BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25314_g7_i7 len=339 path=[13426:0-23 13450:24-51 41751:52-54
37842:55-59 6719:60-109 15178:110-134 6794:135-146 6806:147-208
21480:209-226 21498:227-242 13559:243-338]

Length=339
                                                                      Score     E

gb|KCW67485.1|  hypothetical protein EUGRSUZ_F01221                   84.3    1e-16   
gb|KCW67482.1|  hypothetical protein EUGRSUZ_F01221                   82.8    4e-16   
gb|KCW67481.1|  hypothetical protein EUGRSUZ_F01221                   82.8    5e-16   
ref|XP_010060686.1|  PREDICTED: protein DJ-1 homolog B                82.8    5e-16   
gb|KCW67484.1|  hypothetical protein EUGRSUZ_F01221                   82.8    6e-16   
ref|XP_007021700.1|  Class I glutamine amidotransferase-like supe...  80.5    1e-15   
ref|XP_004137241.1|  PREDICTED: uncharacterized protein LOC101212934  81.3    1e-15   
emb|CDP05996.1|  unnamed protein product                              80.5    2e-15   
ref|XP_008451768.1|  PREDICTED: protein DJ-1 homolog A-like           80.5    2e-15   
emb|CBI20205.3|  unnamed protein product                              79.7    3e-15   
emb|CAN62882.1|  hypothetical protein VITISV_008479                   79.7    4e-15   Vitis vinifera
ref|XP_010644129.1|  PREDICTED: protein DJ-1 homolog B-like           79.7    5e-15   
gb|KHG19771.1|  Chaperone YajL                                        79.3    6e-15   
gb|EMS59734.1|  hypothetical protein TRIUR3_20130                     79.0    6e-15   
ref|XP_004294088.1|  PREDICTED: uncharacterized protein LOC101315413  78.6    9e-15   
gb|KHG22542.1|  Chaperone YajL                                        79.3    9e-15   
ref|XP_006442570.1|  hypothetical protein CICLE_v10021742mg           76.6    2e-14   
ref|XP_006852437.1|  hypothetical protein AMTR_s00021p00099040        78.2    2e-14   
ref|XP_006442553.1|  hypothetical protein CICLE_v10022043mg           75.9    2e-14   
ref|XP_007021699.1|  Class I glutamine amidotransferase-like supe...  77.8    3e-14   
ref|XP_006493626.1|  PREDICTED: protein DJ-1 homolog B-like           75.1    3e-14   
ref|XP_006442550.1|  hypothetical protein CICLE_v10020189mg           77.4    3e-14   
ref|XP_006442543.1|  hypothetical protein CICLE_v10021210mg           75.9    5e-14   
gb|EEE54120.1|  hypothetical protein OsJ_00891                        77.4    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002524274.1|  conserved hypothetical protein                   75.9    8e-14   Ricinus communis
gb|KDO41212.1|  hypothetical protein CISIN_1g045076mg                 73.2    8e-14   
ref|XP_006442547.1|  hypothetical protein CICLE_v10023786mg           73.2    2e-13   
dbj|BAD73062.1|  putative 4-methyl-5(B-hydroxyethyl)-thiazol mono...  75.1    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042407.2|  Os01g0217800                                     75.1    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70182.1|  hypothetical protein OsI_00911                        75.1    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006442560.1|  hypothetical protein CICLE_v10024360mg           73.6    2e-13   
ref|XP_006493620.1|  PREDICTED: protein DJ-1 homolog B-like           74.7    4e-13   
ref|XP_006442555.1|  hypothetical protein CICLE_v10021981mg           72.0    5e-13   
gb|ADE76388.1|  unknown                                               73.6    8e-13   
gb|ADE76519.1|  unknown                                               73.6    9e-13   
ref|XP_008226523.1|  PREDICTED: protein DJ-1 homolog B-like           73.2    1e-12   
gb|KDP32522.1|  hypothetical protein JCGZ_14725                       72.8    1e-12   
ref|XP_011029555.1|  PREDICTED: protein DJ-1 homolog B                72.8    2e-12   
ref|XP_010108252.1|  hypothetical protein L484_018673                 72.4    2e-12   
ref|XP_006645640.1|  PREDICTED: protein DJ-1 homolog B-like           72.4    2e-12   
ref|XP_006442564.1|  hypothetical protein CICLE_v10020809mg           72.0    2e-12   
ref|XP_002316868.1|  putative 4-methyl-5(b-hydroxyethyl)-thiazole...  71.6    4e-12   Populus trichocarpa [western balsam poplar]
gb|AFW86786.1|  hypothetical protein ZEAMMB73_682876                  68.9    7e-12   
ref|XP_009335186.1|  PREDICTED: protein DJ-1 homolog B-like           70.1    1e-11   
ref|XP_009340133.1|  PREDICTED: protein DJ-1 homolog B-like           70.1    1e-11   
ref|XP_008350011.1|  PREDICTED: protein DJ-1 homolog B-like           70.1    1e-11   
ref|NP_001144456.1|  uncharacterized protein LOC100277419             69.3    2e-11   Zea mays [maize]
dbj|BAJ90160.1|  predicted protein                                    69.3    2e-11   
ref|XP_008382064.1|  PREDICTED: protein DJ-1 homolog B                68.9    2e-11   
gb|AFW86787.1|  hypothetical protein ZEAMMB73_682876                  69.3    3e-11   
ref|XP_008222086.1|  PREDICTED: protein DJ-1 homolog B-like           67.0    3e-11   
gb|KDO48783.1|  hypothetical protein CISIN_1g019238mg                 67.4    3e-11   
ref|XP_009342289.1|  PREDICTED: protein DJ-1 homolog B-like           68.2    5e-11   
ref|XP_007211633.1|  hypothetical protein PRUPE_ppa005820mg           68.6    5e-11   
gb|KDO48782.1|  hypothetical protein CISIN_1g019238mg                 67.8    5e-11   
gb|ACN35036.1|  unknown                                               67.4    6e-11   Zea mays [maize]
gb|KCW67488.1|  hypothetical protein EUGRSUZ_F01222                   67.4    8e-11   
ref|XP_010230619.1|  PREDICTED: protein DJ-1 homolog A-like           67.8    8e-11   
ref|XP_004968635.1|  PREDICTED: protein DJ-1 homolog B-like           67.0    2e-10   
gb|EYU42678.1|  hypothetical protein MIMGU_mgv1a005922mg              66.6    2e-10   
ref|XP_004230777.1|  PREDICTED: protein DJ-1 homolog C isoform X2     66.2    2e-10   
ref|NP_001150979.1|  LOC100284612                                     66.6    2e-10   Zea mays [maize]
ref|XP_002457129.1|  hypothetical protein SORBIDRAFT_03g001740        66.2    2e-10   Sorghum bicolor [broomcorn]
emb|CDM82164.1|  unnamed protein product                              67.0    2e-10   
gb|KCW67486.1|  hypothetical protein EUGRSUZ_F01222                   66.2    3e-10   
ref|XP_010690314.1|  PREDICTED: protein DJ-1 homolog C                66.2    3e-10   
ref|XP_004230776.1|  PREDICTED: protein DJ-1 homolog C isoform X1     66.2    3e-10   
gb|KCW67487.1|  hypothetical protein EUGRSUZ_F01222                   66.2    3e-10   
ref|XP_010060685.1|  PREDICTED: protein DJ-1 homolog B-like           65.9    3e-10   
gb|EPS63819.1|  hypothetical protein M569_10960                       65.9    4e-10   
gb|EMS48524.1|  hypothetical protein TRIUR3_19547                     66.2    4e-10   
ref|XP_001763657.1|  predicted protein                                65.9    4e-10   
ref|XP_002518756.1|  conserved hypothetical protein                   65.9    5e-10   Ricinus communis
gb|KFK22990.1|  hypothetical protein AALP_AAs54686U000100             63.2    5e-10   
ref|XP_009147614.1|  PREDICTED: LOW QUALITY PROTEIN: protein DJ-1...  65.5    6e-10   
dbj|GAK50303.1|  hypothetical protein U14_01531                       62.8    8e-10   
gb|KDO40019.1|  hypothetical protein CISIN_1g038375mg                 62.0    8e-10   
ref|XP_011098238.1|  PREDICTED: protein DJ-1 homolog B                64.7    9e-10   
gb|KCW63770.1|  hypothetical protein EUGRSUZ_G01435                   65.1    9e-10   
ref|XP_010066017.1|  PREDICTED: protein DJ-1 homolog C                65.1    1e-09   
ref|XP_006346409.1|  PREDICTED: protein DJ-1 homolog C-like           64.7    1e-09   
emb|CDY59398.1|  BnaC03g78170D                                        64.3    1e-09   
ref|XP_009346259.1|  PREDICTED: protein DJ-1 homolog C                64.7    1e-09   
ref|XP_009620202.1|  PREDICTED: protein DJ-1 homolog C                63.9    2e-09   
ref|XP_009774082.1|  PREDICTED: protein DJ-1 homolog C                63.9    2e-09   
ref|XP_004294798.1|  PREDICTED: uncharacterized protein LOC101291703  63.9    2e-09   
ref|XP_006826220.1|  hypothetical protein AMTR_s00132p00051080        63.5    2e-09   
ref|XP_002313856.2|  hypothetical protein POPTR_0009s10390g           63.5    2e-09   Populus trichocarpa [western balsam poplar]
gb|KDP42270.1|  hypothetical protein JCGZ_01594                       63.5    3e-09   
ref|XP_010263527.1|  PREDICTED: protein DJ-1 homolog C                63.5    3e-09   
ref|XP_011000601.1|  PREDICTED: protein DJ-1 homolog C                63.5    3e-09   
gb|KDO59715.1|  hypothetical protein CISIN_1g012037mg                 63.2    3e-09   
ref|XP_009619737.1|  PREDICTED: protein DJ-1 homolog B                63.2    3e-09   
ref|XP_009106986.1|  PREDICTED: protein DJ-1 homolog B                63.2    3e-09   
ref|XP_007156507.1|  hypothetical protein PHAVU_003G291700g           63.2    4e-09   
ref|XP_006487114.1|  PREDICTED: protein DJ-1 homolog C-like           63.2    4e-09   
ref|XP_009139506.1|  PREDICTED: protein DJ-1 homolog A-like           62.8    4e-09   
ref|XP_006423007.1|  hypothetical protein CICLE_v10028354mg           63.2    4e-09   
ref|XP_008373132.1|  PREDICTED: protein DJ-1 homolog C                62.8    4e-09   
emb|CDO97183.1|  unnamed protein product                              62.8    4e-09   
emb|CDY25999.1|  BnaC06g06250D                                        63.2    4e-09   
dbj|BAJ34358.1|  unnamed protein product                              62.8    4e-09   
ref|XP_010465435.1|  PREDICTED: protein DJ-1 homolog A-like           62.8    4e-09   
ref|XP_004968631.1|  PREDICTED: protein DJ-1 homolog B-like           62.8    5e-09   
ref|XP_010465434.1|  PREDICTED: protein DJ-1 homolog A                62.4    5e-09   
ref|XP_010657627.1|  PREDICTED: protein DJ-1 homolog A-like           60.1    5e-09   
emb|CDY23161.1|  BnaA04g05980D                                        62.4    5e-09   
ref|NP_850588.1|  protein DJ-1-like A                                 62.4    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001760708.1|  predicted protein                                62.4    5e-09   
dbj|BAJ89018.1|  predicted protein                                    60.5    5e-09   
ref|NP_188117.1|  protein DJ-1-like A                                 62.4    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO59716.1|  hypothetical protein CISIN_1g012037mg                 62.4    7e-09   
ref|XP_007201073.1|  hypothetical protein PRUPE_ppa007275mg           62.0    7e-09   
ref|XP_007212913.1|  hypothetical protein PRUPE_ppa022246mg           62.0    8e-09   
ref|XP_010107931.1|  hypothetical protein L484_027520                 62.4    8e-09   
ref|XP_010500964.1|  PREDICTED: protein DJ-1 homolog B                62.0    9e-09   
ref|XP_009381820.1|  PREDICTED: protein DJ-1 homolog C                61.2    9e-09   
gb|KHN37515.1|  Protein DJ-1                                          61.2    1e-08   
ref|XP_006297946.1|  hypothetical protein CARUB_v10013988mg           61.2    1e-08   
ref|XP_006297947.1|  hypothetical protein CARUB_v10013988mg           61.6    1e-08   
emb|CBK19977.2|  unnamed protein product                              59.3    1e-08   
ref|XP_008236599.1|  PREDICTED: protein DJ-1 homolog C                61.6    1e-08   
gb|KGN43923.1|  hypothetical protein Csa_7G073590                     61.6    1e-08   
ref|XP_010487312.1|  PREDICTED: protein DJ-1 homolog A-like           61.6    1e-08   
ref|XP_002882906.1|  hypothetical protein ARALYDRAFT_478924           61.6    1e-08   
ref|XP_008454959.1|  PREDICTED: protein DJ-1 homolog C                61.6    1e-08   
ref|XP_010502412.1|  PREDICTED: protein DJ-1 homolog A-like           61.2    1e-08   
ref|XP_004136975.1|  PREDICTED: uncharacterized protein LOC101204195  61.6    1e-08   
ref|XP_009135416.1|  PREDICTED: protein DJ-1 homolog A-like           61.2    1e-08   
emb|CDX75800.1|  BnaC03g38830D                                        61.2    1e-08   
emb|CDX82455.1|  BnaA03g33660D                                        61.2    1e-08   
ref|XP_008783897.1|  PREDICTED: protein DJ-1 homolog B-like           61.2    1e-08   
ref|XP_006392805.1|  hypothetical protein EUTSA_v10011492mg           61.2    1e-08   
emb|CDX95299.1|  BnaC04g28590D                                        61.2    1e-08   
gb|AFK38256.1|  unknown                                               61.2    1e-08   
emb|CDY24104.1|  BnaA06g01020D                                        60.8    2e-08   
ref|XP_011092565.1|  PREDICTED: LOW QUALITY PROTEIN: protein DJ-1...  60.8    2e-08   
ref|XP_010943091.1|  PREDICTED: protein DJ-1 homolog C isoform X2     60.8    2e-08   
gb|EEC70179.1|  hypothetical protein OsI_00908                        60.1    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006575006.1|  PREDICTED: protein DJ-1 homolog C-like isofo...  60.1    2e-08   
ref|XP_002867138.1|  DJ-1 family protein                              61.2    2e-08   
gb|EYU26333.1|  hypothetical protein MIMGU_mgv1a006668mg              60.5    2e-08   
ref|XP_010943090.1|  PREDICTED: protein DJ-1 homolog C isoform X1     60.8    2e-08   
ref|XP_004505230.1|  PREDICTED: protein DJ-1 homolog C-like           60.8    2e-08   
gb|EYU26334.1|  hypothetical protein MIMGU_mgv1a006668mg              60.8    2e-08   
emb|CAA17570.1|  putative protein                                     60.1    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMS56936.1|  hypothetical protein TRIUR3_21703                     58.2    2e-08   
ref|XP_010462205.1|  PREDICTED: protein DJ-1 homolog B-like           60.5    3e-08   
ref|XP_003574626.1|  PREDICTED: protein DJ-1 homolog C                60.5    3e-08   
emb|CDX98521.1|  BnaC05g38540D                                        60.5    3e-08   
ref|XP_008226524.1|  PREDICTED: protein DJ-1 homolog B                60.5    3e-08   
emb|CBI39979.3|  unnamed protein product                              58.9    3e-08   
ref|XP_010915629.1|  PREDICTED: protein DJ-1 homolog B                60.5    3e-08   
ref|XP_006307524.1|  hypothetical protein CARUB_v10009147mg           60.5    3e-08   
ref|XP_002894433.1|  DJ-1 family protein                              60.5    3e-08   
ref|XP_010432477.1|  PREDICTED: protein DJ-1 homolog C-like           60.5    3e-08   
ref|XP_009146298.1|  PREDICTED: protein DJ-1 homolog A                60.1    3e-08   
ref|XP_010479882.1|  PREDICTED: protein DJ-1 homolog B-like           60.1    4e-08   
ref|XP_009765627.1|  PREDICTED: protein DJ-1 homolog B-like           60.1    4e-08   
gb|KFK38848.1|  hypothetical protein AALP_AA3G168100                  60.1    4e-08   
ref|XP_006583884.1|  PREDICTED: protein DJ-1 homolog C-like isofo...  60.1    4e-08   
ref|XP_009413835.1|  PREDICTED: protein DJ-1 homolog A                60.1    4e-08   
gb|KHN43067.1|  Protein DJ-1                                          60.1    4e-08   
ref|XP_006407024.1|  hypothetical protein EUTSA_v10020891mg           59.7    4e-08   
ref|XP_010535048.1|  PREDICTED: protein DJ-1 homolog B-like           60.1    4e-08   
ref|XP_006583883.1|  PREDICTED: protein DJ-1 homolog C-like isofo...  60.1    4e-08   
ref|NP_195128.2|  protein DJ-1 homolog C                              60.1    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535047.1|  PREDICTED: LOW QUALITY PROTEIN: protein DJ-1...  60.1    4e-08   
ref|XP_010447162.1|  PREDICTED: protein DJ-1 homolog C                60.1    5e-08   
ref|NP_001031787.1|  protein DJ-1 homolog C                           59.7    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407025.1|  hypothetical protein EUTSA_v10020891mg           59.7    5e-08   
ref|XP_010437683.1|  PREDICTED: protein DJ-1 homolog C-like           60.1    5e-08   
gb|EAZ11044.1|  hypothetical protein OsJ_00888                        57.4    5e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDX97625.1|  BnaA05g24540D                                        59.3    5e-08   
dbj|BAK05486.1|  predicted protein                                    59.3    5e-08   
dbj|BAJ85373.1|  predicted protein                                    59.7    6e-08   
ref|XP_008776805.1|  PREDICTED: protein DJ-1 homolog C                59.7    6e-08   
ref|NP_564626.1|  DJ1-like protein B                                  59.3    7e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76501.1|  hypothetical protein VITISV_025207                   57.0    7e-08   Vitis vinifera
gb|AAM60860.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophosphate...  59.3    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563799.1|  PREDICTED: protein DJ-1 homolog B-like           58.9    8e-08   
gb|KFK22993.1|  hypothetical protein AALP_AAs54686U000400             58.9    8e-08   
ref|XP_008783896.1|  PREDICTED: protein DJ-1 homolog B-like           58.9    9e-08   
ref|NP_001042406.1|  Os01g0217500                                     58.5    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282255.1|  PREDICTED: protein DJ-1 homolog C                58.9    1e-07   Vitis vinifera
ref|XP_009117488.1|  PREDICTED: protein DJ-1 homolog C                58.5    1e-07   
gb|KHG14557.1|  Protein DJ-1                                          58.5    1e-07   
ref|XP_002457130.1|  hypothetical protein SORBIDRAFT_03g001750        58.2    1e-07   Sorghum bicolor [broomcorn]
ref|XP_006348292.1|  PREDICTED: protein DJ-1 homolog B-like           58.5    2e-07   
ref|XP_004244263.1|  PREDICTED: protein DJ-1 homolog B                58.2    2e-07   
emb|CDX69022.1|  BnaC01g04310D                                        58.2    2e-07   
ref|XP_006282493.1|  hypothetical protein CARUB_v10006469mg           58.2    2e-07   
ref|XP_004965530.1|  PREDICTED: protein DJ-1 homolog B-like           58.2    2e-07   
gb|EMS45695.1|  hypothetical protein TRIUR3_12961                     58.2    2e-07   
ref|XP_006412285.1|  hypothetical protein EUTSA_v10025121mg           58.2    2e-07   
dbj|BAG16525.1|  putative 4-methyl-5(b-hydroxyethyl)-thiazol mono...  57.8    2e-07   Capsicum chinense [bonnet pepper]
gb|AID60118.1|  animal DJ-1 superfamily protein-like protein          57.8    2e-07   
emb|CDY68228.1|  BnaAnng26560D                                        57.8    2e-07   
emb|CDY49268.1|  BnaA03g50810D                                        57.0    3e-07   
ref|XP_010279104.1|  PREDICTED: protein DJ-1 homolog B-like           57.4    3e-07   
ref|XP_004359634.1|  DJ-1/ThiJ/PfpI family protein                    55.5    3e-07   
ref|XP_002438499.1|  hypothetical protein SORBIDRAFT_10g020910        57.4    3e-07   Sorghum bicolor [broomcorn]
ref|XP_006660203.1|  PREDICTED: protein DJ-1 homolog C-like           57.0    4e-07   
ref|WP_019366336.1|  hypothetical protein                             54.7    4e-07   
dbj|BAK06599.1|  predicted protein                                    57.0    5e-07   
gb|KFK30030.1|  hypothetical protein AALP_AA7G208500                  56.6    5e-07   
emb|CAN60391.1|  hypothetical protein VITISV_006494                   57.0    6e-07   Vitis vinifera
ref|XP_007042441.1|  Class I glutamine amidotransferase-like supe...  56.6    6e-07   
ref|XP_007042442.1|  Class I glutamine amidotransferase-like supe...  56.2    6e-07   
gb|EEC79541.1|  hypothetical protein OsI_20655                        56.2    8e-07   Oryza sativa Indica Group [Indian rice]
ref|WP_034401924.1|  dihydroxyacetone kinase                          53.9    8e-07   
ref|XP_008611948.1|  hypothetical protein SDRG_07869                  53.9    9e-07   
ref|WP_004335279.1|  thiazole biosynthesis protein ThiJ               53.9    9e-07   
ref|WP_023408353.1|  hypothetical protein                             53.9    1e-06   
gb|KEH30911.1|  class I glutamine amidotransferase superfamily pr...  55.5    1e-06   
ref|NP_001169819.1|  hypothetical protein                             55.8    1e-06   Zea mays [maize]
ref|XP_002287916.1|  predicted protein                                53.5    1e-06   Thalassiosira pseudonana CCMP1335
gb|EEE64389.1|  hypothetical protein OsJ_19231                        55.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009529967.1|  hypothetical protein PHYSODRAFT_545709           53.1    1e-06   
ref|XP_006657021.1|  PREDICTED: protein DJ-1 homolog B-like           55.5    1e-06   
gb|EEC80748.1|  hypothetical protein OsI_23231                        55.5    1e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001057783.2|  Os06g0531200                                     55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645639.1|  PREDICTED: protein DJ-1 homolog B-like           55.1    2e-06   
gb|EEE65822.1|  hypothetical protein OsJ_21561                        55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAT69656.1|  unknown protein, similar to DJ-1/PfpI family, PF0...  55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973664.1|  PREDICTED: protein DJ-1 homolog C-like           55.1    2e-06   
ref|XP_003607957.1|  Protein thiJ                                     54.7    2e-06   
ref|WP_010795212.1|  DJ-1 family protein                              52.8    3e-06   
dbj|GAK61017.1|  hypothetical protein U27_00915                       52.4    3e-06   
ref|WP_031450260.1|  dihydroxyacetone kinase                          52.4    3e-06   
gb|ACS87902.1|  putative 4-methyl-5-thiazole monophosphate synthe...  52.4    4e-06   Leptomonas seymouri
ref|XP_002980406.1|  hypothetical protein SELMODRAFT_112362           53.9    5e-06   
ref|XP_002962689.1|  hypothetical protein SELMODRAFT_227351           53.5    6e-06   
gb|KDO34253.1|  hypothetical protein SPRG_19083                       51.6    6e-06   
gb|ETI53651.1|  hypothetical protein F443_03427                       52.0    7e-06   
ref|XP_008910325.1|  hypothetical protein PPTG_15071                  52.0    7e-06   
ref|XP_002908746.1|  conserved hypothetical protein                   50.8    7e-06   
ref|WP_020583181.1|  hypothetical protein                             51.2    9e-06   
ref|WP_012071697.1|  protease                                         50.8    1e-05   
emb|CBJ30585.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophosphat...  51.6    1e-05   
ref|XP_002177693.1|  predicted protein                                50.8    1e-05   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_034873051.1|  hypothetical protein                             50.8    1e-05   
ref|WP_028585375.1|  dihydroxyacetone kinase                          50.4    1e-05   
ref|WP_022668146.1|  thiazole biosynthesis protein ThiJ               50.4    2e-05   
ref|XP_010675431.1|  PREDICTED: protein DJ-1 homolog B-like           51.6    2e-05   
dbj|GAM18592.1|  hypothetical protein SAMD00019534_017670             50.8    2e-05   
ref|WP_014957054.1|  thiazole biosynthesis protein ThiJ               50.1    2e-05   
ref|XP_007149405.1|  hypothetical protein PHAVU_005G067500g           51.6    3e-05   
gb|KHN36876.1|  Chaperone protein YajL                                51.6    3e-05   
gb|AHA84127.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophosphate...  51.6    3e-05   
ref|XP_010530771.1|  PREDICTED: protein DJ-1 homolog C                51.6    3e-05   
ref|XP_005538696.1|  similar to 4-methyl-5(beta-hydroxyethyl)-thi...  51.2    3e-05   
ref|WP_006968239.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophos...  49.7    3e-05   
gb|KDD76880.1|  DJ-1/PfpI family protein                              50.1    3e-05   
ref|NP_001130715.1|  uncharacterized protein LOC100191819             51.2    3e-05   Zea mays [maize]
ref|XP_005846315.1|  hypothetical protein CHLNCDRAFT_135695           49.7    3e-05   
gb|EMS57467.1|  hypothetical protein TRIUR3_15788                     51.6    4e-05   
gb|EAZ37220.1|  hypothetical protein OsJ_21559                        48.9    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ85544.1|  unknown                                               49.7    5e-05   Medicago truncatula
ref|XP_008672043.1|  PREDICTED: uncharacterized protein LOC100191...  50.8    5e-05   
ref|XP_003543217.2|  PREDICTED: protein DJ-1 homolog B-like           50.8    5e-05   
ref|XP_008885371.1|  DJ-1 family protein                              50.1    6e-05   
ref|XP_008672044.1|  PREDICTED: uncharacterized protein LOC100191...  50.4    6e-05   
ref|WP_036882706.1|  thiamine biosynthesis protein ThiJ               48.5    7e-05   
ref|XP_010675408.1|  PREDICTED: protein DJ-1 homolog B-like           50.1    8e-05   
gb|KEH38629.1|  class I glutamine amidotransferase superfamily pr...  50.1    1e-04   
ref|XP_002948595.1|  DJ-1 family protein                              48.1    1e-04   
ref|XP_004489045.1|  PREDICTED: protein DJ-1 homolog B-like           49.7    1e-04   
ref|XP_005855953.1|  dj-1 family protein                              48.5    1e-04   
gb|EMT31986.1|  hypothetical protein F775_11542                       49.7    1e-04   
ref|XP_003540482.1|  PREDICTED: protein DJ-1 homolog B-like           49.7    1e-04   
gb|KFH16375.1|  DJ-1 family protein                                   48.5    2e-04   
gb|EJK65523.1|  hypothetical protein THAOC_13603                      47.8    2e-04   
gb|EPR60164.1|  DJ-1 family protein                                   48.5    2e-04   
ref|XP_001566720.1|  putative 4-methyl-5(beta-hydroxyethyl)-thiaz...  47.4    2e-04   Leishmania braziliensis MHOM/BR/75/M2904
gb|KFG62290.1|  DJ-1 family protein                                   48.5    2e-04   
ref|XP_002370762.1|  intracellular protease, putative                 48.5    2e-04   Toxoplasma gondii ME49
ref|XP_010701115.1|  4-methyl-5(beta-hydroxyethyl)-thiazole monop...  47.4    2e-04   
ref|WP_027425668.1|  hypothetical protein                             47.4    2e-04   
gb|EWM28974.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophosphate...  48.1    2e-04   
gb|EWM28975.1|  4-methyl-5(b-hydroxyethyl)-thiazole monophosphate...  48.5    2e-04   
ref|WP_024335284.1|  dihydroxyacetone kinase                          47.4    2e-04   
ref|WP_007210074.1|  MULTISPECIES: thiazole biosynthesis protein ...  47.0    3e-04   
ref|WP_029427815.1|  thiamine biosynthesis protein ThiJ               47.0    3e-04   
gb|KFM25339.1|  Chaperone protein YajL                                47.4    3e-04   
ref|WP_035233828.1|  hypothetical protein                             47.0    3e-04   
ref|XP_003884756.1|  hypothetical protein NCLIV_051530                47.8    3e-04   
ref|WP_014552677.1|  4-methyl-5(B-hydroxyethyl)-thiazole monophos...  47.0    3e-04   
ref|WP_022406150.1|  dJ-1 family protein                              47.0    4e-04   
gb|EFA81809.1|  hypothetical protein PPL_05804                        47.4    4e-04   
ref|WP_028823115.1|  hypothetical protein                             46.6    4e-04   
ref|WP_004288375.1|  MULTISPECIES: thiazole biosynthesis protein ...  46.6    4e-04   
ref|WP_027710260.1|  hypothetical protein                             46.6    5e-04   
ref|NP_001150139.1|  4-methyl-5-thiazole monophosphate biosynthes...  47.8    5e-04   
ref|WP_007659720.1|  thiazole biosynthesis protein ThiJ               46.2    5e-04   
ref|WP_008374514.1|  4-methyl-5(B-hydroxyethyl)-thiazole monophos...  46.2    7e-04   
ref|WP_009125710.1|  thiazole biosynthesis protein ThiJ               45.8    7e-04   
ref|WP_022021672.1|  dJ-1 family protein                              45.8    7e-04   
ref|WP_022220279.1|  dJ-1 family protein                              45.8    7e-04   
ref|XP_001684668.1|  putative 4-methyl-5(beta-hydroxyethyl)-thiaz...  46.2    8e-04   
dbj|BAJ84975.1|  predicted protein                                    46.6    8e-04   
ref|WP_034835086.1|  hypothetical protein                             45.8    0.001   



>gb|KCW67485.1| hypothetical protein EUGRSUZ_F01221 [Eucalyptus grandis]
Length=448

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  35   IWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            + SL VR  MPGAS+LRDCK LE + KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  122  LVSLPVR--MPGASSLRDCKVLEDLVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  177



>gb|KCW67482.1| hypothetical protein EUGRSUZ_F01221 [Eucalyptus grandis]
Length=445

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+LRDCK LE + KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  129  MPGASSLRDCKVLEDLVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  177



>gb|KCW67481.1| hypothetical protein EUGRSUZ_F01221 [Eucalyptus grandis]
Length=444

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+LRDCK LE + KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  125  MPGASSLRDCKVLEDLVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  173



>ref|XP_010060686.1| PREDICTED: protein DJ-1 homolog B [Eucalyptus grandis]
 gb|KCW67483.1| hypothetical protein EUGRSUZ_F01221 [Eucalyptus grandis]
Length=448

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+LRDCK LE + KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  129  MPGASSLRDCKVLEDLVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  177



>gb|KCW67484.1| hypothetical protein EUGRSUZ_F01221 [Eucalyptus grandis]
Length=472

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+LRDCK LE + KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  129  MPGASSLRDCKVLEDLVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  177



>ref|XP_007021700.1| Class I glutamine amidotransferase-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY13225.1| Class I glutamine amidotransferase-like superfamily protein isoform 
2 [Theobroma cacao]
Length=332

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAII  214
            MPGA+ L++C  LES+ KKQA   +LYAA+CASPAVALGSWGLLKGLK II
Sbjct  116  MPGATNLKNCGALESVVKKQAADGRLYAAVCASPAVALGSWGLLKGLKVII  166



>ref|XP_004137241.1| PREDICTED: uncharacterized protein LOC101212934 [Cucumis sativus]
 ref|XP_004156507.1| PREDICTED: uncharacterized protein LOC101228984 [Cucumis sativus]
 gb|KGN53559.1| hypothetical protein Csa_4G082360 [Cucumis sativus]
Length=434

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA++LRDC  LE+I KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  117  MPGATSLRDCAVLENIVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  165



>emb|CDP05996.1| unnamed protein product [Coffea canephora]
Length=390

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TL+D KTLESI KKQA   +LYAAICASPAVALGSWGLLKG KA
Sbjct  73   MPGATTLKDNKTLESIVKKQASEGRLYAAICASPAVALGSWGLLKGKKA  121



>ref|XP_008451768.1| PREDICTED: protein DJ-1 homolog A-like [Cucumis melo]
Length=434

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA++LRDC  LE+I KKQA   +LYAAICASPAV LGSWGLLKGLKA
Sbjct  117  MPGATSLRDCAVLENIVKKQAADGRLYAAICASPAVVLGSWGLLKGLKA  165



>emb|CBI20205.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TLRDC  LES+ KK A   QLYA ICA+PAVALGSWGL+KGLKA
Sbjct  77   MPGAATLRDCGMLESMVKKHAADGQLYAGICAAPAVALGSWGLMKGLKA  125



>emb|CAN62882.1| hypothetical protein VITISV_008479 [Vitis vinifera]
Length=427

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TLRDC  LES+ KK A   QLYA ICA+PAVALGSWGL+KGLKA
Sbjct  113  MPGAATLRDCGXLESMVKKHAADGQLYAGICAAPAVALGSWGLMKGLKA  161



>ref|XP_010644129.1| PREDICTED: protein DJ-1 homolog B-like [Vitis vinifera]
Length=429

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TLRDC  LES+ KK A   QLYA ICA+PAVALGSWGL+KGLKA
Sbjct  113  MPGAATLRDCGMLESMVKKHAADGQLYAGICAAPAVALGSWGLMKGLKA  161



>gb|KHG19771.1| Chaperone YajL [Gossypium arboreum]
Length=434

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS  +DC  LES+ KKQA   +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  117  MPGASNFKDCGVLESLVKKQAADGRLYAAVCASPAVALGSWGLLKGLKA  165


 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   KLIWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            KL + L V    + GA    +   L ++ KKQAES + Y AICASPA+ L   GLLKG K
Sbjct  310  KLTYDLIVLPGGLGGAQAFANSDKLVNLLKKQAESNKPYGAICASPALVLEPHGLLKGKK  369

Query  206  A  208
            A
Sbjct  370  A  370



>gb|EMS59734.1| hypothetical protein TRIUR3_20130 [Triticum urartu]
Length=375

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAST RDCK LE++ KK AE  +LY AICA+PAVALG+WGLL GLKA
Sbjct  60   MPGASTFRDCKILENMVKKHAEKGKLYTAICAAPAVALGAWGLLNGLKA  108



>ref|XP_004294088.1| PREDICTED: uncharacterized protein LOC101315413 [Fragaria vesca 
subsp. vesca]
Length=397

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L+DC+ LES+ KKQ    +LYAAICASPAVALGSWG+LKGLKA
Sbjct  79   MPGATNLKDCEVLESLVKKQVADGKLYAAICASPAVALGSWGVLKGLKA  127



>gb|KHG22542.1| Chaperone YajL [Gossypium arboreum]
Length=483

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+  +DC  LES+ KKQA   +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  167  MPGATNFKDCAVLESVVKKQAADGRLYAAVCASPAVALGSWGLLKGLKA  215



>ref|XP_006442570.1| hypothetical protein CICLE_v10021742mg [Citrus clementina]
 gb|ESR55810.1| hypothetical protein CICLE_v10021742mg [Citrus clementina]
Length=262

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LESI KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  121  MPGATNLKESEVLESIVKKQASAGRLYAAVCASPAVALGSWGLLKGLKA  169



>ref|XP_006852437.1| hypothetical protein AMTR_s00021p00099040 [Amborella trichopoda]
 gb|ERN13904.1| hypothetical protein AMTR_s00021p00099040 [Amborella trichopoda]
Length=429

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+LRDC+ LESI KK A   +LY AICA+PAVAL SWGLLKGLKA
Sbjct  115  MPGASSLRDCQALESIVKKHAAEGRLYGAICAAPAVALDSWGLLKGLKA  163



>ref|XP_006442553.1| hypothetical protein CICLE_v10022043mg [Citrus clementina]
 gb|ESR55793.1| hypothetical protein CICLE_v10022043mg [Citrus clementina]
Length=232

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LESI KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  1    MPGATNLKESEVLESIVKKQASAGRLYAAVCASPAVALGSWGLLKGLKA  49



>ref|XP_007021699.1| Class I glutamine amidotransferase-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY13224.1| Class I glutamine amidotransferase-like superfamily protein isoform 
1 [Theobroma cacao]
Length=433

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++C  LES+ KKQA   +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  116  MPGATNLKNCGALESVVKKQAADGRLYAAVCASPAVALGSWGLLKGLKA  164



>ref|XP_006493626.1| PREDICTED: protein DJ-1 homolog B-like [Citrus sinensis]
Length=204

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LE+I KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  117  MPGATNLKESEVLETIVKKQASAGRLYAAVCASPAVALGSWGLLKGLKA  165



>ref|XP_006442550.1| hypothetical protein CICLE_v10020189mg [Citrus clementina]
 gb|ESR55790.1| hypothetical protein CICLE_v10020189mg [Citrus clementina]
Length=439

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LESI KKQA   +LYAAICASPAVALGSWGLLKGLKA
Sbjct  121  MPGATNLKESEVLESIVKKQASDGRLYAAICASPAVALGSWGLLKGLKA  169



>ref|XP_006442543.1| hypothetical protein CICLE_v10021210mg [Citrus clementina]
 ref|XP_006442544.1| hypothetical protein CICLE_v10021210mg [Citrus clementina]
 gb|ESR55783.1| hypothetical protein CICLE_v10021210mg [Citrus clementina]
 gb|ESR55784.1| hypothetical protein CICLE_v10021210mg [Citrus clementina]
Length=319

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LE+I KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  1    MPGATNLKESEVLETIVKKQASAGRLYAAVCASPAVALGSWGLLKGLKA  49



>gb|EEE54120.1| hypothetical protein OsJ_00891 [Oryza sativa Japonica Group]
Length=668

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + KKQAE   LYAAICA+PAV L  WGLLKGLKA
Sbjct  339  MPGSANLRDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKA  387


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L   K L  + KKQAES + Y AICASPA  L   GLLKG KA
Sbjct  558  LPGAQKLSSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKA  606



>ref|XP_002524274.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38113.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L+ C TLES+ KKQA   +LYAA+CASPAVA GSWG+LKGLKA
Sbjct  113  MPGATNLKTCGTLESMVKKQAADGRLYAAVCASPAVAFGSWGVLKGLKA  161



>gb|KDO41212.1| hypothetical protein CISIN_1g045076mg, partial [Citrus sinensis]
Length=145

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MP A+ L++ K LE+I KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  36   MPDATNLKESKVLETIVKKQASNGRLYAAVCASPAVALGSWGLLKGLKA  84



>ref|XP_006442547.1| hypothetical protein CICLE_v10023786mg [Citrus clementina]
 gb|ESR55787.1| hypothetical protein CICLE_v10023786mg [Citrus clementina]
Length=199

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LE+I KKQA + +LYA +CASPAVALGSWGLLKGLKA
Sbjct  1    MPGATNLKEYEVLETIVKKQASAGRLYAVVCASPAVALGSWGLLKGLKA  49



>dbj|BAD73062.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis 
enzyme [Oryza sativa Japonica Group]
Length=426

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + KKQAE   LYAAICA+PAV L  WGLLKGLKA
Sbjct  110  MPGSANLRDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKA  158


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L   K L  + KKQAES + Y AICASPA  L   GLLKG KA
Sbjct  316  LPGAQKLSSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKA  364



>ref|NP_001042407.2| Os01g0217800 [Oryza sativa Japonica Group]
 dbj|BAG94619.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04321.2| Os01g0217800 [Oryza sativa Japonica Group]
Length=428

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + KKQAE   LYAAICA+PAV L  WGLLKGLKA
Sbjct  112  MPGSANLRDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKA  160


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L   K L  + KKQAES + Y AICASPA  L   GLLKG KA
Sbjct  318  LPGAQKLSSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKA  366



>gb|EEC70182.1| hypothetical protein OsI_00911 [Oryza sativa Indica Group]
Length=431

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + KKQAE   LYAAICA+PAV L  WGLLKGLKA
Sbjct  102  MPGSANLRDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKA  150


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L   K L  + KKQAES + Y AICASPA  L   GLLKG KA
Sbjct  321  LPGAQKLSSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKA  369



>ref|XP_006442560.1| hypothetical protein CICLE_v10024360mg, partial [Citrus clementina]
 gb|ESR55800.1| hypothetical protein CICLE_v10024360mg, partial [Citrus clementina]
Length=300

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LESI KKQA + +LYAA+CASPAVALGSWGLLK LKA
Sbjct  71   MPGATNLKESEVLESIVKKQASAGRLYAAVCASPAVALGSWGLLKDLKA  119



>ref|XP_006493620.1| PREDICTED: protein DJ-1 homolog B-like [Citrus sinensis]
Length=439

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++   LESI KKQA +  LYAA+CASPAVALGSWGLLKGLKA
Sbjct  121  MPGATNLKESDVLESIVKKQASAGCLYAAVCASPAVALGSWGLLKGLKA  169



>ref|XP_006442555.1| hypothetical protein CICLE_v10021981mg [Citrus clementina]
 gb|ESR55795.1| hypothetical protein CICLE_v10021981mg [Citrus clementina]
Length=238

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MP A+ L++ + LE+I KKQA + +LYAA+CASPAVALGSWGLLKGLKA
Sbjct  120  MPCATNLKESEVLETIVKKQASAGRLYAAVCASPAVALGSWGLLKGLKA  168



>gb|ADE76388.1| unknown [Picea sitchensis]
Length=453

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 11/78 (14%)
 Frame = +2

Query  2    RRIKTKAKGKLIWSLCVREK---------MPGASTLRDCKTLESINKKQAESKQLYAAIC  154
            RR+K  A   ++ S C  E          MPG+S LRDC+ L+SI KKQA   +LY A+C
Sbjct  110  RRVKLVAD--MLISNCTEEMFDLVVLPGGMPGSSRLRDCEILQSITKKQAADGRLYGAVC  167

Query  155  ASPAVALGSWGLLKGLKA  208
            A+PAV L +WGLLKGL+A
Sbjct  168  AAPAVVLETWGLLKGLRA  185


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPGA  L   ++L  + K+QAESK+ Y AICASPAV L   GLLK
Sbjct  341  MPGAERLSKTESLIQLLKEQAESKRAYGAICASPAVVLEIHGLLK  385



>gb|ADE76519.1| unknown [Picea sitchensis]
Length=459

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 11/78 (14%)
 Frame = +2

Query  2    RRIKTKAKGKLIWSLCVREK---------MPGASTLRDCKTLESINKKQAESKQLYAAIC  154
            RR+K  A   ++ S C  E          MPG+S LRDC+ L+SI KKQA   +LY A+C
Sbjct  116  RRVKLVAD--MLISNCTEEMFDLVVLPGGMPGSSRLRDCEILQSITKKQAADGRLYGAVC  173

Query  155  ASPAVALGSWGLLKGLKA  208
            A+PAV L +WGLLKGL+A
Sbjct  174  AAPAVVLETWGLLKGLRA  191


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  L   ++L  + K+QAESK+ Y AICASPAV L   GLLK  KA
Sbjct  347  MPGAERLSKTESLIQLLKEQAESKRAYGAICASPAVVLEIHGLLKEKKA  395



>ref|XP_008226523.1| PREDICTED: protein DJ-1 homolog B-like [Prunus mume]
Length=442

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LES+ KKQA   +LYAAICASPAVA GSWG+LKGLKA
Sbjct  125  MPGAANLKNSEVLESLVKKQAADGKLYAAICASPAVAFGSWGVLKGLKA  173



>gb|KDP32522.1| hypothetical protein JCGZ_14725 [Jatropha curcas]
Length=432

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++   LES+ KKQA   +LYAA+CASPAVALGSWG+LKGLKA
Sbjct  115  MPGATNLKNSGALESMVKKQAADGRLYAAVCASPAVALGSWGVLKGLKA  163



>ref|XP_011029555.1| PREDICTED: protein DJ-1 homolog B [Populus euphratica]
Length=442

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+  ++C+ LE + KKQAE  +LYAA+CASPAVA GSWGLL GLKA
Sbjct  124  IPGATNFKNCQLLEKLVKKQAEDGKLYAAVCASPAVAFGSWGLLNGLKA  172



>ref|XP_010108252.1| hypothetical protein L484_018673 [Morus notabilis]
 gb|EXC18492.1| hypothetical protein L484_018673 [Morus notabilis]
Length=395

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L++   LES+ +KQA   QLYAAICASPAVALG+WGLLKGLKA
Sbjct  77   IPGAANLKNNGVLESLVRKQAADGQLYAAICASPAVALGAWGLLKGLKA  125



>ref|XP_006645640.1| PREDICTED: protein DJ-1 homolog B-like [Oryza brachyantha]
Length=394

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDC  LE + KKQA+   LYAAICA+PAV L  WGLLKGLKA
Sbjct  78   MPGSANLRDCNVLEKMVKKQADQGGLYAAICAAPAVTLAHWGLLKGLKA  126


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L   K L  + KKQA+S + Y AICASPA  L   GLLKG KA
Sbjct  284  LPGAQKLSSTKVLIDLLKKQADSNKPYGAICASPAYVLEPHGLLKGKKA  332



>ref|XP_006442564.1| hypothetical protein CICLE_v10020809mg [Citrus clementina]
 gb|ESR55804.1| hypothetical protein CICLE_v10020809mg [Citrus clementina]
Length=358

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIIST  220
            MPGA+ L++ + LESI KKQA    L AAICASPAV LGSWGLLKGLK  + +
Sbjct  77   MPGATNLKESEVLESIVKKQASDGHLNAAICASPAVVLGSWGLLKGLKQTVES  129



>ref|XP_002316868.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate family 
protein [Populus trichocarpa]
 gb|EEE97480.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate family 
protein [Populus trichocarpa]
Length=442

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+  ++C+ LE + KKQ E  +LYAA+CASPAVA GSWGLL GLKA
Sbjct  124  IPGATNFKNCQLLEKLVKKQVEDGKLYAAVCASPAVAFGSWGLLNGLKA  172



>gb|AFW86786.1| hypothetical protein ZEAMMB73_682876 [Zea mays]
Length=260

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+ST  +CK LE + KK  E  +LYAAICA+PA+ LG+WGLL GLKA
Sbjct  122  MPGSSTFGECKVLEKMVKKHVEKGKLYAAICAAPAMTLGTWGLLNGLKA  170



>ref|XP_009335186.1| PREDICTED: protein DJ-1 homolog B-like [Pyrus x bretschneideri]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L++ + LES+ KKQA   +LYAAICASPAVAL SWG+LKGLKA
Sbjct  79   IPGAANLKNSEVLESLVKKQAADGKLYAAICASPAVALASWGVLKGLKA  127



>ref|XP_009340133.1| PREDICTED: protein DJ-1 homolog B-like [Pyrus x bretschneideri]
Length=443

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LES+ K+QA + +LY+AICASPAVAL SWG+LKGLKA
Sbjct  126  MPGATNLKNSEVLESLVKQQATNGKLYSAICASPAVALASWGVLKGLKA  174



>ref|XP_008350011.1| PREDICTED: protein DJ-1 homolog B-like [Malus domestica]
Length=434

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + LES+ K+QA + +LY+AICASPAVAL SWG+LKGLKA
Sbjct  117  MPGATNLKNSEVLESLVKQQAANGKLYSAICASPAVALASWGVLKGLKA  165



>ref|NP_001144456.1| uncharacterized protein LOC100277419 [Zea mays]
 gb|ACG40657.1| hypothetical protein [Zea mays]
Length=395

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+ST  +CK LE + KK  E  +LYAAICA+PA+ LG+WGLL GLKA
Sbjct  80   MPGSSTFGECKVLEKMVKKHVEKGKLYAAICAAPAMTLGTWGLLNGLKA  128


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  98   LESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            L  + KKQAE+ +LY AICASPA+AL   GLLKG K + S   MW
Sbjct  297  LMDLIKKQAEANRLYGAICASPAIALEPHGLLKG-KKVTSYPAMW  340



>dbj|BAJ90160.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86475.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92152.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97487.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + K  AE  +LY AICA+PAV L  WG+LKGLKA
Sbjct  106  MPGSTNLRDCKVLEKMVKMHAEKGELYGAICAAPAVTLAHWGMLKGLKA  154



>ref|XP_008382064.1| PREDICTED: protein DJ-1 homolog B [Malus domestica]
Length=396

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L++ + LES+ KKQA   +LYAAICASPAVAL SWG LKGLKA
Sbjct  79   IPGAANLKNSEVLESLVKKQAABGKLYAAICASPAVALASWGXLKGLKA  127



>gb|AFW86787.1| hypothetical protein ZEAMMB73_682876 [Zea mays]
Length=437

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+ST  +CK LE + KK  E  +LYAAICA+PA+ LG+WGLL GLKA
Sbjct  122  MPGSSTFGECKVLEKMVKKHVEKGKLYAAICAAPAMTLGTWGLLNGLKA  170



>ref|XP_008222086.1| PREDICTED: protein DJ-1 homolog B-like [Prunus mume]
Length=202

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  65   PGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            PGA+ L++ + LES+ KKQA   +LYA ICASP VA GSWG+LKGLKA
Sbjct  66   PGAANLKNSEVLESLVKKQAADGKLYATICASPEVAFGSWGVLKGLKA  113



>gb|KDO48783.1| hypothetical protein CISIN_1g019238mg [Citrus sinensis]
Length=277

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            MPGA+ L++ + LESI KKQA   +LYAAIC   AVALGSWGLLKGLK
Sbjct  51   MPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLK  98



>ref|XP_009342289.1| PREDICTED: protein DJ-1 homolog B-like [Pyrus x bretschneideri]
Length=396

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L++ + LES+ KKQ    +LYAAICASPAVAL SWG+LKGLKA
Sbjct  79   IPGAANLKNSEVLESLVKKQIADGKLYAAICASPAVALASWGVLKGLKA  127



>ref|XP_007211633.1| hypothetical protein PRUPE_ppa005820mg [Prunus persica]
 gb|EMJ12832.1| hypothetical protein PRUPE_ppa005820mg [Prunus persica]
Length=442

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            M GA+ L++ + LES+ KKQA   +LYAAICASPAVA GSWG+LKGLKA
Sbjct  125  MLGAANLKNSEVLESLVKKQAADGKLYAAICASPAVAFGSWGVLKGLKA  173



>gb|KDO48782.1| hypothetical protein CISIN_1g019238mg [Citrus sinensis]
Length=344

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            MPGA+ L++ + LESI KKQA   +LYAAIC   AVALGSWGLLKGLK
Sbjct  51   MPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLK  98



>gb|ACN35036.1| unknown [Zea mays]
Length=317

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+  LRDCK LE + K  AE   LY AICA+PAV L  WG+LKGLKA
Sbjct  1    MPGSVGLRDCKALEKMVKTHAEDGGLYGAICAAPAVTLAYWGMLKGLKA  49



>gb|KCW67488.1| hypothetical protein EUGRSUZ_F01222 [Eucalyptus grandis]
Length=338

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAII  214
            MPGAS+LRDCK LE + KKQ    +LYAA C  P   LGSWGLLKGLKA I
Sbjct  127  MPGASSLRDCKVLEDLVKKQGADGRLYAASCTFP--ELGSWGLLKGLKAAI  175



>ref|XP_010230619.1| PREDICTED: protein DJ-1 homolog A-like [Brachypodium distachyon]
Length=423

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LRDCK LE + K  AE   LY AICA+PAV L  WG+LKGLKA
Sbjct  107  MPGSANLRDCKVLEKVVKTHAEKGGLYGAICAAPAVTLAHWGMLKGLKA  155



>ref|XP_004968635.1| PREDICTED: protein DJ-1 homolog B-like [Setaria italica]
Length=426

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+  LRDCK LE + K  AE+  LY AICA+PAV L  WG+LKGLKA
Sbjct  110  MPGSVNLRDCKALEKMVKNHAENGGLYGAICAAPAVTLAYWGMLKGLKA  158



>gb|EYU42678.1| hypothetical protein MIMGU_mgv1a005922mg [Erythranthe guttata]
Length=464

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRD KTL+ I K+QA++K+LYAAICA+PA+ L  WGLLK
Sbjct  148  MPGSARLRDSKTLQDITKRQADAKRLYAAICAAPAITLLPWGLLK  192



>ref|XP_004230777.1| PREDICTED: protein DJ-1 homolog C isoform X2 [Solanum lycopersicum]
Length=374

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  +QAE K+LY AICA+PAVAL  WGLLK
Sbjct  59   MPGSARLRDCEVLQKITSRQAEEKRLYGAICAAPAVALLPWGLLK  103



>ref|NP_001150979.1| LOC100284612 [Zea mays]
 ref|XP_008673532.1| PREDICTED: protein DJ-1 homolog A-like [Zea mays]
 gb|ACG41160.1| 4-methyl-5-thiazole monophosphate biosynthesis protein [Zea mays]
 gb|AFW61894.1| 4-methyl-5-thiazole monophosphate biosynthesis protein [Zea mays]
 tpg|DAA52840.1| TPA: 4-methyl-5-thiazole monophosphate biosynthesis protein [Zea 
mays]
Length=428

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+  LRDCK LE + K  AE   LY AICA+PAV L  WG+LKGLKA
Sbjct  112  MPGSVGLRDCKALEKMVKTHAEDGGLYGAICAAPAVTLAYWGMLKGLKA  160



>ref|XP_002457129.1| hypothetical protein SORBIDRAFT_03g001740 [Sorghum bicolor]
 gb|EES02249.1| hypothetical protein SORBIDRAFT_03g001740 [Sorghum bicolor]
Length=429

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+  LRDCK LE + K  AE+  LY AICA+PAV L  WG+LKGLKA
Sbjct  113  MPGSVGLRDCKALEKMVKTHAENGGLYGAICAAPAVTLAYWGMLKGLKA  161



>emb|CDM82164.1| unnamed protein product [Triticum aestivum]
Length=731

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++ LR+CK LE + K  AE  +LY AICA+PAV L  WG+LKGLKA
Sbjct  109  MPGSTNLRECKVLERMVKMHAEKGELYGAICAAPAVTLAHWGMLKGLKA  157



>gb|KCW67486.1| hypothetical protein EUGRSUZ_F01222 [Eucalyptus grandis]
Length=437

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAII  214
            MPGAS+LRDCK LE + KKQ    +LYAA C  P   LGSWGLLKGLKA I
Sbjct  127  MPGASSLRDCKVLEDLVKKQGADGRLYAASCTFP--ELGSWGLLKGLKAAI  175



>ref|XP_010690314.1| PREDICTED: protein DJ-1 homolog C [Beta vulgaris subsp. vulgaris]
 ref|XP_010690315.1| PREDICTED: protein DJ-1 homolog C [Beta vulgaris subsp. vulgaris]
Length=444

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L SI  K AE K+LY AICA+PAV L  WGLLK
Sbjct  131  MPGSARLRDCEVLRSITSKHAEDKRLYGAICAAPAVTLQPWGLLK  175



>ref|XP_004230776.1| PREDICTED: protein DJ-1 homolog C isoform X1 [Solanum lycopersicum]
Length=459

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  +QAE K+LY AICA+PAVAL  WGLLK
Sbjct  144  MPGSARLRDCEVLQKITSRQAEEKRLYGAICAAPAVALLPWGLLK  188



>gb|KCW67487.1| hypothetical protein EUGRSUZ_F01222 [Eucalyptus grandis]
Length=440

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAII  214
            MPGAS+LRDCK LE + KKQ    +LYAA C  P   LGSWGLLKGLKA I
Sbjct  127  MPGASSLRDCKVLEDLVKKQGADGRLYAASCTFP--ELGSWGLLKGLKAAI  175


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA     C  L ++ KKQ ES + Y AICASPA+ L   GLLKG KA
Sbjct  330  GAQAFAKCDKLVNLLKKQKESNRPYGAICASPALVLEPHGLLKGKKA  376



>ref|XP_010060685.1| PREDICTED: protein DJ-1 homolog B-like [Eucalyptus grandis]
Length=390

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAII  214
            MPGAS+LRDCK LE + KKQ    +LYAA C  P   LGSWGLLKGLKA I
Sbjct  77   MPGASSLRDCKVLEDLVKKQGADGRLYAASCTFP--ELGSWGLLKGLKAAI  125


 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA     C  L ++ KKQ ES + Y AICASPA+ L   GLLKG KA
Sbjct  280  GAQAFAKCDKLVNLLKKQKESNRPYGAICASPALVLEPHGLLKGKKA  326



>gb|EPS63819.1| hypothetical protein M569_10960, partial [Genlisea aurea]
Length=385

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDCK L+ I  KQAE K+LY+AICA+PAV L  WGLLK
Sbjct  71   MPGSARLRDCKVLQQITCKQAEEKRLYSAICAAPAVTLLPWGLLK  115



>gb|EMS48524.1| hypothetical protein TRIUR3_19547 [Triticum urartu]
Length=548

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+  LR+CK LE + K  AE  +LY AICA+PAV L  WG+LKGLKA
Sbjct  147  MPGSVNLRECKVLERMVKMHAEKGELYGAICAAPAVTLAHWGMLKGLKA  195



>ref|XP_001763657.1| predicted protein [Physcomitrella patens]
 gb|EDQ71547.1| predicted protein [Physcomitrella patens]
Length=405

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  LRD K L+SI +KQ ++K++ AAICA+P VAL +WGLLKGL A
Sbjct  89   MPGAERLRDSKALKSIAEKQVKAKRMIAAICAAPVVALQAWGLLKGLHA  137


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  L+  K L  I ++QAE  ++Y AICA+PAV L S GLL G KA
Sbjct  293  MPGADRLQKSKELMRILQEQAEEGRIYGAICAAPAVILESSGLLHGKKA  341



>ref|XP_002518756.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43681.1| conserved hypothetical protein [Ricinus communis]
Length=477

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDCK L+ I  KQAE K+LY AIC++PAV L  WGLLK
Sbjct  161  MPGSARLRDCKILQQITSKQAEEKRLYGAICSAPAVTLLPWGLLK  205



>gb|KFK22990.1| hypothetical protein AALP_AAs54686U000100, partial [Arabis alpina]
Length=185

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK+LES+ KKQ E  +L AAIC +PA+A G+WGLL+G  A
Sbjct  77   LPGGETLKNCKSLESMVKKQDEDGRLNAAICCAPALAFGTWGLLEGKNA  125



>ref|XP_009147614.1| PREDICTED: LOW QUALITY PROTEIN: protein DJ-1 homolog B-like [Brassica 
rapa]
Length=430

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 11/77 (14%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWVVC  241
            +PG  TL++CK LES+ KKQ    +L AAIC +PA+ALG+WGLL+G KA          C
Sbjct  115  LPGGETLKNCKPLESMVKKQDADGRLNAAICCAPALALGTWGLLEGKKA---------TC  165

Query  242  WIFNLELEKEGVSCSNS  292
              + + +EK G +C+ +
Sbjct  166  --YPVFMEKLGATCATA  180



>dbj|GAK50303.1| hypothetical protein U14_01531 [bacterium UASB14]
Length=185

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  LRDC  L ++ K+Q E+ ++YAAICASPA+ L  +GLLKG KA
Sbjct  74   MPGAEHLRDCAPLIAMVKQQREAGRIYAAICASPAIVLHHYGLLKGKKA  122



>gb|KDO40019.1| hypothetical protein CISIN_1g038375mg, partial [Citrus sinensis]
Length=121

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L++ + LESI KKQA   +L A ICASPA ALGS GLLKGLKA
Sbjct  3    VPGATNLKESEVLESIVKKQASDGRLNAVICASPAEALGSRGLLKGLKA  51



>ref|XP_011098238.1| PREDICTED: protein DJ-1 homolog B [Sesamum indicum]
Length=438

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+T +DCKTLESI KKQAE+ + YAAICA+PAVALGSWGLLKGLKA
Sbjct  122  MPGAATFKDCKTLESIVKKQAENDRPYAAICAAPAVALGSWGLLKGLKA  170


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA T  + + L ++ KKQ ES +LY AICASPA+ L + GLLKG KA
Sbjct  329  GAQTFANSEKLVNLLKKQRESNKLYGAICASPALVLEAHGLLKGKKA  375



>gb|KCW63770.1| hypothetical protein EUGRSUZ_G01435 [Eucalyptus grandis]
 gb|KCW63771.1| hypothetical protein EUGRSUZ_G01435 [Eucalyptus grandis]
Length=478

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+TL +I  KQAE K+LY AICA+PAV L  WGLLK
Sbjct  162  MPGSVRLRDCETLRNIMSKQAERKRLYGAICAAPAVTLLPWGLLK  206



>ref|XP_010066017.1| PREDICTED: protein DJ-1 homolog C [Eucalyptus grandis]
 ref|XP_010066018.1| PREDICTED: protein DJ-1 homolog C [Eucalyptus grandis]
Length=502

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+TL +I  KQAE K+LY AICA+PAV L  WGLLK
Sbjct  186  MPGSVRLRDCETLRNIMSKQAERKRLYGAICAAPAVTLLPWGLLK  230



>ref|XP_006346409.1| PREDICTED: protein DJ-1 homolog C-like [Solanum tuberosum]
Length=459

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  +QAE K+LY AICA+PAV L  WGLLK
Sbjct  144  MPGSARLRDCEVLQKITSRQAEEKRLYGAICAAPAVTLLPWGLLK  188



>emb|CDY59398.1| BnaC03g78170D [Brassica napus]
Length=428

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 13/78 (17%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWVVC  241
            +PG  TL++CK LE++ KKQ    +L AAIC SPA+AL +WGLL+G KA          C
Sbjct  113  LPGGETLKNCKPLENMVKKQDADGRLNAAICCSPALALATWGLLEGKKA---------TC  163

Query  242  W-IFNLELEKEGVSCSNS  292
            + +F   +EK GV+C  +
Sbjct  164  YPVF---MEKLGVTCGKA  178



>ref|XP_009346259.1| PREDICTED: protein DJ-1 homolog C [Pyrus x bretschneideri]
Length=469

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC  L+ I +KQAE  +LY AICA+PAVAL  WGLLK
Sbjct  153  MPGSVRLRDCAALQEITRKQAEESRLYGAICAAPAVALLPWGLLK  197



>ref|XP_009620202.1| PREDICTED: protein DJ-1 homolog C [Nicotiana tomentosiformis]
Length=457

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  +QAE K+LY AICA+PAV L  WGLLK
Sbjct  142  MPGSARLRDCEVLKKITSRQAEEKRLYGAICAAPAVTLLPWGLLK  186



>ref|XP_009774082.1| PREDICTED: protein DJ-1 homolog C [Nicotiana sylvestris]
Length=457

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  +QAE K+LY AICA+PAV L  WGLLK
Sbjct  142  MPGSARLRDCEVLKKITSRQAEEKRLYGAICAAPAVTLLPWGLLK  186



>ref|XP_004294798.1| PREDICTED: uncharacterized protein LOC101291703 [Fragaria vesca 
subsp. vesca]
Length=456

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ LE I ++QAE ++LY AICA+PAV L  WGLL+
Sbjct  140  MPGSVRLRDCEVLEKITRQQAEKRRLYGAICAAPAVTLLPWGLLR  184



>ref|XP_006826220.1| hypothetical protein AMTR_s00132p00051080 [Amborella trichopoda]
 gb|ERM93457.1| hypothetical protein AMTR_s00132p00051080 [Amborella trichopoda]
Length=435

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC  L+ I  KQA+ K+LY AICA+PAV L  WGLLK
Sbjct  114  MPGSVRLRDCNILQKITSKQADEKRLYGAICAAPAVVLEPWGLLK  158



>ref|XP_002313856.2| hypothetical protein POPTR_0009s10390g [Populus trichocarpa]
 gb|EEE87811.2| hypothetical protein POPTR_0009s10390g [Populus trichocarpa]
Length=471

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L  I  KQAE K+LY AICA+PA+ L  WGLL+
Sbjct  156  MPGSARLRDCEVLRQITSKQAEDKRLYGAICAAPAITLLPWGLLR  200



>gb|KDP42270.1| hypothetical protein JCGZ_01594 [Jatropha curcas]
Length=469

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L  I  +QAE K+LY AICA+PAV L  WGLL+
Sbjct  153  MPGSARLRDCEVLRQITSRQAEEKRLYGAICAAPAVTLLPWGLLR  197



>ref|XP_010263527.1| PREDICTED: protein DJ-1 homolog C [Nelumbo nucifera]
Length=467

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L  I  KQAE K+LY AICA+PAV L  WGLLK
Sbjct  151  MPGSARLRDCEILRKITCKQAEEKRLYGAICAAPAVTLQPWGLLK  195



>ref|XP_011000601.1| PREDICTED: protein DJ-1 homolog C [Populus euphratica]
Length=471

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L  I  KQAE K+LY AICA+PA+ L  WGLL+
Sbjct  156  MPGSARLRDCEVLRQITSKQAEGKRLYGAICAAPAITLLPWGLLR  200



>gb|KDO59715.1| hypothetical protein CISIN_1g012037mg [Citrus sinensis]
Length=405

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L+ I  KQAE K+LY AICA+PAV L  WGLL+
Sbjct  89   MPGSVRLRDCEILKKITSKQAEEKRLYGAICAAPAVTLLPWGLLR  133



>ref|XP_009619737.1| PREDICTED: protein DJ-1 homolog B [Nicotiana tomentosiformis]
Length=439

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ LR+CKTLESI KKQAE+ + YAAICA+PAVALGSWGLLKGLKA
Sbjct  125  IPGATNLRNCKTLESIVKKQAENGRFYAAICAAPAVALGSWGLLKGLKA  173



>ref|XP_009106986.1| PREDICTED: protein DJ-1 homolog B [Brassica rapa]
 ref|XP_009106987.1| PREDICTED: protein DJ-1 homolog B [Brassica rapa]
 emb|CDY02515.1| BnaA08g01220D [Brassica napus]
Length=428

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWVVC  241
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G +A          C
Sbjct  113  LPGGETLKNCKPLENMVKKQDSEGRLNAAICCAPALALGTWGLLEGRRA---------TC  163

Query  242  WIFNLELEKEGVSCSNS  292
              + + +EK G +C  +
Sbjct  164  --YPVFMEKLGATCGTA  178



>ref|XP_007156507.1| hypothetical protein PHAVU_003G291700g [Phaseolus vulgaris]
 gb|ESW28501.1| hypothetical protein PHAVU_003G291700g [Phaseolus vulgaris]
Length=445

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L  I  KQAE  +LY AICA+PAV L  WGLLK
Sbjct  130  MPGSARLRDCEVLRKITSKQAEENRLYGAICAAPAVTLLPWGLLK  174



>ref|XP_006487114.1| PREDICTED: protein DJ-1 homolog C-like [Citrus sinensis]
Length=472

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L+ I  KQAE K+LY AICA+PAV L  WGLL+
Sbjct  156  MPGSVRLRDCEILKKITSKQAEEKRLYGAICAAPAVTLLPWGLLR  200



>ref|XP_009139506.1| PREDICTED: protein DJ-1 homolog A-like [Brassica rapa]
Length=391

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLQGKKA  125



>ref|XP_006423007.1| hypothetical protein CICLE_v10028354mg [Citrus clementina]
 gb|ESR36247.1| hypothetical protein CICLE_v10028354mg [Citrus clementina]
Length=472

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L+ I  KQAE K+LY AICA+PAV L  WGLL+
Sbjct  156  MPGSVRLRDCEILKKITSKQAEEKRLYGAICAAPAVTLLPWGLLR  200



>ref|XP_008373132.1| PREDICTED: protein DJ-1 homolog C [Malus domestica]
Length=459

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC  L+ I +KQAE  +LY AICA+PAV L  WGLLK
Sbjct  143  MPGSVRLRDCAALQEITRKQAEESRLYGAICAAPAVTLLPWGLLK  187



>emb|CDO97183.1| unnamed protein product [Coffea canephora]
Length=467

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ +  KQAE K+LY AICA+PAV L  WGLL+
Sbjct  153  MPGSARLRDCEILQKMTSKQAEEKRLYGAICAAPAVTLLPWGLLR  197



>emb|CDY25999.1| BnaC06g06250D [Brassica napus]
Length=494

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 13/78 (17%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWVVC  241
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA          C
Sbjct  179  LPGGETLKNCKALENMVKKQDADGRLNAAICCAPALALGTWGLLEGKKA---------TC  229

Query  242  W-IFNLELEKEGVSCSNS  292
            + +F   +EK G +C+ +
Sbjct  230  YPVF---MEKLGATCATA  244



>dbj|BAJ34358.1| unnamed protein product [Thellungiella halophila]
Length=391

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKALENMVKKQETDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_010465435.1| PREDICTED: protein DJ-1 homolog A-like [Camelina sativa]
Length=392

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSEGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_004968631.1| PREDICTED: protein DJ-1 homolog B-like [Setaria italica]
Length=438

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ LR C  LESI ++Q     LYAAICA+P +ALG WGLL G+KA
Sbjct  133  VPGAANLRGCGALESIVRRQVLKGGLYAAICAAPPLALGRWGLLDGVKA  181



>ref|XP_010465434.1| PREDICTED: protein DJ-1 homolog A [Camelina sativa]
Length=392

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSEGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_010657627.1| PREDICTED: protein DJ-1 homolog A-like [Vitis vinifera]
Length=129

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGL  202
            MPGA+TL D   LES+ KK A+  QLYA    +PAV LGSWGL+ G 
Sbjct  59   MPGATTLGDGDILESMVKKHADDGQLYARFRVAPAVVLGSWGLMHGF  105



>emb|CDY23161.1| BnaA04g05980D [Brassica napus]
Length=391

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLQGKKA  125



>ref|NP_850588.1| protein DJ-1-like A [Arabidopsis thaliana]
 ref|NP_001030698.1| protein DJ-1-like A [Arabidopsis thaliana]
 dbj|BAA97062.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75599.1| protein DJ-1-like A [Arabidopsis thaliana]
 gb|AEE75600.1| protein DJ-1-like A [Arabidopsis thaliana]
Length=369

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK+LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  54   LPGGETLKNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  102



>ref|XP_001760708.1| predicted protein [Physcomitrella patens]
 gb|EDQ74447.1| predicted protein [Physcomitrella patens]
Length=395

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA   RD + L+ I  KQ++ K+++AAICA+P VAL SWGLL GL A
Sbjct  79   MPGAERFRDSQVLKRITVKQSQEKRMFAAICAAPVVALQSWGLLAGLNA  127


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ L++ + L  I  +Q ES + Y AICA+PAV L + GLL G KA
Sbjct  283  MPGATRLQESEELSKILNQQVESGRCYGAICAAPAVVLEANGLLNGKKA  331



>dbj|BAJ89018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L  C TLE I +K  E   LYAAICA+P +AL SWGLL G KA
Sbjct  81   VPGAANLGGCATLEGILRKHVEKGGLYAAICAAPPLALASWGLLDGHKA  129



>ref|NP_188117.1| protein DJ-1-like A [Arabidopsis thaliana]
 sp|Q9FPF0.1|DJ1A_ARATH RecName: Full=Protein DJ-1 homolog A; Short=AtDJ1A [Arabidopsis 
thaliana]
 gb|AAG41438.1|AF326856_1 putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAK15562.1|AF349515_1 putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAK62629.1| AT3g14990/K15M2_13 [Arabidopsis thaliana]
 gb|AAM91076.1| AT3g14990/K15M2_13 [Arabidopsis thaliana]
 dbj|BAH20124.1| AT3G14990 [Arabidopsis thaliana]
 gb|AEE75598.1| protein DJ-1-like A [Arabidopsis thaliana]
Length=392

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK+LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  125



>gb|KDO59716.1| hypothetical protein CISIN_1g012037mg [Citrus sinensis]
Length=472

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L+ I  KQAE K+LY AICA+PAV L  WGLL+
Sbjct  156  MPGSVRLRDCEILKKITSKQAEEKRLYGAICAAPAVTLLPWGLLR  200



>ref|XP_007201073.1| hypothetical protein PRUPE_ppa007275mg [Prunus persica]
 gb|EMJ02272.1| hypothetical protein PRUPE_ppa007275mg [Prunus persica]
Length=375

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC  L+ I  KQAE ++LY AICA+PAV L  WGLL+
Sbjct  59   MPGSVRLRDCAALQKITSKQAEERRLYGAICAAPAVTLLPWGLLR  103



>ref|XP_007212913.1| hypothetical protein PRUPE_ppa022246mg [Prunus persica]
 gb|EMJ14112.1| hypothetical protein PRUPE_ppa022246mg [Prunus persica]
Length=395

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA+ L++ + LES+ KKQA   +LYAAICASPA+A G+WG+LK LKA
Sbjct  80   GAANLKNNEVLESLVKKQAADGKLYAAICASPAMAFGTWGVLKELKA  126



>ref|XP_010107931.1| hypothetical protein L484_027520 [Morus notabilis]
 gb|EXC17331.1| hypothetical protein L484_027520 [Morus notabilis]
Length=474

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L+ I +KQAE K+LY AICA+PAV L  WGL +
Sbjct  158  MPGSVRLRDCEILQKITRKQAEEKRLYGAICAAPAVTLLPWGLTR  202



>ref|XP_010500964.1| PREDICTED: protein DJ-1 homolog B [Camelina sativa]
 ref|XP_010500965.1| PREDICTED: protein DJ-1 homolog B [Camelina sativa]
Length=444

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  130  LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEGKKA  178



>ref|XP_009381820.1| PREDICTED: protein DJ-1 homolog C [Musa acuminata subsp. malaccensis]
Length=323

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L  I  KQAE K+LY AICA+PAV L  WGL K
Sbjct  64   MPGSVRLRDCEVLRKITIKQAEEKRLYGAICAAPAVTLMPWGLHK  108



>gb|KHN37515.1| Protein DJ-1 [Glycine soja]
Length=316

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH--*MWV  235
            MPG++ LRDC  L  I  +QAE   LY AICA+PAV+L  WGLLK  K ++  +    W 
Sbjct  1    MPGSARLRDCDVLRKITCRQAEENSLYGAICAAPAVSLLPWGLLKKKKFVMQDNLPRFWA  60

Query  236  VCWIFNLELEKEGVSCSNSP  295
            +    NL++ + G++ S  P
Sbjct  61   IKS--NLQVSR-GLTTSRGP  77



>ref|XP_006297946.1| hypothetical protein CARUB_v10013988mg [Capsella rubella]
 gb|EOA30844.1| hypothetical protein CARUB_v10013988mg [Capsella rubella]
Length=342

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_006297947.1| hypothetical protein CARUB_v10013988mg [Capsella rubella]
 gb|EOA30845.1| hypothetical protein CARUB_v10013988mg [Capsella rubella]
Length=369

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  54   LPGGETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  102



>emb|CBK19977.2| unnamed protein product [Blastocystis hominis]
 emb|CBK20037.2| unnamed protein product [Blastocystis hominis]
Length=184

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  LRD KTL  + +KQ E  ++YAAICASPAV   S  LL+G+KA
Sbjct  73   LPGAEHLRDSKTLSKLLEKQKEEGRIYAAICASPAVVFASHNLLEGVKA  121



>ref|XP_008236599.1| PREDICTED: protein DJ-1 homolog C [Prunus mume]
Length=469

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC  L+ I  KQAE ++LY AICA+PAV L  WGLL+
Sbjct  153  MPGSVRLRDCAALQKITSKQAEERRLYGAICAAPAVTLLPWGLLR  197



>gb|KGN43923.1| hypothetical protein Csa_7G073590 [Cucumis sativus]
Length=465

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L  I  +QAE K+LY AICA+PAV L  WGLL+
Sbjct  150  MPGSVRLRDCEILRKITSRQAEEKRLYGAICAAPAVTLLPWGLLR  194



>ref|XP_010487312.1| PREDICTED: protein DJ-1 homolog A-like [Camelina sativa]
Length=392

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_002882906.1| hypothetical protein ARALYDRAFT_478924 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59165.1| hypothetical protein ARALYDRAFT_478924 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_008454959.1| PREDICTED: protein DJ-1 homolog C [Cucumis melo]
Length=474

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L  I  +QAE K+LY AICA+PAV L  WGLL+
Sbjct  159  MPGSVRLRDCEILRKITSRQAEEKRLYGAICAAPAVTLLPWGLLR  203



>ref|XP_010502412.1| PREDICTED: protein DJ-1 homolog A-like [Camelina sativa]
Length=392

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_004136975.1| PREDICTED: uncharacterized protein LOC101204195 [Cucumis sativus]
 ref|XP_004159893.1| PREDICTED: uncharacterized protein LOC101229677 [Cucumis sativus]
Length=473

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRDC+ L  I  +QAE K+LY AICA+PAV L  WGLL+
Sbjct  158  MPGSVRLRDCEILRKITSRQAEEKRLYGAICAAPAVTLLPWGLLR  202



>ref|XP_009135416.1| PREDICTED: protein DJ-1 homolog A-like [Brassica rapa]
Length=392

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQETDGRLNAAICCAPALALGTWGLLEGKKA  125


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH  223
            GAS L  C+ L ++ KKQAE+ + Y  ICASPA      GLLKG KA  +TH
Sbjct  285  GASRLSRCEKLVNMLKKQAEANKPYGGICASPAYVFEPHGLLKGKKA--TTH  334



>emb|CDX75800.1| BnaC03g38830D [Brassica napus]
Length=392

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQETDGRLNAAICCAPALALGTWGLLEGKKA  125


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH  223
            GAS L  C+ L ++ KKQAE+ + Y  ICASPA      GLLKG KA  +TH
Sbjct  285  GASRLSRCEKLVNMLKKQAEANKPYGGICASPAYVFEPHGLLKGKKA--TTH  334



>emb|CDX82455.1| BnaA03g33660D [Brassica napus]
Length=392

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  77   LPGGETLKNCKPLENMVKKQETDGRLNAAICCAPALALGTWGLLEGKKA  125



>ref|XP_008783897.1| PREDICTED: protein DJ-1 homolog B-like [Phoenix dactylifera]
Length=393

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++TLRDC  LESI KKQAE   LYAAICA+PAVALGSWGLLKGLKA
Sbjct  78   MPGSATLRDCGALESIVKKQAEKGGLYAAICAAPAVALGSWGLLKGLKA  126


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   KLIWSLCVREKMPG-ASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            KL + L V    PG A      + L  + KKQA+SK+LY AICASPA+ L   GLLKG K
Sbjct  271  KLQYDLIVLPGGPGGAQAFSTSEKLVDLLKKQAKSKKLYGAICASPAMVLEPHGLLKGKK  330

Query  206  A  208
            A
Sbjct  331  A  331



>ref|XP_006392805.1| hypothetical protein EUTSA_v10011492mg [Eutrema salsugineum]
 gb|ESQ30091.1| hypothetical protein EUTSA_v10011492mg [Eutrema salsugineum]
Length=436

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  122  LPGGETLKNCKALENMVKKQETDGRLNAAICCAPALALGTWGLLEGKKA  170



>emb|CDX95299.1| BnaC04g28590D [Brassica napus]
Length=391

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  35   IWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            I+ L V    +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  67   IFDLIVLPGGLPGGETLKNCKPLENMVKKQDADGRLNAAICCAPALALGTWGLLQGKKA  125



>gb|AFK38256.1| unknown [Lotus japonicus]
Length=453

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  KQAE ++LY AICA+PAV L  WGLLK
Sbjct  133  MPGSARLRDCDVLRKITCKQAEERRLYGAICAAPAVTLLPWGLLK  177



>emb|CDY24104.1| BnaA06g01020D [Brassica napus]
Length=393

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWVVC  241
            +PG  TL++CK LE++ KKQ    ++ AAIC +PA+ALG+WGLL+G KA          C
Sbjct  78   LPGGETLKNCKPLENMVKKQDADGRVNAAICCAPALALGTWGLLEGKKA---------TC  128

Query  242  W-IFNLELEKEGVSCS  286
            + +F   +EK G +C+
Sbjct  129  YPVF---MEKLGATCA  141



>ref|XP_011092565.1| PREDICTED: LOW QUALITY PROTEIN: protein DJ-1 homolog C [Sesamum 
indicum]
Length=376

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG   LRDC+ L+ I K+QA++K+LYAAICA+PAV L  WGLL+
Sbjct  63   MPGXR-LRDCEILQKITKRQADAKRLYAAICAAPAVTLLPWGLLR  106



>ref|XP_010943091.1| PREDICTED: protein DJ-1 homolog C isoform X2 [Elaeis guineensis]
Length=414

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGL  190
            MPGA  LRDC  L  +  KQAE K+LY AICASPAV L  WGL
Sbjct  122  MPGAVRLRDCDILRKMTIKQAEEKRLYGAICASPAVVLMPWGL  164



>gb|EEC70179.1| hypothetical protein OsI_00908 [Oryza sativa Indica Group]
Length=304

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWV  235
            +PGA+ L  C  LE++ ++ A +  LYAAICA+P +AL SWG+L GLKA  + H ++V
Sbjct  84   VPGAANLGGCAALEAMVRRHAATGGLYAAICAAPPLALASWGMLNGLKA--TAHPLFV  139



>ref|XP_006575006.1| PREDICTED: protein DJ-1 homolog C-like isoform X2 [Glycine max]
Length=298

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  +QAE   LY AICA+PAV+L  WGLLK
Sbjct  1    MPGSARLRDCDVLRKITCRQAEENSLYGAICAAPAVSLLPWGLLK  45



>ref|XP_002867138.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43397.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDCK LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  155  MPGAVRLRDCKILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  198



>gb|EYU26333.1| hypothetical protein MIMGU_mgv1a006668mg [Erythranthe guttata]
Length=369

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TL+DCKTLE++ KKQA   + YAA+CA+PAVALGSWGLLKGLKA
Sbjct  119  MPGATTLKDCKTLENMVKKQAADNKPYAAVCAAPAVALGSWGLLKGLKA  167



>ref|XP_010943090.1| PREDICTED: protein DJ-1 homolog C isoform X1 [Elaeis guineensis]
Length=440

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGL  190
            MPGA  LRDC  L  +  KQAE K+LY AICASPAV L  WGL
Sbjct  122  MPGAVRLRDCDILRKMTIKQAEEKRLYGAICASPAVVLMPWGL  164



>ref|XP_004505230.1| PREDICTED: protein DJ-1 homolog C-like [Cicer arietinum]
Length=450

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  KQAE  +LY AICA+PAV L  WGLLK
Sbjct  133  MPGSARLRDCDVLRKITCKQAEENRLYGAICAAPAVTLLPWGLLK  177



>gb|EYU26334.1| hypothetical protein MIMGU_mgv1a006668mg [Erythranthe guttata]
Length=435

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TL+DCKTLE++ KKQA   + YAA+CA+PAVALGSWGLLKGLKA
Sbjct  119  MPGATTLKDCKTLENMVKKQAADNKPYAAVCAAPAVALGSWGLLKGLKA  167



>emb|CAA17570.1| putative protein [Arabidopsis thaliana]
 emb|CAA19884.1| putative protein [Arabidopsis thaliana]
 emb|CAB80119.1| putative protein [Arabidopsis thaliana]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC+ LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  167  MPGAVRLRDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  210



>gb|EMS56936.1| hypothetical protein TRIUR3_21703 [Triticum urartu]
Length=130

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            +PGA  L    TLESI +K AE   LYAAICA+P +AL SWGLL G K
Sbjct  81   VPGAVNLGGSATLESIVRKHAEKGGLYAAICAAPPLALASWGLLNGHK  128



>ref|XP_010462205.1| PREDICTED: protein DJ-1 homolog B-like [Camelina sativa]
Length=447

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+A G+WGLL+G KA
Sbjct  133  LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKA  181



>ref|XP_003574626.1| PREDICTED: protein DJ-1 homolog C [Brachypodium distachyon]
Length=451

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH  223
            MPG+  LRD K L+ I  +QAE K+LY AICA+PAV L  WGL +G K  I++H
Sbjct  135  MPGSVRLRDNKILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHRGRK--ITSH  186



>emb|CDX98521.1| BnaC05g38540D [Brassica napus]
Length=392

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G  A
Sbjct  77   LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEGKTA  125



>ref|XP_008226524.1| PREDICTED: protein DJ-1 homolog B [Prunus mume]
Length=397

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA+ L+  + LES+ KKQA   + YAAICASPA+A G WG+LKGLKA
Sbjct  82   GAANLKTNEVLESLVKKQAADGKPYAAICASPAMAFGPWGVLKGLKA  128



>emb|CBI39979.3| unnamed protein product [Vitis vinifera]
Length=241

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGL  202
            MPGA+TL     LES+ KK A+  QLYA    +PAVALGSWGL+ G 
Sbjct  59   MPGAATLGAGDILESMVKKHADDGQLYAIFRVAPAVALGSWGLMHGF  105



>ref|XP_010915629.1| PREDICTED: protein DJ-1 homolog B [Elaeis guineensis]
Length=436

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++TLRDC+ L+SI KKQAE   LYAAICA+PAVALGSWGLLKGLKA
Sbjct  121  MPGSATLRDCEALKSIVKKQAEKGGLYAAICAAPAVALGSWGLLKGLKA  169


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA      + L  + KKQAESK+LY AICASPA+ L  +GLLKG KA
Sbjct  328  GAQAFSSSEKLVDLLKKQAESKKLYGAICASPAMVLEPYGLLKGKKA  374



>ref|XP_006307524.1| hypothetical protein CARUB_v10009147mg [Capsella rubella]
 gb|EOA40422.1| hypothetical protein CARUB_v10009147mg [Capsella rubella]
Length=442

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AA+C +PA+ALG+WGLL+G KA
Sbjct  128  LPGGETLKNCKPLENMVKKQDTEGRLNAAVCCAPALALGTWGLLEGKKA  176



>ref|XP_002894433.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70692.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE + KKQ    +L AAIC +PA+ALG+WGLL+G KA
Sbjct  123  LPGGETLKNCKPLEKMVKKQDTDGRLNAAICCAPALALGTWGLLEGKKA  171



>ref|XP_010432477.1| PREDICTED: protein DJ-1 homolog C-like [Camelina sativa]
Length=477

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDCK LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  156  MPGAVRLRDCKILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  199



>ref|XP_009146298.1| PREDICTED: protein DJ-1 homolog A [Brassica rapa]
 gb|AAP96742.1| ThiJ-like protein [Brassica rapa subsp. pekinensis]
Length=392

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G  A
Sbjct  77   LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEGKTA  125



>ref|XP_010479882.1| PREDICTED: protein DJ-1 homolog B-like [Camelina sativa]
 ref|XP_010479883.1| PREDICTED: protein DJ-1 homolog B-like [Camelina sativa]
Length=445

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+A G+WGLL+G KA
Sbjct  131  LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKA  179



>ref|XP_009765627.1| PREDICTED: protein DJ-1 homolog B-like [Nicotiana sylvestris]
Length=439

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ LR+CKTLESI KKQA + + YAAICA+PAVALGSWGLLKGLKA
Sbjct  125  IPGATNLRNCKTLESIVKKQAVNGRFYAAICAAPAVALGSWGLLKGLKA  173



>gb|KFK38848.1| hypothetical protein AALP_AA3G168100 [Arabis alpina]
Length=392

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  35   IWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            I+ L V    +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLLK  KA
Sbjct  67   IFDLIVLPGGLPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLKDKKA  125


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 2/52 (4%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH  223
            GA     C+TL ++ KKQAE+ + Y  ICASPA      GLLKG KA  +TH
Sbjct  285  GAQKFASCETLVNMLKKQAEADKPYGGICASPAYVFEPNGLLKGKKA--TTH  334



>ref|XP_006583884.1| PREDICTED: protein DJ-1 homolog C-like isoform X2 [Glycine max]
Length=448

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  +QAE  +LY AICA+PAV L  WGLLK
Sbjct  132  MPGSARLRDCDVLRKITCRQAEENRLYGAICAAPAVTLLPWGLLK  176



>ref|XP_009413835.1| PREDICTED: protein DJ-1 homolog A [Musa acuminata subsp. malaccensis]
Length=440

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG+ TLRDC  LESI KKQAE   LYAAICA+PAVALGSWGLLKGLKA
Sbjct  125  IPGSDTLRDCGVLESIVKKQAEKGGLYAAICAAPAVALGSWGLLKGLKA  173


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   KLIWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            KL + L V    +PGA    + + L ++ +KQAES +LY AICASPA+ L + GLLKG K
Sbjct  318  KLQYDLIVLPGGLPGAQAFSNSEKLVNLLRKQAESSKLYGAICASPAIVLETHGLLKGKK  377

Query  206  A  208
            A
Sbjct  378  A  378



>gb|KHN43067.1| Protein DJ-1 [Glycine soja]
Length=443

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  +QAE  +LY AICA+PAV L  WGLLK
Sbjct  127  MPGSARLRDCDVLRKITCRQAEENRLYGAICAAPAVTLLPWGLLK  171



>ref|XP_006407024.1| hypothetical protein EUTSA_v10020891mg [Eutrema salsugineum]
 gb|ESQ48477.1| hypothetical protein EUTSA_v10020891mg [Eutrema salsugineum]
Length=338

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKG  199
            +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G
Sbjct  23   LPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEG  68



>ref|XP_010535048.1| PREDICTED: protein DJ-1 homolog B-like, partial [Tarenaya hassleriana]
Length=418

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++C  LE++ KKQ    +L  AIC +PA+ALGSWGLLKG KA
Sbjct  103  LPGGETLKNCGVLENMVKKQDAEGRLNGAICCAPALALGSWGLLKGRKA  151



>ref|XP_006583883.1| PREDICTED: protein DJ-1 homolog C-like isoform X1 [Glycine max]
Length=450

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  +QAE  +LY AICA+PAV L  WGLLK
Sbjct  134  MPGSARLRDCDVLRKITCRQAEENRLYGAICAAPAVTLLPWGLLK  178



>ref|NP_195128.2| protein DJ-1 homolog C [Arabidopsis thaliana]
 sp|Q8VY09.1|DJ1C_ARATH RecName: Full=Protein DJ-1 homolog C; Short=AtDJ1C; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL66992.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20345.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86310.1| protein DJ-1 homolog C [Arabidopsis thaliana]
Length=472

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC+ LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  155  MPGAVRLRDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  198



>ref|XP_010535047.1| PREDICTED: LOW QUALITY PROTEIN: protein DJ-1 homolog B-like [Tarenaya 
hassleriana]
Length=437

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++C  LE++ KKQ    +L  AIC +PA+ALGSWGLLKG KA
Sbjct  123  LPGGETLKNCGVLENMVKKQDAEGRLNGAICCAPALALGSWGLLKGRKA  171


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   KLIWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            +L + L V    + GA     C+ L ++ KKQAES + Y AICASPA+ L   GLLKG K
Sbjct  316  RLTYDLIVLPGGLGGAQAFASCEKLVNMLKKQAESNKPYGAICASPALVLEPHGLLKGKK  375

Query  206  A  208
            A
Sbjct  376  A  376



>ref|XP_010447162.1| PREDICTED: protein DJ-1 homolog C [Camelina sativa]
Length=477

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC+ LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  156  MPGAVRLRDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  199



>ref|NP_001031787.1| protein DJ-1 homolog C [Arabidopsis thaliana]
 dbj|BAH20144.1| AT4G34020 [Arabidopsis thaliana]
 gb|AEE86311.1| protein DJ-1 homolog C [Arabidopsis thaliana]
Length=437

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC+ LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  120  MPGAVRLRDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  163



>ref|XP_006407025.1| hypothetical protein EUTSA_v10020891mg [Eutrema salsugineum]
 gb|ESQ48478.1| hypothetical protein EUTSA_v10020891mg [Eutrema salsugineum]
Length=392

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  35   IWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKG  199
            I+ L V    +PG  TL++CK LE++ KKQ    +L AAIC +PA+ALG+WGLL+G
Sbjct  67   IFDLIVLPGGLPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEG  122



>ref|XP_010437683.1| PREDICTED: protein DJ-1 homolog C-like [Camelina sativa]
Length=476

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC+ LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  155  MPGAVRLRDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  198



>gb|EAZ11044.1| hypothetical protein OsJ_00888 [Oryza sativa Japonica Group]
Length=187

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            +PGA+ L  C  LE++ ++ A +  LYAAICA+P +AL SWG+L GLK
Sbjct  115  VPGAANLGGCAALEAMVRRHAATGGLYAAICAAPPLALASWGMLNGLK  162



>emb|CDX97625.1| BnaA05g24540D [Brassica napus]
Length=392

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE + KKQ    +L AAIC +PA+ALG+WGLL+G  A
Sbjct  77   LPGGETLKNCKPLEDMVKKQDTDGRLNAAICCAPALALGTWGLLEGKTA  125



>dbj|BAK05486.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAST RDCK LE++ KK AE  +LYAA+CA+PAVALG+WGLL GLKA
Sbjct  115  MPGASTFRDCKVLENMVKKHAEKGKLYAAVCAAPAVALGAWGLLNGLKA  163


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  337  KKQAEANKLYGAICASPAIALEPHGLLKGKKA-TSYPAMW  375



>dbj|BAJ85373.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=426

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAST RDCK LE++ KK AE  +LYAA+CA+PAVALG+WGLL GLKA
Sbjct  111  MPGASTFRDCKVLENMVKKHAEKGKLYAAVCAAPAVALGAWGLLNGLKA  159


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  333  KKQAEANKLYGAICASPAIALEPHGLLKGKKA-TSYPAMW  371



>ref|XP_008776805.1| PREDICTED: protein DJ-1 homolog C [Phoenix dactylifera]
Length=440

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGL  190
            MPGA  LRDC+ L  +  KQAE K+LY AICA+PAV L  WGL
Sbjct  122  MPGAVRLRDCEILRKMTIKQAEEKRLYGAICAAPAVVLMPWGL  164



>ref|NP_564626.1| DJ1-like protein B [Arabidopsis thaliana]
 sp|Q9MAH3.1|DJ1B_ARATH RecName: Full=Protein DJ-1 homolog B; Short=AtDJ1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF69547.1|AC008007_22 F12M16.18 [Arabidopsis thaliana]
 gb|AAL07117.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14123.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32916.1| DJ1-like protein B [Arabidopsis thaliana]
Length=438

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE + KKQ    +L AAIC +PA+A G+WGLL+G KA
Sbjct  124  LPGGETLKNCKPLEKMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKA  172



>emb|CAN76501.1| hypothetical protein VITISV_025207 [Vitis vinifera]
Length=181

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGL  202
            MPGA+TL D   LES+ KK A+  Q YA    +PAVA GSWGL+ G 
Sbjct  128  MPGAATLGDGDILESMVKKHADEGQPYARFRVAPAVAFGSWGLMHGF  174



>gb|AAM60860.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis 
protein, putative [Arabidopsis thaliana]
Length=438

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG  TL++CK LE + KKQ    +L AAIC +PA+A G+WGLL+G KA
Sbjct  124  LPGGETLKNCKPLERMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKA  172



>ref|XP_003563799.1| PREDICTED: protein DJ-1 homolog B-like [Brachypodium distachyon]
Length=434

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGAS+ RDCK LE++ KK AE  +LYAAICA+PAVALGSWGLL GLKA
Sbjct  119  MPGASSFRDCKILENMVKKHAEKGKLYAAICAAPAVALGSWGLLDGLKA  167


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  341  KKQAETNKLYGAICASPAIALEPHGLLKGKKA-TSYPAMW  379



>gb|KFK22993.1| hypothetical protein AALP_AAs54686U000400 [Arabis alpina]
Length=439

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            G  TL++CK+LES+ KKQ E  +L AAIC +PA+A G+WGLL+G  A
Sbjct  129  GGETLKNCKSLESMVKKQDEEGRLNAAICCAPALAFGTWGLLEGKNA  175



>ref|XP_008783896.1| PREDICTED: protein DJ-1 homolog B-like [Phoenix dactylifera]
Length=430

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG++TLRDC  L+SI KKQAE   LYAAICA+PAVALGSWGLL+GLKA
Sbjct  115  MPGSATLRDCGALQSIVKKQAEKGGLYAAICAAPAVALGSWGLLQGLKA  163


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA      + L  + KKQA+SK+LY AICASPA+ L   GLLKG KA
Sbjct  322  GAQAFSTSEKLVDLLKKQAKSKKLYGAICASPAMVLEPHGLLKGKKA  368



>ref|NP_001042406.1| Os01g0217500 [Oryza sativa Japonica Group]
 dbj|BAD73058.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis 
enzyme [Oryza sativa Japonica Group]
 dbj|BAF04320.1| Os01g0217500 [Oryza sativa Japonica Group]
 dbj|BAG88623.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L  C  LE++ ++ A +  LYAAICA+P +AL SWG+L GLKA
Sbjct  84   VPGAANLGGCAALEAMVRRHAATGGLYAAICAAPPLALASWGMLNGLKA  132



>ref|XP_002282255.1| PREDICTED: protein DJ-1 homolog C [Vitis vinifera]
 emb|CBI32399.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRD + L  I  K AE K+LY AICA+PA+ L  WGLL+
Sbjct  131  MPGSARLRDSEILRKITSKHAEEKRLYGAICAAPAITLQPWGLLR  175



>ref|XP_009117488.1| PREDICTED: protein DJ-1 homolog C [Brassica rapa]
Length=460

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  139  MPGAVRLRDCGALEKIMKRQAEEKRLYGAISMAPAITLLPWGLL  182



>gb|KHG14557.1| Protein DJ-1 [Gossypium arboreum]
Length=468

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  KQAE K+LY  I  +PAV L  WGLLK
Sbjct  153  MPGSAQLRDCEILKKITSKQAEEKRLYGGISTAPAVTLLPWGLLK  197



>ref|XP_002457130.1| hypothetical protein SORBIDRAFT_03g001750 [Sorghum bicolor]
 gb|EES02250.1| hypothetical protein SORBIDRAFT_03g001750 [Sorghum bicolor]
Length=400

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA  L  C  LESI ++QA    LYAAICA+P +AL  WGLL G+KA
Sbjct  83   VPGADNLGGCAALESIVRRQALGGGLYAAICAAPPLALARWGLLDGVKA  131



>ref|XP_006348292.1| PREDICTED: protein DJ-1 homolog B-like [Solanum tuberosum]
Length=441

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L +CK LESI KKQAE+ +LYAAICA+PAVALGSWGLLKGLKA
Sbjct  127  VPGAANLGNCKILESIVKKQAENGKLYAAICAAPAVALGSWGLLKGLKA  175



>ref|XP_004244263.1| PREDICTED: protein DJ-1 homolog B [Solanum lycopersicum]
Length=441

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L +CK LESI KKQAE+ +LYAAICA+PA+ALGSWGLLKGLKA
Sbjct  127  VPGAANLGNCKILESIVKKQAENGKLYAAICAAPAIALGSWGLLKGLKA  175



>emb|CDX69022.1| BnaC01g04310D [Brassica napus]
Length=460

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  139  MPGAVRLRDCGVLEKIMKRQAEDKRLYGAISMAPAMTLLPWGLL  182



>ref|XP_006282493.1| hypothetical protein CARUB_v10006469mg [Capsella rubella]
 gb|EOA15391.1| hypothetical protein CARUB_v10006469mg [Capsella rubella]
Length=476

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  155  MPGAVRLRDCVVLEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  198



>ref|XP_004965530.1| PREDICTED: protein DJ-1 homolog B-like [Setaria italica]
Length=463

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+ST RDCK LE++ KKQ E  +LYAAICA+PA+ALG+WGLL GLKA
Sbjct  148  MPGSSTFRDCKLLENMVKKQVEKGKLYAAICAAPAMALGTWGLLNGLKA  196


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPAVAL   GLLKG KA  S   MW
Sbjct  370  KKQAEANKLYGAICASPAVALEPHGLLKGKKA-TSYPAMW  408



>gb|EMS45695.1| hypothetical protein TRIUR3_12961 [Triticum urartu]
Length=526

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            MPG+  LRD + L+ I  +QAE K+LY AICA+PAV L  WGL KG K
Sbjct  80   MPGSVRLRDNEILQRIMVRQAEEKRLYGAICAAPAVVLMPWGLHKGRK  127



>ref|XP_006412285.1| hypothetical protein EUTSA_v10025121mg [Eutrema salsugineum]
 gb|ESQ53738.1| hypothetical protein EUTSA_v10025121mg [Eutrema salsugineum]
Length=467

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  150  MPGAVRLRDCGILEKIMKRQAEDKRLYGAISMAPAITLLPWGLL  193



>dbj|BAG16525.1| putative 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis 
enzyme [Capsicum chinense]
Length=392

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L +CK LESI KKQAE+ + YAAICA+PAVALGSWGLLKGLKA
Sbjct  78   LPGAANLGNCKILESIVKKQAENGKFYAAICAAPAVALGSWGLLKGLKA  126



>gb|AID60118.1| animal DJ-1 superfamily protein-like protein [Brassica napus]
 gb|AID60161.1| animal DJ-1 superfamily-like protein [Brassica napus]
Length=443

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  122  MPGAVRLRDCGALEKIMKRQAEEKRLYGAISMAPAMTLLPWGLL  165



>emb|CDY68228.1| BnaAnng26560D [Brassica napus]
Length=460

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  139  MPGAVRLRDCGALEKIMKRQAEEKRLYGAISMAPAMTLLPWGLL  182



>emb|CDY49268.1| BnaA03g50810D [Brassica napus]
Length=312

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            M GA  LRDC TLE I K+QAE K+LY AI  +PA+ L  WGLL
Sbjct  95   MSGAVRLRDCVTLEKIMKRQAEDKRLYRAISMAPAITLFPWGLL  138



>ref|XP_010279104.1| PREDICTED: protein DJ-1 homolog B-like [Nelumbo nucifera]
Length=436

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+TLRDC  LES+ KKQA   +LYAAICA+PAVAL SWG+LKGLKA
Sbjct  119  MPGAATLRDCAILESMVKKQAADGRLYAAICAAPAVALASWGVLKGLKA  167



>ref|XP_004359634.1| DJ-1/ThiJ/PfpI family protein [Dictyostelium fasciculatum]
 gb|EGG21784.1| DJ-1/ThiJ/PfpI family protein [Dictyostelium fasciculatum]
Length=193

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKG  199
            MPGA+ L +C+ L  + KKQ ES +LY AICA+PAV L   GLL G
Sbjct  75   MPGATHLSNCQILIDLLKKQKESGKLYGAICAAPAVVLAKHGLLDG  120



>ref|XP_002438499.1| hypothetical protein SORBIDRAFT_10g020910 [Sorghum bicolor]
 gb|EER89866.1| hypothetical protein SORBIDRAFT_10g020910 [Sorghum bicolor]
Length=443

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+ST RDCK LE++ KK  E  +LYAAICA+PA+ALG+WGLL GLKA
Sbjct  128  MPGSSTFRDCKVLENMVKKHVEKGKLYAAICAAPAMALGTWGLLNGLKA  176



>ref|XP_006660203.1| PREDICTED: protein DJ-1 homolog C-like [Oryza brachyantha]
Length=407

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  47   CVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            C    MPG+  LRD + L+ I  +QAE K+LY AICA+PAV L  WGL K
Sbjct  86   CQPGGMPGSVRLRDSEILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHK  135



>ref|WP_019366336.1| hypothetical protein [Pseudomonas luteola]
Length=184

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKG  199
            MPGA  L DC  L    ++  E  +LY AICA+PAV L  WGL++G
Sbjct  73   MPGAQRLADCTALRHFMRRHVEQGRLYGAICAAPAVILEPWGLVEG  118



>dbj|BAK06599.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            M G+  LRDCK LE + +K AES +L  AI ASPAVAL  WG+L+G +A
Sbjct  141  MVGSVNLRDCKQLEKMVRKHAESGRLCGAIGASPAVALAHWGVLQGFRA  189



>gb|KFK30030.1| hypothetical protein AALP_AA7G208500 [Arabis alpina]
Length=456

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRDC  LE I K+Q E K+LY AI  +PA+ L  WGLL
Sbjct  135  MPGAVRLRDCGVLEKIMKRQVEDKRLYGAISMAPAITLLPWGLL  178



>emb|CAN60391.1| hypothetical protein VITISV_006494 [Vitis vinifera]
Length=536

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGL  202
            MPGA+TL     LES+ KK A+  QLYA    +PAVALGSWGL+ G 
Sbjct  104  MPGAATLGAGDILESMVKKHADDGQLYAIFRVAPAVALGSWGLMHGF  150



>ref|XP_007042441.1| Class I glutamine amidotransferase-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX98272.1| Class I glutamine amidotransferase-like superfamily protein isoform 
1 [Theobroma cacao]
Length=480

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  KQAE K+LY  I  +PAV L  WGLL+
Sbjct  165  MPGSARLRDCEILKRITSKQAEEKRLYGGISMAPAVTLLPWGLLR  209



>ref|XP_007042442.1| Class I glutamine amidotransferase-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX98273.1| Class I glutamine amidotransferase-like superfamily protein isoform 
2 [Theobroma cacao]
Length=381

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC+ L+ I  KQAE K+LY  I  +PAV L  WGLL+
Sbjct  66   MPGSARLRDCEILKRITSKQAEEKRLYGGISMAPAVTLLPWGLLR  110



>gb|EEC79541.1| hypothetical protein OsI_20655 [Oryza sativa Indica Group]
Length=412

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRD   L+ I  +QAE K+LY AICA+PAV L  WGL K
Sbjct  96   MPGSVRLRDSAILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHK  140



>ref|WP_034401924.1| dihydroxyacetone kinase [Candidatus Scalindua brodae]
 gb|KHE93824.1| peptidase [Candidatus Scalindua brodae]
Length=182

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  LRD K L  +  +Q +  +L+AAICASPA+ L   GLL  LKA
Sbjct  73   MPGAERLRDSKELTELLTRQKQDGKLFAAICASPAIVLHHHGLLDDLKA  121



>ref|XP_008611948.1| hypothetical protein SDRG_07869 [Saprolegnia diclina VS20]
 gb|EQC34542.1| hypothetical protein SDRG_07869 [Saprolegnia diclina VS20]
Length=185

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ LRDC TL  + +KQ ES + Y AICA+PAV L +  LL G  A
Sbjct  74   LPGANHLRDCPTLIEMLRKQKESGKYYGAICAAPAVVLHTHNLLVGPSA  122



>ref|WP_004335279.1| thiazole biosynthesis protein ThiJ [Porphyromonas endodontalis]
 gb|EEN81925.1| DJ-1 family protein [Porphyromonas endodontalis ATCC 35406]
Length=184

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  5    RIKTKAKGKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSW  184
            R+    +G+   ++ +   +PGA  L D   L S+ ++Q E+ ++ AAICASPA  LG  
Sbjct  55   RVLADVEGQSPLAIVLPGGLPGAQNLHDTPALLSMIRRQLETSKVVAAICASPAFILGEE  114

Query  185  GLLKGLKA  208
            GLL+G KA
Sbjct  115  GLLQGKKA  122



>ref|WP_023408353.1| hypothetical protein [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ09397.1| hypothetical protein N839_01060 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=184

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWV  235
            +PGA  L+  K LE + K+Q +  + +AAICA+PAV L S GLL+G KA  + H M++
Sbjct  74   IPGAENLKKSKPLEKLLKRQHQQDKFFAAICAAPAVVLQSHGLLEGKKA--TCHPMFL  129



>gb|KEH30911.1| class I glutamine amidotransferase superfamily protein [Medicago 
truncatula]
Length=337

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  KQAE  +L+ AI A+PAV L  WGLLK
Sbjct  134  MPGSARLRDCDALRIITCKQAEENRLFGAINAAPAVTLLPWGLLK  178



>ref|NP_001169819.1| hypothetical protein [Zea mays]
 ref|XP_008645361.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34990.1| unknown [Zea mays]
 tpg|DAA48430.1| TPA: hypothetical protein ZEAMMB73_733589 [Zea mays]
Length=461

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGL  190
            MPG+  LRD   L+ I  +QAE K+LY AICA+PAV L  WGL
Sbjct  145  MPGSVRLRDSDILQRITVRQAEEKRLYGAICAAPAVVLVPWGL  187



>ref|XP_002287916.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95359.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=184

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            MPGA  LRD  TL SI +KQ  S +LY AICASPAV L + GL+
Sbjct  76   MPGAEHLRDSATLISILEKQKASGKLYGAICASPAVVLATKGLI  119



>gb|EEE64389.1| hypothetical protein OsJ_19231 [Oryza sativa Japonica Group]
Length=412

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRD   L+ I  +QAE K+LY AICA+PAV L  WGL K
Sbjct  96   MPGSVRLRDSVILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHK  140



>ref|XP_009529967.1| hypothetical protein PHYSODRAFT_545709 [Phytophthora sojae]
 gb|EGZ16218.1| hypothetical protein PHYSODRAFT_545709 [Phytophthora sojae]
Length=143

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   GKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            GK    + +   MPGA  LRD K + ++ +KQ E  +LY AICA+PAV L + GLL
Sbjct  18   GKSFDLVVIPGGMPGAEHLRDSKEVVTLLQKQKEDDKLYGAICAAPAVVLHTHGLL  73



>ref|XP_006657021.1| PREDICTED: protein DJ-1 homolog B-like [Oryza brachyantha]
Length=394

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+S LRDCK LE++ KK A   +LYAAICA+PAVALGSWGLL GLKA
Sbjct  79   MPGSSNLRDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKA  127


 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  301  KKQAEANKLYGAICASPAIALEPHGLLKGKKA-TSFPAMW  339



>gb|EEC80748.1| hypothetical protein OsI_23231 [Oryza sativa Indica Group]
Length=394

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+S LRDCK LE++ KK A   +LYAAICA+PAVALGSWGLL GLKA
Sbjct  79   MPGSSNLRDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKA  127


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  301  KKQAEANKLYGAICASPAIALEPHGLLKGKKA-TSFPGMW  339



>ref|NP_001057783.2| Os06g0531200 [Oryza sativa Japonica Group]
 dbj|BAD54224.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis 
enzyme [Oryza sativa Japonica Group]
 dbj|BAF19697.2| Os06g0531200 [Oryza sativa Japonica Group]
Length=394

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+S LRDCK LE++ KK A   +LYAAICA+PAVALGSWGLL GLKA
Sbjct  79   MPGSSNLRDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKA  127


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  KKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MW  232
            KKQAE+ +LY AICASPA+AL   GLLKG KA  S   MW
Sbjct  301  KKQAEANKLYGAICASPAIALEPHGLLKGKKA-TSFPGMW  339



>ref|XP_006645639.1| PREDICTED: protein DJ-1 homolog B-like [Oryza brachyantha]
Length=399

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ L  C  LE++ ++ A +  LY+AICA+P +AL SWGLL G KA
Sbjct  88   VPGAANLGGCAALEAVVRRHAATGGLYSAICAAPPLALASWGLLDGRKA  136



>gb|EEE65822.1| hypothetical protein OsJ_21561 [Oryza sativa Japonica Group]
Length=400

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPG+S LRDCK LE++ KK A   +LYAAICA+PAVALGSWGLL GLKA
Sbjct  85   MPGSSNLRDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKA  133



>gb|AAT69656.1| unknown protein, similar to DJ-1/PfpI family, PF01965 [Oryza 
sativa Japonica Group]
 gb|AAU93578.1| unknown protein [Oryza sativa Japonica Group]
Length=454

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRD   L+ I  +QAE K+LY AICA+PAV L  WGL K
Sbjct  138  MPGSVRLRDSVILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHK  182



>ref|XP_004973664.1| PREDICTED: protein DJ-1 homolog C-like [Setaria italica]
Length=453

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG+  LRD   L+ I  +QAE K+LY AICA+PAV L  WGL K
Sbjct  137  MPGSVRLRDSDILQRIMVRQAEEKRLYGAICAAPAVVLMPWGLHK  181



>ref|XP_003607957.1| Protein thiJ [Medicago truncatula]
 gb|AES90154.1| class I glutamine amidotransferase superfamily protein [Medicago 
truncatula]
Length=451

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPG++ LRDC  L  I  KQAE  +L+ AI A+PAV L  WGLLK
Sbjct  134  MPGSARLRDCDALRIITCKQAEENRLFGAINAAPAVTLLPWGLLK  178



>ref|WP_010795212.1| DJ-1 family protein [Pseudomonas sp. HPB0071]
 gb|ENA36818.1| DJ-1 family protein [Pseudomonas sp. HPB0071]
Length=184

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPGA  L DC  L    ++  E  +LY AICA+PAV L  WGL++
Sbjct  73   MPGAQRLADCTALRHFMRRHVEQGRLYGAICAAPAVILEPWGLVE  117



>dbj|GAK61017.1| hypothetical protein U27_00915 [bacterium UASB270]
Length=184

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = +2

Query  29   KLIWSLCVREK---------MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGS  181
            KLI S CV E          +PGA  LRD + L  + ++Q +  ++YAAICASP V L  
Sbjct  55   KLI-SECVHETYDVIALPGGIPGAEHLRDSEELIHMLRQQHQEGRIYAAICASPVVVLQH  113

Query  182  WGLLKGLKA  208
             GLL+G KA
Sbjct  114  HGLLQGKKA  122



>ref|WP_031450260.1| dihydroxyacetone kinase [Desulfobacula sp. TS]
Length=185

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            +PGA  LR+   LE + +KQAE K+ YAAICASPAV L   GL+
Sbjct  73   IPGAQNLRNSTELEILLRKQAELKKYYAAICASPAVVLHHHGLV  116



>gb|ACS87902.1| putative 4-methyl-5-thiazole monophosphate synthesis protein 
[Leptomonas seymouri]
Length=196

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAI  211
            MPGA TL   + L+ I +K     +LY AICA+PAVALG  GLL+G++ +
Sbjct  72   MPGAETLGKSEDLKKIMQKIRSQNKLYGAICAAPAVALGPMGLLEGVETV  121



>ref|XP_002980406.1| hypothetical protein SELMODRAFT_112362 [Selaginella moellendorffii]
 gb|EFJ18666.1| hypothetical protein SELMODRAFT_112362 [Selaginella moellendorffii]
Length=390

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  LRD K L+SI  +QA+  ++Y AICASPAV L +  +L G KA
Sbjct  279  MPGAEHLRDSKELQSILARQAKDSRVYGAICASPAVVLEANKILAGKKA  327



>ref|XP_002962689.1| hypothetical protein SELMODRAFT_227351 [Selaginella moellendorffii]
 gb|EFJ36152.1| hypothetical protein SELMODRAFT_227351 [Selaginella moellendorffii]
Length=436

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA  LRD K L+SI  +QA+  ++Y AICASPAV L +  +L G KA
Sbjct  325  MPGAEHLRDSKELQSILARQAKDSRVYGAICASPAVVLEANKILAGKKA  373



>gb|KDO34253.1| hypothetical protein SPRG_19083 [Saprolegnia parasitica CBS 223.65]
Length=187

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PGA+ LRDC  L  + +KQ ES + Y AICA+PAV L +  LL G  A
Sbjct  76   LPGANHLRDCPALIEMLRKQKESGKYYGAICAAPAVVLHTHNLLVGPSA  124



>gb|ETI53651.1| hypothetical protein F443_03427 [Phytophthora parasitica P1569]
 gb|ETL86651.1| hypothetical protein L917_13954 [Phytophthora parasitica]
 gb|ETM39819.1| hypothetical protein L914_14077 [Phytophthora parasitica]
 gb|ETO82336.1| hypothetical protein F444_03496 [Phytophthora parasitica P1976]
 gb|ETP51464.1| hypothetical protein F442_03396 [Phytophthora parasitica P10297]
Length=211

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   GKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            GK    + +   MPGA  LRD K + ++ +KQ E  +LY AICA+PAV L + GLL
Sbjct  86   GKSYDLVVIPGGMPGAEHLRDSKEVVALLQKQKEDGKLYGAICAAPAVVLHTHGLL  141



>ref|XP_008910325.1| hypothetical protein PPTG_15071 [Phytophthora parasitica INRA-310]
 gb|ETK93524.1| hypothetical protein L915_03302 [Phytophthora parasitica]
 gb|ETL46920.1| hypothetical protein L916_03269 [Phytophthora parasitica]
 gb|ETN04398.1| hypothetical protein PPTG_15071 [Phytophthora parasitica INRA-310]
 gb|ETP23457.1| hypothetical protein F441_03413 [Phytophthora parasitica CJ01A1]
Length=211

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   GKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            GK    + +   MPGA  LRD K + ++ +KQ E  +LY AICA+PAV L + GLL
Sbjct  86   GKSYDLVVIPGGMPGAEHLRDSKEVVALLQKQKEDGKLYGAICAAPAVVLHTHGLL  141



>ref|XP_002908746.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY57560.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=143

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   GKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            GK    + +   MPGA  LRD   + ++ +KQ E  +LY AICA+PAV L + GLL
Sbjct  18   GKSFDLIVIPGGMPGAEHLRDSNEVVALLQKQKEDGKLYGAICAAPAVVLHTHGLL  73



>ref|WP_020583181.1| hypothetical protein [Endozoicomonas elysicola]
 gb|KEI71565.1| hypothetical protein GV64_13170 [Endozoicomonas elysicola]
Length=192

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  26   GKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            GK    + +   MPGA  L+DC  L S+   Q ++ + YAAICASPAV L   GLL    
Sbjct  64   GKPFHLIALPGGMPGAENLKDCAPLISLLHDQQKAGKWYAAICASPAVVLSHHGLLDNTH  123

Query  206  A  208
            A
Sbjct  124  A  124



>ref|WP_012071697.1| protease [Marinomonas sp. MWYL1]
 ref|YP_001342867.1| DJ-1 family protein [Marinomonas sp. MWYL1]
 gb|ABR72932.1| DJ-1 family protein [Marinomonas sp. MWYL1]
Length=183

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  14   TKAKGKLIWSLCVREKMPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            T+   ++  ++ +   MPGA  LRDC+ L  I +K      L AAICASPAV  G+ G +
Sbjct  57   TEVGEQIFDAVVLAGGMPGAEHLRDCELLIDILEKHDIQDALLAAICASPAVVFGTHGFV  116



>emb|CBJ30585.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis 
protein, putative [Ectocarpus siliculosus]
Length=238

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA +L++ +TLE+I +KQ    ++  AICA+PAV L S GLL+G +A
Sbjct  128  MPGAVSLKENETLEAILRKQNSEGRIVGAICAAPAVVLASHGLLEGKQA  176



>ref|XP_002177693.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50507.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=191

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +2

Query  38   WSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            W L V    MPGA  LRD K L  + +KQ    +LY AICA+PAVAL   GL+
Sbjct  66   WDLVVLPGGMPGAEHLRDSKPLIQLLEKQKSQGKLYGAICAAPAVALAPHGLI  118



>ref|WP_034873051.1| hypothetical protein [Endozoicomonas montiporae]
 gb|KEQ15777.1| hypothetical protein GZ77_04305 [Endozoicomonas montiporae]
Length=193

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            MPGA+ LRDC+ L  +  +Q ++ + YAAICA+PAV L    LL  + A
Sbjct  76   MPGAANLRDCEPLIQLLHEQQQADRWYAAICAAPAVVLAHHSLLDNVSA  124



>ref|WP_028585375.1| dihydroxyacetone kinase [Desulfobulbus mediterraneus]
Length=185

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKAIISTH*MWV  235
            +PGA  L+  K L  I K+Q    +LYAAICASPAV L   GLL+G +A  + H +++
Sbjct  73   IPGAENLQSSKPLIEILKRQNTQGKLYAAICASPAVVLQPHGLLEGKRA--TCHPLFI  128



>ref|WP_022668146.1| thiazole biosynthesis protein ThiJ [Desulfospira joergensenii]
Length=182

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            +PGA  L+  K LE + KKQAE ++ Y AICASPAV L   GL++
Sbjct  73   IPGAMNLQKSKELEILLKKQAEKEKYYGAICASPAVVLHHHGLVR  117



>ref|XP_010675431.1| PREDICTED: protein DJ-1 homolog B-like [Beta vulgaris subsp. 
vulgaris]
Length=301

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +2

Query  38   WSLCVREK--MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            W+L  R+   MPGA+TL++  TL S+ +KQA   +L+AAICA+PAVALGSWGLLKGLKA
Sbjct  95   WNLRTRKYFGMPGATTLKESATLRSMVEKQAADGRLHAAICAAPAVALGSWGLLKGLKA  153



>dbj|GAM18592.1| hypothetical protein SAMD00019534_017670, partial [Acytostelium 
subglobosum LB1]
Length=216

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLK  196
            MPGA  L  C TL ++   Q ES +LY AICASPAV L    LL 
Sbjct  76   MPGADNLSKCSTLITLLNNQKESNRLYGAICASPAVVLAQHNLLN  120



>ref|WP_014957054.1| thiazole biosynthesis protein ThiJ [Desulfobacula toluolica]
 ref|YP_006760414.1| DJ-1 family protein [Desulfobacula toluolica Tol2]
 emb|CCK79710.1| DJ-1 family protein [Desulfobacula toluolica Tol2]
Length=185

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLL  193
            +PGA  LR+   LE + KKQA+ ++ YAAICASPAV L   GL+
Sbjct  73   IPGAQNLRNSTELEILLKKQAKLEKYYAAICASPAVVLHHHGLV  116



>ref|XP_007149405.1| hypothetical protein PHAVU_005G067500g [Phaseolus vulgaris]
 gb|ESW21399.1| hypothetical protein PHAVU_005G067500g [Phaseolus vulgaris]
Length=437

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG   LRDCK LE + KK  E  +LYAA+CA+PAV LG WGLL GLKA
Sbjct  119  IPGVENLRDCKVLEGLVKKHVEEGRLYAAVCAAPAVVLGPWGLLNGLKA  167


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA    + +TL ++ KKQ ES + Y AICASPA+ L   GLLKG KA
Sbjct  327  GAQAFANSETLVNLLKKQRESNKYYGAICASPALVLEPHGLLKGKKA  373



>gb|KHN36876.1| Chaperone protein YajL [Glycine soja]
Length=394

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  29   KLIWSLCVREK-MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLK  205
            KL + L V    + GA T  + +TL S+ KKQ ES + Y AICASPA+ L   GLLKG K
Sbjct  270  KLSYDLIVLPGGLGGAQTFANSETLVSLLKKQRESNKYYGAICASPALVLEPHGLLKGKK  329

Query  206  A  208
            A
Sbjct  330  A  330



>gb|AHA84127.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis 
protein [Phaseolus vulgaris]
Length=437

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  62   MPGASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            +PG   LRDCK LE + KK  E  +LYAA+CA+PAV LG WGLL GLKA
Sbjct  119  IPGVENLRDCKVLEGLVKKHVEEGRLYAAVCAAPAVVLGPWGLLNGLKA  167


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  68   GASTLRDCKTLESINKKQAESKQLYAAICASPAVALGSWGLLKGLKA  208
            GA    + +TL ++ KKQ ES + Y AICASPA+ L   GLLKG KA
Sbjct  327  GAQAFANSETLVNLLKKQRESNKYYGAICASPALVLEPHGLLKGKKA  373



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513730317888