEELLNWEDVKKMKYSWNVVCEAMRLAPPATGAFREVETDIHFAGVTIP  333

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEI  1381
             KGWK  W+ ++T+KNPKYF EP+ FDP+R+EG+GP   TF+PF  GPRMCPGK+Y+R  I
Sbjct  334   KGWKVLWSPFTTNKNPKYFPEPENFDPTRFEGDGPTSCTFIPFSTGPRMCPGKDYSRFLI  393

Query  1382  LVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRL  1498
             LV+M+NVV  FK++KL+P+EK++Y    P P +GLP+ +
Sbjct  394   LVYMYNVVRKFKLKKLIPDEKVLYR-VGPYPASGLPISV  431



>ref|XP_010052577.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW76647.1| hypothetical protein EUGRSUZ_D01027 [Eucalyptus grandis]
Length=471

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 285/454 (63%), Gaps = 28/454 (6%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP+IGE ++ +   P+K++ DRM KYSP++FKT ILGE  AV CG +G+KF 
Sbjct  33    NLPPGSFGWPIIGETVEFLFGKPDKFVFDRMAKYSPDIFKTRILGEDTAVICGPSGHKFL  92

Query  347   ftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE--------IFKLENLKH  502
             F+NE    T   P+S+          Q   R          HE          K E L  
Sbjct  93    FSNEERYFTASRPRSM----------QMIFRSYKKAAPPAKHEEKVLRSPGFLKPEALVR  142

Query  503   YIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILV  682
             Y+  +DS+ K+ +  EW   REV+VY L+K  T  LAC+ F+  ++ + + RL+D    +
Sbjct  143   YLGKMDSITKQQMQSEWEGKREVRVYPLAKSLTLTLACRFFIGTDEPERIARLVDYFDDI  202

Query  683   STGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRL  862
             + G+ S+ LN PGT + +A K  + +R++L  VI+++KA     +        +D+L  +
Sbjct  203   TLGLHSITLNIPGTIFYKANKAAAAIRKELRAVIRDKKAAISTGT------PMQDILSHM  256

Query  863   LSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIA  1042
             +  +D  G+++ E EI   I+G L   Y + + A+TF +K++ E P IY++V  EQ+E+A
Sbjct  257   IVASDPSGKYMPEAEIADKIMGFLTAGYSTVATAMTFFMKYVGERPDIYKKVLDEQLEVA  316

Query  1043  KSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFW  1222
              SK P E L W+DI KMKYSWNV  E +RL PP QG FRE +TDFTYAG+TIPKGWK +W
Sbjct  317   ASKKPGEFLEWDDINKMKYSWNVLNEVMRLTPPLQGTFREALTDFTYAGYTIPKGWKVYW  376

Query  1223  NVYSTHKNPKYFSEPDKFDPSRY-EGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHN  1399
              V +T+KNP+YF EP+KFDPSR+ + N   PFTFVPFGGGPR+CPGKEYARL IL F+HN
Sbjct  377   TVSTTNKNPEYFPEPEKFDPSRHDDSNTFPPFTFVPFGGGPRLCPGKEYARLAILAFVHN  436

Query  1400  VVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLT  1501
             VV  FK E + P EKI+     P P  GLPVRL+
Sbjct  437   VVKRFKWELVDPKEKII-GDMMPAPQKGLPVRLS  469



>ref|XP_002529893.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF32496.1| cytochrome P450, putative [Ricinus communis]
Length=474

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 214/466 (46%), Positives = 297/466 (64%), Gaps = 18/466 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             +  F  ++     NLPPGS GWPVIGE I+ +   PEK++ DRMKKYSPE+FKT+ILGEK
Sbjct  19    LFAFKIRSKNGSKNLPPGSLGWPVIGETIEFLFGKPEKFVFDRMKKYSPEIFKTNILGEK  78

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI---  478
              AV CG  G+KF F+NE  L T + P S+ K        Q++     I     I  +   
Sbjct  79    TAVICGPNGHKFLFSNEQKLFTAFRPHSMQKIF---RSYQSSAPPAQISREAEIKMLRSP  135

Query  479   --FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEV  652
                K E L  Y+ T+DS+ ++H+   W    E+KV+ L+K  T +LAC+ FL   + D++
Sbjct  136   GFLKPEALVRYLGTMDSITQQHMEYYWVGKDELKVFPLAKTLTLSLACRFFLGTHEPDKI  195

Query  653   KRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE  832
              RL+     ++ G+ S+P+NFPGT +N+A K  + +R++L  +I E+KA   M + G+++
Sbjct  196   TRLVGNFDDITLGIHSIPVNFPGTIFNKANKAAAAIRKELRTIINEKKAA--METGGRMQ  253

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQ  1012
             D    +L  ++  +D  G+H+ E EI   I+G+L+  Y + + A+TF +K++ E P IY 
Sbjct  254   D----ILSHMIMASDPTGKHMPEAEIADKIMGLLVAGYSTVATAMTFFMKYVGERPDIYA  309

Query  1013  QVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGF  1192
             +V  EQ EI+++K   E L W DIQKMKYSWNV  E +RL PP QG FRE +TDFT+AG+
Sbjct  310   KVLAEQKEISEAKKDGELLEWNDIQKMKYSWNVMYEVMRLTPPLQGTFREALTDFTFAGY  369

Query  1193  TIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAP-FTFVPFGGGPRMCPGKEYA  1369
             TIPKGWK +W V + +KNP YF  P++FDPSRYE +   P FTFVPFGGGPRMCPGKEYA
Sbjct  370   TIPKGWKVYWTVSTANKNPDYFPNPEEFDPSRYEDDKRLPAFTFVPFGGGPRMCPGKEYA  429

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             RL IL F++NVV  FK E  +P EK++     P P  GLP+ L  H
Sbjct  430   RLAILTFINNVVKRFKWEVAIPQEKVI-GDMMPTPEKGLPICLISH  474



>sp|Q50EK0.1|C16B2_PICSI RecName: Full=Cytochrome P450 716B2; AltName: Full=Cytochrome 
P450 CYPA2 [Picea sitchensis]
 gb|AAX07437.1| cytochrome P450 CYPA2 [Picea sitchensis]
Length=497

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 208/465 (45%), Positives = 288/465 (62%), Gaps = 15/465 (3%)
 Frame = +2

Query  140   YFITKANTSK-PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  298
             Y I+   T     +PPG+ GWP+IGE ++ +       P  +   R +KY   VF TS++
Sbjct  38    YLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGNPRDFFDSRTQKYG-NVFTTSLV  96

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             G    VFC   GN+F F+NEN L+   WP SV    +F +    T+       R  +   
Sbjct  97    GHPTVVFCSPEGNRFLFSNENKLVVNSWPSSVGN--LFRSSLITTVGDDAKRLRRILMTF  154

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              + E L+ ++  +DSM K H+AE W    EV    L K YTF+LAC LF SI ++D++ R
Sbjct  155   LRPEALREFVGRVDSMTKRHLAEHWIGKDEVTALPLLKRYTFSLACDLFASINNKDDLGR  214

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L    ++   G+  +P++ PGT YN+A    + +R+QL  +I ERK        G    E
Sbjct  215   LWLHFMVFVKGVMQIPIDLPGTRYNKAKHAANAIRQQLGSIINERKIGL---EAGNASPE  271

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  LLS  DE+G+ L + EI   I+ +L   + ++S+ +T +LKFLAE PH Y++V
Sbjct  272   -QDLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEV  330

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              +EQ++IA SK   + L WED+Q+MKYSW VA EALRLFP  QG FR+ + +F Y GFTI
Sbjct  331   LREQLDIAGSKEAGQLLEWEDLQRMKYSWRVAQEALRLFPAAQGSFRKAIKEFIYDGFTI  390

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W V STH+  +YFS P+ FDPSR+EG GP P+TFVPFGGGPRMCPG E+ARLE
Sbjct  391   PKGWKMYWTVNSTHRKSEYFSNPETFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARLE  450

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             ILVF+HN+V N K   + P EK++ +   P PVNGLP++L PH +
Sbjct  451   ILVFLHNIVKNCKWNLVNPGEKVIVDPM-PAPVNGLPIKLVPHDS  494



>ref|XP_011089169.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=479

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 296/451 (66%), Gaps = 12/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPGS GWP++GE ++ +       PEK+I +R +KY  +VFKTS++GE + + CGAAG
Sbjct  33    NLPPGSYGWPILGETVEFLRAGLEGTPEKFIKERSEKYKSQVFKTSLMGEPMVMLCGAAG  92

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NKF F+NEN L+T WWP SV + L+    A ++  +   + +   + +      + YI T
Sbjct  93    NKFLFSNENKLVTVWWPSSV-RQLLGHCLATSSGDEGKQMRKMVSYFVSPDAFTRLYIRT  151

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D ++++HI   W    EVK+    K YTF LAC+LF+S+ED++++ +L+    +   G+
Sbjct  152   MDLVSQQHIKTHWQGKEEVKISPTIKLYTFELACRLFMSLEDQEQISKLVTLFNVFLKGI  211

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              S+P+NFPGT + +A +  S ++ QL +++++R+A        +     +D+L  LL   
Sbjct  212   ISVPVNFPGTRFYKAKRATSAIKSQLQKIVRQRRAALEQ----RTAVPSQDLLSHLLVAP  267

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             DE G+ ++E  I + I+ +L   + ++S AIT ++K LA+LP IY++V +EQ EIA SK 
Sbjct  268   DENGKFMSEPVIVNNILMLLFAGHDTSSVAITMLMKNLAQLPDIYEKVLREQNEIASSKE  327

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L WED+QKMKYSWNV CE  R+ PP  G FRE + D TYAG+ IPKGWK +W+   
Sbjct  328   AGEFLQWEDVQKMKYSWNVVCEVARISPPIIGAFREALADITYAGYHIPKGWKLYWSSSF  387

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH++  +F +   FDPSR+EG GPAPF++VPFGGGPRMC GKE+ARLEIL+F+HNV+  +
Sbjct  388   THRDASWFPDYPNFDPSRFEGAGPAPFSYVPFGGGPRMCLGKEFARLEILIFLHNVIRRY  447

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +    +P+EKI Y+   P PV GLPV+L  H
Sbjct  448   RWNLQIPDEKIAYDPM-PTPVEGLPVQLHSH  477



>ref|XP_006852240.1| hypothetical protein AMTR_s00049p00153870 [Amborella trichopoda]
 gb|ERN13707.1| hypothetical protein AMTR_s00049p00153870 [Amborella trichopoda]
Length=485

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 208/461 (45%), Positives = 285/461 (62%), Gaps = 11/461 (2%)
 Frame = +2

Query  140   YFITKANTSKPNLPPGSTGWPVIGENIDLMV----PEKYISDRMKKYSPEVFKTSILGEK  307
             ++ TK     P LPPG+ GWP+IGE +  +      E +I  RM+KY  +VF+T ILG  
Sbjct  29    WWRTKHPGEGPKLPPGTGGWPLIGETLPYLALTGSGENFIVKRMRKYRTQVFRTHILGSP  88

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKL  487
             +AVFCGAAGNKF F+NEN +L   WP SV K  +F      T        R  +      
Sbjct  89    MAVFCGAAGNKFIFSNENRVLVNAWPASVAK--LFGRSVITTTGDEAKRVRKVLMAFLSP  146

Query  488   ENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLD  667
             E L  ++  +DS A+ H+   W    EVKVY++ K YTF+LAC LF SIE  +   +L  
Sbjct  147   EALHEFVGQMDSAARLHLKRYWDGKAEVKVYSMLKVYTFSLACSLFASIESEERKAQLSA  206

Query  668   PIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRD  847
                +   GM  + L  PGT Y +A K    +RR+L + + +RK      +     +  +D
Sbjct  207   FFNVFLKGMMQMDLKIPGTRYYKAKKAVDALRRELRKEVDDRKEALRAGT----ANPKQD  262

Query  848   VLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             ++  LL+  D+ G+H+++ E+   II +L   + ++S+ +  VLK LAE P+ Y ++  E
Sbjct  263   LMSYLLTTADDSGKHMSDEEVVDNIINLLFAGHDTSSSTLLMVLKHLAEKPYYYNEILNE  322

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q EI KSKG  E L+WED++KMKY+WNV CE +R+ P   G FR  +TDF YAGF IPKG
Sbjct  323   QREIEKSKGKEEVLNWEDLKKMKYTWNVVCEVMRVSPAVAGAFRLAITDFDYAGFRIPKG  382

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
             W+  WNV++TH   +YF EP+KFDPSR+EG GP P+TFVPFGGGPRMCPG E+AR+E+LV
Sbjct  383   WRLHWNVHTTHMMEEYFPEPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGLEFARVEMLV  442

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             F+HN+V N+K E + PNEKI +    P+  NGLPV L PHQ
Sbjct  443   FLHNLVKNYKWELVFPNEKI-HMDPMPVAENGLPVHLHPHQ  482



>ref|XP_008385452.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Malus domestica]
Length=503

 Score =   395 bits (1015),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 208/463 (45%), Positives = 298/463 (64%), Gaps = 21/463 (5%)
 Frame = +2

Query  176   LPPGSTGWPVIGENIDLM------VPEKYISDRMKKY------SPEVFKTSILGEKVAVF  319
             LPPGSTGWP+IGE ++ +      VPE ++ DR+ KY      S +VFKTS+L + +AV 
Sbjct  41    LPPGSTGWPIIGETLEYLSTAKKGVPENFVLDRINKYLSSAGNSCKVFKTSLLLQDMAVL  100

Query  320   CGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLK  499
             C A GNKF F+NE  L+ +WWP  + K ++  ++    + + +   R  +    K   L+
Sbjct  101   CTAGGNKFLFSNEEKLVKSWWPAYLDKLIVGNSEKTLNITEESNRFRMILAPYLKPAGLQ  160

Query  500   HYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIIL  679
              YI T+DS+ K+++        +VKV+  +K Y F LACKL L  ED   + +L   +  
Sbjct  161   KYIGTMDSVTKKYLVTYCDHKDQVKVHQHAKKYAFTLACKLMLDTEDPQLLGKLQRLLKD  220

Query  680   VSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAK---AMMNSLGKVEDEGRDV  850
             +S+G  +LP++ PGT +NRA++G   +R ++ +++ ER+ K   A  NS+   + +  D+
Sbjct  221   LSSGFTALPIDLPGTTFNRAIRGSRQLREEIEKIVVERRIKLSTASANSMVDEDGDHGDM  280

Query  851   LGRLL-SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKE  1027
             L  LL   T  +G+ + E EI   + G+++  + S S+A+T ++ +LAELP +Y  V KE
Sbjct  281   LSSLLMEETYSDGKQITESEIADKLYGVIVAGHDSLSSALTTIMMYLAELPQVYDAVLKE  340

Query  1028  QIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKG  1207
             Q+EIA SK   E L+W D+QKMKYSW+V+CE +RL PP  G FRE  T+F Y G  IPKG
Sbjct  341   QMEIANSKAAGELLNWGDVQKMKYSWSVSCEVMRLLPPNLGTFREATTNFVYEGHLIPKG  400

Query  1208  WKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
              K  WNV STHKNP+ F  P+KFDPSR+EG GP PF FVPFGGGPRMCPGKEY+RL+ILV
Sbjct  401   MKLHWNVNSTHKNPECFPNPEKFDPSRFEGKGPPPFAFVPFGGGPRMCPGKEYSRLKILV  460

Query  1388  FMHNVVTNFKMEKLVPNEKIVYNSASPI--PVNGLPVRLTPHQ  1510
             FMHNVVT +K +K+ P+EK ++   +P+  P  GLP++L PH 
Sbjct  461   FMHNVVTKYKWDKVFPDEKFIW---APVLRPTKGLPIKLFPHN  500



>ref|XP_010450437.1| PREDICTED: beta-amyrin 28-oxidase-like [Camelina sativa]
Length=476

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/461 (44%), Positives = 298/461 (65%), Gaps = 21/461 (5%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKY----SPEVFKTSILGE  304
             ++ S  NLPPG  G+P+IGE+   +       PEK+I+DR++++    S  VFKT + G 
Sbjct  26    SHFSYQNLPPGKIGFPLIGESFSFLSAGRRGHPEKFITDRVRRFYSSSSSCVFKTHLFGS  85

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFK  484
               AV  GA+GNKF FTNEN L+ +WWP SV K  +FP+  Q + ++     R  + +  K
Sbjct  86    PTAVVTGASGNKFLFTNENKLVVSWWPDSVNK--IFPSSMQTSSKEEAKKLRMILSQFMK  143

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLL  664
              E L+ Y+  +D +A+ H   EWA   ++ V+ L+K +TF++AC+ FLS++D + V++L 
Sbjct  144   PEALRKYVGVMDEIAQRHFEMEWANQDQLMVFPLTKKFTFSIACRSFLSMDDPERVRQLR  203

Query  665   DPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGR  844
             +    V  G+FS+P++ PGT +NRA+K   ++R+++  +I++RK +      GK  +E +
Sbjct  204   EKFNTVGVGVFSIPIDLPGTRFNRAIKASRLLRKEVSAIIRQRKEEL---KDGKALEE-K  259

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  +L    E        ++   IIG+L+  + + S   TF++ +LAE PHIYQ+V +
Sbjct  260   DILSHMLMNIGETKDE----DLADKIIGVLIGGHDTASIVCTFIVNYLAEFPHIYQRVLQ  315

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ EI   K   + L WEDI+KM+YSWNVACE +R+ PP  G FRE +  F++ GF IPK
Sbjct  316   EQNEILNQKK-EKGLRWEDIEKMRYSWNVACEVMRIVPPLPGTFREAIDHFSFKGFYIPK  374

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
             GWK +W+  +TH NP YF EP++FDP+R+EG+GP P+T+VPFGGGPRMCPG+EY RLEIL
Sbjct  375   GWKLYWSATATHMNPDYFPEPERFDPNRFEGSGPKPYTYVPFGGGPRMCPGREYGRLEIL  434

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +FMHN+V  FK E + P E  +     PIP  GLP+R+ P 
Sbjct  435   IFMHNLVKRFKWELVSPKENKIVVDPLPIPSEGLPIRIFPQ  475



>ref|XP_011085174.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=480

 Score =   394 bits (1011),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 206/471 (44%), Positives = 291/471 (62%), Gaps = 18/471 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I++  ++ + S PNLPPG+ GWP+IGE I+ +   PE ++ DRMKKYSP++FKT ILGEK
Sbjct  17    ILFITSRRSASDPNLPPGTFGWPIIGETIEFLFGKPENFVGDRMKKYSPDIFKTKILGEK  76

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG  G+KF F+NE+   T + P  +        +              +  E    
Sbjct  77    TAVICGPNGHKFLFSNEHKYFTAFRPHPMQHLFRSYQNKAAAASLAPPSQTQSSDEAKAI  136

Query  476   ----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDR  643
                   K E L  ++  +D + ++ + E  A    V+VY L+K  T +LAC+ FL I + 
Sbjct  137   RQPGFLKPEALMRFLAKMDVVTQQQLQEHCAGKSVVEVYPLAKTITLSLACQFFLGINNP  196

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
             + + RL+     V+ GM S+ LN PGT + RA K  + +R++L+ VI E+K    M S  
Sbjct  197   ERIARLVKYFDDVTVGMHSIMLNVPGTIFYRANKAAAAIRKELLSVITEKKQG--MASGA  254

Query  824   KVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
              ++D    +L  ++++ D  G+ + E EI   I+G+L   Y + +  ITF++K++ +   
Sbjct  255   PLQD----ILSHMIAIRDSSGKSMPEAEIADKIMGLLTAGYSTVATTITFLMKYVGQSSE  310

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             IY++V  EQ+EIA SK   E L WED+ KMKYSWNV CE +R+ PP QG FRE +T+ +Y
Sbjct  311   IYEKVRAEQMEIAASKEAGELLGWEDMAKMKYSWNVICETMRMVPPLQGTFREVLTEISY  370

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRY-EGNGPAPFTFVPFGGGPRMCPGK  1360
             AG+TIPKGWK +W V +T+KNP+YF EP+ F+PSRY EG  P P+T+VPFGGGPRMCPGK
Sbjct  371   AGYTIPKGWKVYWTVSTTNKNPEYFREPETFNPSRYDEGEAPPPYTYVPFGGGPRMCPGK  430

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             EYARL IL F+HNVV N+K E + PNEK V     P P  GLP+RL  H +
Sbjct  431   EYARLAILAFLHNVVKNYKWEVIDPNEK-VEGDMMPEPQKGLPIRLYHHHH  480



>ref|XP_008358589.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Malus domestica]
Length=480

 Score =   394 bits (1011),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 218/470 (46%), Positives = 288/470 (61%), Gaps = 20/470 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG +G+KF F+NE    T + P S+ K       A  T      + + +  E    
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQKMFRSYKAAAPTASAAPAVAQPSRDEESKV  137

Query  476   -----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I+D
Sbjct  138   IRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGIDD  197

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M + 
Sbjct  198   SERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAG  255

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
             G + D    +L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P
Sbjct  256   GPMHD----ILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  311

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY +V  E  EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFT
Sbjct  312   DIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  371

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRYE  N    FT VPFGGGPRMCPG
Sbjct  372   YAGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMCPG  431

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEYARL IL F+HNVV  F+ E L P EKI      P P  GLPVRL  H
Sbjct  432   KEYARLAILTFVHNVVKRFEWEVLFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>ref|XP_008225706.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Prunus mume]
 ref|XP_008225707.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X3 [Prunus mume]
Length=478

 Score =   393 bits (1010),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 219/470 (47%), Positives = 285/470 (61%), Gaps = 22/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG  G+KF F+NE    T + P S+ K  MF +           + +    E    
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAPPAVAQPARDEEAKV  135

Query  476   -----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ +  +   W    EV+VY L+K  T  LACK FL I++
Sbjct  136   LRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLTKTLTLGLACKFFLGIDE  195

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM +  
Sbjct  196   PDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AMASGA  254

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
                     D+L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P
Sbjct  255   PM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  309

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY +V  E  EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFT
Sbjct  310   DIYAKVLAEHKEIADSKKPGQFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  369

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRY+  N    FTFVPFGGGPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPG  429

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEYARL IL F+HNVV  FK E L PNEKI      P P  GLPVR+  H
Sbjct  430   KEYARLAILTFVHNVVMRFKWEVLFPNEKIT-GDMMPTPEKGLPVRIHRH  478



>ref|XP_010044930.1| PREDICTED: cytochrome P450 716B1-like [Eucalyptus grandis]
 gb|KCW87054.1| hypothetical protein EUGRSUZ_B03596 [Eucalyptus grandis]
Length=475

 Score =   393 bits (1010),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 198/461 (43%), Positives = 288/461 (62%), Gaps = 17/461 (4%)
 Frame = +2

Query  146   ITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEK  307
             + K  T++ NLPPGS GWP+IGE+++ +       PEK+I DRM KY   VFKTS+LGE 
Sbjct  22    LLKLKTARRNLPPGSFGWPIIGESLEFLRCQRGGHPEKFIQDRMSKYDSPVFKTSVLGEP  81

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPL--MFPTDAQNTLRKITILNRTNIHEIF  481
             +A+ CG AGNKF F+NE   +  WWP SV K L     + A +  R     ++  +   F
Sbjct  82    IAILCGPAGNKFLFSNEGKKVALWWPSSVEKVLGRCLVSKAGHEARS----DKKMLMSFF  137

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
               E L   +  ID M K H+   W    +++ Y++ K +TF LAC+ F++I D   V RL
Sbjct  138   NPEALMRSVGVIDEMTKAHLRTHWEGKDQLEAYSILKQHTFDLACRQFMAITDPQLVSRL  197

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
              D   +   G+  LPLN PGT + R+ K    +R++L  ++K+R+A+       K     
Sbjct  198   ADHFHVFLRGVVDLPLNVPGTNFYRSKKAADSIRKELRVLVKQRRAELEK----KTASPS  253

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
             +D++  LL+  DE G+ + E EI + ++ +L   + ++++ + F++K+L+ELPH+ ++V 
Sbjct  254   QDIITHLLANGDENGKLMPEAEIINNVLSLLFAGHDTSTSTLVFIIKYLSELPHVLEKVV  313

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
              EQ EIA SK   E L W D+QKM+YSWNV  E +R+  P  G FRE + +FTY G+TIP
Sbjct  314   AEQREIAASKARGELLHWGDLQKMRYSWNVISEVMRMTAPVYGAFREALVEFTYEGYTIP  373

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEI  1381
             KGWK  W+  STH++P Y+     FD SR+EG+GPAP+T+VPFGGGPRMC G E+AR E+
Sbjct  374   KGWKLHWSACSTHRDPDYYPRSLTFDESRFEGSGPAPYTYVPFGGGPRMCLGLEFARAEL  433

Query  1382  LVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             LVF+HN+V  F+   + P+EKI+Y+   PIP  GLP+RL P
Sbjct  434   LVFLHNLVDGFQWSLVHPDEKIIYH-LMPIPAKGLPIRLRP  473



>ref|XP_011089170.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=492

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/464 (44%), Positives = 296/464 (64%), Gaps = 20/464 (4%)
 Frame = +2

Query  149   TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  310
             +K+     NLPPGS GWP++GE +  +       PEK++ +RM KY  +VFKTS+LGE V
Sbjct  38    SKSRNKILNLPPGSYGWPILGETMAFLRGSIDGSPEKFVKERMDKYKTQVFKTSLLGESV  97

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPL---MFPTDAQNTLRKITILNRTNIHEIF  481
             AV  G AG KF F+NEN L+T WWP SV + L   +  T     ++   +++     ++F
Sbjct  98    AVLRGPAGYKFLFSNENKLVTVWWPSSVRELLGTCLATTGGTQAIQMRKMVSYFVSPDVF  157

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
                  K YI  +D ++++HI   W    E+KV+   K YTF LAC+LF+S+E+  ++KRL
Sbjct  158   T----KRYIKVMDIVSQQHIQTHWQGKEELKVFPAIKLYTFELACRLFMSVEEPTQIKRL  213

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVED-E  838
                  +   G+ S+PLNFPGT + +A +  + ++++L  ++++RK +     LG+ +   
Sbjct  214   SALFNIFLGGIISIPLNFPGTRFYKAKRATAAIKKELQVILRQRKER-----LGQQDTVA  268

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
               D+L  LL+  DE G+ ++E +I + I+ +L   + ++S+AIT ++K LAE P +Y +V
Sbjct  269   SEDLLSHLLACPDENGKFMSESDIINNILLLLFAGHDTSSSAITMLIKTLAEHPEVYDKV  328

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              +EQ EIA SK   E L WEDIQKMKY+WNV  E LRL+PP  G FRE + D  Y G+ I
Sbjct  329   LREQSEIASSKEAGECLQWEDIQKMKYTWNVVSETLRLWPPVVGAFREALVDIKYGGYDI  388

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +WN  STH +   F++   FDPSR++G GP P++FVPFGGGPRMC GKE+ARLE
Sbjct  389   PKGWKFYWNTSSTHTDSSLFTDSTNFDPSRFDGAGPIPYSFVPFGGGPRMCLGKEFARLE  448

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             IL F+HNV+  FK   L+P EKI+ +   P P  GLP+RL PH+
Sbjct  449   ILTFLHNVIGQFKWNLLIPGEKIICDPI-PTPEEGLPIRLHPHK  491



>ref|XP_006340081.1| PREDICTED: cytochrome P450 716B1-like [Solanum tuberosum]
Length=474

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/452 (44%), Positives = 288/452 (64%), Gaps = 14/452 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             N PPGS GWP +GE +  +       PEK++ +R++KY  ++FKTS++GE V V  GA+G
Sbjct  28    NYPPGSCGWPFLGETLKFLKANKEGKPEKFVKERIEKYKSKIFKTSLMGETVVVLGGASG  87

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENL-KHYIP  511
             NKF F+NEN  +  WWP +V K  +  +    T+ +   + R  +      +   + YI 
Sbjct  88    NKFLFSNENKQVVIWWPITVRK--IIGSCLITTVGEEAKIMRKMLSTFVSPDAFSRLYIK  145

Query  512   TIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTG  691
             T+  +A  H    W    +VKVY L K YTF +AC+LF+SIED DEV+RL     ++  G
Sbjct  146   TMQLVAHHHFMNYWQGKEKVKVYPLVKLYTFKVACQLFMSIEDHDEVERLSTQFNILLKG  205

Query  692   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSV  871
             + SLP+N PGTA+ +AM+  + +R++L++V+K+R+     N+        +D+L  LLS 
Sbjct  206   LISLPINLPGTAFYKAMRATTAIRKELLQVVKKRRETLEQNT----ASPSQDILSHLLSC  261

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
              DE G++++E  I + I+  L   + ++S A+T ++K LAE P IYQ + +E IEIA SK
Sbjct  262   PDENGKYMSELLIVNNILLFLFAGHDTSSVALTLLIKRLAEHPQIYQNILQEHIEIASSK  321

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
                E L+W+DIQKMKYSWNV  E +RL PP  G +RE + D  Y G+ IPKGWK +WN  
Sbjct  322   KEGEFLNWDDIQKMKYSWNVVSEVMRLTPPIMGAYREAIVDINYGGYHIPKGWKFYWNTA  381

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
              T  +P+ F      +PSR+EG GPAP+T++PFGGGPRMC GKE+ARLEIL+F+H+++  
Sbjct  382   LTSLDPEIFPNATSLEPSRFEGVGPAPYTYIPFGGGPRMCVGKEFARLEILIFLHSLIRK  441

Query  1412  FKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             F  + L+PNEK++Y+   P P+ GLP+ L PH
Sbjct  442   FNWKLLIPNEKMIYDPM-PTPLEGLPISLQPH  472



>ref|XP_006370477.1| hypothetical protein POPTR_0001s43070g [Populus trichocarpa]
 gb|ERP67046.1| hypothetical protein POPTR_0001s43070g [Populus trichocarpa]
Length=474

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/463 (46%), Positives = 290/463 (63%), Gaps = 15/463 (3%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+    ++ S  NLPPGS GWP+ GE ++ +   PE+++  RMKKYS ++FKT ILGE+ 
Sbjct  21    IFAFKYSSRSAKNLPPGSLGWPIFGETLEFLFGKPEEFVFHRMKKYSSDIFKTKILGEET  80

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE---IF  481
              V CG  G+K+ FTNE  L T +   S+ K  +F +D  +   +IT    + I       
Sbjct  81    VVMCGPDGHKYLFTNEQKLFTVFRTHSMQK--LFLSDEASAPIEITREAESKIIRSPGFL  138

Query  482   KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRL  661
             K E L  Y+  +DS+ ++ +   W    EVKV+  +K  T +LAC+ FL  +D + + RL
Sbjct  139   KPEALVRYLGKMDSITQQKMQAYWEGKDEVKVFPFAKTLTLSLACRFFLGSDDPERIARL  198

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEG  841
             +     V+ GM S+PLNFPGT + RA K  + +R +L  VI E++A  +M    +V+D  
Sbjct  199   VSNFDDVTLGMHSIPLNFPGTTFYRANKAAAAIREELRLVISEKRA--IMAEGAQVQD--  254

Query  842   RDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVY  1021
               VL  ++  TD  G+H+ E EI   ++G+L+  Y + + A+TF +K++ + P IY ++ 
Sbjct  255   --VLCHMILATDPSGKHMAEAEIAGMMMGLLVAGYSTVATAMTFFMKYVGQRPDIYAKIL  312

Query  1022  KEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIP  1201
              EQ EIA +K   E L W DIQKMKYSWNV  E +RL PP QG FRE +TD TYAG+TIP
Sbjct  313   AEQTEIATAKKAGEVLDWNDIQKMKYSWNVVYEVMRLTPPIQGTFREALTDVTYAGYTIP  372

Query  1202  KGWKTFWNVYSTHKNPKYFSEPDKFDPSRYE-GNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             KGWK +W V +T+KNPKYF +P+K DPSR+E G    PFTFVPFG GPRMCPGKEYARL 
Sbjct  373   KGWKIYWTVSTTNKNPKYFPDPEKLDPSRHEDGKAFPPFTFVPFGAGPRMCPGKEYARLA  432

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             IL F+HNVV  +K E + P EKIV     P P  GLP+RL  H
Sbjct  433   ILTFVHNVVKRYKWEVVFPEEKIV-GDMMPSPEKGLPIRLQSH  474



>gb|EPS63622.1| hypothetical protein M569_11162 [Genlisea aurea]
Length=966

 Score =   407 bits (1046),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 293/451 (65%), Gaps = 13/451 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             +LPPGS+GWP+IGE++ L+       PEK+  DR+ KYS  VF+T++ G++V VF G AG
Sbjct  523   HLPPGSSGWPIIGESLTLLYDAWRGHPEKFFFDRIAKYSSPVFRTNLFGQRVVVFFGTAG  582

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENLKHYIPT  514
             NK+ F++EN  + +W   S  K  +FP+ A  +  +  +  R  +    K E L  Y+  
Sbjct  583   NKYLFSHENKTVQSWLMPSYDK--LFPSTANISAVEEGLRLRKLLPGYVKPEALSGYVGI  640

Query  515   IDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTGM  694
             +D +A  +  E W     V V+A  K  TF +A ++FLSIED  E+    +P   V+ G+
Sbjct  641   MDEIANRYFKECWEGKGNVVVHAAMKNITFWIASRVFLSIEDPVEMADFWEPFDAVNDGV  700

Query  695   FSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSVT  874
              ++P++ PGTA+N+AMK    +R +LV +I+ RKA  +  +         D+L  +L   
Sbjct  701   VAIPIDLPGTAFNKAMKASKHIRNELVSIIRRRKALMLEGTAAP----PHDILSHMLLTA  756

Query  875   DEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSKG  1054
             D+ G+ + + EI   I+GIL+    +TS   TFV+KFLAE P +Y  VY+EQ+EI K K 
Sbjct  757   DDNGKLMEDMEIATKILGILVAGQDTTSTITTFVVKFLAEYPQVYDAVYEEQMEILKWKK  816

Query  1055  PNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVYS  1234
               E L WED+QKMKY+WNVACEA RL+PP QGGFRE + DF++ GF IPKGWK +W+  S
Sbjct  817   EGELLKWEDVQKMKYTWNVACEAFRLYPPVQGGFREAIADFSFNGFHIPKGWKIYWSTNS  876

Query  1235  THKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTNF  1414
             TH+NP+Y+ +P++FDP R++G G  P++F+PFGGGPRMCPGKEYARL+ILV +HN+V  F
Sbjct  877   THRNPEYYPDPERFDPMRFDGRGVEPYSFIPFGGGPRMCPGKEYARLKILVIIHNMVKRF  936

Query  1415  KMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
               EK+V +EK+  N   P P  GLP+RL PH
Sbjct  937   GWEKVVADEKVNINPF-PSPAKGLPIRLIPH  966



>ref|XP_011016385.1| PREDICTED: beta-amyrin 28-oxidase-like, partial [Populus euphratica]
Length=437

 Score =   391 bits (1004),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/418 (48%), Positives = 273/418 (65%), Gaps = 13/418 (3%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             ++    P+LPPGS+G P IGE ++L++      PEK+  DR  KY+ EVFKT++  E  A
Sbjct  27    RSKFKHPDLPPGSSGLPYIGETLELLLTGCKGHPEKFFLDRKAKYASEVFKTNLFCEPAA  86

Query  314   VFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN  493
             V CGA GN F F+ +N  L  W+P  V K  +FP+  Q +L +     RT + E  + + 
Sbjct  87    VLCGAKGNNFLFSYKNKDLKAWYPDFVCK--IFPSSVQRSLIEEVDRLRTLLPEFLRPDA  144

Query  494   LKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPI  673
             LK Y+   D++A  H A EW     V V+ L+K +TF LAC+LFLSIED D + +L  P 
Sbjct  145   LKRYVGIFDTVAGRHFASEWENKEVVVVFPLAKSFTFGLACRLFLSIEDPDHISKLASPF  204

Query  674   ILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVL  853
              LV +G+FS+P++ PGT  NRA+K  + +R +L  +IK+RK        GK   E +D+L
Sbjct  205   NLVVSGIFSIPIDLPGTPLNRAIKASNFIRTELFAIIKQRKKDL---EEGKASPE-QDIL  260

Query  854   GRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQI  1033
               +LS  D++G   +E  I   I+ +L   + STSAA  F++K+LAELPHIY+ VYKEQ+
Sbjct  261   SHMLSACDDKGAFKSELNIADTILALLASAHESTSAACAFIVKYLAELPHIYEGVYKEQM  320

Query  1034  EIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWK  1213
             EI+ +K  +E L+W DIQ MKYS  V  E LRL P      RE + DF + GF IPKGWK
Sbjct  321   EISGTKARDELLNWNDIQNMKYSRKVIREVLRLCPTFPN-VREAIHDFYFKGFLIPKGWK  379

Query  1214  TFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILV  1387
              +WN  STH+NP+YF EP++FDPSR+EGNGPAP+TFVPFGGGP MCPG+E+AR+E+LV
Sbjct  380   VYWNANSTHRNPEYFPEPERFDPSRFEGNGPAPYTFVPFGGGPMMCPGREFARIEMLV  437



>ref|XP_008349137.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 286/469 (61%), Gaps = 19/469 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GE+I+ +   PE ++  RM+KYSP++FKT ILGEK 
Sbjct  19    IFALKGKSDDGKNLPPGSMGWPIVGESIEFLFGKPENFVFKRMRKYSPDIFKTYILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE-----  475
             AV CG +G+KF F+NE    T + P S+ K       A  T      + + +  E     
Sbjct  79    AVICGPSGHKFLFSNEQKYFTAFRPHSMQKMFRSYKAAAPTASAAPAVAQPSRDEESKVI  138

Query  476   ----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDR  643
                   K E L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I+D 
Sbjct  139   RSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGIDDS  198

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
             + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M + G
Sbjct  199   ERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAGG  256

Query  824   KVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
              + D    +L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P 
Sbjct  257   PMHD----ILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERPD  312

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             IY +V  E  EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFTY
Sbjct  313   IYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFTY  372

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGK  1360
             AG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRYE  N    FT VPFGGGPRMCPGK
Sbjct  373   AGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMCPGK  432

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             EYARL IL F+HNVV  F+ E L P EKI      P P  GLPVRL  H
Sbjct  433   EYARLAILTFVHNVVKRFEWEVLFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>ref|XP_004293684.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/455 (46%), Positives = 288/455 (63%), Gaps = 19/455 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GE ++ +   PE ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29    NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  347   ftnentllttWWPQSVTKPLMFPT----DAQNTLRKITILNRTNIHE---IFKLENLKHY  505
             F+NE    T + P S+ K  MF +          ++I     + + +     K E L  Y
Sbjct  89    FSNEQKYFTAFRPHSMQK--MFRSYKAATPAAAPKQIARDEESKVLKSPGFLKPEALMRY  146

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             +  +DS+ +E +   W    +V  Y L+K  T +LAC+ FL I++ + + RL++    V+
Sbjct  147   LGKMDSITQEQMKVYWEGKNQVLAYPLAKTLTLSLACRFFLGIDEPERIARLVENFDDVT  206

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
              GM SL +NFPGT ++RA K    +R++L  VI+E+KA AM +    +     D+L  ++
Sbjct  207   VGMHSLIVNFPGTIFHRATKAADAIRKELKTVIQEKKA-AMASGAPMM-----DILTHMI  260

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
               +D  GQH+ E EI   ++G+L   Y + + A+TF +K++ E P IY +V  EQ++IA+
Sbjct  261   VASDPSGQHMPEAEIADKMMGLLTAGYSTVATAMTFFMKYVGERPDIYAKVLAEQMDIAE  320

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             SK P + L WED+ KMKYSWNV  E +R  PP QG FRE +TDF YAG+TIPKGWK +W 
Sbjct  321   SKKPGQLLEWEDLNKMKYSWNVIYEVMRFTPPLQGTFREALTDFEYAGYTIPKGWKVYWT  380

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             V +T+ NP+YF  P+KFDPSRY+  +   PFTFVPFGGGPRMCPGKEYARL IL F+HNV
Sbjct  381   VSTTNMNPEYFPNPEKFDPSRYDDLSAFPPFTFVPFGGGPRMCPGKEYARLAILTFVHNV  440

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             V  FK E + P EKI      P P  GLPVRLT H
Sbjct  441   VKRFKWEVVFPKEKIT-GDMMPTPEKGLPVRLTCH  474



>ref|XP_008225708.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=482

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 288/474 (61%), Gaps = 26/474 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT-------DAQNTLRKITILNRTN  466
              AV CG  G+KF F+NE    T + P S+ K  MF +        A      +    R  
Sbjct  78    TAVICGPKGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAAAAAPPAVAQPARDE  135

Query  467   IHEIF------KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFL  628
               ++       K E L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL
Sbjct  136   EAKVLRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLAKTLTLGLACRFFL  195

Query  629   SIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAM  808
              I++ D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM
Sbjct  196   GIDEPDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AM  254

Query  809   MNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFL  988
              +          D+L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++
Sbjct  255   ASGAPM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYV  309

Query  989   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETV  1168
              E P IY +V  E  EIA SK P + L W+DI KMKYSWNV  E +R  PP QG FRE +
Sbjct  310   GERPDIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREAL  369

Query  1169  TDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAP-FTFVPFGGGPR  1345
             TDFTYAG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRY+     P FTFVPFGGGPR
Sbjct  370   TDFTYAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLSAFPAFTFVPFGGGPR  429

Query  1346  MCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             MCPGKEYARL IL F+HNVV  FK E L PNEKI      P P  GLPVRLT H
Sbjct  430   MCPGKEYARLAILTFVHNVVMRFKWEVLYPNEKIT-GDMMPTPEKGLPVRLTCH  482



>ref|XP_008225705.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=478

 Score =   391 bits (1004),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 284/470 (60%), Gaps = 22/470 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG  G+KF F+NE    T + P S+ K  MF +           + +    E    
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAPPAVAQPARDEEAKV  135

Query  476   -----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL I++
Sbjct  136   LRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLAKTLTLGLACRFFLGIDE  195

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM +  
Sbjct  196   PDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AMASGA  254

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
                     D+L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P
Sbjct  255   PM-----HDILSHMIVASDPTGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  309

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY +V  E  EIA SK P + L W+DI KMKYSWNV  E +R  PP QG FRE +TDFT
Sbjct  310   DIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  369

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V +T+ +PKYF  P+KFDPSRY+  N    FTFVPFGGGPRMCPG
Sbjct  370   YAGYTIPKGWKVYWTVSTTNMDPKYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPRMCPG  429

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEYARL IL F+HNVV  FK E L P EKI      P P  GLPVRL  H
Sbjct  430   KEYARLAILTFVHNVVMRFKWEVLFPKEKIT-GDMMPTPEKGLPVRLVRH  478



>ref|XP_007213963.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
 gb|EMJ15162.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
Length=482

 Score =   391 bits (1004),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 221/474 (47%), Positives = 288/474 (61%), Gaps = 26/474 (5%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPT-------DAQNTLRKITILNRTN  466
              AV CG  G+KF F+NE    T + P S+ K  MF +        A   L  +    R  
Sbjct  78    TAVICGPNGHKFLFSNEQKYFTAFRPHSMQK--MFRSYKAPAAAAAAAALPAVAQPARDE  135

Query  467   IHEIF------KLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFL  628
               ++       K E L  Y+  +DS+ +  +   W    EV+VY L+K  T  LAC+ FL
Sbjct  136   EAKVLRSPGFLKPEALVRYLGVMDSITQAQMKAYWEGKDEVEVYPLTKTLTLGLACRFFL  195

Query  629   SIEDRDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAM  808
              I++ D + R +     V+ GM SL LNFPGT + +A K    +RR+L  VI+E+KA AM
Sbjct  196   GIDEPDRIARFVSNFDDVTVGMHSLILNFPGTTFYKATKAADELRRELKIVIQEKKA-AM  254

Query  809   MNSLGKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFL  988
              +          D+L  ++  +D  G+H+ E EI   I+G+L   Y + + A+TF +K++
Sbjct  255   ASGAPM-----HDILSHMIVASDPTGKHMAEAEIADKIMGLLTAGYSTVATAMTFFMKYV  309

Query  989   AELPHIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETV  1168
              E P IY +V  E  EIA SK P + L W+DI KMKYSWNV  E +R  PP QG FRE +
Sbjct  310   GERPDIYAKVLAEHKEIADSKKPGQFLEWDDINKMKYSWNVLYEVMRFTPPLQGTFREAL  369

Query  1169  TDFTYAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPR  1345
             TDFTYAG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRY+  N    FTFVPFGGGPR
Sbjct  370   TDFTYAGYTIPKGWKVYWTVSTTNMNPEYFPNPEKFDPSRYDDLNAFPAFTFVPFGGGPR  429

Query  1346  MCPGKEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             MCPGKEYARL IL F+HNVV  FK E L PNEKI      P P  GLPVRL  H
Sbjct  430   MCPGKEYARLAILTFVHNVVMRFKWEVLFPNEKIT-GDMMPTPEKGLPVRLHRH  482



>ref|XP_003524231.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=486

 Score =   390 bits (1003),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 282/466 (61%), Gaps = 17/466 (4%)
 Frame = +2

Query  137   IYFITK----ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFK  286
             +YFI K          NLPPG  GWPV+GE ++ +         ++I +R +KY   VFK
Sbjct  25    LYFIIKVFRLGKHPNLNLPPGRLGWPVVGETLEFLRTMNEGNVLRFIQERKEKYDSRVFK  84

Query  287   TSILGEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTN  466
             TS+ G+ V +FCG AGNKF F+NEN  +  WWP SV + L       N +     + R  
Sbjct  85    TSMFGDPVVLFCGPAGNKFLFSNENKNVQVWWPSSVRRLLRL--SLVNKVGDEAKMVRRL  142

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
             +      E L++Y+P +DS+A+ HI   W    +V VY + + YTF LAC LFLSIED D
Sbjct  143   LMSFLNAETLRNYLPKMDSIAQRHIDTYWEGKEQVCVYPIVQLYTFELACCLFLSIEDSD  202

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + +L         G+   PLN PGT + RAMK   ++R+++  ++K+RK       +  
Sbjct  203   HISKLSLKFDEFLKGIIGFPLNVPGTRFYRAMKAADVIRKEIKMILKKRKVDLEEKRVSP  262

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
              +D    +L  +L  +D  G+ + E EI   I+ +L   + ++ + ++ V+K+L +LP +
Sbjct  263   TQD----LLSHMLVTSDPSGRFMTEMEILDNILLLLFAGHDTSRSVLSLVMKYLGQLPQV  318

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             Y+ V +EQ+EI++ K   + L WED+QKMKYSWNVA E +RL PP  G +RE + DFTYA
Sbjct  319   YEHVLEEQLEISQGKEAGQLLQWEDVQKMKYSWNVASEVMRLSPPVSGAYREAIKDFTYA  378

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
              + IPKGWK  WN  S+HK+P  FS P+ FD SR+EG GP PF++VPFGGGPRMC G E+
Sbjct  379   DYNIPKGWKLHWNTGSSHKDPTLFSNPETFDASRFEGAGPTPFSYVPFGGGPRMCLGLEF  438

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTP  1504
             ARLEILVFMHN+V  FK + ++P+E   Y+     P+ GL +RL P
Sbjct  439   ARLEILVFMHNIVKRFKWDLVIPDEMFKYDPMLE-PIKGLAIRLHP  483



>ref|XP_004295460.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   389 bits (1000),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/455 (46%), Positives = 286/455 (63%), Gaps = 19/455 (4%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  346
             NLPPGS GWP++GE ++ +   PE ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29    NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  347   ftnentllttWWPQSVTKPLMFPT----DAQNTLRKITILNRTNIHE---IFKLENLKHY  505
             F+NE    T + P S+ K  MF +          ++I     + +       K E L  Y
Sbjct  89    FSNEQKYFTAFRPHSMQK--MFRSYKAATPAAAPKQIARDEESKVLRSPGFLKPEALMRY  146

Query  506   IPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVS  685
             +  +DS+ +E +   W    +V  Y L+K  T +LAC+ FL I++ + + RL++    V+
Sbjct  147   LGKMDSITQEQMKVYWEGKNQVLAYPLAKTLTLSLACRFFLGIDEPERIARLVENFDDVT  206

Query  686   TGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLL  865
              GM SL +NFPGT ++RA K    +R++L  VI+E+KA AM +    +     D+L  ++
Sbjct  207   VGMHSLIVNFPGTIFHRATKAADAIRKELKTVIQEKKA-AMASGAPMM-----DILTHMI  260

Query  866   SVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAK  1045
               +D  GQH+ E EI   ++G+L   Y + + A+TF +K++ E P IY +V  EQ+EIA+
Sbjct  261   VASDPSGQHMPEAEIADKMMGLLTAGYSTVATAMTFFMKYVGERPDIYAKVLAEQMEIAE  320

Query  1046  SKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWN  1225
             SK P + L W+D+ KMKYSWNV  E +R  PP QG FRE +TDF YAG+TIPKGWK +W 
Sbjct  321   SKTPGQLLEWDDLNKMKYSWNVIYEVMRFTPPLQGTFREALTDFEYAGYTIPKGWKVYWT  380

Query  1226  VYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNV  1402
             V +T+ NP YF  P+KFDPSRY+  +   P+TFVPFGGGPRMCPGKEYARL IL F+HNV
Sbjct  381   VSTTNMNPDYFPNPEKFDPSRYDDVSAFPPYTFVPFGGGPRMCPGKEYARLAILTFVHNV  440

Query  1403  VTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             V  FK E + P EKI      P P  GLP+RLT H
Sbjct  441   VKRFKWEVVFPKEKIT-GDMMPTPEKGLPIRLTCH  474



>ref|XP_004301516.1| PREDICTED: cytochrome P450 716B2-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   390 bits (1003),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 212/469 (45%), Positives = 296/469 (63%), Gaps = 32/469 (7%)
 Frame = +2

Query  179   PPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP----------EVFKTSILGEKV  310
             PPGS+GWP+IGE +         VPEK+I  R  KYS           +VF TS+L E V
Sbjct  41    PPGSSGWPIIGEGLSFTMTAKRGVPEKFIEKRRIKYSSSDSKGSNSSCKVFTTSLLRESV  100

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLE  490
             AV C AAGNKF F+NEN L+ +WWP ++    +FP   +    K +I  R  +   F   
Sbjct  101   AVLCTAAGNKFLFSNENKLVHSWWPYTIYT--IFPGLKKPDTHKDSIRLRKVMSPFFSPN  158

Query  491   NLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDP  670
              L+ ++  +D   K H+ E W+  ++VKV AL+K +TF LACK+FL++ED + + +L +P
Sbjct  159   CLQKHVGIMDGFTKRHMDEFWSDEKQVKVLALAKMHTFTLACKIFLNVEDPEVIAKLEEP  218

Query  671   IILVSTGMFS-LPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKA-----KAMMNSLGKVE  832
             I  +S G  S LP+N PGT +NRA++    V + L E+++ R+      +    +   ++
Sbjct  219   IQHISAGFISTLPINLPGTPFNRAIRASKKVTKDLEEMVERRRIDLDRYRQSTATAADLD  278

Query  833   DEGRDVLGRLLSVTDEEGQHLNEFEIYHY---IIGILLPTYHSTSAAITFVLKFLAELPH  1003
             +  +D++ +LL  T   G+ + E +I      + G+L+    +    I  ++ FL +LP 
Sbjct  279   ENNQDMMSKLLMDTYSNGRQMKETDISDIADKLKGLLIAGSDNVVTTICSMVIFLFQLPT  338

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             +Y  V KEQ+EIA SK   E L+W DIQKMK++WNVACE LRL PP  G FRE +TDF Y
Sbjct  339   VYDAVLKEQMEIADSKAEGELLNWGDIQKMKHTWNVACEVLRLEPPNPGTFREAMTDFVY  398

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKE  1363
              G+ IPKG K +W+V+STHKNP+YF +P+KFDPSR+EG GPAP+++VPFGGGPRMCPG+E
Sbjct  399   EGYRIPKGMKLYWSVFSTHKNPEYFPDPEKFDPSRFEGEGPAPYSYVPFGGGPRMCPGRE  458

Query  1364  YARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPI--PVNGLPVRLTP  1504
             YAR  ILVFMHN+VT F+ EK+ P+EK+V    SP   P  GL VRL P
Sbjct  459   YARFTILVFMHNLVTRFRWEKIFPDEKMV---MSPFLGPTRGLHVRLYP  504



>ref|XP_008350555.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
 ref|XP_008350556.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 288/470 (61%), Gaps = 20/470 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSP++FKT ILGEK
Sbjct  19    IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPDIFKTYILGEK  77

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE----  475
              AV CG +G+KF F+NE    T + P S+ K       A  T      + + +  E    
Sbjct  78    TAVICGPSGHKFLFSNEQKYFTAFRPHSMQKMFRSYKAAAPTASAAPAVAQPSRDEEAKV  137

Query  476   -----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIED  640
                    K E L  Y+  +DS+ +E +   W    EV+VY L+K  T +LAC+ FL I+D
Sbjct  138   IRSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVEVYPLAKTLTLSLACRFFLGIDD  197

Query  641   RDEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSL  820
              + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M + 
Sbjct  198   SERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAG  255

Query  821   GKVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELP  1000
             G + D    +L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P
Sbjct  256   GPMHD----ILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERP  311

Query  1001  HIYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFT  1180
              IY +V  E  EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFT
Sbjct  312   DIYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFT  371

Query  1181  YAGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAP-FTFVPFGGGPRMCPG  1357
             YAG+TIPKGWK +W V + + N +YF  P+KFDPSRY+     P FTFVPFGGGPRMCPG
Sbjct  372   YAGYTIPKGWKVYWTVSTVNMNSEYFPNPEKFDPSRYDDLSVFPXFTFVPFGGGPRMCPG  431

Query  1358  KEYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             KEYARL IL F+HNVV  FK E + P EKI      P P  GLPVRLT H
Sbjct  432   KEYARLAILTFVHNVVKRFKWEVVFPKEKIT-GDMMPTPEKGLPVRLTRH  480



>ref|XP_003633047.1| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=475

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 282/466 (61%), Gaps = 19/466 (4%)
 Frame = +2

Query  134   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  307
             I  F  K+      LPPGS GWP++GE ++ +   PE ++ DRMKKYSP++FKT ILGEK
Sbjct  21    IFAFTRKSGDDDKKLPPGSLGWPIMGETLEFLFGKPENFVFDRMKKYSPDIFKTKILGEK  80

Query  308   VAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE---I  478
               V CG  G+KF F+NE    T + P S+ K  +F +      ++I       I      
Sbjct  81    TVVICGPEGHKFLFSNEAKYFTAFRPHSMQK--IFRSYQAAAPKQIARDAEAKIIRAPGF  138

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              K E L HY+  +DS+ ++ +   W    EVKV+  +K  T  LAC+ FL I+D + + R
Sbjct  139   LKPEALIHYLGKMDSITQQQLQAHWEGKTEVKVFPFAKTLTLTLACRFFLGIDDPERIAR  198

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L+     ++ GM S+PL  PGT + +A K  + +R++L  +IKE+KA AM          
Sbjct  199   LVTNFDDITLGMHSIPLRIPGTIFYQASKAAAAIRKELFTIIKEKKA-AMATG-----QP  252

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  ++   D  G+ + E EI   I+G+L   Y + + AI F++  + E P IY ++
Sbjct  253   MQDILSHMIVAADPTGRFMPEAEIADKIMGLLTAGYSTVATAIAFLI--VGERPDIYNKI  310

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
               EQ EIA SK P + LSW+D+ KMKYSWN   E +R  PP QG FR  +  FTYAG+TI
Sbjct  311   LAEQWEIAASKQPGDFLSWDDMHKMKYSWNTVYEVMRFTPPLQGTFRTVLEGFTYAGYTI  370

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYE---GNGPAPFTFVPFGGGPRMCPGKEYA  1369
             PKGWK +W V +T+KNP YF +P+KFDP+RYE   G+ P PF FVPFGGG RMCPGKEYA
Sbjct  371   PKGWKVYWTVSTTNKNPAYFRDPEKFDPTRYEERNGSSPPPFAFVPFGGGQRMCPGKEYA  430

Query  1370  RLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             R  IL F+HNVV  +K E L+P+EKIV     P P  GLP+RL PH
Sbjct  431   RFAILTFLHNVVKRYKWEVLLPDEKIV-GDMMPTPQKGLPIRLQPH  475



>sp|Q50EK1.1|C16B1_PICSI RecName: Full=Cytochrome P450 716B1; AltName: Full=Cytochrome 
P450 CYPA1 [Picea sitchensis]
 gb|AAX07436.1| cytochrome P450 CYPA1 [Picea sitchensis]
Length=493

 Score =   389 bits (1000),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 206/464 (44%), Positives = 284/464 (61%), Gaps = 15/464 (3%)
 Frame = +2

Query  140   YFITKANTSK-PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  298
             Y I+   T     +PPG+ GWP+IGE ++ +       P  +   R +KY   VF TS++
Sbjct  38    YLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGNPRDFFDSRTQKYG-NVFTTSLV  96

Query  299   GEKVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEI  478
             G    VFC   GN+F F+NEN L+   WP SV    +F +    T+       R  +   
Sbjct  97    GHPTVVFCSPEGNRFLFSNENKLVVNSWPSSVGN--LFRSSLITTVGDDAKRLRRILMTF  154

Query  479   FKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKR  658
              + E L+ ++  +DSM K H+AE W    EV    L K YTF+LAC LF SI  +D++ R
Sbjct  155   LRPEALREFVGRVDSMTKRHLAEHWIGKDEVMALPLLKRYTFSLACDLFASINTKDDLDR  214

Query  659   LLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDE  838
             L    ++   G+  +P++ PGT YN+     + +R+QL  +I ERK        G    E
Sbjct  215   LWLHFMVFVKGVMQIPIDLPGTRYNKTKHAANAIRQQLGSIINERKIAL---EAGNASPE  271

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  LLS  DE+G+ L + EI   I+ +L   + ++S+ +T +LKFLAE PH Y++V
Sbjct  272   -QDLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEV  330

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              +EQ+ IA SK   + L WED+Q+MKYSW VA EALRLFP  QG FR+ + +F Y GFTI
Sbjct  331   LREQLNIAGSKEEGQLLEWEDLQRMKYSWRVAQEALRLFPAVQGSFRKAIKEFIYDGFTI  390

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK  W V STH+  +YFS P+KFDPSR+EG GP P+TFVPFGGGPRMCPG E+AR+E
Sbjct  391   PKGWKLHWTVNSTHQKSEYFSNPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARME  450

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             IL+F+HN+V NF    + P EK++ +   P PVNGLP++L PH 
Sbjct  451   ILIFLHNIVKNFNWNLVNPLEKVIVDPM-PAPVNGLPIKLVPHD  493



>ref|XP_009353896.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=480

 Score =   389 bits (998),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 286/469 (61%), Gaps = 19/469 (4%)
 Frame = +2

Query  137   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  310
             I+ +   +    NLPPGS GWP++GE+I+ +   PE ++ +RM+KYSP++FKT ILGEK 
Sbjct  19    IFALKGKSDGAKNLPPGSMGWPIVGESIEFLFGKPENFVFNRMRKYSPDIFKTYILGEKT  78

Query  311   AVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHE-----  475
             AV CG +G+KF F+NE    T + P S+ K       A  T      + + +  E     
Sbjct  79    AVICGPSGHKFLFSNEQKYFTAFRPHSMQKMFRSYKAAAPTASAAPAVAQPSRDEEAKVI  138

Query  476   ----IFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDR  643
                   K E L  Y+  +DS+ +E +   W    EVKVY L+K  T +LAC+ FL I+D 
Sbjct  139   RSPGFLKPEALVRYLGKMDSITQEQMKAYWEGKDEVKVYPLAKTLTLSLACRFFLGIDDS  198

Query  644   DEVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLG  823
             + + RL+     V+ GM SL +NFPGT + +A K    +R++L  VI+E+KA   M + G
Sbjct  199   ERIARLVSNFDDVTVGMHSLIINFPGTTFYKATKAADALRKELRIVIQEKKAA--MAAGG  256

Query  824   KVEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPH  1003
              + D    +L  ++  +D  G+H+ E E+   I+G+L   Y + + A+TF +K++ E P 
Sbjct  257   PMHD----ILSHMIVASDPSGKHMPEAEVADKIMGLLTAGYSTVATAMTFFMKYVGERPD  312

Query  1004  IYQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTY  1183
             IY +V  E  EIA SK P + L WEDI KMKYSWNV  E +R  PP QG FRE +TDFTY
Sbjct  313   IYAKVLAEHKEIADSKKPGDFLEWEDINKMKYSWNVLYEVMRFTPPLQGTFREALTDFTY  372

Query  1184  AGFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEG-NGPAPFTFVPFGGGPRMCPGK  1360
             AG+TIPKGWK +W V +T+ NP+YF  P+KFDPSRYE  N    FT VPFGGGPRMCPGK
Sbjct  373   AGYTIPKGWKVYWTVSTTNMNPQYFPNPEKFDPSRYEDLNAFPAFTLVPFGGGPRMCPGK  432

Query  1361  EYARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             E ARL IL F+HNVV  F+ E + P EKI      P P  GLPVRL  H
Sbjct  433   ENARLAILTFVHNVVKRFEWEVVFPKEKIT-GDMMPTPEKGLPVRLRRH  480



>gb|EPS59491.1| hypothetical protein M569_15315, partial [Genlisea aurea]
Length=471

 Score =   387 bits (995),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/458 (44%), Positives = 292/458 (64%), Gaps = 18/458 (4%)
 Frame = +2

Query  152   KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  313
             K+   K NLPPG  GWP+IGE++D         P+K+   R++KY   +FKTS+LGEK+A
Sbjct  21    KSTDGKRNLPPGGYGWPIIGESLDFFRDARNGEPQKFALSRVEKYKSPIFKTSLLGEKMA  80

Query  314   VFCGAAGNKffftnentllttWWPQSVTK---PLMFPTDAQNTLRKITILNRTNIHEIFK  484
                GA+GNKF F+NEN L++ WWP SV +   P +  T  +  L     ++     E F 
Sbjct  81    FLSGASGNKFLFSNENKLVSLWWPASVRRLLGPCLSTTSGEEGLAMRKFMSHFLNPERFS  140

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD-EVKRL  661
                 K YI T+DS+ ++H+   W    EV V+  +K+YTF LAC+LFLS++D D E++RL
Sbjct  141   ----KVYITTMDSVTQQHVRNHWEGKSEVNVFKTAKFYTFELACRLFLSLDDSDGEIRRL  196

Query  662   LDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVE-DE  838
              D   +   G+ SL  NFPG  ++ A +   +++++L  +++ RK   M+    + + D 
Sbjct  197   FDLFNVFLKGIISLDFNFPGFRFHAANRATLVIKQRLQNIVRNRKQ--MLEQGTRTDADA  254

Query  839   GRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQV  1018
              +D+L  LL   DE G+ + E  I + I+ +L   + ++S+AIT V+K+LAELP +Y+ V
Sbjct  255   PQDLLTHLLVACDENGKFMAESMIVNNILMLLFAGHDTSSSAITLVMKYLAELPQVYEDV  314

Query  1019  YKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTI  1198
              KEQ EIA  K   E L WEDIQKM+Y+WNV  E +RL PP  G FRE + D TY G+ I
Sbjct  315   LKEQEEIAGGKESGEFLRWEDIQKMRYTWNVVSEVIRLAPPVVGSFREALVDITYGGYHI  374

Query  1199  PKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             PKGWK +W   STH++P  F+E D+FDPSR+EG+GP P++FV FGGGPRMC GKE ARLE
Sbjct  375   PKGWKLYWGAPSTHRDPDLFAECDRFDPSRFEGSGPVPYSFVAFGGGPRMCLGKELARLE  434

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPV  1492
             IL+F+HNVV  ++    + +E++VY+   P P++GL +
Sbjct  435   ILIFLHNVVRRYEWRLKMGDERVVYDPM-PTPIHGLDI  471



>gb|EYU33953.1| hypothetical protein MIMGU_mgv1a023105mg [Erythranthe guttata]
Length=483

 Score =   387 bits (995),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/454 (44%), Positives = 291/454 (64%), Gaps = 14/454 (3%)
 Frame = +2

Query  173   NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  334
             NLPPG+ GWP++GE ++ +      +P K++ +R+ KY+ +VFKTS++G+ VAV  G +G
Sbjct  36    NLPPGTYGWPILGETLEFLNTRFDGLPHKFVQERVDKYNSKVFKTSLMGQSVAVLYGPSG  95

Query  335   NKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLENL-KHYIP  511
             NKF F+NEN L+T WWP SV K L         L+ + +  R  +      +   K YI 
Sbjct  96    NKFLFSNENKLVTVWWPSSVRKILGTCISTTGGLQGMHM--RKMVSYFVSPDAFTKLYIK  153

Query  512   TIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVSTG  691
              +D  A++HIA  W    E+KV+   + YTF +AC+LF+SIED   +  L     +   G
Sbjct  154   KMDLTAQQHIANHWLGNDEIKVFEAIRLYTFEVACRLFMSIEDPMHIDTLATLFNVFIKG  213

Query  692   MFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLSV  871
             + S+P+NFPGT + +A +  + +R++L +++K R+         K     +D+L  LL  
Sbjct  214   VISIPINFPGTRFFKAKRATNSIRKELEKIVKHRRVALE----EKTAVPSQDLLSHLLYY  269

Query  872   TDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKSK  1051
              DE G+ ++E  I + I+ +L   + ++S+A+T ++K+LA+ P +YQ+V  EQ +IA SK
Sbjct  270   PDENGKFMSEEVIINNILMLLFAGHDTSSSALTMLIKYLAQHPQVYQKVLTEQNKIASSK  329

Query  1052  GPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNVY  1231
                E L WED+QKMKYSWNVA EA+RL PP  G FRE V D  Y G+ IPKGWK +W+  
Sbjct  330   KDGEFLEWEDLQKMKYSWNVASEAMRLSPPLIGAFREAVVDLNYGGYDIPKGWKLYWSSS  389

Query  1232  STHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVTN  1411
              TH++P  F +   FDPSR+EG GP P+++VPFGGGPRMC GKE+ARLEIL+F+HN+V  
Sbjct  390   LTHRDPNLFKDSKDFDPSRFEGTGPIPYSYVPFGGGPRMCLGKEFARLEILIFLHNLVKT  449

Query  1412  FKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQN  1513
             FK E ++ +EKI+Y+   P PV GLP+RL PH +
Sbjct  450   FKWELVIDSEKIIYDPI-PTPVQGLPIRLRPHHH  482



>gb|AHF22082.1| CYP716D22 [Artemisia annua]
Length=479

 Score =   386 bits (991),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 202/468 (43%), Positives = 294/468 (63%), Gaps = 23/468 (5%)
 Frame = +2

Query  143   FITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEV-FKTSILG  301
             +   +  SK NLPPGS GWP +GE++ L+       PE++I++R++K+   V FKTS+LG
Sbjct  22    YTKSSQRSKINLPPGSFGWPFLGESLSLLRACWAGEPERFINERIEKHGNSVVFKTSLLG  81

Query  302   EKVAVFCGAAGNKffftnentllttWWPQSVTKP-----LMFPTDAQNTLRKITILNRTN  466
             + +AV CG AGNKF F NEN L+  WWP  V K      +    D    +RK+ +L+   
Sbjct  82    DYMAVLCGPAGNKFLFGNENKLVAAWWPLPVRKLFGRCLITIRGDEAKWMRKM-LLSYLG  140

Query  467   IHEIFKLENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRD  646
                        HY  T+D + + HI   W    EV VY   K Y F LAC+LF+S+E+ +
Sbjct  141   PDAF-----ATHYAVTMDVVTRRHIEVHWRGKEEVNVYQTVKLYAFELACRLFMSLEEPN  195

Query  647   EVKRLLDPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGK  826
              + +L     +   G+  LP++FPGT +  + K  + +R +L  +I  R+      + GK
Sbjct  196   HIAKLASLFNVFLKGIIELPIDFPGTRFYSSKKAAAAIRTELKTLINARRVAL---AEGK  252

Query  827   VEDEGRDVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHI  1006
                  +D+L  LL+ +DE+G++L E EI + I+ +L   + +++ +IT ++K LAE P +
Sbjct  253   ATS-SQDLLSHLLTSSDEDGKYLTEMEIANNILLLLFAGHDTSTCSITLLMKRLAEHPAV  311

Query  1007  YQQVYKEQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYA  1186
             Y +V KE ++I K+K   E L WEDIQKMKYSWNV  E +RL PP  G +RE + DF Y 
Sbjct  312   YDKVLKEHLDICKTKEAGELLKWEDIQKMKYSWNVVSEVMRLTPPIVGAYREALVDFEYG  371

Query  1187  GFTIPKGWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEY  1366
             G+TIPKGWK +W+  + HK+   F + ++FDPSR+EG GP PFT+VPFGGGPRMC GKE+
Sbjct  372   GYTIPKGWKLYWSAAAAHKDEANFEDVERFDPSRFEGAGPTPFTYVPFGGGPRMCLGKEF  431

Query  1367  ARLEILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
             +RLE+LV++HN+VTNFK + L+P+EKI Y+  + +P  GLP+RL PHQ
Sbjct  432   SRLEVLVYLHNIVTNFKWDLLIPDEKIEYDPMA-VPEKGLPIRLHPHQ  478



>ref|XP_006445580.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
 gb|ESR58820.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
Length=484

 Score =   386 bits (991),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 203/454 (45%), Positives = 283/454 (62%), Gaps = 18/454 (4%)
 Frame = +2

Query  170   PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  331
             P+LPPG+ GWPVIGE +  +       PE++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  39    PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  98

Query  332   GNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFKLEN-LKHYI  508
             G+K  F+NEN L+ TWWP SV K  +F T             R  +   F   N L  Y+
Sbjct  99    GHKLLFSNENKLVRTWWPSSVGK--LFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYV  156

Query  509   PTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLLDPIILVST  688
               ID + ++HIA  W    EVKV+   K YTF LAC L  S+ED   + +L     +   
Sbjct  157   ERIDMITQQHIATYWEGKEEVKVHPTVKLYTFELACHLLASVEDPLLISKLASHFNIFLK  216

Query  689   GMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGRDVLGRLLS  868
             G+ S P+NFPGT + ++++    +R +L+++I    AK    +LG      +D+L RL+ 
Sbjct  217   GVMSFPVNFPGTTFYKSIRAADAIREELIKLI----AKQTREALGS----KQDLLSRLVV  268

Query  869   VTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYKEQIEIAKS  1048
             + D  G+ L E E+   I+ +L  ++ ++S+AIT +LK+L ++P +++ V +EQI IA+S
Sbjct  269   IADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAES  328

Query  1049  KGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPKGWKTFWNV  1228
             K   E L WEDIQKMKY+WNVA E +RL PP  G FRE + DFTY+G+TIPKGWK  W+ 
Sbjct  329   KEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWST  388

Query  1229  YSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEILVFMHNVVT  1408
              STHK+   F  P+ FD SR+E  G  P+++VPFGGGPRMCPG E+ RL ILVF+HN++ 
Sbjct  389   GSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIK  448

Query  1409  NFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPHQ  1510
              FK + L+P+EK  Y+     P  GLP+RL PHQ
Sbjct  449   RFKWDLLIPDEKFGYDPMLS-PSQGLPIRLQPHQ  481



>gb|AJD25250.1| cytochrome P450 CYP716D25 [Salvia miltiorrhiza]
Length=477

 Score =   385 bits (990),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 205/463 (44%), Positives = 296/463 (64%), Gaps = 15/463 (3%)
 Frame = +2

Query  143   FITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGE  304
             F   +     NLPPGS GWPV+GE  + +       PEK++ +RM+KY+ +VFKT I+GE
Sbjct  21    FTRSSRNGALNLPPGSYGWPVLGETAEFLRAGLDGKPEKFVRERMEKYNSQVFKTWIMGE  80

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFK  484
              +AV CGAAGNKF F+NEN L+T WWP SV K L+ P  A +   +   + R   + +  
Sbjct  81    PMAVLCGAAGNKFLFSNENKLVTVWWPSSVRK-LLGPCLATSGGEEGRQMRRMVSYFVSP  139

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLL  664
                 + YI T+D ++++HI   W    EVKV+   K YTF LAC+LF+S+ED +++ +L 
Sbjct  140   DAFTRLYIKTMDMVSQQHIKTHWQGKEEVKVFPTIKQYTFELACRLFMSLEDGEQIGKLA  199

Query  665   DPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGR  844
                 +   G+ S+P+N PG  + RA K    ++ +L ++++ER+         K     +
Sbjct  200   ILFNIFLKGIISIPINLPGARFYRAKKATYAIKNELHKLVRERRGALEQ----KTALPCQ  255

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  LL   DE  + + E  I + I+ +L   + ++S AIT +LK LAE P +Y++V +
Sbjct  256   DLLSHLLVTPDENARFMAEPVIVNNILMLLFAGHDTSSVAITMLLKSLAERPDVYEKVLR  315

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ EIA ++G  E L WEDIQKMKYSW+V CEA+RL PP  G FRE +TD +YAG+ IPK
Sbjct  316   EQREIA-TEGAGEFLQWEDIQKMKYSWSVVCEAMRLSPPVIGAFREALTDISYAGYHIPK  374

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYE--GNGPAPFTFVPFGGGPRMCPGKEYARLE  1378
             GWK +W+  +TH++P  F    +FDPSR+E   +GPAP+++VPFGGGPRMC GKE+ARLE
Sbjct  375   GWKLYWSSSNTHRDPSLFKSYTEFDPSRFEESSSGPAPYSYVPFGGGPRMCLGKEFARLE  434

Query  1379  ILVFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             IL+F+HN++  ++ + + P EKI Y+   P PV GLP+ L PH
Sbjct  435   ILIFLHNLIKRYRWKLVNPREKIAYDPM-PTPVEGLPILLQPH  476



>ref|XP_010435488.1| PREDICTED: beta-amyrin 28-oxidase-like [Camelina sativa]
Length=480

 Score =   385 bits (990),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 198/461 (43%), Positives = 294/461 (64%), Gaps = 21/461 (5%)
 Frame = +2

Query  155   ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKY----SPEVFKTSILGE  304
             +N S  +LPPG  G+P+IGE++  +       PEK+I+DR++ +    S  VFKT + G 
Sbjct  26    SNFSYQHLPPGKIGFPLIGESLSFLSAGRQGHPEKFITDRVRLFYSSSSSCVFKTHLFGS  85

Query  305   KVAVFCGAAGNKffftnentllttWWPQSVTKPLMFPTDAQNTLRKITILNRTNIHEIFK  484
               AV  GA+GNKF FTNEN L+ +WWP SV K  +FP+  Q + ++     R  + +  K
Sbjct  86    PTAVVTGASGNKFLFTNENKLVVSWWPDSVNK--IFPSSMQTSSKEEAKKLRMILSQFMK  143

Query  485   LENLKHYIPTIDSMAKEHIAEEWAPFREVKVYALSKYYTFALACKLFLSIEDRDEVKRLL  664
              E L+ Y+  +D +A+ H   EWA   ++ V+ L+K +TF++AC+ FLS++D + V++L 
Sbjct  144   PEALRKYVGVMDEIAQRHFEMEWANQDQLIVFPLTKKFTFSIACRSFLSMDDPERVRQLR  203

Query  665   DPIILVSTGMFSLPLNFPGTAYNRAMKGGSMVRRQLVEVIKERKAKAMMNSLGKVEDEGR  844
             +    V      +P++ PGT +NRA+K   ++R+++  +I++RK +      GK  +E +
Sbjct  204   EKFNTVXXXXXXIPIDLPGTRFNRAIKASRLLRKEVSAIIRQRKEEL---KDGKALEE-K  259

Query  845   DVLGRLLSVTDEEGQHLNEFEIYHYIIGILLPTYHSTSAAITFVLKFLAELPHIYQQVYK  1024
             D+L  +L    E        ++   IIG+L+  + + S   TF++ +LAE PHIYQ+V +
Sbjct  260   DILSHMLMNIGETKDE----DLADKIIGVLIGGHDTASIVCTFIVNYLAEFPHIYQRVLQ  315

Query  1025  EQIEIAKSKGPNERLSWEDIQKMKYSWNVACEALRLFPPGQGGFRETVTDFTYAGFTIPK  1204
             EQ EI   K   + L WEDI+KM+YSWNVACE +R+ PP  G FRE +  F++ GF IPK
Sbjct  316   EQKEILNQKK-EKGLRWEDIEKMRYSWNVACEVMRIVPPLPGTFREAIDHFSFKGFYIPK  374

Query  1205  GWKTFWNVYSTHKNPKYFSEPDKFDPSRYEGNGPAPFTFVPFGGGPRMCPGKEYARLEIL  1384
             GWK +W+  +TH NP YF EP++FDP+R+EG+GP P+T+VPFGGGPRMCPG+EY RLEIL
Sbjct  375   GWKLYWSATATHTNPDYFPEPERFDPNRFEGSGPKPYTYVPFGGGPRMCPGREYGRLEIL  434

Query  1385  VFMHNVVTNFKMEKLVPNEKIVYNSASPIPVNGLPVRLTPH  1507
             +FMHN+V  FK E + P E  +     PIP  GLP+R+ P 
Sbjct  435   IFMHNLVKRFKWELVSPKENKIVVDPLPIPSKGLPIRILPQ  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5132930094402