BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25313_g5_i8 len=1681 path=[19371:0-118 4072:119-145 4099:146-852
2946:853-1172 1442:1173-1184 5135:1185-1216 18215:1217-1247
22758:1248-1251 22762:1252-1252 22763:1253-1262 22773:1263-1268
5214:1269-1269 5215:1270-1281 22790:1282-1293 18129:1294-1302
1967:1303-1303 1968:1304-1315 5237:1316-1355 5277:1356-1478
5400:1479-1680]

Length=1681
                                                                      Score     E

ref|XP_009603556.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    603   0.0      
ref|XP_009765543.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    600   0.0      
ref|XP_004232488.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    593   0.0      
gb|AAC49929.1|  flavanone 3beta-hydroxylase                             593   0.0      Petunia x hybrida [garden petunia]
dbj|BAA75309.1|  flavanone 3-hydroxyrase                                590   0.0      Ipomoea batatas [batate]
dbj|BAA75308.1|  flavanone 3-hydroxyrase                                590   0.0      Ipomoea batatas [batate]
gb|AID50182.1|  flavanone 3-hydroxylase                                 590   0.0      
sp|Q07353.1|FL3H_PETHY  RecName: Full=Naringenin,2-oxoglutarate 3...    589   0.0      Petunia x hybrida [garden petunia]
dbj|BAA75307.1|  fravanone 3-hydroxyrase                                589   0.0      Ipomoea batatas [batate]
gb|ACT31918.1|  flavanone 3-hydroxyrase                                 588   0.0      
dbj|BAK78918.1|  flavanone 3-hydroxylase                                587   0.0      
dbj|BAC10996.1|  flavanone 3-hydroxylase                                586   0.0      Nierembergia sp. NB17
ref|NP_001274930.1|  flavanone 3 beta-hydroxylase                       585   0.0      
gb|AIY22755.1|  flavanone 3-hydroxylase                                 585   0.0      
gb|AIY22754.1|  flavanone 3-hydroxylase                                 585   0.0      
gb|AAX63401.1|  flavanone 3 beta-hydroxylase                            585   0.0      Solanum pinnatisectum
dbj|BAL43067.1|  flavanone 3-hydroxylase                                585   0.0      
gb|AFN70721.1|  flavanone 3-hydroxylase                                 584   0.0      
ref|NP_001268034.1|  naringenin,2-oxoglutarate 3-dioxygenase            583   0.0      
gb|AEN83504.1|  flavanone 3 beta-hydroxylase                            583   0.0      
dbj|BAD34459.1|  flavanone 3-hydroxylase                                582   0.0      Eustoma exaltatum subsp. russellianum [bluebells]
gb|ABL74481.1|  flavanone 3-hydroxyrase                                 582   0.0      Ipomoea batatas [batate]
ref|NP_001275816.1|  naringenin,2-oxoglutarate 3-dioxygenase-like       582   0.0      
gb|AIY22753.1|  flavanone 3-hydroxylase                                 582   0.0      
ref|XP_006425499.1|  hypothetical protein CICLE_v10025931mg             582   0.0      
dbj|BAA21897.1|  flavanone 3-hydroxylase                                581   0.0      Ipomoea nil [qian niu]
ref|XP_007156141.1|  hypothetical protein PHAVU_003G261900g             581   0.0      
gb|ADB92595.1|  flavanone 3-hydroxylase                                 580   0.0      Citrus maxima [buntan]
gb|KDO71174.1|  hypothetical protein CISIN_1g017946mg                   580   0.0      
emb|CDP01900.1|  unnamed protein product                                580   0.0      
dbj|BAK78917.1|  flavanone 3-hydroxylase                                580   0.0      
gb|ABO48521.1|  flavanone-3-hydroxylase                                 580   0.0      Dimocarpus longan [longan]
emb|CAN61951.1|  hypothetical protein VITISV_003886                     580   0.0      Vitis vinifera
gb|ABM64799.1|  flavanone-3-hydroxylase                                 579   0.0      Gossypium hirsutum [American cotton]
gb|AEN71544.1|  flavanone 3-hydroxylase                                 578   0.0      
gb|ABL86673.1|  F3H                                                     579   0.0      Gossypium barbadense [Egyptian cotton]
gb|KHG27094.1|  Naringenin,2-oxoglutarate 3-dioxygenase -like pro...    579   0.0      
gb|ABA01482.1|  gibberellin 20-oxidase 1                                578   0.0      Gossypium hirsutum [American cotton]
gb|AAB41102.1|  flavanone 3-hydroxylase                                 578   0.0      Ipomoea purpurea
gb|ABW69678.1|  flavanone 3-hydroxylase                                 578   0.0      Ipomoea purpurea
gb|AIU98512.1|  flavanone 3-hydroxylase                                 577   0.0      
gb|ABW69679.1|  flavanone 3-hydroxylase                                 577   0.0      Ipomoea purpurea
ref|XP_007046697.1|  Flavanone 3-hydroxylase isoform 1                  577   0.0      
gb|ACQ99190.1|  flavanone-3-hydroxylase                                 576   0.0      
sp|Q7XZQ7.1|FL3H_PETCR  RecName: Full=Flavanone 3-dioxygenase; Al...    576   0.0      Petroselinum crispum
gb|KDO71175.1|  hypothetical protein CISIN_1g017946mg                   576   0.0      
gb|ABW69692.1|  flavanone 3-hydroxylase                                 576   0.0      Ipomoea nil [qian niu]
gb|ADO95201.1|  flavanone 3-hydroxylase                                 575   0.0      
dbj|BAM42670.1|  flavanone3-hydroxylase                                 575   0.0      
gb|KDP46752.1|  hypothetical protein JCGZ_06540                         575   0.0      
gb|ACR77526.1|  flavanone 3-hydroxylase                                 574   0.0      Citrus maxima [buntan]
gb|KFK34366.1|  hypothetical protein AALP_AA5G136000                    573   0.0      
ref|XP_006292468.1|  hypothetical protein CARUB_v10018698mg             573   0.0      
ref|XP_011043191.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    573   0.0      
gb|AHY35311.1|  flavanone 3-hydroxylase 1                               573   0.0      
ref|XP_002876075.1|  flavanone 3-hydroxylase                            572   0.0      
ref|XP_006383106.1|  hypothetical protein POPTR_0005s11600g             572   0.0      
gb|ABX74780.1|  flavanone-3-hydroxylase                                 572   0.0      Rubus sp. SSL-2007
ref|NP_001236797.1|  flavanone 3-hydroxylase                            573   0.0      
gb|AEF14415.1|  flavanone 3-hydroxylase                                 572   0.0      
gb|ABK94757.1|  unknown                                                 572   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011043195.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    572   0.0      
ref|XP_010113349.1|  Naringenin,2-oxoglutarate 3-dioxygenase            572   0.0      
ref|XP_010268217.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    572   0.0      
gb|AEO36935.1|  F3H                                                     572   0.0      
ref|NP_190692.1|  flavanone 3-hydroxylase                               571   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275563.1|  PREDICTED: flavanone 3-dioxygenase                 571   0.0      Vitis vinifera
dbj|BAD91806.1|  flavanone 3-hydroxylase                                571   0.0      Gentiana triflora
ref|XP_006383107.1|  hypothetical protein POPTR_0005s11610g             570   0.0      
ref|XP_006403939.1|  hypothetical protein EUTSA_v10010399mg             573   0.0      
ref|XP_010550464.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    570   0.0      
gb|ACA81443.1|  flavanone 3-hydroxylase                                 571   0.0      Glycine soja [wild soybean]
ref|XP_003629323.1|  Naringenin,2-oxoglutarate 3-dioxygenase            570   0.0      
gb|AAC49176.1|  flavanone 3-hydroxylase                                 570   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABB91635.1|  flavanone 3-hydroxylase 1                               569   0.0      Brassica napus [oilseed rape]
gb|ACL54955.1|  flavanone 3-hydroxylase                                 570   0.0      Actinidia chinensis
gb|AFK41061.1|  unknown                                                 569   0.0      
gb|KHG28485.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 569   0.0      
gb|AHZ31752.1|  flavanone 3-hydroxylase                                 569   0.0      
sp|Q05965.1|FL3H_MATIN  RecName: Full=Naringenin,2-oxoglutarate 3...    569   0.0      Matthiola incana
gb|ACA81448.1|  flavanone 3-hydroxylase                                 569   0.0      Glycine soja [wild soybean]
dbj|BAD91807.1|  flavanone 3-hydroxylase                                569   0.0      Gentiana triflora
gb|ABW74548.1|  Flavanone-3-hydroxylase                                 569   0.0      Rubus coreanus [cha tian pao]
ref|XP_010515520.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    568   0.0      
gb|ACA81455.1|  flavanone 3-hydroxylase                                 569   0.0      Glycine soja [wild soybean]
gb|AEK99074.1|  flavanone 3 beta-hydroxylase                            568   0.0      
gb|AAM65101.1|  flavanone 3-hydroxylase FH3                             568   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACA81430.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine max [soybeans]
gb|ACA81431.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine soja [wild soybean]
gb|ACA81453.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine max [soybeans]
dbj|BAD89980.1|  mutant protein of flavanone-3-hydroxylase              568   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACM62745.1|  flavanone-3-hydroxylase                                 568   0.0      Garcinia mangostana [mangosteen]
gb|ACA81441.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine soja [wild soybean]
gb|ACA81452.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine soja [wild soybean]
gb|ACA81445.1|  flavanone 3-hydroxylase                                 568   0.0      Glycine max [soybeans]
ref|XP_011043194.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    567   0.0      
ref|XP_009115799.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    567   0.0      
gb|AHZ97872.1|  flavanone 3-hydroxylase                                 567   0.0      
gb|ACA81446.1|  flavanone 3-hydroxylase                                 567   0.0      Glycine soja [wild soybean]
gb|ACA81454.1|  flavanone 3-hydroxylase                                 567   0.0      Glycine max [soybeans]
gb|ACA81440.1|  flavanone 3-hydroxylase                                 567   0.0      Glycine soja [wild soybean]
gb|AIB06739.1|  flavanone 3-hydroxylase-2                               566   0.0      
gb|ACA81458.1|  flavanone 3-hydroxylase                                 566   0.0      Glycine soja [wild soybean]
gb|AAX21540.1|  flavanone-3-beta-hydroxylase                            566   0.0      Anethum graveolens
gb|ACA81433.1|  flavanone 3-hydroxylase                                 566   0.0      Glycine soja [wild soybean]
gb|ACA81447.1|  flavanone 3-hydroxylase                                 566   0.0      Glycine soja [wild soybean]
gb|AFI71897.1|  flavanone 3-hydroxylase                                 566   0.0      
ref|XP_003520255.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    566   0.0      
gb|AAU04792.1|  flavanone 3-hydroxylase                                 565   0.0      Fragaria x ananassa
gb|ACA81437.1|  flavanone 3-hydroxylase                                 566   0.0      Glycine max [soybeans]
gb|AIB06738.1|  flavanone 3-hydroxylase-1                               565   0.0      
gb|ACA81438.1|  flavanone 3-hydroxylase                                 566   0.0      Glycine max [soybeans]
ref|XP_010033486.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    565   0.0      
ref|XP_010268688.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    565   0.0      
gb|ACA81439.1|  flavanone 3-hydroxylase                                 565   0.0      Glycine max [soybeans]
gb|ABK96090.1|  unknown                                                 564   0.0      Populus trichocarpa [western balsam poplar]
gb|ACA81429.1|  flavanone 3-hydroxylase                                 564   0.0      Glycine max [soybeans]
gb|ADZ28514.1|  flavanone 3-hydroxylase                                 563   0.0      
ref|XP_004287814.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    563   0.0      
emb|CDX90656.1|  BnaA03g41250D                                          563   0.0      
ref|XP_010426669.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    563   0.0      
sp|P41090.1|FL3H_VITVI  RecName: Full=Naringenin,2-oxoglutarate 3...    563   0.0      Vitis vinifera
gb|ABF60660.1|  flavanone 3-hydroxylase 2                               562   0.0      Brassica napus [oilseed rape]
gb|AGS57503.1|  flavanone 3-hydroxylase                                 563   0.0      
ref|XP_004509357.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    562   0.0      
gb|AFL47799.1|  flavanone 3 beta-hydroxylase                            562   0.0      
gb|AFC37250.1|  flavanone 3-hydroxylase                                 562   0.0      
gb|AAX21539.1|  flavanone-3-beta-hydroxylase                            562   0.0      Ammi majus [ameo mayor]
gb|AAU04791.1|  flavanone 3-hydroxylase                                 562   0.0      Fragaria x ananassa
gb|AAT68774.1|  flavanone 3-hydroxylase                                 562   0.0      Camellia sinensis [black tea]
gb|ADY02649.1|  flavanone 3-hydroxylase                                 561   0.0      
gb|ACA81428.1|  flavanone 3-hydroxylase                                 561   0.0      Glycine soja [wild soybean]
gb|AAX21535.1|  flavanone-3-beta-hydroxylase                            560   0.0      Pimpinella anisum
gb|ACA81432.1|  flavanone 3-hydroxylase                                 560   0.0      Glycine max [soybeans]
gb|ABG78794.1|  flavanone 3 beta-hydroxylase                            560   0.0      Pimpinella anisum
dbj|BAF49292.1|  naringenin 2-oxoglutarate 3-dioxygenase                560   0.0      Clitoria ternatea
ref|XP_010679937.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    560   0.0      
gb|ABG78792.1|  flavanone 3 beta-hydroxylase                            560   0.0      Aethusa cynapium
emb|CDY29008.1|  BnaC07g32140D                                          559   0.0      
gb|ADY02650.1|  flavanone 3-hydroxylase                                 560   0.0      
ref|XP_006574482.1|  PREDICTED: flavanone 3-hydroxylase isoform X1      558   0.0      
gb|ACA81427.1|  flavanone 3-hydroxylase                                 559   0.0      Glycine max [soybeans]
emb|CAD37982.1|  flavanone-3-hydroxylase                                557   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAD37971.1|  flavanone-3-hydroxylase                                557   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAC26921.1|  flavanone-3-hydroxylase                                556   0.0      Arabidopsis lyrata subsp. petraea
emb|CAD37956.1|  flavanone-3-hydroxylase                                556   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ADY02652.1|  flavanone 3-hydroxylase                                 557   0.0      
gb|AAD56577.1|AF184270_1  flavanone 3-hydroxylase                       556   0.0      Daucus carota [carrots]
ref|XP_010503810.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    556   0.0      
emb|CAD37954.1|  flavanone-3-hydroxylase                                555   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ADT63064.1|  flavones 3-hydroxylase                                  556   0.0      
emb|CAD37979.1|  flavanone-3-hydroxylase                                555   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAD37953.1|  flavanone-3-hydroxylase                                555   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABY63660.1|  flavonoid 3-hydroxylase                                 555   0.0      Epimedium sagittatum
gb|AGC74052.1|  flavanone 3-hydroxylase                                 555   0.0      
emb|CAC26959.1|  flavanone-3-hydroxylase                                554   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAC26942.1|  flavanone-3-hydroxylase                                553   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AGL50918.1|  flavanone 3-hydroxylase                                 553   0.0      
ref|XP_008241821.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    553   0.0      
gb|AFR31807.1|  flavanone 3-hydroxylase                                 553   0.0      
gb|AAX89397.1|  flavanon 3 beta-hydroxylase                             553   0.0      Malus domestica [apple tree]
gb|AEF30420.1|  flavones 3-hydroxylase                                  553   0.0      
sp|Q06942.1|FL3H_MALDO  RecName: Full=Naringenin,2-oxoglutarate 3...    553   0.0      Malus domestica [apple tree]
ref|XP_009136604.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    552   0.0      
ref|XP_007202107.1|  hypothetical protein PRUPE_ppa007636mg             552   0.0      
emb|CAC26949.1|  flavanone-3-hydroxylase                                551   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAC26952.1|  flavanone-3-hydroxylase                                551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382400.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    552   0.0      
ref|XP_004512134.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    551   0.0      
gb|ADZ54782.1|  naringenin 3-dioxygenase                                551   0.0      
ref|XP_006574679.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    552   0.0      
gb|AAX89399.1|  flavanon 3 beta-hydroxylase                             551   0.0      Pyrus communis
emb|CAC26955.1|  flavanone-3-hydroxylase                                550   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280854.1|  naringenin,2-oxoglutarate 3-dioxygenase            550   0.0      
gb|AGL81347.1|  flavanone 3-hydroxylase                                 550   0.0      
gb|AAR01566.1|  flavanone 3-hydroxylase                                 550   0.0      Sinningia cardinalis
gb|AEO79981.1|  flavanone 3-hydroxylase                                 549   0.0      
ref|XP_003629320.1|  Flavanone 3-hydroxylase                            549   0.0      
gb|AAM18084.1|  flavanone 3-hydroxylase                                 549   0.0      Pyrus communis
gb|EYU36787.1|  hypothetical protein MIMGU_mgv1a008982mg                548   0.0      
gb|ADP09378.1|  flavanone 3-hydroxylase                                 547   0.0      
gb|AGZ15309.1|  flavanone 3-hydroxylase                                 546   0.0      
gb|AGD99671.1|  flavonoid 3' hydroxylase                                546   0.0      
ref|NP_001280883.1|  naringenin,2-oxoglutarate 3-dioxygenase-like       546   0.0      
ref|XP_004509358.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    546   0.0      
gb|ACR47976.1|  flavanone 3-hydroxylase                                 545   0.0      Juglans regia
ref|XP_009409832.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    546   0.0      
gb|ADP08986.1|  flavanone 3-hydroxylase                                 546   0.0      
gb|AGZ15308.1|  flavanone 3-hydroxylase                                 545   0.0      
ref|XP_010934537.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    544   0.0      
ref|XP_009363496.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    543   0.0      
sp|Q05964.1|FL3H_DIACA  RecName: Full=Naringenin,2-oxoglutarate 3...    542   0.0      Dianthus caryophyllus [carnation]
dbj|BAE79203.1|  flavanone 3-hidroxylase                                542   0.0      Lilium speciosum
dbj|BAM28970.1|  flavanone 3-hydroxylase                                542   0.0      
gb|AAS20189.1|  flavanone-3-hydroxylase                                 541   0.0      Gypsophila paniculata
gb|AAP20865.1|  putative flavonoid 3-hydroxylase                        542   0.0      Anthurium andraeanum [flamingo-lily]
gb|ABI50233.1|  flavanone 3-hydroxylase                                 542   0.0      Anthurium andraeanum [flamingo-lily]
ref|XP_008777191.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    542   0.0      
ref|XP_010940993.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    541   0.0      
gb|AIS35916.1|  flavanone 3-hydroxylase                                 538   0.0      
gb|AGT79807.1|  flavanone 3-hydroxylase                                 538   0.0      
emb|CAA57410.1|  flavonone-3-hydroxylase                                537   0.0      Medicago sativa [alfalfa]
dbj|BAD86791.1|  Flavanone 3-hydroxylase                                537   0.0      Iris x hollandica [Dutch iris]
gb|AGJ50588.1|  F3H1                                                    535   0.0      
ref|XP_002448703.1|  hypothetical protein SORBIDRAFT_06g031790          535   0.0      Sorghum bicolor [broomcorn]
emb|CAA55628.1|  flavanone-3-hydroxylase                                534   0.0      Medicago sativa [alfalfa]
gb|AIC32296.1|  flavanone 3-hydroxylase                                 533   0.0      
ref|XP_003547939.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    534   0.0      
ref|XP_008791262.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    534   0.0      
ref|XP_011083555.1|  PREDICTED: flavanone 3-dioxygenase                 533   0.0      
gb|AAB97310.1|  flavanone 3-hydroxylase                                 532   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEY81365.1|  flavanone 3-hydroxylase                                 532   0.0      
gb|AFI08246.1|  F3H                                                     532   0.0      
gb|AAO63022.1|  flavanone 3-hydroxylase                                 532   0.0      Allium cepa
gb|AGY46122.1|  flavanone 3-hydroxylase                                 532   0.0      
dbj|BAJ21534.1|  flavanone-3-hydroxylase                                531   0.0      
gb|AEP37359.1|  flavanone 3-hydroxylase                                 529   0.0      
emb|CAA61486.1|  naringenin 3-dioxygenase                               529   0.0      Bromheadia finlaysoniana
dbj|BAF44478.1|  flavanone 3-hydroxylase                                529   0.0      Iris x hollandica [Dutch iris]
gb|AAC97525.1|  flavanone 3-hydroxylase                                 529   0.0      Persea americana
dbj|BAE72878.1|  flavanone 3-hydroxylase                                529   0.0      Glandularia x hybrida [garden verbena]
gb|ABP57073.1|  flavanone 3-hydroxylase                                 528   0.0      Plectranthus scutellarioides
gb|ADB66755.1|  flavanone 3-hydroxylase                                 529   0.0      Sorghum bicolor [broomcorn]
dbj|BAJ17667.1|  flavanone 3-hydroxylase                                528   0.0      
ref|NP_001130275.1|  uncharacterized protein LOC100191369               528   0.0      Zea mays [maize]
ref|XP_003612166.1|  Flavanone-3-hydroxylase                            526   0.0      
gb|KHN36033.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 526   1e-180   
ref|XP_003517175.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    526   1e-180   
gb|ABP57075.1|  flavanone 3-hydroxylase                                 526   1e-180   Plectranthus scutellarioides
tpg|DAA35528.1|  TPA: flavanone 3-hydroxylase1                          527   3e-180   
gb|AHJ80978.1|  flavanone 3-hydroxylase                                 525   3e-180   
gb|AFI08245.1|  F3H                                                     523   2e-179   
ref|XP_010245069.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    522   2e-179   
gb|AEP17012.1|  flavanone 3-hydroxylase                                 522   3e-179   
gb|AAC15414.1|  flavanone 3-hydroxylase                                 530   2e-178   Nicotiana tabacum [American tobacco]
gb|AAX21536.1|  flavone synthase I                                      520   3e-178   Daucus carota [carrots]
gb|EYU38809.1|  hypothetical protein MIMGU_mgv1a008381mg                520   5e-178   
gb|ABG78791.1|  flavone synthase I                                      518   7e-178   Aethusa cynapium
gb|ABG78793.1|  flavone synthase I                                      519   7e-178   Angelica archangelica [wild parsnip]
dbj|BAH36892.1|  flavanone 3-hydroxylase                                518   2e-177   Triticum aestivum [Canadian hard winter wheat]
sp|Q05963.1|FL3H_CALCH  RecName: Full=Naringenin,2-oxoglutarate 3...    518   2e-177   Callistephus chinensis [Chinese aster]
dbj|BAH36894.1|  flavanone 3-hydroxylase                                518   2e-177   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001266318.1|  naringenin,2-oxoglutarate 3-dioxygenase            518   2e-177   
gb|ABB60206.1|  flavanone 3-hydroxylase                                 518   3e-177   Triticum aestivum [Canadian hard winter wheat]
gb|EMT32361.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 518   3e-177   
gb|ABB60207.1|  flavanone 3-hydroxylase                                 517   3e-177   Aegilops tauschii
gb|ACH72669.1|  flavanone 3-dioxygenase                                 517   4e-177   Triticum aestivum [Canadian hard winter wheat]
gb|ABG78795.1|  flavone synthase I                                      516   5e-177   Conium maculatum [fool's-parsley]
gb|ABR13013.1|  flavanone 3-hydroxylase                                 517   7e-177   Triticum aestivum [Canadian hard winter wheat]
dbj|BAA19657.1|  flavanone 3-hydroxylase                                516   9e-177   Perilla frutescens [beefsteak-mint]
ref|XP_006852053.1|  hypothetical protein AMTR_s00041p00221250          516   1e-176   
gb|AGT56411.1|  flavanone 3-hydroxylase                                 516   1e-176   
gb|ABG78790.1|  flavone synthase I                                      515   2e-176   Cuminum cyminum [cumin]
ref|NP_001105695.1|  flavanone 3-hydroxylase1                           515   2e-176   Zea mays [maize]
ref|XP_004960184.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    514   5e-176   
gb|AFO84097.1|  flavanone 3-hydroxylase                                 511   6e-176   
gb|AII32446.1|  flavanone-3-hydroxylase                                 513   8e-176   
gb|ACB56921.1|  flavanone-3-beta-hydroxylase                            513   8e-176   Pilosella officinarum [mouse-ear hawkweed]
gb|AGL98408.1|  flavanone 3-hydroxylase                                 512   1e-175   
sp|P28038.1|FL3H_HORVU  RecName: Full=Naringenin,2-oxoglutarate 3...    513   2e-175   Hordeum vulgare [barley]
gb|AAX21537.1|  flavone synthase I                                      511   3e-175   Apium graveolens
dbj|BAH36893.1|  flavanone 3-hydroxylase                                512   5e-175   Triticum aestivum [Canadian hard winter wheat]
gb|AAX21538.1|  flavone synthase I                                      511   7e-175   Conium maculatum [fool's-parsley]
sp|Q7XZQ8.1|FNSI_PETCR  RecName: Full=Flavone synthase; AltName: ...    511   1e-174   Petroselinum crispum
gb|ADX68826.1|  flavanone 3-hydroxylase                                 506   7e-174   
ref|XP_010649034.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    508   1e-173   
ref|XP_004146140.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    506   2e-173   
gb|ACH42080.1|  flavanone 3-hydroxylase                                 508   3e-173   Hordeum vulgare [barley]
ref|XP_006653847.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    507   4e-173   
gb|EEC78186.1|  hypothetical protein OsI_17790                          506   7e-173   Oryza sativa Indica Group [Indian rice]
emb|CAN70236.1|  hypothetical protein VITISV_022093                     505   2e-172   Vitis vinifera
gb|KEH34044.1|  naringenin 3-dioxygenase (flavanone-3-hydroxylase)      504   3e-172   
emb|CAE04838.2|  OSJNBa0084K01.10                                       504   4e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579435.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    503   8e-172   
gb|AEG64806.1|  flavanone 3-hvdroxylase                                 502   3e-171   
ref|XP_006403940.1|  hypothetical protein EUTSA_v10010399mg             502   3e-171   
gb|ADX68828.1|  flavanone 3-hydroxylase                                 498   8e-171   
gb|ADX68824.1|  flavanone 3-hydroxylase                                 497   2e-170   
gb|ADX68825.1|  flavanone 3-hydroxylase                                 496   7e-170   
dbj|BAQ19355.1|  flavanone 3-hydroxylase                                497   3e-169   
gb|AGT50292.1|  flavanone 3-hydroxylase                                 493   6e-169   
gb|ADN33941.1|  flavanone 3-hydroxylase                                 494   1e-168   
gb|ADX68823.1|  flavanone 3-hydroxylase                                 493   1e-168   
ref|XP_008449161.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    494   3e-168   
dbj|BAD95810.1|  flavanone 3-hydroxylase                                494   3e-168   
gb|AFJ38181.1|  flavanone 3-hydroxylase                                 492   9e-168   
gb|AGT50300.1|  flavanone 3-hydroxylase                                 489   1e-167   
gb|AGT50290.1|  flavanone 3-hydroxylase                                 488   3e-167   
gb|AGT50304.1|  flavanone 3-hydroxylase                                 488   4e-167   
gb|AGT50294.1|  flavanone 3-hydroxylase                                 488   6e-167   
gb|ACR56689.1|  flavanoe 3-hydroxylase                                  490   9e-167   
gb|AGT50305.1|  flavanone 3-hydroxylase                                 487   1e-166   
gb|AGT50293.1|  flavanone 3-hydroxylase                                 486   3e-166   
gb|AGT50296.1|  flavanone 3-hydroxylase                                 485   5e-166   
gb|AGT50291.1|  flavanone 3-hydroxylase                                 485   8e-166   
gb|AGT50308.1|  flavanone 3-hydroxylase                                 484   1e-165   
gb|AGT50307.1|  flavanone 3-hydroxylase                                 484   2e-165   
gb|AGT50298.1|  flavanone 3-hydroxylase                                 483   3e-165   
gb|AGT50301.1|  flavanone 3-hydroxylase                                 483   5e-165   
gb|AGT50295.1|  flavanone 3-hydroxylase                                 483   8e-165   
gb|AGT50302.1|  flavanone 3-hydroxylase                                 482   2e-164   
gb|AGT50299.1|  flavanone 3-hydroxylase                                 481   3e-164   
dbj|BAF44477.1|  flavanone 3-hydroxylase                                483   1e-163   
gb|AGY80772.1|  flavanone 3-hydroxylase                                 478   5e-162   
gb|ADX68827.1|  flavanone 3-hydroxylase                                 473   3e-161   
gb|ABK26149.1|  unknown                                                 475   1e-160   
ref|XP_010243876.1|  PREDICTED: flavanone 3-dioxygenase-like            474   2e-160   
emb|CAB97360.1|  flavanone 3-hydroxylase                                469   7e-160   
gb|ABK25766.1|  unknown                                                 472   2e-159   
gb|ADE76269.1|  unknown                                                 471   2e-159   
gb|ABK26851.1|  unknown                                                 467   1e-157   
ref|XP_004170234.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    457   5e-155   
dbj|BAC98346.1|  flavanone 3-hydroxylase                                453   1e-153   
gb|AAU93347.1|  flavanone 3-hydroxylase                                 454   8e-153   
gb|ADB43598.1|  flavanone 3-hydroxylase                                 449   4e-152   
gb|KDO71176.1|  hypothetical protein CISIN_1g017946mg                   450   6e-152   
ref|XP_010691906.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    452   6e-152   
ref|XP_010691865.1|  PREDICTED: flavanone 3-dioxygenase-like            452   8e-152   
gb|KCW53146.1|  hypothetical protein EUGRSUZ_J02430                     449   4e-151   
gb|AFP52994.1|  flavanone 3-hydroxylase                                 445   1e-150   
gb|AFP52995.1|  flavanone 3-hydroxylase                                 444   2e-150   
gb|AFP53314.1|  flavanone 3-hydroxylase                                 444   2e-150   
gb|AFP52998.1|  flavanone 3-hydroxylase                                 444   2e-150   
gb|ACA65268.1|  flavanone-3-hydroxylase                                 445   2e-150   
gb|AFP53002.1|  flavanone 3-hydroxylase                                 444   3e-150   
ref|NP_001190050.1|  flavanone 3-hydroxylase                            444   3e-150   
gb|AFK09332.1|  flavanone 3-hydroxylase                                 444   4e-150   
gb|ABY58233.1|  flavanone-3-hydroxylase                                 443   1e-149   
ref|XP_002521659.1|  naringenin,2-oxoglutarate 3-dioxygenase and ...    443   1e-149   
gb|ABA86594.1|  putative flavanone 3-hydroxylase                        442   2e-149   
gb|ABY58232.1|  flavanone-3-hydroxylase                                 442   2e-149   
gb|ABY58234.1|  flavanone-3-hydroxylase                                 442   4e-149   
gb|ACA65266.1|  flavanone-3-hydroxylase                                 441   1e-148   
gb|ABY58249.1|  flavanone-3-hydroxylase                                 440   2e-148   
gb|ACA65269.1|  flavanone-3-hydroxylase                                 439   7e-148   
ref|XP_010426670.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    436   5e-147   
ref|XP_010691864.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    439   1e-146   
dbj|BAF03076.1|  flavanone 3-hydroxylase                                434   2e-146   
gb|EMS58260.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 436   2e-146   
ref|XP_010691863.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    432   4e-144   
gb|ABA01484.1|  gibberellin 3-hydroxylase 2                             424   2e-142   
gb|EPS62774.1|  hypothetical protein M569_12015                         426   3e-142   
ref|XP_010691866.1|  PREDICTED: flavanone 3-dioxygenase-like            424   8e-141   
dbj|BAB85681.1|  flavanon 3-hydroxylase                                 418   3e-140   
gb|ACB55492.1|  flavanone 3-hydroxylase                                 417   2e-139   
emb|CBI19865.3|  unnamed protein product                                412   8e-138   
gb|AGT50297.1|  flavanone 3-hydroxylase                                 410   3e-137   
gb|AAC68585.1|  mutant flavanone 3-hydroxylase                          410   5e-137   
ref|XP_004163753.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    409   2e-135   
ref|XP_004140496.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    407   4e-135   
gb|AGT50303.1|  flavanone 3-hydroxylase                                 404   8e-135   
ref|XP_008459735.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    407   8e-135   
gb|AGT50306.1|  flavanone 3-hydroxylase                                 403   2e-134   
gb|AGM46643.1|  flavone synthase I protein                              400   7e-133   
gb|KHN00480.1|  Flavanone 3-dioxygenase                                 393   1e-129   
dbj|BAI66079.1|  flavanone 3-hydroxylase                                384   2e-127   
gb|AIU39028.1|  flavanone-3-hydroxylase 3                               384   5e-127   
gb|ABF21083.1|  flavanone 3-hydroxylase                                 384   9e-127   
dbj|BAI66080.1|  flavanone 3-hydroxylase                                379   2e-125   
gb|AID16082.1|  flavanone-3-hydroxylase                                 373   5e-123   
gb|AFD32257.1|  flavanone 3-hydroxylase                                 372   8e-123   
gb|AGA82769.1|  flavonone 3-hydroxylase x                               370   5e-122   
gb|ADY02648.1|  flavanone 3-hydroxylase                                 363   2e-118   
gb|ADY02696.1|  flavanone 3-hydroxylase                                 359   7e-118   
gb|ADY02695.1|  flavanone 3-hydroxylase                                 358   2e-117   
gb|ADY02702.1|  flavanone 3-hydroxylase                                 358   2e-117   
gb|ADY02694.1|  flavanone 3-hydroxylase                                 357   5e-117   
gb|ADY02691.1|  flavanone 3-hydroxylase                                 357   6e-117   
gb|ADY02692.1|  flavanone 3-hydroxylase                                 356   1e-116   
gb|ADY02700.1|  flavanone 3-hydroxylase                                 355   2e-116   
gb|ADY02693.1|  flavanone 3-hydroxylase                                 355   3e-116   
gb|ACJ06501.1|  flavanone 3-hydroxylase                                 351   4e-114   
gb|ACN60402.1|  flavanone 3-beta-hydroxylase                            350   4e-114   
gb|AGO18338.1|  flavanone 3-hydroxylase                                 349   5e-114   
gb|AHG55343.1|  naringenin,2-oxoglutarate 3-dioxygenase-like protein    343   9e-112   
dbj|BAO56860.1|  flavanone 3-hydroxyrase                                343   2e-111   
emb|CBI17377.3|  unnamed protein product                                341   2e-110   
ref|XP_006441036.1|  hypothetical protein CICLE_v10023305mg             333   5e-107   
dbj|BAC58033.1|  flavanone 3-hydroxylase                                325   9e-105   
ref|XP_007046695.1|  Flavanone 3-hydroxylase                            327   4e-104   
emb|CDY56277.1|  BnaA09g55810D                                          334   1e-103   
gb|ABU63003.1|  flavanone-3-hydroxylase                                 318   3e-102   
gb|AFI25038.1|  flavanone 3-hydroxylase                                 312   6e-100   
ref|XP_006383103.1|  hypothetical protein POPTR_0005s11570g             308   6e-98    
gb|ABF21085.1|  flavanone 3-hydroxylase                                 303   1e-96    
gb|AHY24651.1|  flavanon-3-hydroxylase                                  299   3e-95    
dbj|BAB91488.1|  flavanone-3-hydroxylase                                299   8e-95    
dbj|BAB91484.1|  flavanone-3-hydroxylase                                299   9e-95    
dbj|BAB91494.1|  flavanone-3-hydroxylase                                299   1e-94    
gb|ACV49883.1|  flavanone 3-hydroxylase                                 295   1e-93    
dbj|BAB91486.1|  flavanone-3-hydroxylase                                296   1e-93    
dbj|BAB91485.1|  flavanone-3-hydroxylase                                295   2e-93    
emb|CDX76159.1|  BnaA04g04230D                                          299   3e-93    
gb|ADP37946.1|  flavanone-3-hydroxylase                                 294   4e-93    
dbj|BAB91487.1|  flavanone-3-hydroxylase                                295   5e-93    
gb|AFK29452.1|  flavanone-3-hydroxylase                                 291   3e-92    
dbj|BAB91493.1|  flavanone-3-hydroxylase                                292   4e-92    
dbj|BAF96942.1|  flavanone 3-hydroxylase                                290   8e-92    
gb|AFK29453.1|  flavanone-3-hydroxylase                                 290   1e-91    
gb|AFK29451.1|  flavanone-3-hydroxylase                                 290   1e-91    
gb|ACA04010.1|  flavanone-3-hydroxylase                                 288   1e-90    
gb|AAU04696.1|  flavonol 6-hydroxylase                                  295   2e-90    
gb|ABD52381.1|  flavanone 3-hydroxylase                                 284   2e-89    
dbj|BAB91489.1|  flavanone-3-hydroxylase                                283   2e-88    
dbj|BAE16364.1|  flavanone 3-hydroxylase                                281   4e-88    
gb|AEQ38548.1|  flavanone 3-hydroxylase                                 281   5e-88    
gb|ADY02651.1|  flavanone 3-hydroxylase                                 281   9e-88    
dbj|BAB91490.1|  flavanone-3-hydroxylase                                280   3e-87    
gb|ABV71916.1|  F3H                                                     278   6e-87    
dbj|BAB91491.1|  flavanone-3-hydroxylase                                278   1e-86    
dbj|BAB91492.1|  flavanone-3-hydroxylase                                277   3e-86    
gb|ADG21951.1|  flavanone-3-hydroxylase                                 273   3e-85    
gb|AFK35641.1|  unknown                                                 272   3e-84    
dbj|BAJ10381.1|  flavanone-3-beta-hydroxylase                           268   3e-83    
emb|CAE47029.1|  flavanone-3-hydroxylase                                266   1e-82    
emb|CAE47039.1|  flavanone-3-hydroxylase                                265   3e-82    
dbj|BAH04210.1|  F3H                                                    265   4e-82    
emb|CAE47023.1|  flavanone-3-hydroxylase                                265   4e-82    
dbj|BAL42105.1|  F3H                                                    265   6e-82    
dbj|BAH04212.1|  F3H                                                    264   6e-82    
dbj|BAL42094.1|  F3H                                                    263   2e-81    
dbj|BAL42076.1|  F3H                                                    263   2e-81    
gb|ACB55497.1|  flavanone 3-hydroxylase                                 262   4e-81    
gb|ACB55494.1|  flavanone 3-hydroxylase                                 262   5e-81    
gb|ACB55496.1|  flavanone 3-hydroxylase                                 262   6e-81    
gb|AGM46645.1|  flavanone 3beta-hydroxylase protein                     261   8e-81    
gb|ACB55498.1|  flavanone 3-hydroxylase                                 260   2e-80    
gb|ACB55493.1|  flavanone 3-hydroxylase                                 254   4e-78    
ref|XP_006852050.1|  hypothetical protein AMTR_s00041p00220450          253   7e-77    
emb|CDX76765.1|  BnaC08g33510D                                          253   3e-76    
gb|AAZ95166.1|  flavanone 3-hydrocylase                                 248   1e-75    
gb|ACE96633.1|  heat shock protein Hsp20                                247   2e-75    
dbj|BAD89979.1|  mutant protein of flavanone-3-hydroxylase              247   5e-75    
gb|ACE96646.1|  heat shock protein Hsp20                                244   1e-74    
gb|ABM53756.1|  flavanone-3-hydroxylase                                 244   3e-74    
emb|CBI17376.3|  unnamed protein product                                265   5e-73    
gb|AIK02205.1|  flavone synthase I                                      244   4e-71    
gb|ADN03367.1|  flavanone 3-hydroxylase                                 236   4e-71    
gb|AHB19305.1|  flavanone 3-hydroxylase                                 233   2e-70    
gb|AEB61004.1|  flavanone 3-hydroxylase                                 233   8e-70    
gb|AGH20186.1|  flavanone 3-hydroxylase                                 232   1e-69    
gb|AGA82771.1|  flavonone 3-hydroxylase x                               228   7e-68    
gb|AHZ08762.1|  flavonoid biosynthesis oxidoreductase protein           230   2e-66    
ref|XP_010048418.1|  PREDICTED: flavanone 3-dioxygenase                 231   2e-66    
ref|XP_009608170.1|  PREDICTED: flavanone 3-dioxygenase                 230   2e-66    
gb|AAV92381.1|  flavanone 3-hydroxylase 2                               223   3e-66    
ref|NP_001267994.1|  uncharacterized protein LOC100854106               230   3e-66    
ref|XP_002524434.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    229   4e-66    
gb|AAV92380.1|  flavanone 3-hydroxylase 2                               223   5e-66    
gb|AAV92395.1|  flavanone 3-hydroxylase 2                               223   7e-66    
gb|EYU31999.1|  hypothetical protein MIMGU_mgv1a009622mg                228   1e-65    
ref|XP_009797505.1|  PREDICTED: flavanone 3-dioxygenase                 228   2e-65    
ref|XP_011090789.1|  PREDICTED: flavanone 3-dioxygenase-like            226   6e-65    
gb|KDP30058.1|  hypothetical protein JCGZ_18383                         226   1e-64    
ref|XP_010251364.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    225   2e-64    
emb|CDP04983.1|  unnamed protein product                                224   4e-64    
ref|XP_010251334.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    225   5e-64    
ref|XP_007218269.1|  hypothetical protein PRUPE_ppa008269mg             224   5e-64    
ref|XP_003528757.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    224   6e-64    
ref|XP_006347521.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    224   6e-64    
gb|KHG13755.1|  Flavanone 3-dioxygenase                                 223   1e-63    
gb|KDP27711.1|  hypothetical protein JCGZ_19834                         223   1e-63    
ref|NP_001233840.1|  flavonoid biosynthesis oxidoreductase protein      223   1e-63    
ref|XP_009389864.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    223   1e-63    
ref|XP_001780809.1|  predicted protein                                  223   2e-63    
ref|XP_004510617.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    223   2e-63    
ref|XP_002985262.1|  2-oxoglutarate-iron(II)-dependent oxygenase        223   3e-63    
ref|XP_010241045.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    222   3e-63    
ref|XP_007136430.1|  hypothetical protein PHAVU_009G044600g             222   4e-63    
gb|ADE77790.1|  unknown                                                 223   4e-63    
ref|XP_008234635.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    222   4e-63    
ref|XP_004976588.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    221   7e-63    
gb|AGH20185.1|  flavanone 3-hydroxylase                                 213   8e-63    
ref|XP_009361273.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    221   1e-62    
dbj|BAP92234.1|  flavanone-3-hydroxylase homolog                        212   2e-62    
ref|XP_002317046.2|  hypothetical protein POPTR_0011s15310g             220   2e-62    
ref|XP_006347314.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    220   2e-62    
ref|XP_007135331.1|  hypothetical protein PHAVU_010G120300g             220   2e-62    
gb|AGQ53962.1|  flavanone 3-hydroxylase                                 212   3e-62    
dbj|BAP92245.1|  flavanone-3-hydroxylase homolog                        211   3e-62    
gb|KHN23297.1|  Flavanone 3-dioxygenase                                 219   4e-62    
ref|XP_004241427.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    219   5e-62    
ref|XP_003526765.1|  PREDICTED: flavanone 3-dioxygenase-like            219   5e-62    
ref|XP_009400481.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    219   5e-62    
ref|XP_003548081.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    219   5e-62    
gb|AGX27514.1|  PRXQ2                                                   219   6e-62    
ref|XP_006578869.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    219   6e-62    
ref|XP_011043760.1|  PREDICTED: flavanone 3-dioxygenase-like            219   6e-62    
ref|XP_010089920.1|  Naringenin,2-oxoglutarate 3-dioxygenase            219   6e-62    
emb|CAN63747.1|  hypothetical protein VITISV_009059                     218   7e-62    
ref|XP_009335249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    218   8e-62    
ref|XP_002970071.1|  2-oxoglutarate-iron(II)-dependent oxygenase        218   8e-62    
ref|XP_006421681.1|  hypothetical protein CICLE_v10007009mg             218   9e-62    
ref|XP_002515091.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    218   1e-61    
ref|XP_006490103.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          218   1e-61    
ref|XP_008376823.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    218   1e-61    
ref|NP_197841.1|  putative 2OG-Fe(II) oxygenase                         218   1e-61    
ref|XP_008797642.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    218   1e-61    
gb|AGH20184.1|  flavanone 3-hydroxylase                                 210   1e-61    
ref|XP_010040085.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    218   2e-61    



>ref|XP_009603556.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Nicotiana 
tomentosiformis]
 dbj|BAF96938.1| flavanone 3-hydroxylase [Nicotiana tabacum]
Length=369

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/368 (80%), Positives = 324/368 (88%), Gaps = 8/368 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD-GGVNGRRRGIC  235
             M PSTLT LA EKTL +SFIRDEDERPKVAYN+FSDEIP+ISLKGIDD  G+NG+R  IC
Sbjct  1     MAPSTLTALAEEKTLQTSFIRDEDERPKVAYNQFSDEIPIISLKGIDDESGINGKRGEIC  60

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IVKACE+WGIFQVVDHGVDA LISQMT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSS
Sbjct  61    EKIVKACEDWGIFQVVDHGVDAQLISQMTTLAKQFFALPPEEKLRFDMSGGKKGGFIVSS  120

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGE VQ+WRE+VTYFSYP + RDYSRWPDKP+GW GVT+KYSEKLME+A KLLEVLSE
Sbjct  121   HLQGEVVQDWREIVTYFSYPIRARDYSRWPDKPDGWIGVTQKYSEKLMELACKLLEVLSE  180

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  181   AMGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  240

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KD GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPE
Sbjct  241   KDNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPE  300

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-------QKMLGIGKPHFQ  1114
             A VYPLK+REGEK +M+E ITFAEMYRRKMSKD+ELARLKK       Q      K   +
Sbjct  301   AIVYPLKIREGEKAVMDEPITFAEMYRRKMSKDLELARLKKLAKEHQIQAEKAAEKAKLK  360

Query  1115  PKPIDQLL  1138
              KPI+++L
Sbjct  361   TKPIEEIL  368



>ref|XP_009765543.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Nicotiana 
sylvestris]
Length=369

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/368 (80%), Positives = 322/368 (88%), Gaps = 8/368 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD-GGVNGRRRGIC  235
             M PSTLT LA EKTL +SFIRDEDERPKVAYN+FSDEIP+ISLKGIDD GG+NGRR  IC
Sbjct  1     MAPSTLTALAEEKTLQTSFIRDEDERPKVAYNQFSDEIPIISLKGIDDEGGINGRRGEIC  60

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IVKACE+WG+FQVVDHGVDA LISQMT+LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  61    EKIVKACEDWGVFQVVDHGVDAQLISQMTTLAKQFFALPAEEKLRFDMSGGKKGGFIVSS  120

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYSEKLME+A KLLEVLSE
Sbjct  121   HLQGEVVQDWREIVTYFSYPIRARDYSRWPDKPEGWIDVTQKYSEKLMELACKLLEVLSE  180

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  181   AMGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  240

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KD GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPE
Sbjct  241   KDNGKTWITVQPVVGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPE  300

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-------QKMLGIGKPHFQ  1114
             A VYPLK+REGEK +M+E + FAEMYRRKMSKD+ELARLKK       Q      K   +
Sbjct  301   AIVYPLKIREGEKAVMDEPVAFAEMYRRKMSKDLELARLKKLAKEQQIQAEEAAEKAKSE  360

Query  1115  PKPIDQLL  1138
              KPID++L
Sbjct  361   TKPIDEIL  368



>ref|XP_004232488.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Solanum lycopersicum]
Length=362

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/363 (79%), Positives = 322/363 (89%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISL+GIDD  VNGRR  IC 
Sbjct  1     MAPSTLTALANEKTLETSFIRDEEERPKVAYNKFSDEIPVISLQGIDD--VNGRRSEICE  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV ACE+WG+FQV+DHGVDA LISQMT LA  FF +PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    RIVNACEDWGVFQVIDHGVDAQLISQMTKLAKEFFELPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKP+GW GVTE+YSEKLM++A KLLEVLSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIGVTEQYSEKLMDLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIGKPHFQPKPID  1129
              VYPLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLK   K++ +   +   + KPI+
Sbjct  299   KVYPLKIREGEKSIMDEPITFAEMYRRKMSKDLELARLKKLAKEEKIQTEEAKLESKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>gb|AAC49929.1| flavanone 3beta-hydroxylase [Petunia x hybrida]
Length=366

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/367 (79%), Positives = 321/367 (87%), Gaps = 9/367 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDEDERPKVAYN+FS+EIP+ISL+GIDD    G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQTSFIRDEDERPKVAYNQFSNEIPIISLEGIDDE--TGKRAEICD  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WG+FQVVDHGVDA+LISQMT+ A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVKACEDWGVFQVVDHGVDAELISQMTTFAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYSEKLME+A KLL+VLSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPTRARDYSRWPDKPEGWIAVTQKYSEKLMELACKLLDVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKM-------LGIGKPHFQP  1117
              VYPLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLKKQ         +   K   + 
Sbjct  299   IVYPLKIREGEKSIMDEPITFAEMYRRKMSKDLELARLKKQAKEQQLQAEVAAEKAKLES  358

Query  1118  KPIDQLL  1138
             KPI+++L
Sbjct  359   KPIEEIL  365



>dbj|BAA75309.1| flavanone 3-hydroxyrase [Ipomoea batatas]
Length=368

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/364 (80%), Positives = 322/364 (88%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGEK+L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  VNGRR  I   IV
Sbjct  6     STLTALAGEKSLQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VNGRRVQIRNDIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFALPPEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  124   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  184   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA+VY
Sbjct  244   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEATVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKML--GIGKPHFQPKPI  1126
             PL VREG+KPIMEE ITFAEMYRRKMSKD+ELARLKK     Q+++       + + KPI
Sbjct  304   PLTVREGDKPIMEEPITFAEMYRRKMSKDLELARLKKFAKEQQQIVKAAAADKNLETKPI  363

Query  1127  DQLL  1138
             DQ+L
Sbjct  364   DQIL  367



>dbj|BAA75308.1| flavanone 3-hydroxyrase [Ipomoea batatas]
 gb|AEQ92210.1| lavanone 3-hydroxyrase [Ipomoea batatas]
Length=368

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/364 (80%), Positives = 321/364 (88%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGEK L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  VNGRR  I   IV
Sbjct  6     STLTALAGEKALQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VNGRRVQIRNDIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFALPPEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  124   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  184   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA+VY
Sbjct  244   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEATVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKML--GIGKPHFQPKPI  1126
             PL VREG+KPIMEE ITFAEMYRRKMSKD+ELARLKK     Q+++       + + KPI
Sbjct  304   PLTVREGDKPIMEEPITFAEMYRRKMSKDLELARLKKFAKEQQQIVKAAAADKNLETKPI  363

Query  1127  DQLL  1138
             DQ+L
Sbjct  364   DQIL  367



>gb|AID50182.1| flavanone 3-hydroxylase [Lycium chinense]
Length=366

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/367 (79%), Positives = 318/367 (87%), Gaps = 9/367 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISLKGIDD  V+GRR  IC 
Sbjct  1     MAPSTLTALADEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLKGIDD--VDGRRGEICE  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WGIFQVVDHGVDA+LI QMT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVKACEDWGIFQVVDHGVDAELIKQMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VT+ YSEKLME+A KLLEVLSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIDVTQNYSEKLMELACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQATK
Sbjct  179   MGLEKEALTNACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKM-------LGIGKPHFQP  1117
              VYPLK+REGEK +M E ITF+EMYRRKMS D+ELARLKKQ            GK   + 
Sbjct  299   IVYPLKIREGEKAVMAEPITFSEMYRRKMSNDLELARLKKQAKEQQIQAEEAAGKAKLES  358

Query  1118  KPIDQLL  1138
             KPI+++L
Sbjct  359   KPIEEIL  365



>sp|Q07353.1|FL3H_PETHY RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H, 
partial [Petunia x hybrida]
 emb|CAA43027.1| naringenin,2-oxoglutarate 3-dioxygenase [Petunia x hybrida]
Length=369

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/367 (78%), Positives = 321/367 (87%), Gaps = 9/367 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             + PSTLT LA EKTL +SFIRDEDERPKVAYN+FS+EIP+ISL+GIDD    G+R  IC 
Sbjct  4     VTPSTLTALAEEKTLQTSFIRDEDERPKVAYNQFSNEIPIISLEGIDDE--TGKRAEICD  61

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WG+FQVVDHGVDA++ISQMT+ A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  62    KIVKACEDWGVFQVVDHGVDAEVISQMTTFAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  121

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYSEKLME+A KLL+VLSEA
Sbjct  122   LQGEVVQDWREIVTYFSYPTRARDYSRWPDKPEGWIAVTQKYSEKLMELACKLLDVLSEA  181

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  182   MGLEKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  241

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  242   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  301

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKM-------LGIGKPHFQP  1117
              VYPLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLKKQ         +   K   + 
Sbjct  302   IVYPLKIREGEKSIMDEPITFAEMYRRKMSKDLELARLKKQAKEQQLQAEVAAEKAKLES  361

Query  1118  KPIDQLL  1138
             KPI+++L
Sbjct  362   KPIEEIL  368



>dbj|BAA75307.1| fravanone 3-hydroxyrase [Ipomoea batatas]
Length=368

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/364 (80%), Positives = 319/364 (88%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  VNGRR  I   IV
Sbjct  6     STLTALAGETALQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VNGRRVQIRNDIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFALPPEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEK M++A KLLEVLSEAMGL
Sbjct  124   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKFMDLACKLLEVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  184   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQPI+GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  244   KTWITVQPIDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEAKVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKML--GIGKPHFQPKPI  1126
             PLKVREGEKPI+EE ITFAEMYRRKMSKD+ELARLKK     Q+++       + + KPI
Sbjct  304   PLKVREGEKPILEEPITFAEMYRRKMSKDLELARLKKFAKEQQQIINAATADKNLETKPI  363

Query  1127  DQLL  1138
             DQ+L
Sbjct  364   DQIL  367



>gb|ACT31918.1| flavanone 3-hydroxyrase [Ipomoea batatas]
Length=368

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/364 (80%), Positives = 320/364 (88%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGEK L SSF+RDEDERPKV YN FSDEIPVISLKGIDD   NGRR  I   IV
Sbjct  6     STLTALAGEKALQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--FNGRRVQIRNDIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFALPPEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  124   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  184   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA+VY
Sbjct  244   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEATVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKML--GIGKPHFQPKPI  1126
             PL VREG+KPIMEE ITFAEMYRRKMSKD+ELARLKK     Q+++       + + KPI
Sbjct  304   PLTVREGDKPIMEEPITFAEMYRRKMSKDLELARLKKFAKEQQQIVKAAAADKNLETKPI  363

Query  1127  DQLL  1138
             DQ+L
Sbjct  364   DQIL  367



>dbj|BAK78918.1| flavanone 3-hydroxylase [Ipomoea hederifolia]
Length=368

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/365 (79%), Positives = 320/365 (88%), Gaps = 10/365 (3%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  IC  IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQICNDIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA+LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAELIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPIKARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             E E L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   ENEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK------KQKML--GIGKPHFQPKP  1123
             PLKVREGEKPI+EE ITFAEMYRRKMSKD+ELAR+K      KQ+M+       + + KP
Sbjct  303   PLKVREGEKPILEEPITFAEMYRRKMSKDLELARMKKFSKEQKQQMIIKAAADTNLETKP  362

Query  1124  IDQLL  1138
             IDQ+L
Sbjct  363   IDQIL  367



>dbj|BAC10996.1| flavanone 3-hydroxylase [Nierembergia sp. NB17]
Length=367

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/367 (78%), Positives = 320/367 (87%), Gaps = 8/367 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDEDERPKVAYN+FS+EIP+ISLKGIDD   +G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQTSFIRDEDERPKVAYNQFSNEIPIISLKGIDDDQ-SGKRGEICD  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WGIFQVVDHGVD +LI++MT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  60    KIVKACEDWGIFQVVDHGVDVELINKMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWP+KPEGW  VTEKYS+ LM +A KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTYFSYPIRARDYSRWPNKPEGWIAVTEKYSDTLMALACKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  180   MGLEKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  240   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-------QKMLGIGKPHFQP  1117
              VYPLK+REGEK IMEE ITFAEMYR+KMSKD+ELARLKK       Q  +   K   + 
Sbjct  300   IVYPLKIREGEKSIMEEPITFAEMYRKKMSKDLELARLKKLAKEQQLQAEVAAEKTKLES  359

Query  1118  KPIDQLL  1138
             KPI+++ 
Sbjct  360   KPIEEIF  366



>ref|NP_001274930.1| flavanone 3 beta-hydroxylase [Solanum tuberosum]
 gb|AAM48289.1| flavanone 3 beta-hydroxylase [Solanum tuberosum]
Length=358

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/357 (79%), Positives = 315/357 (88%), Gaps = 2/357 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISL+GIDD  +NGRR  IC +IV
Sbjct  3     STLTALANEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLQGIDD--INGRRSEICEKIV  60

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WG+FQV+DHG DA LIS+MT LA  FF +PP+EKLRFDMSGGKKGGF+VSSHLQG
Sbjct  61    NACEDWGVFQVIDHGADAQLISEMTKLAKEFFELPPDEKLRFDMSGGKKGGFIVSSHLQG  120

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             E VQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  121   EVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEAMGL  180

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKD G
Sbjct  181   EKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDNG  240

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A VY
Sbjct  241   KTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAKVY  300

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQPKPIDQLL  1138
             PLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLKK       +   + KPI+++L
Sbjct  301   PLKIREGEKAIMDEPITFAEMYRRKMSKDLELARLKKLAKEQTEEAKLESKPIEEIL  357



>gb|AIY22755.1| flavanone 3-hydroxylase [Iochroma cyaneum]
Length=362

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 318/364 (87%), Gaps = 7/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISLKG+   G +G+R  IC 
Sbjct  1     MAPSTLTALADEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLKGL---GESGKRGEICE  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WG+FQVVDHGVD +LISQMT  A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVKACEDWGVFQVVDHGVDDELISQMTKFAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP   RDYSRWPDKP+GW  V EKYSEKLM++A KLLEVLSEA
Sbjct  118   LQGEVVQDWREIVTYFSYPVGARDYSRWPDKPQGWIAVAEKYSEKLMDLACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  178   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  238   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
              VYPLK+REGEK +M+E ITFAEMYRRKMSKD+ELARLKK    Q++    K   + KPI
Sbjct  298   IVYPLKIREGEKAVMDEPITFAEMYRRKMSKDLELARLKKLAKEQQIQAAEKAKLESKPI  357

Query  1127  DQLL  1138
             +++L
Sbjct  358   EEIL  361



>gb|AIY22754.1| flavanone 3-hydroxylase [Iochroma calycinum]
Length=362

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 319/364 (88%), Gaps = 7/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISLKG+   G +G+R  IC 
Sbjct  1     MAPSTLTALADEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLKGL---GESGKRGEICE  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WG+FQVVDHGVD +LISQMT  A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVKACEDWGVFQVVDHGVDDELISQMTKFAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP   RDYSRWPDKP+GW  VTEKYSEKLM++A KLLEVLSEA
Sbjct  118   LQGEVVQDWREIVTYFSYPVGARDYSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             +GLEKEGL+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  178   VGLEKEGLTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS S RLSIA FQ PAPEA
Sbjct  238   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSCRLSIATFQNPAPEA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
              VYPLK+REGEK +M+E ITFAEMYRRKMSKD+ELARLKK    Q++    K   + KPI
Sbjct  298   IVYPLKIREGEKAVMDEPITFAEMYRRKMSKDLELARLKKLAKEQQIQAAEKAKLESKPI  357

Query  1127  DQLL  1138
             +++L
Sbjct  358   EEIL  361



>gb|AAX63401.1| flavanone 3 beta-hydroxylase [Solanum pinnatisectum]
Length=358

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/358 (80%), Positives = 319/358 (89%), Gaps = 4/358 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRG-ICAQI  244
             STLT LA EKTL +SFIRDE+ERPKVAY++FSDEIPVISL+GIDD  +NG RR  IC +I
Sbjct  3     STLTALANEKTLQTSFIRDEEERPKVAYDKFSDEIPVISLQGIDD--INGSRRSEICEEI  60

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V ACE+WG+FQVVDHGVDA+L+SQMT LA  FF +PP+EKLRFDMSGGKKGGF+VSSHLQ
Sbjct  61    VNACEDWGVFQVVDHGVDAELLSQMTKLAKEFFELPPDEKLRFDMSGGKKGGFIVSSHLQ  120

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VTEKYSEKLM++A KLLEVLSEAMG
Sbjct  121   GEVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEAMG  180

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKD 
Sbjct  181   LEKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDN  240

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A V
Sbjct  241   GKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAKV  300

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQPKPIDQLL  1138
             YPLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLKKQK     +   + KPI+++L
Sbjct  301   YPLKIREGEKAIMDEPITFAEMYRRKMSKDLELARLKKQKK-QTEEAQLESKPIEEIL  357



>dbj|BAL43067.1| flavanone 3-hydroxylase [Ipomoea coccinea]
Length=368

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/365 (79%), Positives = 319/365 (87%), Gaps = 10/365 (3%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD    GRR  IC  IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--FLGRRVQICNDIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA+LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAELIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPIKARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             E E L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   ENEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK------KQKML--GIGKPHFQPKP  1123
             PLKVREGEKPI+EE ITFAEMYRRKMSKD+ELAR+K      KQ+M+       + + KP
Sbjct  303   PLKVREGEKPILEEPITFAEMYRRKMSKDLELARMKKFSKEQKQQMIIKAAADTNLETKP  362

Query  1124  IDQLL  1138
             IDQ+L
Sbjct  363   IDQIL  367



>gb|AFN70721.1| flavanone 3-hydroxylase [Ampelopsis grossedentata]
Length=363

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/364 (78%), Positives = 322/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGEKTL SSF+RDEDERPKVAYN FS+EIP+ISL+GID+  V GRR  IC 
Sbjct  1     MAPTTLTALAGEKTLQSSFVRDEDERPKVAYNEFSNEIPIISLEGIDE--VGGRRDEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVV+HGVD++LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVNHGVDSNLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWKSVTQEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M LEKE L+KACVDMDQK+VVNFYP+CPQP LTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MDLEKEALTKACVDMDQKVVVNFYPQCPQPGLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK ++EE ITFAEMYRRKMSKD+ELARLKK    Q++  + K   + KPI
Sbjct  299   TVYPLKIREGEKAVLEEPITFAEMYRRKMSKDLELARLKKLAKEQQLQDLEKAKLESKPI  358

Query  1127  DQLL  1138
             D++ 
Sbjct  359   DEIF  362



>ref|NP_001268034.1| naringenin,2-oxoglutarate 3-dioxygenase [Vitis vinifera]
 gb|ABM67589.1| flavanone 3-hydroxylase [Vitis vinifera]
 emb|CAN68166.1| hypothetical protein VITISV_017488 [Vitis vinifera]
Length=363

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/364 (78%), Positives = 322/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGEKTL SSF+RDEDERPKVAYN FS+EIPVISL+GID+  V GRR  IC 
Sbjct  1     MAPTTLTALAGEKTLQSSFVRDEDERPKVAYNDFSNEIPVISLEGIDE--VGGRRDEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVV+HGVD++LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVNHGVDSNLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRSVTQEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+K+ L+ ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MDLDKDALTNACVDMDQKVVVNFYPQCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK ++E  ITFAEMYRRKMSKD+ELARLKK    Q++  + K   + KPI
Sbjct  299   TVYPLKIREGEKAVLEGPITFAEMYRRKMSKDLELARLKKLAKEQQLQDVEKAKLESKPI  358

Query  1127  DQLL  1138
             DQ+L
Sbjct  359   DQIL  362



>gb|AEN83504.1| flavanone 3 beta-hydroxylase [Solanum tuberosum]
Length=358

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 315/357 (88%), Gaps = 2/357 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISL+GIDD  +NGRR  IC +IV
Sbjct  3     STLTALANEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLQGIDD--INGRRSEICEKIV  60

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WG+FQV+DHGVDA LIS+MT LA  FF +PP+E+LRFDMSGGKKGGF+VSSHLQ 
Sbjct  61    NACEDWGVFQVIDHGVDAQLISEMTKLAKEFFELPPDEELRFDMSGGKKGGFIVSSHLQR  120

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             E VQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  121   EVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEAMGL  180

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKD G
Sbjct  181   EKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDNG  240

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A VY
Sbjct  241   KTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAEVY  300

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQPKPIDQLL  1138
             PLK+REGEK IM+E ITFAEMYRRKMSKD+ELARLKK       +   + KPI+++L
Sbjct  301   PLKIREGEKAIMDEPITFAEMYRRKMSKDLELARLKKLAKEQTEEAKLESKPIEEIL  357



>dbj|BAD34459.1| flavanone 3-hydroxylase [Eustoma grandiflorum]
Length=363

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/364 (77%), Positives = 322/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL SSFIRDEDERPKVAYN+FS+EIP+ISLKG+D+  ++GRR  IC 
Sbjct  1     MAPSTLTALAEEKTLQSSFIRDEDERPKVAYNQFSNEIPIISLKGLDE--IDGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQV+DHGVD+DLIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVIDHGVDSDLISEMTMLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE++TYFSYP + RDYSRWPDKPE W GVTEKYSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIMTYFSYPIKARDYSRWPDKPEAWRGVTEKYSEQLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGG TWITV P++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DGGNTWITVLPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPL VREGE P++E  +TFAEMYRRKMSKD+ELA+LKK     ++  + K   + KPI
Sbjct  299   TVYPLAVREGETPVLEAPMTFAEMYRRKMSKDLELAKLKKLAKENELKHVEKAKVESKPI  358

Query  1127  DQLL  1138
             +++ 
Sbjct  359   EEIF  362



>gb|ABL74481.1| flavanone 3-hydroxyrase [Ipomoea batatas]
Length=367

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/364 (80%), Positives = 317/364 (87%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  VNGRR  I   IV
Sbjct  5     STLTALAGETALQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VNGRRVQIRNDIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FFA+PPEEKL FDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFALPPEEKLLFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++ AFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDSAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKML--GIGKPHFQPKPI  1126
             PLKVREGEKP +EE ITFAEMYRRKMSKD+ELARLKK     Q+++       + + KPI
Sbjct  303   PLKVREGEKPTLEEPITFAEMYRRKMSKDLELARLKKFAKEQQQIIKAAAADKNLETKPI  362

Query  1127  DQLL  1138
             DQ+L
Sbjct  363   DQIL  366



>ref|NP_001275816.1| naringenin,2-oxoglutarate 3-dioxygenase-like [Citrus sinensis]
 dbj|BAA36553.1| flavanone 3-hydroxylase [Citrus sinensis]
Length=362

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/363 (79%), Positives = 318/363 (88%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAGEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE V++WRE+VTYFS+PKQ RDYSRWPDKPEGW  VT++YS+KLM VA KLLEVLSEA
Sbjct  119   LQGEVVKDWREIVTYFSFPKQSRDYSRWPDKPEGWMEVTKEYSDKLMGVACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPID  1129
             +VYPLK+REGEKP++EE I F+EMYRRKMSKD+ELARLKK   +K     K     KPI+
Sbjct  299   TVYPLKIREGEKPVLEEPIPFSEMYRRKMSKDLELARLKKLANEKKQYSEKAKLDAKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>gb|AIY22753.1| flavanone 3-hydroxylase [Iochroma calycinum]
Length=362

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/364 (79%), Positives = 318/364 (87%), Gaps = 7/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SFIRDE+ERPKVAYN+FSDEIPVISLKG+   G +G+R  IC 
Sbjct  1     MAPSTLTALADEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLKGL---GESGKRGEICE  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IVKACE+WG+FQVVDHGVD +LISQMT  A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVKACEDWGVFQVVDHGVDDELISQMTKFAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP   RD SRWPDKP+GW  VTEKYSEKLM++A KLLEVLSEA
Sbjct  118   LQGEVVQDWREIVTYFSYPVGARDCSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             +GLEKEGL+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  178   VGLEKEGLTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS S RLSIA FQ PAPEA
Sbjct  238   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSCRLSIATFQNPAPEA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
              VYPLK+REGEK +M+E ITFAEMYRRKMSKD+ELARLKK    Q++    K   + KPI
Sbjct  298   IVYPLKIREGEKAVMDEPITFAEMYRRKMSKDLELARLKKLAKEQQIQAAEKAKLESKPI  357

Query  1127  DQLL  1138
             +++L
Sbjct  358   EEIL  361



>ref|XP_006425499.1| hypothetical protein CICLE_v10025931mg [Citrus clementina]
 gb|ESR38739.1| hypothetical protein CICLE_v10025931mg [Citrus clementina]
Length=362

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/363 (79%), Positives = 318/363 (88%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAGEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE V++WRE+VTYFSYPKQ RDYSRWPDKPEGW  VT++YS++LM VA KLLEVLSEA
Sbjct  119   LQGEVVKDWREIVTYFSYPKQSRDYSRWPDKPEGWMEVTKEYSDQLMGVACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPID  1129
             +VYPLK+REGEKP++EE I F+EMYRRKMSKD+ELARLKK   +K     K     KPI+
Sbjct  299   TVYPLKIREGEKPVLEEPIPFSEMYRRKMSKDLELARLKKLANEKHQDSEKAKLGTKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>dbj|BAA21897.1| flavanone 3-hydroxylase [Ipomoea nil]
Length=366

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/363 (80%), Positives = 320/363 (88%), Gaps = 8/363 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  +IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRKEIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FF++PPEEKL FDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFSLPPEEKLLFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTEKYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE LSKACV++DQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALSKACVELDQKLVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSEHSRMSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML--GIGKPHFQPKPID  1129
             PLKVREGEKPI+EE ITFAEMYRRKMSKD+ELAR+KK    Q+M+    G  + + KPID
Sbjct  303   PLKVREGEKPILEEPITFAEMYRRKMSKDLELARIKKFAKEQQMIKAAAGDTNLETKPID  362

Query  1130  QLL  1138
             Q+L
Sbjct  363   QIL  365



>ref|XP_007156141.1| hypothetical protein PHAVU_003G261900g [Phaseolus vulgaris]
 gb|ESW28135.1| hypothetical protein PHAVU_003G261900g [Phaseolus vulgaris]
Length=365

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/362 (78%), Positives = 319/362 (88%), Gaps = 6/362 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P TLT LA EKTL SSF+RDEDERPKVAYN FSD+IPVISL GIDD  V+GRR  IC +I
Sbjct  5     PKTLTYLAQEKTLESSFVRDEDERPKVAYNHFSDQIPVISLAGIDD--VHGRRGSICQKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WGIFQVVDHGVD  L+S+MT LAT FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VQACEDWGIFQVVDHGVDQKLVSEMTRLATQFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE+VQ+WRE+VTYFSYPK++RDYSRWPD PEGW  VTE+YSEKLM +A KLLEVLSEAMG
Sbjct  123   GESVQDWREIVTYFSYPKKERDYSRWPDTPEGWRAVTEEYSEKLMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+ ACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D 
Sbjct  183   LEKEALTNACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDN  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH +SNGRFK+ADHQAVVNS  SRLSIA FQ PAP A+V
Sbjct  243   GKTWITVQPVEGAFVVNLGDHGHFVSNGRFKNADHQAVVNSNHSRLSIATFQNPAPNATV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQ  1132
             YPLKVREGEKP++EE ITFAEMYR+KMSKD+E+AR+KK    +++  + K   + KP+ Q
Sbjct  303   YPLKVREGEKPVLEEPITFAEMYRKKMSKDLEIARMKKLAKEKQLQDLEKAKLETKPLKQ  362

Query  1133  LL  1138
             +L
Sbjct  363   IL  364



>gb|ADB92595.1| flavanone 3-hydroxylase [Citrus maxima]
Length=362

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/363 (79%), Positives = 317/363 (87%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAAEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE V++WRE+VTYFSYPKQ RDYSRWPDKPEGW  VT++YS++LM VA KLLEVLSEA
Sbjct  119   LQGEVVKDWREIVTYFSYPKQSRDYSRWPDKPEGWMEVTKEYSDQLMGVACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPID  1129
             +VYPLK+REGEKP++EE I F+EMYRRKMSKD+ELARLKK   +K     K     KPI+
Sbjct  299   TVYPLKIREGEKPVLEEPIPFSEMYRRKMSKDLELARLKKLANEKHQDSEKAKLDTKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>gb|KDO71174.1| hypothetical protein CISIN_1g017946mg [Citrus sinensis]
Length=362

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/363 (79%), Positives = 318/363 (88%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAGEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE V++WRE+VTYFS+PKQ RDYSRWPDKPEGW  VT++YS+KLM VA KLLEVLSEA
Sbjct  119   LQGEVVKDWREIVTYFSFPKQSRDYSRWPDKPEGWMEVTKEYSDKLMGVACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPID  1129
             +VYPLK+REGEKP++EE I F+EMYRRKMSKD+ELARLKK   ++     K     KPI+
Sbjct  299   TVYPLKIREGEKPVLEEPIPFSEMYRRKMSKDLELARLKKLANERHQDSEKAKLGTKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>emb|CDP01900.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/364 (77%), Positives = 317/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL SSFIRDEDERPKVAYN+FS+EIP+ISLKG+DD   +G R  IC 
Sbjct  1     MAPSTLTALAEEKTLQSSFIRDEDERPKVAYNQFSNEIPIISLKGLDD--TDGARPEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQV+DHGVD  LIS MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVIDHGVDDKLISDMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPD+PE W  VTEKYSEKLME+A KLLEVLSEA
Sbjct  119   LQGETVQDWREIVTYFSYPIRARDYSRWPDRPEAWRAVTEKYSEKLMELACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++  +TF+EMYR+KMSKD+ELARLKK    Q++  + K   + KPI
Sbjct  299   TVYPLKIREGEKAVLDAPMTFSEMYRKKMSKDLELARLKKLAKEQELQAVEKAKLEAKPI  358

Query  1127  DQLL  1138
             D++ 
Sbjct  359   DEIF  362



>dbj|BAK78917.1| flavanone 3-hydroxylase [Ipomoea quamoclit]
Length=368

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/365 (79%), Positives = 319/365 (87%), Gaps = 10/365 (3%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  ++V
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRDEVV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI++MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAGLIAEMTRLSKEFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGWRAVTERYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSERSRVSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML----GIGKPHFQPKP  1123
             PL VREGEKPI+EE ITFAEMYRRKMSKD+ELAR+KK    QK +         + + KP
Sbjct  303   PLTVREGEKPILEEPITFAEMYRRKMSKDLELARIKKFAKEQKQMIKAAAAADTNLETKP  362

Query  1124  IDQLL  1138
             IDQ+L
Sbjct  363   IDQIL  367



>gb|ABO48521.1| flavanone-3-hydroxylase [Dimocarpus longan]
Length=365

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/366 (78%), Positives = 321/366 (88%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LA EKTL +SF+RDEDERPKVAYN FS EIPVISL GID+  V+GRR  IC 
Sbjct  1     MAPATLTALAQEKTLNASFVRDEDERPKVAYNEFSKEIPVISLAGIDE--VDGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQV+DHGVD  LIS MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVIDHGVDTKLISDMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS+KLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPMRTRDYSRWPDKPEGWIDVTKEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVV+S  SRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVDSNCSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIG---KPHFQPK  1120
             +VYPLK+REGEKPI+EE ITFAEMYRRKMSKD+ELARLK   K++ L +    K   + K
Sbjct  299   TVYPLKIREGEKPILEEPITFAEMYRRKMSKDLELARLKKLAKEQKLQLQDNEKSKLEAK  358

Query  1121  PIDQLL  1138
             PI+Q+L
Sbjct  359   PIEQIL  364



>emb|CAN61951.1| hypothetical protein VITISV_003886 [Vitis vinifera]
Length=363

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/364 (78%), Positives = 321/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGEKTL SSF+RDEDERPKVAYN FS+EIPVISL+GID+  V GRR  IC 
Sbjct  1     MAPTTLTALAGEKTLQSSFVRDEDERPKVAYNDFSNEIPVISLEGIDE--VGGRRDEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVV+HGVD++LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVNHGVDSNLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRSVTQEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+K+ L+ ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MDLDKDALTNACVDMDQKVVVNFYPQCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK ++E  ITFAEMYRRKMSKD+ELARLKK     ++  + K   + KPI
Sbjct  299   TVYPLKIREGEKAVLEGPITFAEMYRRKMSKDLELARLKKLAKELQLQDVEKAKLESKPI  358

Query  1127  DQLL  1138
             DQ+L
Sbjct  359   DQIL  362



>gb|ABM64799.1| flavanone-3-hydroxylase [Gossypium hirsutum]
Length=368

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 320/369 (87%), Gaps = 11/369 (3%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS++IPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNDIPVISLAGIDD--VDGKRGEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQVVDHGVD  L+S+MT  A  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVVDHGVDTKLVSEMTRFAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLKSRDYSRWPDKPEGWIEVTKEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---------KQKMLGIGKPHF  1111
             +VYPLK+REGEKPI+EE ITFAEMYRRKMSKD+ELARLK         K+K     KP  
Sbjct  299   TVYPLKIREGEKPILEEPITFAEMYRRKMSKDLELARLKKLAKEQQQLKEKEAENEKPKL  358

Query  1112  QPKPIDQLL  1138
             + KP++++L
Sbjct  359   EAKPLEEIL  367



>gb|AEN71544.1| flavanone 3-hydroxylase [Paeonia suffruticosa]
Length=361

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 318/358 (89%), Gaps = 4/358 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT LAGEKTL SSF+RDEDERPKVAYN+FS+EIP+ISL GIDD   +G+R  IC +IV
Sbjct  6     TTLTALAGEKTLQSSFVRDEDERPKVAYNQFSNEIPIISLAGIDD---DGQRSEICRKIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WGIFQVVDHGVDA+LIS M  LA  FFA+PP++KLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    GACEDWGIFQVVDHGVDANLISDMNRLAREFFALPPDDKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSEAMGL
Sbjct  123   EAVRDWREIVTYFSYPIRNRDYSRWPDKPEGWKRVTEEYSEKLMGLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  183   EKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA VY
Sbjct  243   KTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEAIVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLG-IGKPHFQPKPIDQLL  1138
             PLK+R+GEKP++E+ ITF EMYR KMSKDIELARLKKQ+M   + K   + KP+DQ+L
Sbjct  303   PLKIRDGEKPVLEKPITFTEMYRTKMSKDIELARLKKQQMQDHLEKTQLESKPLDQIL  360



>gb|ABL86673.1| F3H [Gossypium barbadense]
 gb|ADC96713.1| flavanone-3-hydroxylase [Gossypium hirsutum]
Length=368

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 320/369 (87%), Gaps = 11/369 (3%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS++IPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNDIPVISLAGIDD--VDGKRGEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQVVDHGVD  L+S+MT  A  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVVDHGVDTKLVSEMTRFAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLKSRDYSRWPDKPEGWIEVTKEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---------KQKMLGIGKPHF  1111
             +VYPLK+REGEKPI+EE ITFAEMYRRKMSKD+ELARLK         K+K     KP  
Sbjct  299   TVYPLKIREGEKPILEEPITFAEMYRRKMSKDLELARLKKVAKEQQQLKEKEAENEKPKL  358

Query  1112  QPKPIDQLL  1138
             + KP++++L
Sbjct  359   EAKPLEEIL  367



>gb|KHG27094.1| Naringenin,2-oxoglutarate 3-dioxygenase -like protein [Gossypium 
arboreum]
Length=368

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 321/369 (87%), Gaps = 11/369 (3%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS++IPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNDIPVISLAGIDD--VDGKRGEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQVVDHGVD  L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVVDHGVDTKLVSEMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRSRDYSRWPDKPQGWVEVTKEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---------KQKMLGIGKPHF  1111
             +VYPLK+REGEKPI+EE ITFAEMYRRKMSKD+ELARLK         K+K     KP  
Sbjct  299   TVYPLKIREGEKPILEEPITFAEMYRRKMSKDLELARLKKLAKEQQQLKEKEAENEKPKL  358

Query  1112  QPKPIDQLL  1138
             + KP++++L
Sbjct  359   EAKPLEEIL  367



>gb|ABA01482.1| gibberellin 20-oxidase 1 [Gossypium hirsutum]
Length=368

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 321/369 (87%), Gaps = 11/369 (3%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS++IPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNDIPVISLAGIDD--VDGKRGEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQVVDHGVD  L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVVDHGVDTKLVSEMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRSRDYSRWPDKPEGWVEVTKEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---------KQKMLGIGKPHF  1111
             +VYPLK+REG+KPI+EE ITFAEMYRRKMSKD+ELARLK         K+K     KP  
Sbjct  299   TVYPLKIREGDKPILEEPITFAEMYRRKMSKDLELARLKKLAKEQQQLKEKEAENEKPKL  358

Query  1112  QPKPIDQLL  1138
             + KP++++L
Sbjct  359   EAKPLEEIL  367



>gb|AAB41102.1| flavanone 3-hydroxylase [Ipomoea purpurea]
Length=367

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/364 (79%), Positives = 318/364 (87%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  +IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRKEIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEG   VTEKYSEKLM++A KLLEVLSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGLRAVTEKYSEKLMDLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSEHSRMSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML---GIGKPHFQPKPI  1126
             PLKVREGEK I+EE ITFAEMYRRKMSKD+ELAR+KK    Q+M+        + + KPI
Sbjct  303   PLKVREGEKAILEEPITFAEMYRRKMSKDLELARIKKFAKEQQMIKAAAAADTNLETKPI  362

Query  1127  DQLL  1138
             DQ+L
Sbjct  363   DQIL  366



>gb|ABW69678.1| flavanone 3-hydroxylase [Ipomoea purpurea]
Length=367

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 318/364 (87%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  +IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRKEIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDARLIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEG   VTEKYSEKLM++A KLLE+LSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGLRAVTEKYSEKLMDLACKLLEILSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSEHSRMSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML---GIGKPHFQPKPI  1126
             PLKVREGEK I+EE ITFAEMYRRKMSKD+ELAR+KK    Q+M+        + + KPI
Sbjct  303   PLKVREGEKAILEEPITFAEMYRRKMSKDLELARIKKFAKEQQMIKAAAAADTNLETKPI  362

Query  1127  DQLL  1138
             DQ+L
Sbjct  363   DQIL  366



>gb|AIU98512.1| flavanone 3-hydroxylase [Paeonia suffruticosa]
Length=361

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/358 (78%), Positives = 317/358 (89%), Gaps = 4/358 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT LAGEKTL SSF+RDEDERPKVAYN+FS+EIP+ISL GIDD   +G+R  IC +IV
Sbjct  6     TTLTALAGEKTLQSSFVRDEDERPKVAYNQFSNEIPIISLAGIDD---DGQRSEICRKIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WGIFQV+DHGVDA+LIS M  LA  FFA+PP++KLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    DACEDWGIFQVIDHGVDANLISDMNRLAREFFALPPDDKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP   RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSEAMGL
Sbjct  123   EAVRDWREIVTYFSYPINNRDYSRWPDKPEGWKRVTEEYSEKLMGLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  183   EKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             +TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA VY
Sbjct  243   ETWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEAIVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLG-IGKPHFQPKPIDQLL  1138
             PLK+R+GEKP++E+ ITF EMYR KMSKDIELARLKKQ+M   + K   + KP+DQ+L
Sbjct  303   PLKIRDGEKPVLEKPITFTEMYRTKMSKDIELARLKKQQMQDHLEKTQLESKPLDQIL  360



>gb|ABW69679.1| flavanone 3-hydroxylase [Ipomoea purpurea]
Length=367

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 317/364 (87%), Gaps = 9/364 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  +IV
Sbjct  5     STLTALAGETALQSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRKEIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WGIFQVVDHGVDA LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGIFQVVDHGVDAGLIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP   RDYSRWPDKPEG   VTEKYSEKLM++A KLLE+LSEAMGL
Sbjct  123   EAVKDWREIVTYFSYPVTARDYSRWPDKPEGLRAVTEKYSEKLMDLACKLLEILSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSEHSRMSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML---GIGKPHFQPKPI  1126
             PLKVREGEK I+EE ITFAEMYRRKMSKD+ELAR+KK    Q+M+        + + KPI
Sbjct  303   PLKVREGEKAILEEPITFAEMYRRKMSKDLELARIKKFAKEQQMIKAAAAADTNLETKPI  362

Query  1127  DQLL  1138
             DQ+L
Sbjct  363   DQIL  366



>ref|XP_007046697.1| Flavanone 3-hydroxylase isoform 1 [Theobroma cacao]
 ref|XP_007046698.1| Flavanone 3-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOX90854.1| Flavanone 3-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOX90855.1| Flavanone 3-hydroxylase isoform 1 [Theobroma cacao]
Length=364

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/365 (77%), Positives = 320/365 (88%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS+EIPVISL GIDD  V+G R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNEIPVISLAGIDD--VDGNRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQV+DHGVD  LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVIDHGVDTKLISEMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS+KLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLKARDYSRWPDKPEGWVEVTKEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+KE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MDLDKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKMLGIGKPHFQPKP  1123
             +VYPL++REGE+PI+EE ITFAEMYRRKMSKD+ELARLKK     Q++  I K   + KP
Sbjct  299   TVYPLRIREGEQPILEEPITFAEMYRRKMSKDLELARLKKLAKEQQQVQEIEKTKLEAKP  358

Query  1124  IDQLL  1138
             ++++L
Sbjct  359   LEKIL  363



>gb|ACQ99190.1| flavanone-3-hydroxylase [Fagopyrum tataricum]
Length=367

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 313/365 (86%), Gaps = 6/365 (2%)
 Frame = +2

Query  56    IMKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             + KPSTLT LA EKTL  SF+RDEDERPKVAYN FS+EIPVISL GID+  V+G+R  IC
Sbjct  4     VAKPSTLTALAEEKTLNLSFVRDEDERPKVAYNHFSNEIPVISLAGIDE--VDGKRAEIC  61

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IVKACEEWGIFQV+DHGVD  L+S+MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSS
Sbjct  62    NKIVKACEEWGIFQVIDHGVDTSLVSEMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSS  121

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWP+ PEGW  VTEKYSE LM +A KLL VLSE
Sbjct  122   HLQGEAVQDWREIVTYFSYPLKSRDYSRWPNNPEGWIKVTEKYSENLMALACKLLGVLSE  181

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLE E L+KACVDMDQK+VVN YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  182   AMGLETEALTKACVDMDQKVVVNCYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  241

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQPI GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAPE
Sbjct  242   RDDGKTWITVQPIEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPE  301

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A+VYPL +REGEKPI+EE ITFAEMYRRKMSKD+ELARLKK    Q+   + K     KP
Sbjct  302   ATVYPLAIREGEKPILEEPITFAEMYRRKMSKDLELARLKKLAKEQQSSDLQKAKLDSKP  361

Query  1124  IDQLL  1138
             I  + 
Sbjct  362   IQDIF  366



>sp|Q7XZQ7.1|FL3H_PETCR RecName: Full=Flavanone 3-dioxygenase; AltName: Full=Flavanone 
3-beta-hydroxylase; AltName: Full=Flavanone 3-hydroxylase; 
Short=F3H; AltName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; 
Short=Naringenin 3-dioxygenase [Petroselinum crispum]
 gb|AAP57394.1| flavanone 3beta-hydroxylase [Petroselinum crispum]
Length=368

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/340 (80%), Positives = 307/340 (90%), Gaps = 1/340 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL S F+RDEDERPK+AYN+FSDEIPVISL GIDD  V+ +R  IC 
Sbjct  1     MAPSTLTALAQEKTLNSKFVRDEDERPKIAYNKFSDEIPVISLAGIDDDSVD-KRSQICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHG+D DLIS+MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSH
Sbjct  60    KIVEACEDWGIFQVVDHGIDIDLISEMTRLARQFFALPAEEKLRFDMTGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP Q RDYSRWPDKPEGW  +TE YS++LM +A KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTYFSYPIQARDYSRWPDKPEGWRSITEMYSDELMALACKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKEGL+KACVDMDQK++VN+YPKCPQP+LTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MGLEKEGLTKACVDMDQKVIVNYYPKCPQPNLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSIATFQNPAPNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLK+REGEK +MEE ITFAEMY+RKMS+DIE+A LKK
Sbjct  300   TVYPLKIREGEKAVMEEPITFAEMYKRKMSRDIEMATLKK  339



>gb|KDO71175.1| hypothetical protein CISIN_1g017946mg [Citrus sinensis]
Length=363

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 318/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAGEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQ-GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             LQ GE V++WRE+VTYFS+PKQ RDYSRWPDKPEGW  VT++YS+KLM VA KLLEVLSE
Sbjct  119   LQQGEVVKDWREIVTYFSFPKQSRDYSRWPDKPEGWMEVTKEYSDKLMGVACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KD GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPE
Sbjct  239   KDNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPI  1126
             A+VYPLK+REGEKP++EE I F+EMYRRKMSKD+ELARLKK   ++     K     KPI
Sbjct  299   ATVYPLKIREGEKPVLEEPIPFSEMYRRKMSKDLELARLKKLANERHQDSEKAKLGTKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>gb|ABW69692.1| flavanone 3-hydroxylase [Ipomoea nil]
Length=366

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/363 (79%), Positives = 320/363 (88%), Gaps = 8/363 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             STLT LAGE  L SSF+RDEDERPKV YN FSDEIPVISLKGIDD  V GRR  I  +IV
Sbjct  5     STLTALAGETALRSSFVRDEDERPKVGYNEFSDEIPVISLKGIDD--VLGRRVQIRKEIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             KACE+WG+FQVVDHGVDA LI +MT L+  FF++PPEEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    KACEDWGVFQVVDHGVDAGLIGEMTRLSKDFFSLPPEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKPEG   VTEKYSEKL+++A KLLEVLSEA+GL
Sbjct  123   EAVKDWREIVTYFSYPVRARDYSRWPDKPEGLRAVTEKYSEKLIDLACKLLEVLSEAIGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACV++DQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG
Sbjct  183   EKEALTKACVELDQKLVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SR+SIA FQ PAPEA VY
Sbjct  243   KTWITVQPVDGAFVVNLGDHGHFLSNGRFKNADHQAVVNSEHSRMSIATFQNPAPEAKVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKML--GIGKPHFQPKPID  1129
             PLKVREGEKPI+EE ITFAEMYRRKMSKD+ELAR+KK    Q+M+    G  + + KPID
Sbjct  303   PLKVREGEKPILEEPITFAEMYRRKMSKDLELARIKKFAKEQQMIKAAAGDTNLETKPID  362

Query  1130  QLL  1138
             Q+L
Sbjct  363   QIL  365



>gb|ADO95201.1| flavanone 3-hydroxylase [Litchi chinensis]
Length=363

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/364 (77%), Positives = 317/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M  +TLT LA EKTL +SF+RDEDERPKVAYN FS+EIPVISL GID+  V+GRR  IC 
Sbjct  1     MALATLTALAQEKTLNASFVRDEDERPKVAYNEFSNEIPVISLAGIDE--VDGRRAEICQ  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQV+DHGVD  LIS MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVIDHGVDTKLISDMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VT++YS+KLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPMRTRDYSRWPDKPQGWIDVTKEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQK+VVN+YPKCPQ DLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKVVVNYYPKCPQSDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEKPI+E+ ITFAEMYRRKMSKD+ELARLKK    Q+     K   + KPI
Sbjct  299   TVYPLKIREGEKPILEQPITFAEMYRRKMSKDLELARLKKLAKEQQQQDTEKSKLEAKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>dbj|BAM42670.1| flavanone3-hydroxylase [Vaccinium ashei]
 dbj|BAM42671.1| flavanone3-hydroxylase [Vaccinium ashei]
Length=359

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/360 (77%), Positives = 312/360 (87%), Gaps = 2/360 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT L+ EKTL + F+RDEDERPKVAYN FSD IPVISL G+D+  V+GRR  IC 
Sbjct  1     MAPTTLTALSEEKTLNAKFVRDEDERPKVAYNTFSDAIPVISLSGLDE--VDGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WG+FQVVDHGVDA LIS MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGVFQVVDHGVDAGLISDMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLME+A K+L+VLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRNRDYSRWPDKPEGWISVTEKYSEKLMELACKMLDVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEK+ L+KACVDMDQK+VVN+YPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKDALTKACVDMDQKVVVNYYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGK WITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP A
Sbjct  239   DGGKNWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPNA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQPKPIDQLL  1138
             +VYPLK+REGEK IMEE I F+EMYRRKM+KD+ELARLKK       +   + KPI ++ 
Sbjct  299   TVYPLKIREGEKSIMEEPIPFSEMYRRKMTKDLELARLKKLAKEQNAEAQLEAKPIKEIF  358



>gb|KDP46752.1| hypothetical protein JCGZ_06540 [Jatropha curcas]
Length=365

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 313/364 (86%), Gaps = 4/364 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT L+ EKTL +SF+RDEDERPKVAYN FS+EIPVISL GIDD     +R  IC 
Sbjct  1     MAPATLTSLSKEKTLQASFVRDEDERPKVAYNEFSNEIPVISLAGIDDVSEGNKRAEICK  60

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVD  LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  61    KIVEACEDWGIFQVVDHGVDTKLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  120

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT +YSEKLM +A KLLE+LSEA
Sbjct  121   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRAVTAEYSEKLMGLACKLLEILSEA  180

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVN+YP CPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  181   MGLEKEALTKACVDMDQKVVVNYYPTCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  240

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  241   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEA  300

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
              VYPLK+ EG KP++EE ITFAEMYRRKMSKD+ELARLKK    Q++  + K   + KPI
Sbjct  301   IVYPLKIEEGVKPVLEEPITFAEMYRRKMSKDLELARLKKLAKEQQIKDLEKSKLESKPI  360

Query  1127  DQLL  1138
             +++ 
Sbjct  361   EEIF  364



>gb|ACR77526.1| flavanone 3-hydroxylase [Citrus maxima]
Length=362

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/363 (78%), Positives = 316/363 (87%), Gaps = 5/363 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL  SF+R +DERPKVAYN FS+EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPSTLTALAAEKTLNPSFVRFQDERPKVAYNEFSNEIPVISLAGIDD--VGGKRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS MT LAT FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAKLISDMTRLATEFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE V++WRE+VTYFSYPKQ RDYSRWPDKPEGW  VT++YS++LM VA KLLEVLSEA
Sbjct  119   LQGEVVKDWREIVTYFSYPKQSRDYSRWPDKPEGWMEVTKEYSDQLMGVACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQ+IVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLEKEALTKACVDMDQEIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP A
Sbjct  239   DNGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPGA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK---QKMLGIGKPHFQPKPID  1129
             +VYPLK+REGEKP++E+ I F+EMYRRKMSKD+ELARLKK   +K     K     KPI+
Sbjct  299   TVYPLKIREGEKPVLEKPIPFSEMYRRKMSKDLELARLKKLANEKHQDSEKAKLDTKPIE  358

Query  1130  QLL  1138
             ++L
Sbjct  359   EIL  361



>gb|KFK34366.1| hypothetical protein AALP_AA5G136000 [Arabis alpina]
Length=358

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/340 (82%), Positives = 302/340 (89%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FS EIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNEFSTEIPVISLAGIDD--VDGKREEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD DL++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTDLVAYMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YS+KLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKVREGEKPI+ E ITFAEMY+RKM +DIELARLKK
Sbjct  299   TVYPLKVREGEKPILAEPITFAEMYKRKMGRDIELARLKK  338



>ref|XP_006292468.1| hypothetical protein CARUB_v10018698mg [Capsella rubella]
 gb|EOA25366.1| hypothetical protein CARUB_v10018698mg [Capsella rubella]
Length=360

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/340 (81%), Positives = 305/340 (90%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN+FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNKFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHGVD +L+S MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACENWGIFQVVDHGVDTNLVSDMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTQEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEK+ L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKDSLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKVREGEKPI+EE ITFAEMY+RKM KD+ELARLKK
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYKRKMGKDLELARLKK  338



>ref|XP_011043191.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Populus 
euphratica]
Length=363

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 318/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MAPSTLTALAGEKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+M +LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMKTLAKEFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A+ KK    Q++  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIAKKKKLAKEQQVKDLETAKLETKPI  358

Query  1127  DQLL  1138
             +Q+ 
Sbjct  359   EQIF  362



>gb|AHY35311.1| flavanone 3-hydroxylase 1 [Morus notabilis]
Length=365

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/366 (77%), Positives = 313/366 (86%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT L  EKTL  SF+RDEDERPKVAYN FS EIPVISL GID+  V GRR  IC 
Sbjct  1     MAPKTLTALVEEKTLHGSFVRDEDERPKVAYNEFSTEIPVISLAGIDE--VEGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS M+ LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAALISNMSRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAV +WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVNDWREIVTYFSYPLRHRDYSRWPDKPEGWIAVTEEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL+KE L+KACVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLDKEALTKACVDMDQKVVINYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGG TWITVQP+  AFVVNLGDHGH LSNGRF++ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGNTWITVQPVEAAFVVNLGDHGHYLSNGRFRNADHQAVVNSNYSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK------QKMLGIGKPHFQPK  1120
             +VYPLK+REGEK I+EE ITFAEMYRRKMSKDIELARLKK       + L   K H + K
Sbjct  299   TVYPLKIREGEKSILEEPITFAEMYRRKMSKDIELARLKKLAKEKQLQDLENAKRHDESK  358

Query  1121  PIDQLL  1138
             PI+++L
Sbjct  359   PIERIL  364



>ref|XP_002876075.1| flavanone 3-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52334.1| flavanone 3-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/361 (78%), Positives = 312/361 (86%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNEFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+ PEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTLLARDFFALSPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEKPI+EE ITFAEMY+RKM +D+ELARLK  K+      H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYKRKMGRDLELARLK--KLAKEESDHKEVAKPVDQI  356

Query  1136  L  1138
              
Sbjct  357   F  357



>ref|XP_006383106.1| hypothetical protein POPTR_0005s11600g [Populus trichocarpa]
 gb|ABK94850.1| unknown [Populus trichocarpa]
 gb|ERP60903.1| hypothetical protein POPTR_0005s11600g [Populus trichocarpa]
Length=363

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 318/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MSPSTLTALAEEKTLRASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+MT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A+ KK    Q +  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIAKKKKLAKEQLLRDMETAKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>gb|ABX74780.1| flavanone-3-hydroxylase [Rubus sp. SSL-2007]
 gb|ABY84868.1| flavanone-3-hydroxylase [Rubus coreanus]
 gb|ACM17897.1| flavanone-3-hydroxylase [Rubus occidentalis]
Length=365

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 307/338 (91%), Gaps = 2/338 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT +AGEKTL  SF+RDEDERPKVAYN+FS+EIP+ISL GID+  V GRR  IC +I
Sbjct  5     PTTLTAIAGEKTLQQSFVRDEDERPKVAYNQFSNEIPIISLSGIDE--VEGRRAEICNKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WG+FQ+VDHGVDA LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEDWGVFQIVDHGVDAKLISEMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPVRHRDYSRWPDKPEGWRAVTQQYSDELMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  183   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PA EA V
Sbjct  243   GKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPLKVREGEKPI+EE IT+ EMY++KMSKD+ELARLKK
Sbjct  303   YPLKVREGEKPILEEPITYTEMYKKKMSKDLELARLKK  340



>ref|NP_001236797.1| flavanone 3-hydroxylase [Glycine max]
 gb|AAT94365.1| flavanone 3-hydroxylase [Glycine max]
 gb|AAU06216.1| flavanone 3-hydroxylase [Glycine max]
 gb|AAU06217.1| flavanone 3-hydroxylase [Glycine max]
 gb|AAY82085.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACN81825.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACU20893.1| unknown [Glycine max]
 gb|KHN00478.1| Flavanone 3-dioxygenase [Glycine soja]
Length=375

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 307/342 (90%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+VTYFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVTYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLACKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|AEF14415.1| flavanone 3-hydroxylase [Onobrychis viciifolia]
Length=365

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 318/366 (87%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDEDERPKVAYN FS EIPVISL GID+  V+GRR  I
Sbjct  1     MAPAARTLTHLAKEKTLESSFVRDEDERPKVAYNNFSTEIPVISLTGIDE--VDGRRAEI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQV+DHG+D +LIS MT LA  FF +PPEEKLRFDMSGGKKGGF+VS
Sbjct  59    CKKIVEACENWGIFQVIDHGIDTNLISDMTRLAKLFFDLPPEEKLRFDMSGGKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGEAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLS
Sbjct  119   SHLQGEAVKDWREIVTYFSYPIRARDYSRWPDKPEGWKEVTEEYSEKLMGLACKLLEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKE L+KACVDMDQK+V+N+YPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEALTKACVDMDQKVVINYYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             TKD GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TKDNGKTWITVQPIEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNYSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPK  1120
             +A+VYPLKVREGEK +MEE ITFAEMYRRKMSKD+E+AR+KK    +++  + K   + K
Sbjct  299   DATVYPLKVREGEKSVMEEPITFAEMYRRKMSKDLEIARMKKIAKEKELRDLEKAKLEAK  358

Query  1121  PIDQLL  1138
             P++Q+L
Sbjct  359   PLNQIL  364



>gb|ABK94757.1| unknown [Populus trichocarpa]
Length=363

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 320/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+MT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELA---RLKKQKML-GIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A   +L K+++L  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIATKKKLAKEQLLRDLETAKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>ref|XP_011043195.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoform X2 
[Populus euphratica]
Length=363

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 319/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGEKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MAPSTLTALAGEKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+M +LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMKTLAKEFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A+ KK    Q++  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIAKKKKLAKEQQVKELETVKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>ref|XP_010113349.1| Naringenin,2-oxoglutarate 3-dioxygenase [Morus notabilis]
 gb|EXC35356.1| Naringenin,2-oxoglutarate 3-dioxygenase [Morus notabilis]
Length=365

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/366 (77%), Positives = 313/366 (86%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT L  EKTL  SF+RDEDERPKVAYN FS EIPVISL GID+  V GRR  IC 
Sbjct  1     MAPKTLTALVEEKTLHGSFVRDEDERPKVAYNEFSTEIPVISLAGIDE--VEGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA LIS M+ LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDAALISNMSRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAV +WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVNDWREIVTYFSYPLRHRDYSRWPDKPEGWIAVTEEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL+KE L+KACVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ+T+
Sbjct  179   MGLDKEALTKACVDMDQKVVINYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQSTR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGG TWITVQP+  AFVVNLGDHGH LSNGRF++ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGNTWITVQPVEAAFVVNLGDHGHYLSNGRFRNADHQAVVNSNYSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK------QKMLGIGKPHFQPK  1120
             +VYPLK+REGEK I+EE ITFAEMYRRKMSKDIELARLKK       + L   K H + K
Sbjct  299   TVYPLKIREGEKSILEEPITFAEMYRRKMSKDIELARLKKLAKEKQLQDLENAKRHDESK  358

Query  1121  PIDQLL  1138
             PI+++L
Sbjct  359   PIERIL  364



>ref|XP_010268217.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Nelumbo 
nucifera]
Length=371

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 307/339 (91%), Gaps = 2/339 (1%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             KP+TLT L  EKTL SSF+RDEDERPKVAYN+FS+++PVISL GID+   +GRR  IC +
Sbjct  5     KPATLTELVEEKTLQSSFVRDEDERPKVAYNQFSNDVPVISLAGIDEA--DGRRSEICQK  62

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV+ACE+WG+FQV+DHGVDA+LIS+M  LA  FFA+P EEKLRFDM+GGKKGGF+VSSHL
Sbjct  63    IVQACEDWGVFQVIDHGVDANLISEMNRLARDFFALPAEEKLRFDMTGGKKGGFIVSSHL  122

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSEKLME+A KLL VLSEAM
Sbjct  123   QGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWKEVTEKYSEKLMELACKLLGVLSEAM  182

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GLE E L+KACVDMDQK+VVN+YPKCPQP+LTLGLKRHTDPGTITLLLQDQVGGLQATKD
Sbjct  183   GLETEALTKACVDMDQKVVVNYYPKCPQPNLTLGLKRHTDPGTITLLLQDQVGGLQATKD  242

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
             GGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA 
Sbjct  243   GGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEAI  302

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             VYPLK++EGEK I+EE ITFAEMYRRKMSKD+ELARLKK
Sbjct  303   VYPLKIKEGEKAILEEPITFAEMYRRKMSKDLELARLKK  341



>gb|AEO36935.1| F3H [Canarium album]
Length=364

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/362 (77%), Positives = 321/362 (89%), Gaps = 6/362 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT LA +KTL +SF+RDEDERPKVAYN+FS+EIPVISL GID+  V+GRR  IC +I
Sbjct  4     PATLTTLAQQKTLEASFVRDEDERPKVAYNQFSNEIPVISLAGIDE--VDGRRAEICKKI  61

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WGIFQV+DHGVDA+LIS MT LA  FFA+PPEEKLRFDM+GGKKGGF+VSSHLQ
Sbjct  62    VEACEDWGIFQVIDHGVDANLISDMTRLAREFFALPPEEKLRFDMTGGKKGGFIVSSHLQ  121

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS+KLM +A KLLEVLSEAMG
Sbjct  122   GEAVQDWREIVTYFSYPLRSRDYSRWPDKPEGWIEVTKEYSDKLMGLACKLLEVLSEAMG  181

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D 
Sbjct  182   LEKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDD  241

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+  AFVVNLGDHGH LSNGRF++ADHQAVVNS  SRLSIA FQ PAP A+V
Sbjct  242   GKTWITVQPVEEAFVVNLGDHGHHLSNGRFRNADHQAVVNSDCSRLSIATFQNPAPNATV  301

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQ  1132
             YPLK+REGEKP++EE ITFAEMYRRKMS+D+ELARLKK    +++  + K   + KP++Q
Sbjct  302   YPLKIREGEKPVLEEPITFAEMYRRKMSRDLELARLKKLAKEKQLQDLEKAKLEGKPLEQ  361

Query  1133  LL  1138
             +L
Sbjct  362   IL  363



>ref|NP_190692.1| flavanone 3-hydroxylase [Arabidopsis thaliana]
 sp|Q9S818.1|FL3H_ARATH RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; Short=Naringenin 
3-dioxygenase; AltName: Full=F3H; AltName: Full=Flavanone 
3-hydroxylase; AltName: Full=Protein TRANSPARENT TESTA 
6 [Arabidopsis thaliana]
 gb|AAL16265.1|AF428335_1 AT3g51240/F24M12_280 [Arabidopsis thaliana]
 gb|AAC68584.1| flavanone 3-hydroxylase [Arabidopsis thaliana]
 emb|CAB62646.1| flavanone 3-hydroxylase (FH3) [Arabidopsis thaliana]
 gb|AAL24272.1| AT3g51240/F24M12_280 [Arabidopsis thaliana]
 gb|AAM51591.1| AT3g51240/F24M12_280 [Arabidopsis thaliana]
 gb|AEE78766.1| flavanone 3-hydroxylase [Arabidopsis thaliana]
Length=358

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/361 (78%), Positives = 313/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEK I+EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKAILEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVDKPVDQI  356

Query  1136  L  1138
              
Sbjct  357   F  357



>ref|XP_002275563.1| PREDICTED: flavanone 3-dioxygenase [Vitis vinifera]
 emb|CAN80262.1| hypothetical protein VITISV_027403 [Vitis vinifera]
Length=358

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/340 (82%), Positives = 303/340 (89%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT L  EKTL  SF+RDEDERPKVAYN+FS+EIPVISL GID+    GRR  IC 
Sbjct  1     MAPSTLTALVEEKTLQQSFVRDEDERPKVAYNQFSNEIPVISLAGIDES--EGRRSEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVDA+L+S MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEDWGIFQVVDHGVDANLVSDMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRAVTEVYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+KE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MDLDKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPLK+REGEK +MEE ITFAEMYRRKMSKD+ELARLKK
Sbjct  299   VVYPLKIREGEKSVMEEPITFAEMYRRKMSKDLELARLKK  338



>dbj|BAD91806.1| flavanone 3-hydroxylase [Gentiana triflora]
Length=365

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/361 (76%), Positives = 320/361 (89%), Gaps = 6/361 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             PSTLT L+ EKTL  +FIRDEDERPK+AYN+FS+EIPVISLKG++DG     R+GIC +I
Sbjct  7     PSTLTALSKEKTLQQTFIRDEDERPKIAYNQFSNEIPVISLKGLEDGD---ERKGICEKI  63

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WGIFQVVDHGVD D++++MT LA  FF +PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  64    VEACEDWGIFQVVDHGVDLDVVNEMTRLAREFFDLPPEEKLRFDMSGGKKGGFIVSSHLQ  123

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSE+LM +A KLLEVLSE+M 
Sbjct  124   GEAVRDWREIVTYFSYPIKSRDYSRWPDKPEGWKSVTEKYSEQLMNLACKLLEVLSESMR  183

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  184   LEKEALTKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  243

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GK+WITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA+V
Sbjct  244   GKSWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEATV  303

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ---KMLGIGKPHFQPKPIDQL  1135
             YPL +R+GEKP+++E ITFAEMYRRKMSKD+ELARLKKQ   ++  + K   + K ++++
Sbjct  304   YPLAIRDGEKPVLDEPITFAEMYRRKMSKDLELARLKKQAKEELKNVEKAKIEGKALEEI  363

Query  1136  L  1138
             L
Sbjct  364   L  364



>ref|XP_006383107.1| hypothetical protein POPTR_0005s11610g [Populus trichocarpa]
 gb|ERP60904.1| hypothetical protein POPTR_0005s11610g [Populus trichocarpa]
Length=363

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 319/364 (88%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MAPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVD  L+S+MT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDTKLVSEMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELA---RLKKQKML-GIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A   +L K+++L  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIATKKKLAKEQLLRDLETAKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>ref|XP_006403939.1| hypothetical protein EUTSA_v10010399mg [Eutrema salsugineum]
 gb|ESQ45392.1| hypothetical protein EUTSA_v10010399mg [Eutrema salsugineum]
Length=428

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/340 (81%), Positives = 303/340 (89%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN+FS+EIPVISL G+DD  V G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNKFSNEIPVISLAGMDD--VGGKREEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+PP+EKL FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPQEKLSFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YS+KLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA EA
Sbjct  239   DGGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKVR+GEKPI+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   TVYPLKVRDGEKPILEEPITFAEMYKRKMGRDLELARLKK  338



>ref|XP_010550464.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Tarenaya 
hassleriana]
Length=366

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/367 (75%), Positives = 315/367 (86%), Gaps = 9/367 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L + F+RDEDERPKVAYN FSDEIPVISL GIDD  V G+R GIC 
Sbjct  1     MAPGTLTELAGETKLNARFVRDEDERPKVAYNDFSDEIPVISLAGIDD--VGGKRDGICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHGVD++L+ +MT LA  FFA+ PEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACENWGIFQVVDHGVDSELVDEMTRLAREFFALSPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW   TE+YSEKLM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKTTEEYSEKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D G+TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAP+A
Sbjct  239   DDGRTWITVQPVPGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNTSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-------QKMLGIGKPHFQP  1117
             +VYPL +R+GEKPI++E ITF+EMYRRKM++D+ELARLKK       Q    + K   + 
Sbjct  299   TVYPLSIRDGEKPILDEPITFSEMYRRKMARDLELARLKKLAREKQAQDDAHVHKDKLEA  358

Query  1118  KPIDQLL  1138
             KP+DQ+L
Sbjct  359   KPLDQIL  365



>gb|ACA81443.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81444.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRSVTEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>ref|XP_003629323.1| Naringenin,2-oxoglutarate 3-dioxygenase [Medicago truncatula]
 gb|ACR15123.1| flavanone-3-hydroxylase [Medicago truncatula]
 gb|AET03799.1| naringenin 3-dioxygenase (flavanone-3-hydroxylase) [Medicago 
truncatula]
Length=365

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/367 (75%), Positives = 319/367 (87%), Gaps = 8/367 (2%)
 Frame = +2

Query  59    MKPS-TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+ TLT LA EKTL SSF+R+EDERPKVAYN FS+EIP+ISL GIDD G  GRR  IC
Sbjct  1     MAPAQTLTYLAQEKTLESSFVREEDERPKVAYNNFSNEIPIISLDGIDDAG--GRRAEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE WGIFQVVDHGVD+ LIS+MT  A  FF +PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    NKIVEACENWGIFQVVDHGVDSKLISEMTRFAKGFFDLPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAV++WRE+VTYFSYP ++RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSE
Sbjct  119   HLQGEAVKDWRELVTYFSYPIRQRDYSRWPDKPEGWKEVTEQYSEKLMNLACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEK+ L+KACVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKDALTKACVDMDQKVVINYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KD GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+
Sbjct  239   KDNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPD  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKMLGIGKPHFQPK  1120
             A+VYPLK+R+GEK +MEE ITFAEMYRRKMSKD+E+AR+KK     +++  + K   + K
Sbjct  299   ATVYPLKIRDGEKSVMEEPITFAEMYRRKMSKDLEIARMKKLAKEEKELRDLEKAKIEAK  358

Query  1121  PIDQLLV  1141
             P++++L 
Sbjct  359   PLNEILA  365



>gb|AAC49176.1| flavanone 3-hydroxylase [Arabidopsis thaliana]
Length=358

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/361 (78%), Positives = 313/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEK I+EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKAILEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVAKPVDQI  356

Query  1136  L  1138
              
Sbjct  357   F  357



>gb|ABB91635.1| flavanone 3-hydroxylase 1 [Brassica napus]
 gb|ABB91636.1| flavanone 3-hydroxylase 1 [Brassica napus]
 emb|CDX77983.1| BnaA09g31780D [Brassica napus]
Length=358

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/361 (78%), Positives = 311/361 (86%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FS EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPGTLTELAGETKLNSKFVRDEDERPKVAYNEFSTEIPVISLAGIDD--VGGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WG+FQVVDHGVD  L++ MT LA  FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGVFQVVDHGVDTSLVADMTRLARDFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE+VQ+WRE+VTYFSYP + RDYSRWP KPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGESVQDWREIVTYFSYPVRNRDYSRWPTKPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEKPI+EE ITFAEMYRRKMS+DIELARLK  K+      H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYRRKMSRDIELARLK--KLAKEEHDHKEAAKPLDQI  356

Query  1136  L  1138
             +
Sbjct  357   I  357



>gb|ACL54955.1| flavanone 3-hydroxylase [Actinidia chinensis]
Length=366

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/341 (81%), Positives = 306/341 (90%), Gaps = 3/341 (1%)
 Frame = +2

Query  59    MKPST-LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+T LT LA EKTL S F+RDEDERPKVAYN FS EIPVISL GID+  V+GRR  IC
Sbjct  1     MAPTTTLTALAEEKTLQSKFVRDEDERPKVAYNVFSSEIPVISLAGIDE--VDGRRSEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGIFQVVDHGVDA L+ +MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    RKIVEACEDWGIFQVVDHGVDAKLVGEMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VT+ YSE LM +A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPDGWRAVTQAYSENLMGLACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KAC+DMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKEALTKACIDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPE
Sbjct  239   RDGGKTWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             A+VYPL ++EGEKP++EE ITFAEMYRRKMSKD+ELARLKK
Sbjct  299   ATVYPLAIQEGEKPVLEEPITFAEMYRRKMSKDLELARLKK  339



>gb|AFK41061.1| unknown [Medicago truncatula]
Length=365

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/367 (75%), Positives = 319/367 (87%), Gaps = 8/367 (2%)
 Frame = +2

Query  59    MKPS-TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+ TLT LA EKTL SSF+R+EDERPKVAYN FS+EIP+ISL GIDD G  GRR  IC
Sbjct  1     MAPAQTLTYLAQEKTLESSFVREEDERPKVAYNNFSNEIPIISLDGIDDAG--GRRAEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE WGIFQVVDHGVD+ LIS+MT  A  FF +PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    NKIVEACENWGIFQVVDHGVDSRLISEMTRFAKGFFDLPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAV++WRE+VTYFSYP ++RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEV+SE
Sbjct  119   HLQGEAVKDWRELVTYFSYPIRQRDYSRWPDKPEGWKEVTEQYSEKLMNLACKLLEVISE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEK+ L+KACVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKDALTKACVDMDQKVVINYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KD GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+
Sbjct  239   KDNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPD  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKMLGIGKPHFQPK  1120
             A+VYPLK+R+GEK +MEE ITFAEMYRRKMSKD+E+AR+KK     +++  + K   + K
Sbjct  299   ATVYPLKIRDGEKSVMEEPITFAEMYRRKMSKDLEIARMKKLAKEEKELRDLEKAKIEAK  358

Query  1121  PIDQLLV  1141
             P++++L 
Sbjct  359   PLNEILA  365



>gb|KHG28485.1| Naringenin,2-oxoglutarate 3-dioxygenase [Gossypium arboreum]
Length=363

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/364 (77%), Positives = 315/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAG++TL +SF+RDEDERPKVAYN+FSDEIPVISL GI+D G N  R  IC 
Sbjct  1     MAPSTLTELAGKETLQASFVRDEDERPKVAYNQFSDEIPVISLAGINDVGEN--RTEICQ  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHGVD  LIS+MT LA  FFA+P E+KLRF+MSGGKKGGF+VSSH
Sbjct  59    KIVEACENWGIFQVVDHGVDTKLISEMTGLAREFFALPAEDKLRFNMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPD PE W  VT++YS+KLM +A KLLEVLSEA
Sbjct  119   LQGETVQDWREIVTYFSYPIKSRDYSRWPDMPERWIEVTKEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE LSKACV+MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALSKACVEMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D G TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A
Sbjct  239   DNGNTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEKPI+EE ITF+EMYRRKMSKD+ELA LKK    Q+M    KP  + KP+
Sbjct  299   TVYPLKIREGEKPILEEPITFSEMYRRKMSKDLELAMLKKLAKEQQMETTKKPELETKPL  358

Query  1127  DQLL  1138
             +Q+L
Sbjct  359   EQIL  362



>gb|AHZ31752.1| flavanone 3-hydroxylase [Viola x wittrockiana]
Length=365

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/367 (78%), Positives = 319/367 (87%), Gaps = 10/367 (3%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LAGE TL SSF+RDEDERPKVAYN FS +IP+ISL GIDD     +R  IC+
Sbjct  1     MAPSTLTALAGETTLQSSFVRDEDERPKVAYNHFSHDIPIISLAGIDDAQ---KRCQICS  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQ+VDHGVD++LIS MT+LA AFFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVEACEDWGIFQIVDHGVDSNLISDMTTLAKAFFALPPEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP  +RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  118   LQGEAVQDWREIVTYFSYPIPRRDYSRWPDKPEGWIDVTKEYSEKLMGLACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  178   MGLEKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  238   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIG-------KPHFQP  1117
             +VYPLKVREGEKPI+EE ITFAEMYRRKMSKDIELA+LKK              KP  + 
Sbjct  298   TVYPLKVREGEKPILEEPITFAEMYRRKMSKDIELAKLKKLAKEEKQMQEEEWQKPKLEA  357

Query  1118  KPIDQLL  1138
             KP++ +L
Sbjct  358   KPLEDIL  364



>sp|Q05965.1|FL3H_MATIN RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H, 
partial [Matthiola incana]
 emb|CAA51192.1| naringenin,2-oxoglutarate 3-dioxygenase [Matthiola incana]
Length=357

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/362 (78%), Positives = 309/362 (85%), Gaps = 11/362 (3%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC +I
Sbjct  2     PGTLTELAGESKLNSKFVRDEDERPKVAYNEFSDEIPVISLAGIDD--VDGKRGEICREI  59

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE WGIFQVVDHGVD  L++ MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  60    VEACENWGIFQVVDHGVDTSLVADMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  119

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VTE+YSEKLM +A KLLEVLSEAMG
Sbjct  120   GEAVQDWREIVTYFSYPVRNRDYSRWPDKPQGWAKVTEEYSEKLMGLACKLLEVLSEAMG  179

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D 
Sbjct  180   LEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDD  239

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA+V
Sbjct  240   GNTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATV  299

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ----PKPIDQ  1132
             YPLKVREGEK IMEE ITFAEMY+RKM +D+ELARLKK     + K         KP+DQ
Sbjct  300   YPLKVREGEKAIMEEPITFAEMYKRKMGRDLELARLKK-----LAKEEHNHKEAAKPLDQ  354

Query  1133  LL  1138
             +L
Sbjct  355   IL  356



>gb|ACA81448.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>dbj|BAD91807.1| flavanone 3-hydroxylase [Gentiana triflora]
Length=365

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/361 (76%), Positives = 319/361 (88%), Gaps = 6/361 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             PSTLT L+ EKTL  +FIRDEDERP +AYN+FS+EIPVISLKG++DG     R+GIC +I
Sbjct  7     PSTLTALSKEKTLQQTFIRDEDERPTIAYNQFSNEIPVISLKGLEDGD---ERKGICEKI  63

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WGIFQVVDHGVD D++++MT LA  FF +PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  64    VEACEDWGIFQVVDHGVDLDVVNEMTRLAREFFDLPPEEKLRFDMSGGKKGGFIVSSHLQ  123

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTEKYSE+LM +A KLLEVLSE+M 
Sbjct  124   GEAVRDWREIVTYFSYPIKSRDYSRWPDKPEGWKSVTEKYSEQLMNLACKLLEVLSESMR  183

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  184   LEKEALTKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  243

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GK+WITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA+V
Sbjct  244   GKSWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEATV  303

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ---KMLGIGKPHFQPKPIDQL  1135
             YPL +R+GEKP+++E ITFAEMYRRKMSKD+ELARLKKQ   ++  + K   + K ++++
Sbjct  304   YPLAIRDGEKPVLDEPITFAEMYRRKMSKDLELARLKKQAKEELKNVEKAKIEGKALEEI  363

Query  1136  L  1138
             L
Sbjct  364   L  364



>gb|ABW74548.1| Flavanone-3-hydroxylase [Rubus coreanus]
Length=365

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/338 (81%), Positives = 306/338 (91%), Gaps = 2/338 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT +AGEKTL  SF+RDEDERPKVAYN+FS+EIP+ISL GID+  V GRR  IC +I
Sbjct  5     PTTLTAIAGEKTLQQSFVRDEDERPKVAYNQFSNEIPIISLSGIDE--VEGRRAEICNKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WG+FQ+VDHGVDA LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEDWGVFQIVDHGVDAKLISEMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPVRHRDYSRWPDKPEGWRAVTQQYSDELMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  183   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWIT QP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PA EA V
Sbjct  243   GKTWITGQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPLKVREGEKPI+EE IT+ EMY++KMSKD+ELARLKK
Sbjct  303   YPLKVREGEKPILEEPITYTEMYKKKMSKDLELARLKK  340



>ref|XP_010515520.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Camelina 
sativa]
Length=355

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/360 (77%), Positives = 310/360 (86%), Gaps = 6/360 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNEFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE+WGIFQVVDHGVD +L+S MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACEDWGIFQVVDHGVDTNLVSDMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPD PEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDTPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQPKPIDQLL  1138
             +VYPLK++EGEK I+EE ITFAEMY+RKM +D+ELARLKK       + H   + +DQ+ 
Sbjct  299   TVYPLKIKEGEKAILEEPITFAEMYKRKMGRDLELARLKKLAK----EKHDHEEAVDQIF  354



>gb|ACA81455.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81456.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACA81457.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81459.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/342 (80%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|AEK99074.1| flavanone 3 beta-hydroxylase [Solanum lycopersicum]
Length=346

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/347 (79%), Positives = 310/347 (89%), Gaps = 5/347 (1%)
 Frame = +2

Query  107   SSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQVVD  286
             +SFIRDE+ERPKVAYN+FSDEIPVISL+GIDD  VNGRR  IC +IV ACE+WG+FQV+D
Sbjct  1     TSFIRDEEERPKVAYNKFSDEIPVISLQGIDD--VNGRRSEICERIVNACEDWGVFQVID  58

Query  287   HGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVTYF  466
             HGVDA LISQMT LA  FF +PPEEKLRFDMSGGKKGGF+VSSHLQGE VQ+WRE+VTYF
Sbjct  59    HGVDAQLISQMTKLAKEFFELPPEEKLRFDMSGGKKGGFIVSSHLQGEVVQDWREIVTYF  118

Query  467   SYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVDMD  646
             SYP + RDYSRWPDKP+GW GVTE+YSEKLM++A KLLEVLSEAMGLEKE L+KACVDMD
Sbjct  119   SYPIRARDYSRWPDKPQGWIGVTEQYSEKLMDLACKLLEVLSEAMGLEKEALTKACVDMD  178

Query  647   QKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPINGAF  826
             QK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQATKD GKTWITVQP+ GAF
Sbjct  179   QKVVVNFYPKCPEPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDNGKTWITVQPVEGAF  238

Query  827   VVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPIME  1006
             VVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A VYPLK+REGEK IM+
Sbjct  239   VVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAKVYPLKIREGEKSIMD  298

Query  1007  EAITFAEMYRRKMSKDIELARLK---KQKMLGIGKPHFQPKPIDQLL  1138
             E ITFA+MYRRKMSKD+ELARLK   K++ +   +   + KPI+++L
Sbjct  299   EPITFADMYRRKMSKDLELARLKKLAKEEKIQTEEAKLESKPIEEIL  345



>gb|AAM65101.1| flavanone 3-hydroxylase FH3 [Arabidopsis thaliana]
Length=358

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/361 (77%), Positives = 313/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWP+KPEGW  VT++YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPNKPEGWVKVTKEYSERLMSLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEK I+EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKAILEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVAKPVDQI  356

Query  1136  L  1138
              
Sbjct  357   F  357



>gb|ACA81430.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ACA81431.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 304/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C  IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CENIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ACA81453.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRSVTEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLL DQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLLDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>dbj|BAD89980.1| mutant protein of flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=358

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/361 (78%), Positives = 312/361 (86%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVG LQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGELQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEK I+EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKAILEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVDKPVDQI  356

Query  1136  L  1138
              
Sbjct  357   F  357



>gb|ACM62745.1| flavanone-3-hydroxylase [Garcinia mangostana]
Length=365

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/362 (76%), Positives = 317/362 (88%), Gaps = 6/362 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT L GE  L +SF+RDEDERPKVAYN+FS+++PVISL+GID+GG   +R  IC +I
Sbjct  5     PTTLTALEGETILRASFVRDEDERPKVAYNQFSNDVPVISLEGIDEGG--QKRAEICKKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACEEWGIFQVVDHGVD  L+S+MT LA AFFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEEWGIFQVVDHGVDTKLVSEMTRLARAFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  VT+ Y ++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPTRTRDYSRWPDKPDGWVDVTKDYGDQLMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D 
Sbjct  183   LEKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDN  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQPI GAFVVNLGDHGH LSNGRF++ADHQAVVNS  SRLSIA FQ PAP+A V
Sbjct  243   GETWITVQPIEGAFVVNLGDHGHFLSNGRFRNADHQAVVNSNCSRLSIATFQNPAPDAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQ  1132
             YPLK+REGEK I+EE ITF+EMYRRKM+KD+ELARLKK    Q++  + K   + KPI++
Sbjct  303   YPLKIREGEKSILEEPITFSEMYRRKMAKDLELARLKKLAKEQQLTDVEKAKLEAKPIEK  362

Query  1133  LL  1138
             +L
Sbjct  363   IL  364



>gb|ACA81441.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81442.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>gb|ACA81452.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQ+QVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQEQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ACA81445.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACA81449.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/342 (80%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>ref|XP_011043194.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoform X1 
[Populus euphratica]
Length=363

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 318/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA +KTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MAPSTLTALAEKKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+M +LA  FFA+PPE+KLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMKTLAKEFFALPPEDKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPE W  VTE+YS+KLME+A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPEAWKAVTEEYSKKLMELACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSKDIE+A+ KK    Q++  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKDIEIAKKKKLAKEQQVKELETVKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>ref|XP_009115799.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Brassica 
rapa]
 gb|ABY89689.1| flavanone 3-hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=358

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/361 (78%), Positives = 310/361 (86%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FS EIPVISL GIDD  V G+R  IC 
Sbjct  1     MAPGTLTELAGETKLNSKFVRDEDERPKVAYNEFSTEIPVISLAGIDD--VGGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WG+FQVVDHGVD  L++ MT LA  FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGVFQVVDHGVDTSLVADMTRLARDFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE+VQ+WRE+VTYFSYP + RDYSRWP KPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGESVQDWREIVTYFSYPVRNRDYSRWPTKPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GA VVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DDGKTWITVQPVEGAVVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEKPI+EE ITFAEMYRRKMS+DIELARLK  K+      H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYRRKMSRDIELARLK--KLAKEEHDHKEAAKPLDQI  356

Query  1136  L  1138
             +
Sbjct  357   I  357



>gb|AHZ97872.1| flavanone 3-hydroxylase [Punica granatum]
Length=372

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/337 (82%), Positives = 298/337 (88%), Gaps = 0/337 (0%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT LA EKTL S F+RDEDERPKVAYN+FS EIPVISL GIDD     RR  IC +IV
Sbjct  7     TTLTALAEEKTLQSRFVRDEDERPKVAYNQFSSEIPVISLDGIDDKAEGSRRFEICKKIV  66

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACEEWGIFQV+DHG+DA LI  MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSHLQG
Sbjct  67    AACEEWGIFQVIDHGIDAKLIGDMTRLAKEFFALPAEEKLRFDMTGGKKGGFIVSSHLQG  126

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYF+YP + RDY+RWPDKPEGW  VTE+YSEKLME+A KLL VLSEAMGL
Sbjct  127   EAVQDWREIVTYFAYPIRSRDYTRWPDKPEGWRAVTEEYSEKLMELACKLLGVLSEAMGL  186

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD G
Sbjct  187   EKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDDG  246

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A VY
Sbjct  247   KTWITVQPIEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSDCSRLSIATFQNPAPDAIVY  306

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PLKV EGEKP+MEE ITFAEMYRRKMSKD+E+ARLKK
Sbjct  307   PLKVPEGEKPVMEEPITFAEMYRRKMSKDLEVARLKK  343



>gb|ACA81446.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/342 (80%), Positives = 304/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C  IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CENIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>gb|ACA81454.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V +FSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIHFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ACA81440.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMS+D+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSRDLEIARMKK  340



>gb|AIB06739.1| flavanone 3-hydroxylase-2 [Mangifera indica]
Length=363

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/364 (76%), Positives = 312/364 (86%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M  ++LT LA EKTL   F+RDEDERPKVAYN FS+EIPVISL GID+  V+GRR  IC 
Sbjct  1     MASTSLTALAQEKTLNPKFVRDEDERPKVAYNEFSNEIPVISLDGIDE--VDGRRDEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWGIFQV+DHGVD  LIS MT+ A  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGIFQVIDHGVDTKLISDMTAHARKFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A  LLEVLSEA
Sbjct  119   LQGETVQDWREIVTYFSYPIKNRDYSRWPDKPEGWRDVTKEYSEKLMGLACMLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYP CPQP+LTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTKACVDMDQKVVVNFYPTCPQPELTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DNGKTWITVQPVPGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK I+EE ITFAEMYRRKMSKD+ELARLKK    Q++    K     +P+
Sbjct  299   TVYPLKIREGEKAILEEPITFAEMYRRKMSKDLELARLKKLAKEQQLQDFEKAKLDARPL  358

Query  1127  DQLL  1138
             + +L
Sbjct  359   ENIL  362



>gb|ACA81458.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITF EMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFTEMYRRKMSKDLEIARMKK  340



>gb|AAX21540.1| flavanone-3-beta-hydroxylase [Anethum graveolens]
Length=366

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/334 (81%), Positives = 300/334 (90%), Gaps = 3/334 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL S F+RDEDERPK+AYN+FSDEIPVISL GID    + +R  IC 
Sbjct  1     MAPSTLTALAQEKTLNSKFVRDEDERPKIAYNQFSDEIPVISLAGIDS---DDKRSEICR  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVD+DLIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVEACEDWGIFQVVDHGVDSDLISEMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP Q RDYSRWPDKPEGW  +TE YSEKLM +A KLLEVLSEA
Sbjct  118   LQGEAVQDWREIVTYFSYPIQARDYSRWPDKPEGWRSITEVYSEKLMALACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE ++KACVDMDQK++VN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  178   MGLEKETITKACVDMDQKVIVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  238   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSIATFQNPAPNA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIE  1060
             +VYPLK+REGEK +MEE ITFAEMY+RKMSKDIE
Sbjct  298   TVYPLKIREGEKAVMEEPITFAEMYKRKMSKDIE  331



>gb|ACA81433.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81434.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACA81435.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACA81436.1| flavanone 3-hydroxylase [Glycine soja]
 gb|ACA81451.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/342 (80%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ACA81447.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/342 (80%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+G RR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGLRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>gb|AFI71897.1| flavanone 3-hydroxylase [Paeonia lactiflora]
Length=364

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/361 (77%), Positives = 313/361 (87%), Gaps = 7/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT LAGEKTL SSF+RDEDERPKVAYN+FS+EIP+ISL GIDD   +G+R  IC +IV
Sbjct  6     TTLTALAGEKTLQSSFVRDEDERPKVAYNQFSNEIPIISLAGIDD---DGQRSEICRKIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WGIFQV+DHGVDA+LIS M  LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    DACEDWGIFQVIDHGVDANLISDMNRLAREFFALPPEDKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAV++WRE+VTYFSYP + RDYSRWPDKP GW  VTE+YSEKLM +A KLLEVLSEAMGL
Sbjct  123   EAVRDWREIVTYFSYPIRNRDYSRWPDKPGGWKRVTEEYSEKLMGLACKLLEVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+ ACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  183   EKEALTNACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA VY
Sbjct  243   KTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEAIVY  302

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PLK+R+GEK ++E+ ITF EMYR KMSKDIELARLKK    Q    + K   + KP++Q+
Sbjct  303   PLKIRDGEKSVLEKPITFTEMYRTKMSKDIELARLKKLAKEQMQDHLEKTQLESKPLEQI  362

Query  1136  L  1138
             L
Sbjct  363   L  363



>ref|XP_003520255.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoform X1 
[Glycine max]
 gb|AAU06218.1| flavanone 3-hydroxylase [Glycine max]
Length=376

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/336 (80%), Positives = 302/336 (90%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LA +KTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR IC +IV+
Sbjct  8     TLTYLAQQKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREICEKIVE  65

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VSSHLQGE
Sbjct  66    ACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVSSHLQGE  125

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             +VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLSEAMGLE
Sbjct  126   SVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLSEAMGLE  185

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  186   KEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGK  245

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP A+VYP
Sbjct  246   TWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAPNATVYP  305

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  306   LKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  341



>gb|AAU04792.1| flavanone 3-hydroxylase [Fragaria x ananassa]
 dbj|BAE17126.1| flavanone 3-hydroxylase [Fragaria x ananassa]
Length=364

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/361 (76%), Positives = 315/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT +AGEKTL  SF+RDEDERPKVAYN+FS++IP+ISL GI++  V GRR  IC +I
Sbjct  5     PTTLTAIAGEKTLQQSFVRDEDERPKVAYNQFSNDIPIISLSGIEE--VEGRRAEICKKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WG+FQ+VDHG+D  LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEDWGVFQIVDHGIDPKLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT +YS++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPVRHRDYSRWPDKPEGWRDVTTQYSDELMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  183   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PA EA V
Sbjct  243   GKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIGKPHFQPKPIDQL  1135
             YPLKVREGEKPI+EE +T+ EMY++KMSKD+ELARLK   K+++    K   + KP+D +
Sbjct  303   YPLKVREGEKPILEEPMTYTEMYKKKMSKDLELARLKKHAKEQLQDSEKTKLEAKPVDDI  362

Query  1136  L  1138
              
Sbjct  363   F  363



>gb|ACA81437.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDVEIARMKK  340



>gb|AIB06738.1| flavanone 3-hydroxylase-1 [Mangifera indica]
Length=363

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 315/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LA EKTL S F+RDEDERPKVAYN FS+EIPVISL GID+  V+GRR  IC 
Sbjct  1     MAPATLTALAQEKTLNSKFVRDEDERPKVAYNEFSNEIPVISLAGIDE--VDGRRAEICK  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWGIFQV+DHGVD  LIS MT+LA  FF++PP EKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGIFQVIDHGVDIKLISDMTALAREFFSLPPVEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS+KLM +A KLLEVLSEA
Sbjct  119   LQGETVQDWREIVTYFSYPIKNRDYSRWPDKPEGWRDVTKEYSDKLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL+KE L+KACVDMDQK+VVNFYP CP+P+LTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLDKEALTKACVDMDQKVVVNFYPTCPEPELTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D G+TWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  239   DNGETWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGE+ I+EE ITFAEMYRRKMSKD+ELARLKK    Q++          +PI
Sbjct  299   TVYPLKIREGEEAILEEPITFAEMYRRKMSKDLELARLKKLAKEQQLQESETAKLDAQPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EKIL  362



>gb|ACA81438.1| flavanone 3-hydroxylase [Glycine max]
 gb|ACA81450.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>ref|XP_010033486.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Eucalyptus 
grandis]
 gb|KCW53147.1| hypothetical protein EUGRSUZ_J02430 [Eucalyptus grandis]
Length=363

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/361 (77%), Positives = 309/361 (86%), Gaps = 7/361 (2%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LAGEKTL S F+RDEDERP VAYN+FS EIPVISL GID+ G   RR  IC +IV+
Sbjct  4     TLTALAGEKTLQSKFVRDEDERPTVAYNQFSSEIPVISLAGIDEAG--SRRAEICKKIVE  61

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE+WG+FQVVDHGVD  LI+ MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSHLQGE
Sbjct  62    ACEDWGVFQVVDHGVDTGLITDMTRLAREFFALPSEEKLRFDMTGGKKGGFIVSSHLQGE  121

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             AVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VTE+YSEKLM +A KLLEVLSEAMGLE
Sbjct  122   AVQDWREIVTYFSYPLRTRDYSRWPDKPEAWKSVTEQYSEKLMALACKLLEVLSEAMGLE  181

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGK
Sbjct  182   KEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGK  241

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             +WITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA+VYP
Sbjct  242   SWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEATVYP  301

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKMLGIGKPHFQPKPIDQL  1135
             LKVREGE+ IM E ITFAEMYRRKMSKD+ELAR KK     +++    K   + KPI+Q+
Sbjct  302   LKVREGEECIMPEPITFAEMYRRKMSKDLELARQKKLAKEQEQLKDAEKTKLEAKPIEQI  361

Query  1136  L  1138
              
Sbjct  362   F  362



>ref|XP_010268688.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Nelumbo 
nucifera]
Length=368

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/365 (76%), Positives = 315/365 (86%), Gaps = 8/365 (2%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             KP+TLT L  EKTL + F+RDEDERPKVAYN+FS+++PVISL GID+ G  GRR  IC +
Sbjct  5     KPTTLTDLVEEKTLQARFVRDEDERPKVAYNQFSNDVPVISLAGIDETG--GRRAEICQK  62

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV+ACE WG+FQVVDHGVDA+LIS+MT LA  FFA+PP+EKLRFDM+GGKKGGF+VSSHL
Sbjct  63    IVEACENWGVFQVVDHGVDANLISEMTRLAREFFALPPDEKLRFDMTGGKKGGFIVSSHL  122

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGEAV +WRE+VTYFSYP   RDYSRWPDKPEGW  VTE YSEKLME+A KLL VLSEAM
Sbjct  123   QGEAVHDWREIVTYFSYPLCTRDYSRWPDKPEGWRAVTEVYSEKLMELACKLLGVLSEAM  182

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GLE + L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D
Sbjct  183   GLETDALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRD  242

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
             GGKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS  SRLSIA FQ PAPEA 
Sbjct  243   GGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNCSRLSIATFQNPAPEAI  302

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP--  1123
             VYPLK+ EGEKP+++E ITFAEMYRRKMSKD+ELA+LKK    QK   + K   Q KP  
Sbjct  303   VYPLKINEGEKPVLDEPITFAEMYRRKMSKDLELAKLKKIAKEQKTEELEKAKQQNKPQV  362

Query  1124  IDQLL  1138
             I++LL
Sbjct  363   IEELL  367



>gb|ACA81439.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 305/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>gb|ABK96090.1| unknown [Populus trichocarpa]
Length=363

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 317/364 (87%), Gaps = 6/364 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL +SF+RDEDERPKVAYN+FS+EIPVIS+ GIDDGG   +R  IC 
Sbjct  1     MGPSTLTALAEEKTLQASFVRDEDERPKVAYNQFSNEIPVISIAGIDDGG--EKRAEICN  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWG+FQ+VDHGVDA L+S+MT+LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVEACEEWGVFQIVDHGVDAKLVSEMTTLAKEFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP + RDYSRWPDKP+ W  VTE+YS+KLME+A KL+ VLSEA
Sbjct  119   LQGEAVQDWREIVTFFSYPIRTRDYSRWPDKPQAWKAVTEEYSKKLMELACKLIGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVNFYPKCPQP+LTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  179   MGLETEALTKACVDMDQKVVVNFYPKCPQPELTLGLKRHTDPGTITLLLQDTVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRF++ADHQAVVNS SSRLSIA FQ PA +A
Sbjct  239   DNGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSNSSRLSIATFQNPAQDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK +++E ITFAEMYRRKMSK IE+A+ KK    Q++  +     + KPI
Sbjct  299   TVYPLKIREGEKSVLDEPITFAEMYRRKMSKVIEIAKKKKLAEEQQLTDLETAKLETKPI  358

Query  1127  DQLL  1138
             +++L
Sbjct  359   EEIL  362



>gb|ACA81429.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 303/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPG ITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGAITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ P P
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPVP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLKVREGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  299   NATVYPLKVREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  340



>gb|ADZ28514.1| flavanone 3-hydroxylase [Camellia nitidissima]
Length=367

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/334 (81%), Positives = 303/334 (91%), Gaps = 3/334 (1%)
 Frame = +2

Query  59    MKPST-LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+T LT LA EK+L   F+RDEDERPKVAYN FS+EIPVISL GID+  + GRR  IC
Sbjct  1     MAPTTTLTALAEEKSLQQKFVRDEDERPKVAYNVFSNEIPVISLAGIDE--IEGRRSEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WG+FQVVDHGVDA+LI++MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    RKIVEACEDWGVFQVVDHGVDANLIAEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW+ VTE YSEKLM++A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWSAVTETYSEKLMDLACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKEALTKACVDMDQKVVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPE
Sbjct  239   RDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDI  1057
             A+VYPLK+REGEKP++EE ITFA+MY+RKMSKDI
Sbjct  299   ATVYPLKIREGEKPVLEEPITFADMYKRKMSKDI  332



>ref|XP_004287814.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/361 (75%), Positives = 314/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT +AGEKTL  SF+RDEDERPKVAYN+FS++IP+ISL GI++  V GRR  IC +I
Sbjct  5     PTTLTAIAGEKTLQQSFVRDEDERPKVAYNQFSNDIPIISLSGIEE--VEGRRAEICKKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WG+FQ+VDHG+D  LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEDWGVFQIVDHGIDPKLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT +YS++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPVRHRDYSRWPDKPEGWRDVTTQYSDELMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  183   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PA EA V
Sbjct  243   GKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIGKPHFQPKPIDQL  1135
             YPL VREGEKPI+EE +T+ EMY++KMSKD+ELARLK   K+++    K   + KP+D +
Sbjct  303   YPLTVREGEKPILEEPMTYTEMYKKKMSKDLELARLKKHAKEQLQDSEKTKLEAKPVDDI  362

Query  1136  L  1138
              
Sbjct  363   F  363



>emb|CDX90656.1| BnaA03g41250D [Brassica napus]
Length=350

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/340 (79%), Positives = 303/340 (89%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGE  L S F+RD DERPKVAYN FS+EIPVISL GID   V G+R  IC 
Sbjct  1     MAPATLTELAGESELNSKFVRDVDERPKVAYNEFSNEIPVISLAGIDH--VGGKRGDICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE+WG+FQVVDHGVD  L++ MT LA+ FF++PPE+KL+FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACEDWGVFQVVDHGVDTKLVADMTRLASDFFSLPPEDKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + R+YSRWP+KPEGW  VTE+YSEKLME+A KLLE+LSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPVRNRNYSRWPNKPEGWVKVTEEYSEKLMELACKLLEILSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKVREGEKPI+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYKRKMGRDLELARLKK  338



>ref|XP_010426669.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X1 [Camelina sativa]
Length=361

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 300/340 (88%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSD IPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESNLNSKFVRDEDERPKVAYNEFSDAIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L+S MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVSDMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPD PEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDTPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ AC+DMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACIDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +V PLK+REGEK I+EE ITFAEMY+RKM +D+EL+RLKK
Sbjct  299   TVKPLKIREGEKAILEEPITFAEMYKRKMGRDLELSRLKK  338



>sp|P41090.1|FL3H_VITVI RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H 
[Vitis vinifera]
 emb|CAA53579.1| flavanone 3-hydroxylase [Vitis vinifera]
Length=364

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 314/364 (86%), Gaps = 5/364 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGEKTL SSF+RDEDERPKVAYN FS+EIPVISL   +   +      IC 
Sbjct  1     MAPTTLTALAGEKTLQSSFVRDEDERPKVAYNDFSNEIPVISLTK-ESMKLAAVVDEICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVV+HGVD++LIS+MT LA  FFA+PPEE +RFDMSGGKKGGF+VSSH
Sbjct  60    KIVEACEDWGIFQVVNHGVDSNLISEMTRLAREFFALPPEENVRFDMSGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRSVTQEYSEKLMGLACKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+K+ L+ ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MDLDKDALTNACVDMDQKVVVNFYPQCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAPEA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK ++E  ITFAEMYRRKMSKD+ELARLKK    Q++  + K   + KPI
Sbjct  300   TVYPLKIREGEKAVLEGPITFAEMYRRKMSKDLELARLKKLAKEQQLQDVEKAKLESKPI  359

Query  1127  DQLL  1138
             DQ+L
Sbjct  360   DQIL  363



>gb|ABF60660.1| flavanone 3-hydroxylase 2 [Brassica napus]
 gb|ABF60661.1| flavanone 3-hydroxylase 2 [Brassica napus]
 emb|CDX73739.1| BnaC08g22640D [Brassica napus]
Length=358

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/361 (77%), Positives = 309/361 (86%), Gaps = 5/361 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TL  LAGE  L S F+RDEDERPKVAYN FS EIPVISL GIDD  V  +R  IC 
Sbjct  1     MAPGTLNELAGETKLNSKFVRDEDERPKVAYNEFSTEIPVISLAGIDD--VGEKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WG+FQVVDHGVD  L++ MT LA  FFA+PPEEKL+FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGVFQVVDHGVDTSLVADMTRLARDFFALPPEEKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE+VQ+WRE+VTYFSYP + RDYSRWP KPEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGESVQDWREIVTYFSYPVRNRDYSRWPTKPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQL  1135
             +VYPLKVREGEKPI+EE ITFAEMY+RKMS+D+ELARLK  K+      H +  KP+DQ+
Sbjct  299   TVYPLKVREGEKPILEEPITFAEMYKRKMSRDLELARLK--KLAKEEHDHKEAAKPLDQI  356

Query  1136  L  1138
             +
Sbjct  357   I  357



>gb|AGS57503.1| flavanone 3-hydroxylase [Vitis rotundifolia]
Length=364

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 314/364 (86%), Gaps = 5/364 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGEKTL SSF+RDEDERPKVAYN FS+EIPVISL   +   +      IC 
Sbjct  1     MAPTTLTALAGEKTLQSSFVRDEDERPKVAYNDFSNEIPVISLTK-ESMKLAAVVDEICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVV+HGVD++LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  60    KIVEACEDWGIFQVVNHGVDSNLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YSEKLM +A KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTYFSYPLRTRDYSRWPDKPEGWRSVTQEYSEKLMGLACKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             M L+K+ L+ ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MDLDKDALTNACVDMDQKVVVNFYPQCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAPEA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             +VYPLK+REGEK ++E  ITFAEMYRRKMSKD+ELARLKK     ++  + K   + KPI
Sbjct  300   TVYPLKIREGEKAVLEGPITFAEMYRRKMSKDLELARLKKLAKELQLQDVEKAKLESKPI  359

Query  1127  DQLL  1138
             DQ+L
Sbjct  360   DQIL  363



>ref|XP_004509357.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cicer 
arietinum]
Length=364

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/363 (76%), Positives = 311/363 (86%), Gaps = 6/363 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P TL  L+ EK L SSFIRDED+RPKVAYN FS++IPVISL GIDD G  GRR  IC  I
Sbjct  4     PKTLNYLSQEKILQSSFIRDEDQRPKVAYNNFSNDIPVISLAGIDDEG--GRRTEICNNI  61

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE WGIFQ+VDHGVD +LIS+MT  A  FF +PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  62    VEACENWGIFQIVDHGVDRELISEMTRFAKGFFDLPPEEKLRFDMSGGKKGGFIVSSHLQ  121

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAV++WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSEKLM +A KLLEVLSEAMG
Sbjct  122   GEAVKDWRELVTYFSYPIRNRDYSRWPDKPEGWKEVTEQYSEKLMGLACKLLEVLSEAMG  181

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD 
Sbjct  182   LEKEALTKACVDMDQKVVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDN  241

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+V
Sbjct  242   GKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPDATV  301

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQ  1132
             YPLK++EGEK IME  ITF EMYRRKMSKD+E+AR+KK    +++  + K   + KP+++
Sbjct  302   YPLKIKEGEKSIMEAPITFTEMYRRKMSKDLEIARMKKLAKEKELRDLEKAKLEGKPLNE  361

Query  1133  LLV  1141
             +L 
Sbjct  362   ILA  364



>gb|AFL47799.1| flavanone 3 beta-hydroxylase [Capsicum annuum]
Length=365

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/340 (81%), Positives = 297/340 (87%), Gaps = 3/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PS+LT LA E T+ +SFIRDE ER KVAYN FSD+IPVISLK ID+ G  G    IC 
Sbjct  1     MPPSSLTSLANETTVPTSFIRDEQERSKVAYNNFSDDIPVISLKDIDEIGTRGE---ICE  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVD  LISQMT  A  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  58    KIVEACEDWGIFQVVDHGVDPQLISQMTKFAKEFFALPSEEKLRFDMSGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWPDKP GW  VTEKYSEKLME+A KLLEVLSEA
Sbjct  118   LQGEVVQDWREIVTYFSYPIRARDYSRWPDKPHGWIAVTEKYSEKLMELACKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  178   MGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITV+PI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  238   DNGKTWITVKPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPLK+REGEK +M+E ITFAEMYRRKMSKD+E AR KK
Sbjct  298   IVYPLKIREGEKAVMDEPITFAEMYRRKMSKDLEAARFKK  337



>gb|AFC37250.1| flavanone 3-hydroxylase [Camellia chekiangoleosa]
Length=368

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/334 (81%), Positives = 301/334 (90%), Gaps = 3/334 (1%)
 Frame = +2

Query  59    MKPST-LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+T LT LA EK+L   F+RDEDERPK AYN FS+EIPVISL GID+  + GRR  IC
Sbjct  1     MAPTTTLTALAQEKSLQQKFVRDEDERPKAAYNVFSNEIPVISLAGIDE--IEGRRSEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGIFQVVDHGVDA+L+++MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    RKIVEACEDWGIFQVVDHGVDANLVAEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE YSEKLM++A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRAVTETYSEKLMDLACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPE
Sbjct  239   RDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDI  1057
             A+VYPLK+REGEKP++EE ITFA+MY+RKMSKDI
Sbjct  299   ATVYPLKIREGEKPVLEEPITFADMYKRKMSKDI  332



>gb|AAX21539.1| flavanone-3-beta-hydroxylase [Ammi majus]
Length=368

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/335 (80%), Positives = 299/335 (89%), Gaps = 1/335 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LA EKTL S F+RDEDERPK+AYN+FSDEIPVISL GIDD   + +R  IC 
Sbjct  1     MAPTTLTALAQEKTLNSKFVRDEDERPKIAYNQFSDEIPVISLAGIDDDS-DDKRSQICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHG+D DLIS+MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSH
Sbjct  60    KIVEACEGWGIFQVVDHGIDTDLISEMTRLAREFFALPAEEKLRFDMTGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP   RDYSRWPDKPEGW  VTE YS+KLM +A KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTYFSYPVPARDYSRWPDKPEGWRSVTEVYSDKLMGLACKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK++VN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MGLEKEALTKACVDMDQKVIVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSIATFQNPAPNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIEL  1063
             +VYPLK+REGEK +MEE ITFAEMY+RKMSKDIE+
Sbjct  300   TVYPLKIREGEKAVMEEPITFAEMYKRKMSKDIEM  334



>gb|AAU04791.1| flavanone 3-hydroxylase [Fragaria x ananassa]
Length=364

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/361 (75%), Positives = 313/361 (87%), Gaps = 5/361 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+TLT +AGE TL  SF+RDEDERPKVAYN+FS +IP+ISL GI++  V GRR  IC +I
Sbjct  5     PTTLTAIAGENTLQQSFVRDEDERPKVAYNQFSIDIPIISLSGIEE--VEGRRAEICKKI  62

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WG+FQ+VDHG+D  LIS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  63    VEACEDWGVFQIVDHGIDPKLISEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSHLQ  122

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT +YS++LM +A KLLEVLSEAMG
Sbjct  123   GEAVQDWREIVTYFSYPVRHRDYSRWPDKPEGWRDVTTQYSDELMGLACKLLEVLSEAMG  182

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DG
Sbjct  183   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDG  242

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PA EA V
Sbjct  243   GKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEAIV  302

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIGKPHFQPKPIDQL  1135
             YPLKVREGEKPI+EE +T+ EMY++KMSKD+ELARLK   K+++    K   + KP+D +
Sbjct  303   YPLKVREGEKPILEEPMTYTEMYKKKMSKDLELARLKKHAKEQLQDSEKTKLEAKPVDDI  362

Query  1136  L  1138
              
Sbjct  363   F  363



>gb|AAT68774.1| flavanone 3-hydroxylase [Camellia sinensis]
Length=368

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/334 (81%), Positives = 301/334 (90%), Gaps = 3/334 (1%)
 Frame = +2

Query  59    MKPST-LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+T LT LA EK+L   F+RDEDERPKVAYN FS+EIPVISL GID+  + GRR  IC
Sbjct  1     MAPTTTLTALAEEKSLQQKFVRDEDERPKVAYNVFSNEIPVISLAGIDE--IEGRRSEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE WG+FQVVDHGVDA+LI++MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSS
Sbjct  59    RKIVEACEGWGVFQVVDHGVDANLIAEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE YSEKLM++A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRAVTETYSEKLMDLACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE L+KACVDMDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLEKEALTKACVDMDQKVVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPE
Sbjct  239   RDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDI  1057
             A+VYPLK+REGEKPI+EE ITFA+MY+RKMSKDI
Sbjct  299   ATVYPLKIREGEKPILEEPITFADMYKRKMSKDI  332



>gb|ADY02649.1| flavanone 3-hydroxylase [Parrya nudicaulis]
Length=380

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/336 (81%), Positives = 298/336 (89%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LAGE  L + F+RDEDERPKVAYN+FS EIPVISL GIDD  V G+R  IC QIV+
Sbjct  1     TLTELAGESKLNNKFVRDEDERPKVAYNKFSHEIPVISLAGIDD--VGGKRGEICRQIVE  58

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WG+FQVVDHGVD  L++ MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  59    ACENWGVFQVVDHGVDTKLVTDMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQGE  118

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             AVQ+WRE+VTYFSYP +  DYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEAMGLE
Sbjct  119   AVQDWREIVTYFSYPVRNXDYSRWPDKPEGWVKVTEEYSERLMGLACKLLEVLSEAMGLE  178

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  179   KESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGK  238

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA+VYP
Sbjct  239   TWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATVYP  298

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LKVREGEK IM+E ITFAEMY+RKM +D+ELARLKK
Sbjct  299   LKVREGEKAIMKEPITFAEMYKRKMGRDLELARLKK  334



>gb|ACA81428.1| flavanone 3-hydroxylase [Glycine soja]
Length=375

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/342 (79%), Positives = 303/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLS
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLS  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PA 
Sbjct  239   TRDNGKTWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAL  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLKVREGEKP+MEE ITFAEMYRRKMSKD+E+A +KK
Sbjct  299   NATVYPLKVREGEKPVMEEPITFAEMYRRKMSKDLEIAGMKK  340



>gb|AAX21535.1| flavanone-3-beta-hydroxylase [Pimpinella anisum]
Length=365

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/335 (80%), Positives = 297/335 (89%), Gaps = 4/335 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL S F+RDEDERPK+AYN+FSDEIPVISL GIDD     +R  IC 
Sbjct  1     MAPSTLTALAQEKTLNSKFVRDEDERPKIAYNQFSDEIPVISLAGIDDD----KRSQICR  56

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHG+D DLIS+MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSH
Sbjct  57    KIVEACEGWGIFQVVDHGIDTDLISEMTRLAREFFALPAEEKLRFDMTGGKKGGFIVSSH  116

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP   RDYSRWPDKPEGW  VTE YS+KLM +A KLLEVLSEA
Sbjct  117   LQGEAVQDWREIVTYFSYPVPARDYSRWPDKPEGWRSVTEVYSDKLMGLACKLLEVLSEA  176

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK++VN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  177   MGLEKEALTKACVDMDQKVIVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  236

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  237   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSIATFQNPAPNA  296

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIEL  1063
             +VYPL +REGEK +MEE ITFAEMY+RKMSKDIE+
Sbjct  297   TVYPLTIREGEKAVMEEPITFAEMYKRKMSKDIEM  331



>gb|ACA81432.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/342 (79%), Positives = 304/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA +KTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQKKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGL KEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLGKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WIT+QP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  239   TRDNGKSWITLQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAP  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  299   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  340



>gb|ABG78794.1| flavanone 3 beta-hydroxylase [Pimpinella anisum]
Length=365

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/335 (80%), Positives = 297/335 (89%), Gaps = 4/335 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL S F+RDEDERPK+AYN+FSDEIPVISL GIDD     +R  IC 
Sbjct  1     MAPSTLTALAQEKTLNSKFVRDEDERPKIAYNQFSDEIPVISLAGIDDD----KRSQICR  56

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE WGIFQVVDHG+D DLIS+MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSH
Sbjct  57    KIVEACEGWGIFQVVDHGIDTDLISEMTRLAREFFALPAEEKLRFDMTGGKKGGFIVSSH  116

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP   RDYSRWPDKPEGW  VTE YS+KLM +A KLLEVLSEA
Sbjct  117   LQGEAVQDWREIVTYFSYPVPARDYSRWPDKPEGWRSVTEVYSDKLMGLACKLLEVLSEA  176

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACVDMDQK++VN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  177   MGLEKEALTKACVDMDQKVIVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  236

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  237   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSIATFQNPAPNA  296

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIEL  1063
             +VYPL +REGEK +MEE ITFAEMY+RKMSKDIE+
Sbjct  297   TVYPLTIREGEKAVMEEPITFAEMYKRKMSKDIEM  331



>dbj|BAF49292.1| naringenin 2-oxoglutarate 3-dioxygenase [Clitoria ternatea]
Length=366

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/336 (80%), Positives = 300/336 (89%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LA EKTL SSF+RDEDERPKVAYN FSDEIPVIS+ GID+  V+GRR  IC +IV+
Sbjct  7     TLTTLAEEKTLESSFVRDEDERPKVAYNEFSDEIPVISIAGIDE--VDGRRGEICNKIVE  64

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WGIFQ+VDHGVD  L+S+MT LA  FFAMPPEEKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  65    ACENWGIFQIVDHGVDPKLVSKMTLLAKEFFAMPPEEKLRFDMSGGKKGGFIVSSHLQGE  124

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             +V++WREMVTYFSYP ++RDY RWPD P+ W  VTE+YSEK+M +A KLLEVLSEAMGLE
Sbjct  125   SVRDWREMVTYFSYPIKERDYKRWPDTPKEWRAVTEEYSEKVMNLACKLLEVLSEAMGLE  184

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             ++ L+KACVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT D GK
Sbjct  185   RDALTKACVDMDQKVVINYYPKCPQPDLTLGLKRHTDPGTITLLLQDHVGGLQATNDNGK  244

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP A+VYP
Sbjct  245   TWITVQPIQGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPNATVYP  304

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LK+REGEKP++EE ITFAEMYRRKMSKD+ELAR+KK
Sbjct  305   LKIREGEKPVLEEPITFAEMYRRKMSKDLELARMKK  340



>ref|XP_010679937.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/340 (80%), Positives = 300/340 (88%), Gaps = 1/340 (0%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD-GGVNGRRRGICA  238
             KP+TLT L GEKTL  SF+RDEDERPKVAYN FS EIPVISL GID   G  G R  IC 
Sbjct  4     KPTTLTALEGEKTLNLSFVRDEDERPKVAYNEFSREIPVISLAGIDSVSGEGGERIEICR  63

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACEEWGIFQV+DHG+D +LIS MT LA  FFA+PP EKLRFDMSGGKKGGF+VSSH
Sbjct  64    KIVEACEEWGIFQVIDHGIDVNLISDMTRLAREFFALPPNEKLRFDMSGGKKGGFIVSSH  123

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT++YS+KLM +A KLL VLSEA
Sbjct  124   LQGEAVQDWREIVTYFSYPIKNRDYSRWPDKPEGWRKVTQEYSDKLMGLACKLLGVLSEA  183

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+
Sbjct  184   MGLETEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDHVGGLQATR  243

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITV+PI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  244   DGGKTWITVEPIPGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDYSRLSIATFQNPAPEA  303

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPL +REGEKPI+EE ITFAEMYR+KMSKD+ELARLKK
Sbjct  304   TVYPLAIREGEKPILEEPITFAEMYRKKMSKDLELARLKK  343



>gb|ABG78792.1| flavanone 3 beta-hydroxylase [Aethusa cynapium]
Length=368

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/335 (80%), Positives = 299/335 (89%), Gaps = 1/335 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LA EKTL S F+RDEDERPKVAYN+FS+EIPVISL GIDD     +R  IC 
Sbjct  1     MAPTTLTALAQEKTLNSKFVRDEDERPKVAYNQFSNEIPVISLAGIDDDS-GDKRSQICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHG+D+ LIS+MT LA  FFA+P EEKLRFDM+GGKKGGF+VSSH
Sbjct  60    KIVEACEDWGIFQVVDHGIDSHLISEMTRLAREFFALPAEEKLRFDMTGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VT+FSYP   RDYSRWPDKPEGW  VTE YSEKLM +  KLLEVLSEA
Sbjct  120   LQGEAVQDWREIVTFFSYPVPARDYSRWPDKPEGWRSVTEVYSEKLMALGCKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE ++KACVDMDQK++VN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MGLEKETITKACVDMDQKVIVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR+SIA FQ PAP A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSDSSRMSIATFQNPAPNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIEL  1063
             +VYPLK+REGEK +MEEAITFAEMYRRKMSKDIE+
Sbjct  300   TVYPLKIREGEKSVMEEAITFAEMYRRKMSKDIEV  334



>emb|CDY29008.1| BnaC07g32140D [Brassica napus]
Length=350

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/340 (79%), Positives = 300/340 (88%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGE  L S F+RDEDERPKVAYN FS+EIPVISL GID   V G+R  IC 
Sbjct  1     MAPATLTELAGESKLNSKFVRDEDERPKVAYNEFSNEIPVISLAGIDH--VGGKRGDICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WG+FQVVDHGVD  L++ MT LA+ FF++PPE+K++FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGVFQVVDHGVDTKLVADMTRLASDFFSLPPEDKIKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWP KPEGW  VTE+YSEKLME+A KLLE+LSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPVRNRDYSRWPGKPEGWVKVTEEYSEKLMELACKLLEILSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MG+EKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGIEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSR SIA FQ PAPEA
Sbjct  239   DDGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRFSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKV+EGEKPI+EE I FAEMY+RKM +D+ELARLKK
Sbjct  299   TVYPLKVKEGEKPILEEPIAFAEMYKRKMGRDLELARLKK  338



>gb|ADY02650.1| flavanone 3-hydroxylase [Parrya nudicaulis]
Length=380

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/336 (81%), Positives = 297/336 (88%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LAGE  L + F RDEDERPKVAYN+FS EIPVISL GIDD  V G+R  IC QIV+
Sbjct  1     TLTELAGESKLNNKFXRDEDERPKVAYNKFSHEIPVISLAGIDD--VGGKRGEICRQIVE  58

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WG+FQVVDHGVD  L++ MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  59    ACENWGVFQVVDHGVDTKLVTDMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQGE  118

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             AVQ+WRE+VTYFSYP +  DYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEAMGLE
Sbjct  119   AVQDWREIVTYFSYPVRNXDYSRWPDKPEGWVKVTEEYSERLMGLACKLLEVLSEAMGLE  178

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  179   KESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGK  238

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA+VYP
Sbjct  239   TWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATVYP  298

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LKVREGEK IM+E ITFAEMY+RKM +D+ELARLKK
Sbjct  299   LKVREGEKAIMKEPITFAEMYKRKMGRDLELARLKK  334



>ref|XP_006574482.1| PREDICTED: flavanone 3-hydroxylase isoform X1 [Glycine max]
Length=370

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 302/342 (88%), Gaps = 9/342 (3%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQ     +WRE+VTYFSYPK++RDYSRWPD PEGW  VTE+YS+K+M +A KL+EVLS
Sbjct  119   SHLQ-----DWREIVTYFSYPKRERDYSRWPDTPEGWRSVTEEYSDKVMGLACKLMEVLS  173

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  174   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  233

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GKTWITVQP+  AFVVNLGDH H LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  234   TRDNGKTWITVQPVEAAFVVNLGDHAHYLSNGRFKNADHQAVVNSNHSRLSIATFQNPAP  293

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLK+REGEKP+MEE ITFAEMYRRKMSKDIE+AR+KK
Sbjct  294   NATVYPLKIREGEKPVMEEPITFAEMYRRKMSKDIEIARMKK  335



>gb|ACA81427.1| flavanone 3-hydroxylase [Glycine max]
Length=375

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 303/342 (89%), Gaps = 4/342 (1%)
 Frame = +2

Query  59    MKPS--TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGI  232
             M P+  TLT LA EKTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR I
Sbjct  1     MAPTAKTLTYLAQEKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREI  58

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
             C +IV+ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VS
Sbjct  59    CEKIVEACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVS  118

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGE+VQ+WRE+V YFSYPK++RDYSRWP KPEGW  VTE+YSEKLM +A KL+EVL 
Sbjct  119   SHLQGESVQDWREIVIYFSYPKRERDYSRWPHKPEGWRWVTEEYSEKLMGLAGKLMEVLP  178

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGLEKEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  179   EAMGLEKEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  238

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             T+D GK+WITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PA 
Sbjct  239   TRDNGKSWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAL  298

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              A+VYPLKVREGEKP+MEE ITFAEMYRRKMSKD+E+A +KK
Sbjct  299   NATVYPLKVREGEKPVMEEPITFAEMYRRKMSKDLEIAGMKK  340



>emb|CAD37982.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/330 (82%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFAEMYKRKMGRDLELARLKK  328



>emb|CAD37971.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37972.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37973.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37974.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37975.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37976.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/330 (82%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFAEMYKRKMGRDLELARLKK  328



>emb|CAC26921.1| flavanone-3-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=344

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/347 (79%), Positives = 304/347 (88%), Gaps = 5/347 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNEFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHGVD +L++ MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGVDTNLVADMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWPDKPEGW  +TE+YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPDKPEGWVKLTEEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEKPI
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKPI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQLL  1138
             +EE ITFAEMY+RKM +D+ELARLK  K+      H +  KP+DQ+ 
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLK--KLAKEESDHKEVAKPVDQIF  343



>emb|CAD37956.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37957.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37958.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37959.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37960.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37961.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37962.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37963.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37964.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37965.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37966.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37967.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37968.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37969.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37970.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37983.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37984.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37985.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37986.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37987.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37988.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/330 (81%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFAEMYKRKMGRDLELARLKK  328



>gb|ADY02652.1| flavanone 3-hydroxylase [Parrya nudicaulis]
Length=377

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/336 (80%), Positives = 298/336 (89%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LAGE  L + F+RDEDERP+ AYN+FS EIPVISL GIDD  V G+R  IC QIV+
Sbjct  1     TLTELAGESKLNNKFVRDEDERPQGAYNKFSHEIPVISLAGIDD--VGGKRGKICRQIVE  58

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WG+FQVVDHGVD  L++ MT LA  FFA+PP+EKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  59    ACENWGVFQVVDHGVDTKLVADMTRLARDFFALPPKEKLRFDMSGGKKGGFIVSSHLQGE  118

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
             AVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEA+GLE
Sbjct  119   AVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMGLACKLLEVLSEALGLE  178

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  179   KESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGK  238

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA+VYP
Sbjct  239   TWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATVYP  298

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LKVREGEK IM+E ITFAEMY+RKM +D+ELARLKK
Sbjct  299   LKVREGEKAIMKEPITFAEMYKRKMGRDLELARLKK  334



>gb|AAD56577.1|AF184270_1 flavanone 3-hydroxylase [Daucus carota]
Length=366

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/336 (80%), Positives = 296/336 (88%), Gaps = 3/336 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M PSTLT LA EKTL S F+RDEDERPKVAYN+FSDEIPVISL GIDD     RR  IC 
Sbjct  1     MAPSTLTALAQEKTLNSRFVRDEDERPKVAYNQFSDEIPVISLAGIDDAA---RRSEICR  57

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGVD  LI++MT LA  FFA+P  EKLRFDM+GGKKGGF+VSSH
Sbjct  58    KIVEACEDWGIFQVVDHGVDTALIAEMTRLAREFFALPAAEKLRFDMTGGKKGGFIVSSH  117

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW   T +YSEKLM +  KLLEVLSEA
Sbjct  118   LQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRSATGEYSEKLMGLGCKLLEVLSEA  177

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL+KE ++KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  178   MGLDKEAITKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  237

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP A
Sbjct  238   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPNA  297

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELA  1066
             +VYPLK+REGEK +MEE ITFAEMYRRKMSKDIE+A
Sbjct  298   TVYPLKIREGEKAVMEEPITFAEMYRRKMSKDIEVA  333



>ref|XP_010503810.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Camelina 
sativa]
Length=360

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/361 (77%), Positives = 305/361 (84%), Gaps = 8/361 (2%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P TLT LAGE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC 
Sbjct  1     MAPGTLTELAGESKLNSKFVRDEDERPKVAYNEFSDEIPVISLAGIDD--VDGKRGEICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WGIFQVVDHGVD +L+S MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGIFQVVDHGVDTNLVSDMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPD PEGW  VTE+YSE+LM +A KLLEVLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPVRNRDYSRWPDTPEGWVKVTEEYSERLMGLACKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D GKTWITVQP+ GAFVVNL      LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DDGKTWITVQPVEGAFVVNLXXXXKFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ---PKPID  1129
             +VYPLK+REGEK I+EE ITFAEMY+RKM +D+ELARLKK   L   K H      KP+D
Sbjct  299   TVYPLKIREGEKAILEEPITFAEMYKRKMGRDLELARLKK---LAKEKKHDHEEAAKPVD  355

Query  1130  Q  1132
             Q
Sbjct  356   Q  356



>emb|CAD37954.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37977.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37978.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37980.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37981.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/330 (81%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWPDKP+GW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPDKPKGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFAEMYKRKMGRDLELARLKK  328



>gb|ADT63064.1| flavones 3-hydroxylase [Fagopyrum esculentum]
Length=367

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/363 (74%), Positives = 309/363 (85%), Gaps = 6/363 (2%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             KP TLT L+ E TL +SF+RDEDERPKVAYN+FS++IPVISL GIDD  + G+R  IC +
Sbjct  6     KPKTLTALSQETTLNTSFVRDEDERPKVAYNQFSNDIPVISLAGIDD--IGGKRDEICKK  63

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV ACE+WG+FQVVDHGVD  L+S+MT LA  FFA+P E+KL+FDM+GGKKGGF+VSSHL
Sbjct  64    IVDACEDWGVFQVVDHGVDTKLVSEMTRLAREFFALPAEDKLKFDMTGGKKGGFIVSSHL  123

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             +GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE YSE+LM +A KLL VLSEAM
Sbjct  124   RGEAVQDWREIVTYFSYPLKARDYSRWPDKPEGWIKVTEHYSEQLMGLACKLLGVLSEAM  183

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GLE E L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D
Sbjct  184   GLETEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRD  243

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
              GKTWITVQP+ GAFVVNLGDH H LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+
Sbjct  244   DGKTWITVQPVEGAFVVNLGDHDHYLSNGRFKNADHQAVVNSNFSRLSIATFQNPAPDAT  303

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPID  1129
             VYPL VREGE PI+E  ITFAEMYRRKM KD+ELARLKK    Q    + K   +PKPI+
Sbjct  304   VYPLAVREGETPILEAPITFAEMYRRKMGKDLELARLKKLAKEQAQQNLDKAKVEPKPIE  363

Query  1130  QLL  1138
             ++L
Sbjct  364   EIL  366



>emb|CAD37979.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/330 (81%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITF+EMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFSEMYKRKMGRDLELARLKK  328



>emb|CAD37953.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAD37955.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=340

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/330 (81%), Positives = 296/330 (90%), Gaps = 2/330 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE  L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WG
Sbjct  1     GESKLNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWG  58

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHG+D +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  59    IFQVVDHGLDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWR  118

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ 
Sbjct  119   EIVTYFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN  178

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQ
Sbjct  179   ACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQ  238

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREG
Sbjct  239   PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREG  298

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EK I+EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   EKAILEEPITFAEMYKRKMGRDLELARLKK  328



>gb|ABY63660.1| flavonoid 3-hydroxylase [Epimedium sagittatum]
Length=367

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/359 (75%), Positives = 307/359 (86%), Gaps = 6/359 (2%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             KPSTLT L  EK L  SF+RDEDERPKVAYN FS+EIPVISL GID+  V+GRR  IC +
Sbjct  9     KPSTLTALVDEKKLQQSFVRDEDERPKVAYNVFSNEIPVISLAGIDE--VDGRRSEICKK  66

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV ACE+WGIFQVVDHGVD DLI++MT LA  FFA+PPE+KLRFDM+GGKKGGF+VSSHL
Sbjct  67    IVDACEDWGIFQVVDHGVDTDLITEMTKLAREFFALPPEDKLRFDMTGGKKGGFIVSSHL  126

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGEA  +WRE+VTYFSYP + RDYSRWPD P  W  VT++YS+KLM +A KLLEVLSEAM
Sbjct  127   QGEAASDWREIVTYFSYPIRARDYSRWPDTPAAWRAVTQEYSDKLMGLACKLLEVLSEAM  186

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
              LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D
Sbjct  187   DLEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRD  246

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
              GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+
Sbjct  247   DGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPDAT  306

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPI  1126
             VYPLK+REGEKPI++  ITFAEMY++KMS+D+ELA LKK    QK+  + K   +PK I
Sbjct  307   VYPLKIREGEKPILDAPITFAEMYKKKMSRDLELAALKKLAKEQKLEDLEKVDLKPKEI  365



>gb|AGC74052.1| flavanone 3-hydroxylase [Strelitzia reginae]
Length=373

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/343 (79%), Positives = 299/343 (87%), Gaps = 3/343 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD---GGVNGRRRG  229
             M P T      E TL +SF+RDEDERPKVAYN FS +IPVISL GIDD    G  GRR  
Sbjct  1     MAPGTAVLPTNEDTLRASFVRDEDERPKVAYNEFSRDIPVISLAGIDDEAEAGPGGRRAE  60

Query  230   ICAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVV  409
             I  +IV+ACE+WGIFQVVDHGVDADL+SQMTSLA  FFA+PPEEKLRFDMSGGKKGGF+V
Sbjct  61    IRRRIVEACEDWGIFQVVDHGVDADLVSQMTSLAREFFALPPEEKLRFDMSGGKKGGFIV  120

Query  410   SSHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVL  589
             SSHLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSEKLM +A +LLEVL
Sbjct  121   SSHLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRSVVESYSEKLMGLACRLLEVL  180

Query  590   SEAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ  769
             SEAMGL+KE L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ
Sbjct  181   SEAMGLDKEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ  240

Query  770   ATKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPA  949
             ATKDGGKTWITVQP+  AFVVNLGDHGH LSNGRFK+ADHQAVVNS  SR+SIA FQ PA
Sbjct  241   ATKDGGKTWITVQPVEDAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRMSIATFQNPA  300

Query  950   PEASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PEA VYPL +REGEKPI++E ITF+EMYRRKMS+D+ELA+LKK
Sbjct  301   PEAIVYPLAIREGEKPILDEPITFSEMYRRKMSRDLELAKLKK  343



>emb|CAC26959.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26960.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26961.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=344

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/347 (78%), Positives = 304/347 (88%), Gaps = 5/347 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWPDKPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEK I
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKAI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQLL  1138
             +EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+ 
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVDKPVDQIF  343



>emb|CAC26942.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26943.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26944.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26945.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26946.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26947.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26948.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26956.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26957.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26958.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=344

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/347 (78%), Positives = 304/347 (88%), Gaps = 5/347 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEK I
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKAI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQLL  1138
             +EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+ 
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVAKPVDQIF  343



>gb|AGL50918.1| flavanone 3-hydroxylase [Pyrus communis]
Length=364

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/365 (74%), Positives = 310/365 (85%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGIFQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVEACEDWGIFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A+VYPL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  +       KP
Sbjct  299   ATVYPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQLQDLETAKVDTKP  358

Query  1124  IDQLL  1138
             +D + 
Sbjct  359   VDDIF  363



>ref|XP_008241821.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Prunus mume]
Length=362

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/337 (79%), Positives = 299/337 (89%), Gaps = 2/337 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +AGEKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     TTLTSIAGEKTLQQKFVRDEDERPKVAYNNFSNEIPIISLAGIDE--VEGRRANICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WG+FQ+VDHGVDA LIS+MT LA  FFA+P EEKLR+DMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGVFQIVDHGVDAKLISEMTGLAREFFALPSEEKLRYDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEGWREVTRKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KAC+DMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  184   DTEALTKACIDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA EA VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PL +REGEKPI+E  IT+ EMY++KMSKD+ELARLKK
Sbjct  304   PLSIREGEKPILEGPITYTEMYKKKMSKDLELARLKK  340



>gb|AFR31807.1| flavanone 3-hydroxylase [x Ascocenda sp. NK-2012]
Length=370

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/338 (79%), Positives = 298/338 (88%), Gaps = 4/338 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+ +T    EKTL +SF+RDEDERPK+AYN FS++IPVISL+GID+ G  GRR  IC++I
Sbjct  8     PTAVT----EKTLRASFVRDEDERPKIAYNEFSNQIPVISLQGIDEDGDGGRRSEICSRI  63

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V ACE+WGIFQVVDHGVDA LI+ MT LA  FF +PPEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  64    VAACEDWGIFQVVDHGVDAGLIADMTRLAREFFDLPPEEKLRFDMSGGKKGGFIVSSHLQ  123

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E+YS KLME+A  LL VLSEAMG
Sbjct  124   GEVVQDWREIVTYFSYPIRSRDYSRWPDKPEGWRVVVEEYSAKLMELACNLLGVLSEAMG  183

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             L++E L+ AC+DMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD 
Sbjct  184   LDREALAGACIDMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDD  243

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+  AFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIAAFQ PAPEA V
Sbjct  244   GKTWITVQPVQNAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIAAFQNPAPEAVV  303

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPL VREGE+P+MEEAITFAEMYRRKMS+D+ELARLKK
Sbjct  304   YPLAVREGERPVMEEAITFAEMYRRKMSRDLELARLKK  341



>gb|AAX89397.1| flavanon 3 beta-hydroxylase [Malus domestica]
Length=365

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/361 (75%), Positives = 308/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     TTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDE--VEGRRGEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WGIFQ+VDHGVDA+LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    AACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS S+RLSIA FQ PA EA VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSNRLSIATFQNPAQEAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  + K     KP+D +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLSKEQQLQDLEKAKVDTKPVDDI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>gb|AEF30420.1| flavones 3-hydroxylase [Fagopyrum tataricum]
Length=367

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/363 (74%), Positives = 307/363 (85%), Gaps = 6/363 (2%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             KP TLT L+ E TL +SF+RDEDERPKVAYN+FS++IPVISL GIDD G  G+R  IC +
Sbjct  6     KPKTLTALSEETTLNTSFVRDEDERPKVAYNQFSNDIPVISLAGIDDLG--GKRDEICKK  63

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV ACE+WG+FQVVDHGVD  L+S+MT LA  FFA+P E+KL+FDM+GGKKGGF+VSSHL
Sbjct  64    IVDACEDWGVFQVVDHGVDTKLVSEMTRLARDFFALPAEDKLKFDMTGGKKGGFIVSSHL  123

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VTE YSE+LM +A KLL VLSEAM
Sbjct  124   QGEAVQDWREIVTYFSYPLKARDYSRWPDKPEGWVKVTEHYSEQLMGLACKLLGVLSEAM  183

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GLE E L+KACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ T+D
Sbjct  184   GLETEALTKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQVTRD  243

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
              GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ P P+A+
Sbjct  244   DGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNFSRLSIATFQNPVPDAT  303

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPID  1129
             VYPL VREGE  I+E  ITFAEMYRRKM KD+ELARLKK    Q    + K   +PKPI+
Sbjct  304   VYPLAVREGETLILEAPITFAEMYRRKMGKDLELARLKKLAKEQAQQNLDKAKVEPKPIE  363

Query  1130  QLL  1138
             ++L
Sbjct  364   EIL  366



>sp|Q06942.1|FL3H_MALDO RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H 
[Malus domestica]
 gb|AAD26206.1|AF117270_1 flavanone 3-hydroxylase [Malus domestica]
 emb|CAA49353.1| naringenin, 2-oxoglutarate 3-dioxygenase [Malus sp.]
 gb|ACP30361.1| flavanone 3-hydroxylase protein [Malus hybrid cultivar]
Length=364

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/365 (75%), Positives = 309/365 (85%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDE--VEGRRGEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV ACE+WGIFQ+VDHGVDA+LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVAACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A VYPL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q+   + K     KP
Sbjct  299   AIVYPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQSQDLEKAKVDTKP  358

Query  1124  IDQLL  1138
             +D + 
Sbjct  359   VDDIF  363



>ref|XP_009136604.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Brassica 
rapa]
Length=350

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/340 (78%), Positives = 299/340 (88%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+TLT LAGE  L S F+RD DERPKVAYN FS+EIPVISL GID   V G+R  IC 
Sbjct  1     MAPATLTELAGESKLNSKFVRDVDERPKVAYNEFSNEIPVISLAGIDH--VGGKRGDICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             QIV+ACE WG+F+VVDHGVD  L+  MT LA+ FF++PPE+KL+FDMSGGKKGGF+VSSH
Sbjct  59    QIVEACENWGVFKVVDHGVDTKLVGDMTRLASDFFSLPPEDKLKFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP + RDYSRWP+KPEGW  VTE+YSEKL+E+A KLLE+LSEA
Sbjct  119   LQGEVVQDWREIVTYFSYPVRNRDYSRWPNKPEGWVKVTEEYSEKLIELACKLLEILSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+ ACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  179   MGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             D G+TWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA
Sbjct  239   DDGQTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPLKV+EGEKPI+EE I FAEMY+ KM +D+ELARLKK
Sbjct  299   TVYPLKVKEGEKPILEEPIAFAEMYKIKMGRDLELARLKK  338



>ref|XP_007202107.1| hypothetical protein PRUPE_ppa007636mg [Prunus persica]
 gb|AEJ88219.1| flavanone 3-hydroxylase [Prunus persica]
 gb|EMJ03306.1| hypothetical protein PRUPE_ppa007636mg [Prunus persica]
Length=361

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/341 (78%), Positives = 301/341 (88%), Gaps = 3/341 (1%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +AGEKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAGEKTLQQKFVRDEDERPKVAYNNFSNEIPIISLAGIDE--VEGRRADIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGIFQ+VDHGVD  LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVEACEDWGIFQIVDHGVDTKLISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYS++LM +A KLL VLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEGWREVTQKYSDELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             A+VYPL +REGEKPI+E  IT+ EMY++KM+KD+ELARLKK
Sbjct  299   ATVYPLSIREGEKPILEGPITYTEMYKKKMTKDLELARLKK  339



>emb|CAC26949.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26950.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26951.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=344

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/347 (78%), Positives = 304/347 (88%), Gaps = 5/347 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHG+D +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGLDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWP+KPEGW  VTE+YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPNKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEK I
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKAI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQLL  1138
             +EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+ 
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVAKPVDQIF  343



>emb|CAC26952.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26953.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
 emb|CAC26954.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=344

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/347 (78%), Positives = 304/347 (88%), Gaps = 5/347 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWP+KPEGW  VT++YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPNKPEGWVKVTKEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEK I
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKAI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKKQKMLGIGKPHFQ-PKPIDQLL  1138
             +EE ITFAEMY+RKM +D+ELARLK  K+    + H +  KP+DQ+ 
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLK--KLAKEERDHKEVAKPVDQIF  343



>ref|XP_009382400.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=372

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/340 (79%), Positives = 296/340 (87%), Gaps = 0/340 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P T      E+TL +SF+RDEDERPKVAYN+FS +IPVISL GIDD    G+R  I  
Sbjct  1     MAPGTAVLPTNEQTLRASFVRDEDERPKVAYNQFSLDIPVISLSGIDDDAAGGKRAEIRR  60

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             ++V+ACE+WGIFQVVDHGVDA LIS MT LA  FFA+ PEEKL FDMSGGKKGGF+VSSH
Sbjct  61    KVVEACEDWGIFQVVDHGVDAGLISDMTRLAKEFFALSPEEKLLFDMSGGKKGGFIVSSH  120

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSEKLM +A KLLEVLSEA
Sbjct  121   LQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRSVVESYSEKLMGLACKLLEVLSEA  180

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL+KE L++AC+DMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  181   MGLDKEALTEACIDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  240

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA
Sbjct  241   DGGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEA  300

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPL VREGEKPI+EE ITFAEMYRRKMS+D+ELA+LKK
Sbjct  301   IVYPLAVREGEKPILEEPITFAEMYRRKMSRDLELAKLKK  340



>ref|XP_004512134.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cicer 
arietinum]
Length=365

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/363 (74%), Positives = 311/363 (86%), Gaps = 7/363 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P TLT LA E T  S FIRDEDERPK+A+N FS+EIP+IS+ GID+   N +R  IC +I
Sbjct  4     PKTLTTLADENTFESRFIRDEDERPKIAHNNFSNEIPIISIAGIDEA--NEQREEICKRI  61

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACEEWGIFQVVDHGVD  LIS+MT LA  FFA+ PEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  62    VEACEEWGIFQVVDHGVDTKLISEMTRLAREFFALSPEEKLRFDMSGGKKGGFIVSSHLQ  121

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWP+KPE W  VTE+YSEKLM ++ KLL+VLSEAMG
Sbjct  122   GEAVQDWREIVTYFSYPIKSRDYSRWPEKPEEWKKVTEEYSEKLMSLSCKLLQVLSEAMG  181

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEK+ L+KACVDMDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLL QDQVGGLQATKD 
Sbjct  182   LEKDALTKACVDMDQKVVVNFYPKCPKPDLTLGLKRHTDPGTITLLFQDQVGGLQATKDN  241

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GAFVVNLGDHGH+LSNGRFK+ADHQAVVNS  SRLSIA FQ P+P+A V
Sbjct  242   GKTWITVQPVEGAFVVNLGDHGHILSNGRFKNADHQAVVNSNHSRLSIATFQNPSPDAIV  301

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKMLGIGK--PHFQPKPID  1129
             YPLK+R+GEK ++EE ITFAEMYRRKMSKD+E+ARLK   K+K L   +    F+ KP+D
Sbjct  302   YPLKIRDGEKSLLEEPITFAEMYRRKMSKDLEIARLKKLAKEKQLQDLEISVKFEAKPMD  361

Query  1130  QLL  1138
             ++L
Sbjct  362   KIL  364



>gb|ADZ54782.1| naringenin 3-dioxygenase [Prunus avium]
Length=360

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/341 (78%), Positives = 301/341 (88%), Gaps = 4/341 (1%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +AGEKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+    GRR  IC
Sbjct  1     MAPATTLTSIAGEKTLQQKFVRDEDERPKVAYNNFSNEIPIISLAGIDE---EGRRAEIC  57

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGI+Q+VDHGVDA LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  58    KKIVEACEDWGIYQIVDHGVDAKLISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  117

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYS++LM +A KLL VLSE
Sbjct  118   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEGWREVTQKYSDELMGLACKLLGVLSE  177

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  178   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  237

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  238   RDGGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  297

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             A VYPL +REGEKPI+E  IT+ EMY++KM +D+ELARLKK
Sbjct  298   AIVYPLSIREGEKPILEGPITYTEMYKKKMGRDLELARLKK  338



>ref|XP_006574679.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoform X2 
[Glycine max]
Length=371

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/336 (79%), Positives = 297/336 (88%), Gaps = 7/336 (2%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TLT LA +KTL SSF+RDE+ERPKVAYN FSDEIPVISL GID+  V+GRRR IC +IV+
Sbjct  8     TLTYLAQQKTLESSFVRDEEERPKVAYNEFSDEIPVISLAGIDE--VDGRRREICEKIVE  65

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WGIFQVVDHGVD  L+++MT LA  FFA+PP+EKLRFDMSG KKGGF+VSSHLQ  
Sbjct  66    ACENWGIFQVVDHGVDQQLVAEMTRLAKEFFALPPDEKLRFDMSGAKKGGFIVSSHLQ--  123

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
                +WRE+V YFSYPK++RDYSRWP KPEGW   TE+YSEKLM +A KL+EVLSEAMGLE
Sbjct  124   ---DWREIVIYFSYPKRERDYSRWPHKPEGWRWATEEYSEKLMGLAGKLMEVLSEAMGLE  180

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KEGLSKACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  181   KEGLSKACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGK  240

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP+  AFVVNLGDH H L+NGRFK+ADHQAVVNS  SRLSIA FQ PAP A+VYP
Sbjct  241   TWITVQPVEAAFVVNLGDHAHYLTNGRFKNADHQAVVNSNHSRLSIATFQNPAPNATVYP  300

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LK+REGEKP+MEE ITFAEMYRRKMSKD+E+AR+KK
Sbjct  301   LKIREGEKPVMEEPITFAEMYRRKMSKDLEIARMKK  336



>gb|AAX89399.1| flavanon 3 beta-hydroxylase [Pyrus communis]
 gb|AAX89400.1| flavanon 3 beta-hydroxylase [Pyrus communis]
Length=364

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/365 (74%), Positives = 309/365 (85%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDE--VEGRRAEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV ACE+WG+FQ+VDHGVDA+LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVAACEDWGVFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A+VYPL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  +       KP
Sbjct  299   ATVYPLCVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQLQDLETAKVDTKP  358

Query  1124  IDQLL  1138
             +D + 
Sbjct  359   VDDIF  363



>emb|CAC26955.1| flavanone-3-hydroxylase [Arabidopsis thaliana]
Length=344

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/326 (81%), Positives = 294/326 (90%), Gaps = 2/326 (1%)
 Frame = +2

Query  101   LGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQV  280
             L S F+RDEDERPKVAYN FSDEIPVISL GIDD  V+G+R  IC QIV+ACE WGIFQV
Sbjct  1     LNSKFVRDEDERPKVAYNVFSDEIPVISLAGIDD--VDGKRGEICRQIVEACENWGIFQV  58

Query  281   VDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVT  460
             VDHGVD +L++ MT LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VT
Sbjct  59    VDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVT  118

Query  461   YFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVD  640
             YFSYP + RDYSRWP+KPEGW  VT++YSE+LM +A KLLEVLSEAMGLEKE L+ ACVD
Sbjct  119   YFSYPVRNRDYSRWPNKPEGWVKVTKEYSERLMSLACKLLEVLSEAMGLEKESLTNACVD  178

Query  641   MDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPING  820
             MDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GKTWITVQP+ G
Sbjct  179   MDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGKTWITVQPVEG  238

Query  821   AFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPI  1000
             AFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYPLKVREGEK I
Sbjct  239   AFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDATVYPLKVREGEKAI  298

Query  1001  MEEAITFAEMYRRKMSKDIELARLKK  1078
             +EE ITFAEMY+RKM +D+ELARLKK
Sbjct  299   LEEPITFAEMYKRKMGRDLELARLKK  324



>ref|NP_001280854.1| naringenin,2-oxoglutarate 3-dioxygenase [Malus domestica]
 gb|AAX89398.1| flavanon 3 beta-hydroxylase [Malus domestica]
Length=365

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/361 (75%), Positives = 307/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL G+D+  V GRR  IC +IV
Sbjct  6     TTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGLDE--VEGRRGEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WGIFQ+VDHGVDA+LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    AACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGHLLSNGR K+ADHQAVVNS SSRLSIA FQ PA EA VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHLLSNGRVKNADHQAVVNSNSSRLSIATFQNPAQEAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  + K     KP+D +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLSKEQQLQDLEKAKVDTKPVDDI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>gb|AGL81347.1| flavanone 3-hydroxylase [Pyrus communis]
Length=364

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/365 (74%), Positives = 308/365 (84%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDE--VEGRRPEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV ACE+WG+FQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVAACEDWGVFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS +LM +A KLL VLSE
Sbjct  119   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSNELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A+VYPL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  +       KP
Sbjct  299   ATVYPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQLQDLETAKVDTKP  358

Query  1124  IDQLL  1138
             +D + 
Sbjct  359   VDDIF  363



>gb|AAR01566.1| flavanone 3-hydroxylase [Sinningia cardinalis]
Length=372

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/338 (78%), Positives = 298/338 (88%), Gaps = 3/338 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRG-ICAQI  244
             +TLT LA E +L   FIRDEDERPKVAYN+FS EIP+ISL GID+   NG  R  IC +I
Sbjct  6     TTLTALAEENSLHQKFIRDEDERPKVAYNQFSTEIPIISLAGIDE--TNGHHREEICKKI  63

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V+ACE+WGIFQV+DHG+D+ LI+QMT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  64    VEACEDWGIFQVIDHGIDSKLINQMTCLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQ  123

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW   TE YSE+L+++ASKLLEVLSEAMG
Sbjct  124   GEAVQDWREIVTYFSYPIKARDYSRWPDKPEGWKATTEAYSEQLIKLASKLLEVLSEAMG  183

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEK+ L+K+CVDMDQK+VVNFYPKCPQP+LTLGLKRHTDPGTITLLLQDQVGGLQATKDG
Sbjct  184   LEKDALTKSCVDMDQKVVVNFYPKCPQPELTLGLKRHTDPGTITLLLQDQVGGLQATKDG  243

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA V
Sbjct  244   GKTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEAIV  303

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPLK+R+GE  IME+ ITF EMY+RKMS D+ELAR+KK
Sbjct  304   YPLKIRDGENSIMEKPITFLEMYKRKMSNDLELARIKK  341



>gb|AEO79981.1| flavanone 3-hydroxylase [Prunus avium]
Length=360

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/341 (78%), Positives = 301/341 (88%), Gaps = 4/341 (1%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +AGEKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+    GRR  IC
Sbjct  1     MAPATTLTSIAGEKTLQQKFVRDEDERPKVAYNNFSNEIPIISLAGIDE---EGRRAEIC  57

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGI+Q+VDHGVDA LIS+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  58    KKIVEACEDWGIYQIVDHGVDAKLISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  117

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  VT+KYS++LM +A KLL VLSE
Sbjct  118   HLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEGWREVTQKYSDELMGLACKLLGVLSE  177

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  178   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  237

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVV+LGDHGHLLSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  238   RDGGKTWITVQPVEGAFVVDLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  297

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             A VYPL +REGEKPI+E  IT+ EMY++KM +D+ELARLKK
Sbjct  298   AIVYPLSIREGEKPILEGPITYTEMYKKKMGRDLELARLKK  338



>ref|XP_003629320.1| Flavanone 3-hydroxylase [Medicago truncatula]
 gb|AET03796.1| naringenin 3-dioxygenase (flavanone-3-hydroxylase) [Medicago 
truncatula]
Length=365

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 310/361 (86%), Gaps = 7/361 (2%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             TL  LA EKTL SSFIRD  ERPKVAYN FS+EIP+ISL GIDD  V+G R   C +IV+
Sbjct  6     TLKYLAQEKTLESSFIRDVSERPKVAYNNFSNEIPIISLAGIDD--VDGLRIETCNKIVE  63

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WGIFQ+VDHGVD  LIS+MT LA  FF +PPEEKLRFD+SGGKKGGF+VSSHLQGE
Sbjct  64    ACENWGIFQIVDHGVDQKLISEMTRLAKGFFDLPPEEKLRFDLSGGKKGGFIVSSHLQGE  123

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              V++WREM+ YFSYP ++RDYSRWP+KPEGW  VTE+YSEKLM ++ KLLEVLSEAMGLE
Sbjct  124   PVRDWREMMIYFSYPIKQRDYSRWPNKPEGWKEVTEQYSEKLMSLSCKLLEVLSEAMGLE  183

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             KE L+KACVDMDQK+V+N YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D GK
Sbjct  184   KEALTKACVDMDQKLVINNYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNGK  243

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITV+PI GAFVVN+GDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+VYP
Sbjct  244   TWITVKPIEGAFVVNIGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPDATVYP  303

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-----QKMLGIGKPHFQPKPIDQL  1135
             LK+R+GEK +MEE ITFAEMYRRKMSKD+E+AR+KK     +++  + K   +PKP++++
Sbjct  304   LKIRDGEKSVMEEPITFAEMYRRKMSKDLEIARMKKLGKEEKELRNLEKAKLEPKPLNEI  363

Query  1136  L  1138
             L
Sbjct  364   L  364



>gb|AAM18084.1| flavanone 3-hydroxylase [Pyrus communis]
Length=364

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/365 (74%), Positives = 307/365 (84%), Gaps = 7/365 (2%)
 Frame = +2

Query  59    MKP-STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC
Sbjct  1     MAPATTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDE--VEGRRPEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV ACE+WG+FQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSS
Sbjct  59    KKIVAACEDWGVFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEA Q+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS +LM +A KLL VLSE
Sbjct  119   HLQGEAAQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSNELMGLACKLLGVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  179   AMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D GKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA E
Sbjct  239   RDDGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKP  1123
             A+VYPL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  +       KP
Sbjct  299   ATVYPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQLQDLETAKVDTKP  358

Query  1124  IDQLL  1138
             +D + 
Sbjct  359   VDDIF  363



>gb|EYU36787.1| hypothetical protein MIMGU_mgv1a008982mg [Erythranthe guttata]
Length=356

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/336 (79%), Positives = 295/336 (88%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             T+T L+ E +L   FIRDE+ERPKVAYN+FSDEIPVISL GI++ G    R  IC +IV 
Sbjct  9     TITALSEENSLDEKFIRDENERPKVAYNQFSDEIPVISLAGIEESG--EERAEICRKIVA  66

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE WGIFQVVDHGVD+D+I  MT LA  FFA P EEKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  67    ACEGWGIFQVVDHGVDSDVIDDMTRLAREFFAFPAEEKLRFDMSGGKKGGFIVSSHLQGE  126

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              VQ+WRE+VTYFSYP Q RDYSRWPDKPE W  VTE YSE+LM++  KLLEVLSEAMGLE
Sbjct  127   VVQDWREIVTYFSYPIQARDYSRWPDKPESWRAVTETYSEQLMKLGCKLLEVLSEAMGLE  186

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             K+ LSKACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG+
Sbjct  187   KDALSKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGE  246

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A+VYP
Sbjct  247   TWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPQAAVYP  306

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LK+REGE PIMEE ITF+EMY++KM+KD+ELA LKK
Sbjct  307   LKIREGEDPIMEEPITFSEMYKKKMAKDLELANLKK  342



>gb|ADP09378.1| flavanone 3-hydroxylase [Pyrus pyrifolia]
Length=365

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 308/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     ATLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WGIFQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGIFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA +A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+E+ARLKK    Q++  + K   + KP + +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLEVARLKKLAKEQELQDLEKDKVEIKPANDI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>gb|AGZ15309.1| flavanone 3-hydroxylase [Pyrus x bretschneideri]
Length=365

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 308/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     ATLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WGIFQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGIFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA +A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+E+ARLKK    Q++  + K   + KP + +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLEVARLKKLAKEQQLQDLEKDKVEIKPANDI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>gb|AGD99671.1| flavonoid 3' hydroxylase [Lycoris chinensis]
Length=365

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/335 (79%), Positives = 298/335 (89%), Gaps = 4/335 (1%)
 Frame = +2

Query  59    MKPST-LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P T L  L+ EKTL SSF+RDEDERPKVAYN FSDEIP+ISL GIDDG    RR GIC
Sbjct  1     MAPITFLPTLSEEKTLRSSFVRDEDERPKVAYNEFSDEIPIISLAGIDDGE---RRVGIC  57

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+ACE+WGIFQVVDHGVD ++I++MT +A  FFA+PPE+KLRFDMSGGKKGGF+VSS
Sbjct  58    EKIVEACEDWGIFQVVDHGVDGEIIAEMTRMAREFFALPPEDKLRFDMSGGKKGGFIVSS  117

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKP+GW  V EKYSEKLME+A KLL VLSE
Sbjct  118   HLQGEAVQDWREIVTYFSYPIKARDYSRWPDKPDGWISVAEKYSEKLMELACKLLGVLSE  177

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+ E L+KACVDMDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  178   AMGLDHEALTKACVDMDQKMVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  237

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             KDGGKTWIT+QP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+
Sbjct  238   KDGGKTWITIQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPD  297

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIE  1060
             A VYPL +REGEKPI+++ ITFAEMYR+KMS+DIE
Sbjct  298   AIVYPLAIREGEKPILDKPITFAEMYRKKMSRDIE  332



>ref|NP_001280883.1| naringenin,2-oxoglutarate 3-dioxygenase-like [Malus domestica]
 dbj|BAB92997.1| flavanone 3-hydroxylase [Malus domestica]
Length=365

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/361 (74%), Positives = 306/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     TTLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WGIFQ+VDHGVDA+LIS+MT LA  FF +P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGIFQIVDHGVDAELISEMTGLAKEFFDLPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYF YP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFLYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA +A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+ELARLKK    Q++  + K   + KP D +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLAKEQQLQDLEKAKVETKPADDI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>ref|XP_004509358.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cicer 
arietinum]
Length=367

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/367 (74%), Positives = 311/367 (85%), Gaps = 8/367 (2%)
 Frame = +2

Query  59    MKPS-TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+ TL  L+ E TL SSF+RDEDERPKVAYN FS++IPVISL GI+D  V GRR  IC
Sbjct  1     MAPAQTLNYLSQENTLESSFVRDEDERPKVAYNNFSNDIPVISLAGIEDV-VGGRRIEIC  59

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
               IV+ACE WGIFQ+VDHGVD DLIS+MT  A  FF +PPEEKLRFDMSGGKKGGF VSS
Sbjct  60    NNIVEACENWGIFQIVDHGVDRDLISEMTRFAKGFFDLPPEEKLRFDMSGGKKGGFNVSS  119

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAV++WRE++ Y SYP  +RDYS WP+KPEGW  VTE+YSEKLM ++ KLLEVLSE
Sbjct  120   HLQGEAVKDWREIMIYSSYPISERDYSMWPNKPEGWRKVTEQYSEKLMGLSCKLLEVLSE  179

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGLEKE ++KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT
Sbjct  180   AMGLEKEAVTKACVDMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  239

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D G TWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+
Sbjct  240   RDDGNTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPD  299

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK------QKMLGIGKPHFQP  1117
             A+VYPLK++EGEK IMEE ITFAEMYRRKMSKD+E+AR+KK      +++  + K + + 
Sbjct  300   ATVYPLKIKEGEKSIMEEPITFAEMYRRKMSKDLEIARMKKLAKDSYKEITHLEKANLET  359

Query  1118  KPIDQLL  1138
             KP++++L
Sbjct  360   KPLNEIL  366



>gb|ACR47976.1| flavanone 3-hydroxylase [Juglans regia]
Length=342

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/344 (78%), Positives = 302/344 (88%), Gaps = 9/344 (3%)
 Frame = +2

Query  125   EDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQVVDHGVDAD  304
             EDERPKVAYN+FS EIP+ISL GID+  V+GRR  IC +IV+ACE+WGIFQVVDHGVDA 
Sbjct  1     EDERPKVAYNQFSTEIPIISLAGIDE--VHGRRTEICQKIVEACEDWGIFQVVDHGVDAS  58

Query  305   LISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVTYFSYPKQK  484
             LIS MT LA  FFAMPPEEKLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE+VTYFSYP + 
Sbjct  59    LISDMTRLARDFFAMPPEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRT  118

Query  485   RDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVDMDQKIVVN  664
             RDYSRWPDKPEGW  VTE+YS+KLM +A KLLEVLSEAMGLEKE L+KACVDMDQK+VVN
Sbjct  119   RDYSRWPDKPEGWRKVTEEYSDKLMGLACKLLEVLSEAMGLEKEALTKACVDMDQKVVVN  178

Query  665   FYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPINGAFVVNLGD  844
             +YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGKTWITVQP+ GAFVVNLGD
Sbjct  179   YYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVQPVEGAFVVNLGD  238

Query  845   HGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPIMEEAITFA  1024
             HGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+VYPLK+REGEKP++ E +TFA
Sbjct  239   HGHFLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPDATVYPLKIREGEKPVL-EPMTFA  297

Query  1025  EMYRRKMSKDIELARLKK------QKMLGIGKPHFQPKPIDQLL  1138
             EMYRRKMSKD+ELARLKK      Q++    K   + KPI+++ 
Sbjct  298   EMYRRKMSKDLELARLKKLAKEQQQQLQDSEKAKLEAKPIEEIF  341



>ref|XP_009409832.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=373

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/342 (77%), Positives = 295/342 (86%), Gaps = 2/342 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD--GGVNGRRRGI  232
             M P T      E TL +SF+RDEDERPKVAYN+FS +IPVISL G+DD  G   GRR  I
Sbjct  1     MAPGTALLPTNEATLRASFVRDEDERPKVAYNQFSSDIPVISLAGVDDEDGATGGRRAEI  60

Query  233   CAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVS  412
               +IV+ACE+WG+FQV+DHGVDA +IS+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VS
Sbjct  61    RRKIVEACEDWGLFQVLDHGVDAGMISEMTRLARDFFALPPEEKLRFDMSGGKKGGFIVS  120

Query  413   SHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLS  592
             SHLQGEAVQ+WRE+VTYFSYP   RDYSRWPDKPEGW  V E YSEKLM +A KLLEVLS
Sbjct  121   SHLQGEAVQDWREIVTYFSYPIGARDYSRWPDKPEGWRSVVESYSEKLMGLACKLLEVLS  180

Query  593   EAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  772
             EAMGL+KE L+ ACVDMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA
Sbjct  181   EAMGLDKEALTDACVDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA  240

Query  773   TKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAP  952
             TKDGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP
Sbjct  241   TKDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSCSRLSIATFQNPAP  300

Query  953   EASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             EA VYPL +REG+KPI++E ITF+EMYRRKMS+D+ELA LK 
Sbjct  301   EAIVYPLAIREGDKPILDEPITFSEMYRRKMSRDLELANLKN  342



>gb|ADP08986.1| flavanone 3-hydroxylase [Curcuma alismatifolia]
Length=376

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/343 (78%), Positives = 297/343 (87%), Gaps = 3/343 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVN---GRRRG  229
             M P        E+TL +SF+RDEDERPKVAYN FS +I VISL GIDD   +   G+R  
Sbjct  1     MAPGATVLPTNEETLRASFVRDEDERPKVAYNHFSHDISVISLAGIDDEAASDDGGKREE  60

Query  230   ICAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVV  409
             I  +IV+ACE+WG+FQVVDHGVDA LI++MT LA  FFA+PPEEKLRFDMSGGKKGGF+V
Sbjct  61    IRRRIVEACEDWGVFQVVDHGVDAGLIAEMTRLAREFFALPPEEKLRFDMSGGKKGGFIV  120

Query  410   SSHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVL  589
             SSHLQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSEKLM +A KLLEVL
Sbjct  121   SSHLQGEAVQDWREIVTYFSYPLRARDYSRWPDKPEGWRSVVEAYSEKLMGLACKLLEVL  180

Query  590   SEAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ  769
             SEAMGL+KE L+KAC+DMDQK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ
Sbjct  181   SEAMGLDKEALTKACIDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQ  240

Query  770   ATKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPA  949
             ATKDGGKTWITV+P+ GAFVVNLGDHGH LSNGRFK+ADHQAVV+S  SRLSIA FQ PA
Sbjct  241   ATKDGGKTWITVEPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVSSNCSRLSIATFQNPA  300

Query  950   PEASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PEA VYPL VREGEKPI+EE ITF+EMYRRKMSKD+ELA+LKK
Sbjct  301   PEAIVYPLAVREGEKPILEEPITFSEMYRRKMSKDLELAKLKK  343



>gb|AGZ15308.1| flavanone 3-hydroxylase [Pyrus x bretschneideri]
Length=365

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/337 (78%), Positives = 298/337 (88%), Gaps = 2/337 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     ATLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WGIFQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGIFQIVDHGVDAELVSEMTGLAGEFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W  VT+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA +A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PL VREGEKPI+E  IT+ EMY++KMSKD+E+ARLKK
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLEVARLKK  340



>ref|XP_010934537.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Elaeis 
guineensis]
Length=371

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/344 (78%), Positives = 297/344 (86%), Gaps = 4/344 (1%)
 Frame = +2

Query  59    MKPST--LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDG-GVNGRRRG  229
             M P T  L  +  EK L  +F+RDEDERPKVAYN+FS++IPVISL GIDD  GV G +R 
Sbjct  1     MAPGTPFLPTITDEKILRPNFVRDEDERPKVAYNQFSNDIPVISLAGIDDEEGVGGEKRS  60

Query  230   -ICAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFV  406
              IC +IV ACE+WGIFQVVDHGVD +L+S+MT LA  FF +PPEEKLRFDMSGGKKGGF+
Sbjct  61    EICHKIVAACEDWGIFQVVDHGVDTELVSEMTRLAKEFFVLPPEEKLRFDMSGGKKGGFI  120

Query  407   VSSHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEV  586
             VSSHLQGEAVQ+WRE+VT+FSYP   RDYSRWPDKPEGW  V E YSEKLM +A KLL V
Sbjct  121   VSSHLQGEAVQDWREIVTFFSYPIGARDYSRWPDKPEGWRSVAESYSEKLMGLACKLLGV  180

Query  587   LSEAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGL  766
             LSEAMGLEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLL QDQVGGL
Sbjct  181   LSEAMGLEKEALTKACVDMDQKMVVNFYPKCPQPDLTLGLKRHTDPGTITLLYQDQVGGL  240

Query  767   QATKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIP  946
             QATKDGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS   RLSIA FQ P
Sbjct  241   QATKDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYERLSIATFQNP  300

Query  947   APEASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             APEA VYPL +REGEKP+++E ITFA+MYRRKMSKD+ELA+LKK
Sbjct  301   APEAIVYPLAIREGEKPVLDEPITFAKMYRRKMSKDLELAQLKK  344



>ref|XP_009363496.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Pyrus x bretschneideri]
Length=365

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/361 (74%), Positives = 307/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EKTL   F+RDEDERPKVAYN FS+EIP+ISL GID+  V GRR  IC +IV
Sbjct  6     ATLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE--VEGRRAEICKKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE+WGIFQ+VDHGVDA+L+S+MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    EACEDWGIFQIVDHGVDAELVSEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKPE W   T+KYS++LM +A KLL VLSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREGTKKYSDELMGLACKLLGVLSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             + E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  184   DTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA +A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQL  1135
             PL VREGEKPI+E  IT+ EMY++KMSKD+E+ARLKK    Q++  + K   + KP + +
Sbjct  304   PLSVREGEKPILEAPITYTEMYKKKMSKDLEVARLKKLAKEQQLQDLEKDKVEIKPANGI  363

Query  1136  L  1138
              
Sbjct  364   F  364



>sp|Q05964.1|FL3H_DIACA RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H 
[Dianthus caryophyllus]
 emb|CAA49839.1| naringenin 3-dioxygenase [Dianthus caryophyllus]
 emb|CAA51190.1| naringenin,2-oxoglutarate 3-dioxygenase [Dianthus caryophyllus]
Length=365

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/365 (74%), Positives = 307/365 (84%), Gaps = 11/365 (3%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRG-ICA  238
             KP TLT L G+  L S+F+RDEDERPKVAYN FS++IPVISL GID     G +RG IC 
Sbjct  5     KPKTLTSLEGDDKLNSNFVRDEDERPKVAYNEFSNDIPVISLAGID-----GEKRGEICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQVVDHGV  DLI+ MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSH
Sbjct  60    KIVEACEDWGIFQVVDHGVGDDLIADMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGE VQ+WRE+VTYFSYP   RDY+RWPDKPEGW  VTE+YS KLM +A  LL VLSEA
Sbjct  120   LQGEVVQDWREIVTYFSYPTNSRDYTRWPDKPEGWIKVTEEYSNKLMTLACTLLGVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLE E L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+
Sbjct  180   MGLELEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SRLSIA FQ P+P+A
Sbjct  240   DGGKTWITVQPVPGAFVVNLGDHGHFLSNGRFKNADHQAVVNSECSRLSIATFQNPSPDA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELA---RLKKQKM--LGIGKPHFQPKP  1123
             +VYPL +REGE  IMEE ITFA++YRRKM+KD+E+A   RL K++M    + +  F+ K 
Sbjct  300   TVYPLAIREGENSIMEEPITFADLYRRKMAKDLEIARHKRLAKEEMPFKELDEAKFESKS  359

Query  1124  IDQLL  1138
             IDQ+L
Sbjct  360   IDQIL  364



>dbj|BAE79203.1| flavanone 3-hidroxylase [Lilium speciosum]
Length=369

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/335 (78%), Positives = 296/335 (88%), Gaps = 2/335 (1%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L  ++ EKTL +SF+RDEDERPKVAYN FSD+IP+ISL G+D+ G    R  IC +IV A
Sbjct  9     LPTISDEKTLRASFVRDEDERPKVAYNNFSDDIPIISLAGMDEDG--PIRSEICGKIVAA  66

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
             CE+WGIFQVVDHGVDA L+++M  LA  FFA+PPE+KLRFDM+GGKKGGF+VSSHLQGEA
Sbjct  67    CEDWGIFQVVDHGVDAGLVTEMNRLAREFFALPPEDKLRFDMTGGKKGGFIVSSHLQGEA  126

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSE+LM +A KLL VLSEAMGL+K
Sbjct  127   VQDWREIVTYFSYPIRVRDYSRWPDKPEGWRAVVEAYSEQLMGLACKLLGVLSEAMGLDK  186

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG T
Sbjct  187   EALTKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGNT  246

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITV+PI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAPEA+VYPL
Sbjct  247   WITVKPIEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATVYPL  306

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              +R+GEKP+++  +TF+EMYR+KMSKDIELA+LKK
Sbjct  307   AIRDGEKPVLDAPMTFSEMYRKKMSKDIELAKLKK  341



>dbj|BAM28970.1| flavanone 3-hydroxylase [Lilium hybrid division I]
Length=369

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/362 (73%), Positives = 307/362 (85%), Gaps = 9/362 (2%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L  ++ EKTL +SF+RDEDERPKVAYN FSD+IP+ISL G+DD G    R  IC++IV A
Sbjct  9     LPTISDEKTLRASFVRDEDERPKVAYNIFSDDIPIISLAGMDDDG--SIRSEICSKIVAA  66

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
             CE+WGIFQVVDHGVDA L+++M  LA  FFA+PPE+KLRFDM+GGKKGGF+VSSHLQGEA
Sbjct  67    CEDWGIFQVVDHGVDAGLVTEMNRLAREFFALPPEDKLRFDMTGGKKGGFIVSSHLQGEA  126

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSE LM +A KLL VLSEAMGL+K
Sbjct  127   VQDWREIVTYFSYPIRVRDYSRWPDKPEGWRTVVEAYSEHLMGLACKLLGVLSEAMGLDK  186

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG T
Sbjct  187   EALTKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGNT  246

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITV+PI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SR+SIA FQ PAPEA+VYPL
Sbjct  247   WITVKPIEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNCSRMSIATFQNPAPEATVYPL  306

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKP---HFQPKPIDQ  1132
              +R+GEKP+++  +TF+EMYR+KMS+DIELA+LKK    +   G  KP     QP+ +DQ
Sbjct  307   AIRDGEKPVLDAPMTFSEMYRKKMSRDIELAKLKKLAKTEAQEGAKKPTEVAVQPEKLDQ  366

Query  1133  LL  1138
             +L
Sbjct  367   IL  368



>gb|AAS20189.1| flavanone-3-hydroxylase [Gypsophila paniculata]
Length=365

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 309/364 (85%), Gaps = 9/364 (2%)
 Frame = +2

Query  62    KPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQ  241
             +P TLT L G+  L  +FIRDEDERPKVAYN FS++IPVISL G+D  G N  R  IC +
Sbjct  5     RPKTLTSLEGDNKLNPNFIRDEDERPKVAYNTFSNDIPVISLAGLD--GEN--RAEICRK  60

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             IV+ACE+WGIFQVVDHGV  DLI+ MT LA  FFA+PP+EKL++DMSGGKKGGF+VSSHL
Sbjct  61    IVEACEDWGIFQVVDHGVGDDLIADMTRLAREFFALPPDEKLQYDMSGGKKGGFIVSSHL  120

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGE VQ+WRE+VTYFSYP   RDY+RWPDKP+GW  VTE+YS KLM +A +LL VLSEAM
Sbjct  121   QGEVVQDWREIVTYFSYPITSRDYTRWPDKPDGWKKVTEEYSNKLMGLACRLLGVLSEAM  180

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GLE E L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D
Sbjct  181   GLESEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRD  240

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
             GG+TWITVQPI+GAFVVNLGDHGH LSNGRFK+ADHQAVVNS+ SRLSIA FQ PAPEA+
Sbjct  241   GGRTWITVQPISGAFVVNLGDHGHFLSNGRFKNADHQAVVNSECSRLSIATFQNPAPEAT  300

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK---KQKML--GIGKPHFQPKPI  1126
             VYPL +REGEK IMEE ITFAEMYRRKMSKD+E ARLK   K++++   + K   + K I
Sbjct  301   VYPLAIREGEKSIMEEPITFAEMYRRKMSKDLEAARLKRLAKEELVIKEMDKAKLETKSI  360

Query  1127  DQLL  1138
             +Q+L
Sbjct  361   EQIL  364



>gb|AAP20865.1| putative flavonoid 3-hydroxylase [Anthurium andraeanum]
 gb|AIZ74401.1| flavanone 3-hydroxylase [Anthurium andraeanum]
Length=370

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/339 (77%), Positives = 295/339 (87%), Gaps = 0/339 (0%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L   A E TL  SFIRDEDERPKV +N+FSD IPV+SL GIDD   + RR  +C +IV+A
Sbjct  9     LPTTAEEATLRPSFIRDEDERPKVPHNQFSDAIPVLSLAGIDDSDGSPRRAELCREIVEA  68

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
             CE WGIFQVVDHGVD  L++ MT LAT FFA+PPE+KLR+DMSGGKKGGF+VSSHLQGEA
Sbjct  69    CEGWGIFQVVDHGVDPGLVADMTRLATEFFALPPEDKLRYDMSGGKKGGFIVSSHLQGEA  128

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYP + RDY+RWPDKPEGW  V E YSE LM +A KLL VLSEAMGL+K
Sbjct  129   VQDWREIVTYFSYPVRARDYTRWPDKPEGWRAVVEAYSEGLMGLACKLLGVLSEAMGLDK  188

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KACVDMDQK+VVNFYP+CPQPDLTLG+KRHTDPGTITLLLQDQVGGLQAT+DGGKT
Sbjct  189   EALAKACVDMDQKVVVNFYPRCPQPDLTLGVKRHTDPGTITLLLQDQVGGLQATRDGGKT  248

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLSIA FQ PAPE  VYPL
Sbjct  249   WITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSERSRLSIATFQNPAPEGVVYPL  308

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKML  1090
              VREGEKP+++E I+F+EMYRRKMS+D+ELARLKKQ  L
Sbjct  309   AVREGEKPVLDEPISFSEMYRRKMSRDLELARLKKQAKL  347



>gb|ABI50233.1| flavanone 3-hydroxylase [Anthurium andraeanum]
Length=370

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/339 (77%), Positives = 295/339 (87%), Gaps = 0/339 (0%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L   A E TL  SFIRDEDERPKV +N+FSD IPV+SL GIDD   + RR  +C +IV+A
Sbjct  9     LPTTAEEATLRPSFIRDEDERPKVPHNQFSDAIPVLSLAGIDDSDGSPRRAELCREIVEA  68

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
             CE WGIFQVVDHGVD  L++ MT LAT FFA+PPE+KLR+DMSGGKKGGF+VSSHLQGEA
Sbjct  69    CEGWGIFQVVDHGVDPGLVADMTRLATEFFALPPEDKLRYDMSGGKKGGFIVSSHLQGEA  128

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYP + RDY+RWPDKPEGW  V E YSE LM +A KLL VLSEAMGL+K
Sbjct  129   VQDWREIVTYFSYPVRARDYTRWPDKPEGWRAVVEAYSEGLMGLACKLLGVLSEAMGLDK  188

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KACVDMDQK+VVNFYP+CPQPDLTLG+KRHTDPGTITLLLQDQVGGLQAT+DGGKT
Sbjct  189   EALAKACVDMDQKVVVNFYPRCPQPDLTLGVKRHTDPGTITLLLQDQVGGLQATRDGGKT  248

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLSIA FQ PAPE  VYPL
Sbjct  249   WITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSERSRLSIATFQNPAPEGVVYPL  308

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKML  1090
              VREGEKP+++E I+F+EMYRRKMS+D+ELARLKKQ  L
Sbjct  309   AVREGEKPVLDEPISFSEMYRRKMSRDLELARLKKQAKL  347



>ref|XP_008777191.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Phoenix 
dactylifera]
Length=373

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/372 (73%), Positives = 310/372 (83%), Gaps = 12/372 (3%)
 Frame = +2

Query  59    MKPST--LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNG---RR  223
             M P+T  L     EKTL  SFIRDEDERPKVAYN+FSD+IPVISL GID+        +R
Sbjct  1     MAPATPFLPTATDEKTLRPSFIRDEDERPKVAYNQFSDDIPVISLAGIDEEEEEEGGEKR  60

Query  224   RGICAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggF  403
             + IC +IV ACE+WGIFQVVDHGVDA+LIS+MT L+  FFA+PPEEKLRFDMSGGKKGGF
Sbjct  61    KEICRKIVAACEDWGIFQVVDHGVDAELISEMTRLSKEFFALPPEEKLRFDMSGGKKGGF  120

Query  404   VVSSHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLE  583
             +VSSHLQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPEGW    E YSEKLM +A KLL 
Sbjct  121   IVSSHLQGEAVQDWREIVTFFSYPIRARDYSRWPDKPEGWKSTVESYSEKLMNLACKLLG  180

Query  584   VLSEAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGG  763
             VLSEAMGL+KE L++ACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLL QDQVGG
Sbjct  181   VLSEAMGLDKEALTQACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLFQDQVGG  240

Query  764   LQATKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQI  943
             LQAT+DGGKTWITVQP+ GA VVNLGDHGH LSNGRFK+ADHQAVVNS   RLSIA FQ 
Sbjct  241   LQATRDGGKTWITVQPVAGALVVNLGDHGHYLSNGRFKNADHQAVVNSNYERLSIATFQN  300

Query  944   PAPEASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK------QKML-GIGK  1102
             PAPEA VYPL +REGEKP+++E ITFAEMYR KMSKD+ELA+LKK      Q++L   G+
Sbjct  301   PAPEAIVYPLAIREGEKPVLDEPITFAEMYRGKMSKDLELAKLKKMAKMEQQEVLKKAGE  360

Query  1103  PHFQPKPIDQLL  1138
                QPK ++++L
Sbjct  361   VTAQPKALNEIL  372



>ref|XP_010940993.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Elaeis 
guineensis]
Length=372

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/344 (77%), Positives = 295/344 (86%), Gaps = 4/344 (1%)
 Frame = +2

Query  59    MKPST--LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD--GGVNGRRR  226
             M P T  L     EKTL  SFIRDEDERPKVAYN+FS++IPVISL GIDD  G    +R+
Sbjct  1     MAPGTPFLPTATDEKTLRPSFIRDEDERPKVAYNQFSNDIPVISLAGIDDEEGAGGEKRK  60

Query  227   GICAQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFV  406
              IC +IV ACE+WGIFQVVDHGVD +LIS+M  L+  FF +PPEEKLRFDMSGGKKGGF+
Sbjct  61    EICRKIVAACEDWGIFQVVDHGVDPELISEMKRLSKEFFVLPPEEKLRFDMSGGKKGGFI  120

Query  407   VSSHLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEV  586
             VSSHLQGEAVQ+WRE+VT+FSYP + RDYSRWPDKPEGW  V + YSEKLM++A KLL V
Sbjct  121   VSSHLQGEAVQDWREIVTFFSYPVRNRDYSRWPDKPEGWISVAKSYSEKLMDLACKLLGV  180

Query  587   LSEAMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGL  766
             LSEAMGL+KE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLL QDQVGGL
Sbjct  181   LSEAMGLDKEALTKACVDMDQKMVVNFYPKCPQPDLTLGLKRHTDPGTITLLFQDQVGGL  240

Query  767   QATKDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIP  946
             QAT+DGGKTWITV P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS   RLSIA FQ P
Sbjct  241   QATRDGGKTWITVPPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYERLSIATFQNP  300

Query  947   APEASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             APEA VYPL +REGEKP+++E ITF EMYRRKMSKD+ELARLKK
Sbjct  301   APEAIVYPLAIREGEKPVLDEPITFTEMYRRKMSKDLELARLKK  344



>gb|AIS35916.1| flavanone 3-hydroxylase [Phalaenopsis equestris]
Length=370

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/346 (75%), Positives = 295/346 (85%), Gaps = 4/346 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P+ +T    EKTL +SF+RDEDERPKVAYN FS++IPVISL+GI++ G  GRR  IC  I
Sbjct  8     PTAVT----EKTLRASFVRDEDERPKVAYNEFSNQIPVISLQGIEENGDGGRRSEICRSI  63

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V ACE+WGIFQV+DHGVD  LI+ MT LA  FF + PEEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  64    VAACEDWGIFQVIDHGVDTGLIADMTRLAREFFDLLPEEKLRFDMSGGKKGGFIVSSHLQ  123

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP   RDYSRWP+KPEGW  V E+YS KLM++A  LL VLSEAMG
Sbjct  124   GEAVQDWREIVTYFSYPIGSRDYSRWPEKPEGWRAVVEEYSAKLMDLACNLLGVLSEAMG  183

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             L++E ++ AC+DMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD 
Sbjct  184   LDREAIAGACIDMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDD  243

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+  AFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIAAFQ PAPEA V
Sbjct  244   GKTWITVQPVQNAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIAAFQNPAPEAVV  303

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGIGK  1102
             YPL VREGE P+MEE ITFAEMYRRK+S+D+ELARLKK   +  G+
Sbjct  304   YPLAVREGEMPVMEEGITFAEMYRRKVSRDLELARLKKMAKIESGE  349



>gb|AGT79807.1| flavanone 3-hydroxylase [Phyllanthus emblica]
Length=364

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/360 (72%), Positives = 307/360 (85%), Gaps = 8/360 (2%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L  ++ E TL +SF+RDE+ERPKVA+++FSD+IP++SL+G+    V G+R  IC +IV A
Sbjct  9     LPTMSDEATLRASFVRDEEERPKVAHDQFSDDIPIVSLEGL----VGGKRAEICKKIVDA  64

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
             CE+WG+FQVVDHGVD +L++ MT LA  FF++PPEEKLRFDMSGGKKGGF+VSSHLQGEA
Sbjct  65    CEDWGVFQVVDHGVDPELVTDMTRLAREFFSLPPEEKLRFDMSGGKKGGFIVSSHLQGEA  124

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYPK  RDYSRWPDKPEGWT V E+YS+ LM +A +LL VLSEAMGLE 
Sbjct  125   VQDWREIVTYFSYPKNSRDYSRWPDKPEGWTAVAERYSDALMGLACRLLGVLSEAMGLET  184

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KACVDMDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQATKDGGKT
Sbjct  185   EALTKACVDMDQKMVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDSVGGLQATKDGGKT  244

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA VYPL
Sbjct  245   WITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSCSRLSIATFQNPAPEAVVYPL  304

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK----QKMLGIGKPHFQPKPIDQLLV  1141
              +R GE+PI+EE +TFAEMY+RKMS+DIELA++KK    ++   + K   + KPI+++L 
Sbjct  305   AIRGGERPILEEPMTFAEMYKRKMSRDIELAKMKKLAKEKQAQDLEKSKLESKPIEEILA  364



>emb|CAA57410.1| flavonone-3-hydroxylase [Medicago sativa]
Length=357

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/330 (79%), Positives = 287/330 (87%), Gaps = 2/330 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             T+T L+ E T  S FIRDEDERPKVAYN+FS+EIPVIS+ GID+  VNGRR  IC +IV+
Sbjct  6     TITSLSEENTFESGFIRDEDERPKVAYNQFSNEIPVISIAGIDE--VNGRREEICKKIVE  63

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACEEWGIFQ+VDHGVD  LIS+MT L+  FFA+PPEEKLRFDMSGGKKGGFVVSSHLQGE
Sbjct  64    ACEEWGIFQIVDHGVDTKLISEMTHLSREFFALPPEEKLRFDMSGGKKGGFVVSSHLQGE  123

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              VQ+WREMV YFSYP + RDYSRWPDKPE W  V E+YSE LM +  KLLEVLSEAM LE
Sbjct  124   VVQDWREMVIYFSYPIKDRDYSRWPDKPEEWKKVIEEYSENLMNLGCKLLEVLSEAMDLE  183

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             K+ L+KACVDMDQKIVVN YPKCP+PDLTLG KRHTDPGTITLLLQDQVGGLQATKD GK
Sbjct  184   KDALTKACVDMDQKIVVNLYPKCPKPDLTLGNKRHTDPGTITLLLQDQVGGLQATKDNGK  243

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWIT+QPI GAFVVNLGDHGH+LSNGRFK+ADHQAVVNS   RLSIA FQ PA +A+VYP
Sbjct  244   TWITIQPIEGAFVVNLGDHGHVLSNGRFKNADHQAVVNSNHDRLSIATFQNPAQDATVYP  303

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIE  1060
             LK+REGEK ++EE ITFAEMYRRKMSKDIE
Sbjct  304   LKIREGEKSLLEEPITFAEMYRRKMSKDIE  333



>dbj|BAD86791.1| Flavanone 3-hydroxylase [Iris x hollandica]
Length=370

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/338 (77%), Positives = 289/338 (86%), Gaps = 0/338 (0%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P  L   +   TL  +F+RDE+ERPKVAYN FSDEIPVISL+GID+ G  GRR  I  +I
Sbjct  8     PPFLPTCSNGTTLPVTFVRDEEERPKVAYNAFSDEIPVISLEGIDEAGDGGRREEIRRKI  67

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L++ M  LA  FFA+PPEEKLRFDM+GGKKGGF+VSSHLQ
Sbjct  68    AAACEDWGIFQVVDHGVDAGLVADMARLAREFFALPPEEKLRFDMTGGKKGGFIVSSHLQ  127

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+VTYF+YP   RD+SRWPDKP  W  VTEKYSEKLME+A KLL VLSEAMG
Sbjct  128   GEVVQDWREIVTYFTYPIISRDFSRWPDKPNEWRSVTEKYSEKLMELACKLLGVLSEAMG  187

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LEKE L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG
Sbjct  188   LEKEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  247

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQPI G+FVVNLGDH H LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A V
Sbjct  248   GKTWITVQPIQGSFVVNLGDHAHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDADV  307

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPL +REGE P+++E I F EMYRRKMS+D+ELA+LKK
Sbjct  308   YPLAIREGETPVLDEPIKFTEMYRRKMSRDLELAKLKK  345



>gb|AGJ50588.1| F3H1 [Tulipa fosteriana]
 gb|AGL98422.1| flavanone 3-hydroxylase [Tulipa fosteriana]
Length=366

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/340 (75%), Positives = 294/340 (86%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+ L  ++ EKTL ++F+RDEDERPKVAYN FS++IPVISL G+DD      R  IC 
Sbjct  1     MAPTFLPTVSDEKTLRANFVRDEDERPKVAYNIFSNDIPVISLAGLDDD--ESIRSQICD  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV ACE+WGIFQVVDHGVD  L+  M  LA  FFA+PPEEKLRFDMSGGKKGGF+VSSH
Sbjct  59    KIVAACEDWGIFQVVDHGVDGGLVDDMNRLAREFFALPPEEKLRFDMSGGKKGGFIVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQGEAVQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V E YSE+LM +A KLL VLSEA
Sbjct  119   LQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWKSVVESYSEQLMGLACKLLGVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL++E L++ACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK
Sbjct  179   MGLDREALTQACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGG TWITV+P+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PAP+A
Sbjct  239   DGGDTWITVKPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             +VYPL +REGEK +++  +TF+EMYR+KMS+DIELA+LKK
Sbjct  299   TVYPLAIREGEKSVLDAPMTFSEMYRKKMSRDIELAKLKK  338



>ref|XP_002448703.1| hypothetical protein SORBIDRAFT_06g031790 [Sorghum bicolor]
 gb|EES13031.1| hypothetical protein SORBIDRAFT_06g031790 [Sorghum bicolor]
Length=374

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/339 (76%), Positives = 296/339 (87%), Gaps = 2/339 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P   T  AGE TL +SF+RDEDERPKV ++RFSDE+PV+SL+GID GG   RR  I A++
Sbjct  11    PFLPTAAAGESTLRASFVRDEDERPKVPHDRFSDEVPVVSLEGIDGGG--ARRAEIRARV  68

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L+++M  LA  FFA+P E+KLRFDMSGGKKGGF+VSSHLQ
Sbjct  69    AAACEDWGIFQVVDHGVDAALVAEMARLARDFFALPAEDKLRFDMSGGKKGGFIVSSHLQ  128

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP  W  V E+YSE+LM +A KLL VLSEAMG
Sbjct  129   GEAVQDWREIVTYFSYPVKSRDYSRWPDKPAAWRAVVERYSEQLMGLACKLLGVLSEAMG  188

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LE + L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  189   LETDALAKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDG  248

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLS+A FQ PAP+A+V
Sbjct  249   GRTWITVQPLEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSECSRLSVATFQNPAPDATV  308

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             YPL VR+GE PI+++ ITFAEMYRRKM++DIELA+LKKQ
Sbjct  309   YPLAVRDGEAPILDQPITFAEMYRRKMARDIELAKLKKQ  347



>emb|CAA55628.1| flavanone-3-hydroxylase [Medicago sativa]
Length=357

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/330 (78%), Positives = 287/330 (87%), Gaps = 2/330 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             T+T L+ E T  S FIRDEDERPKVAYN+FS+EIPVIS+ GID+  VNGRR  IC +IV+
Sbjct  6     TITSLSEENTFESGFIRDEDERPKVAYNQFSNEIPVISIAGIDE--VNGRREEICKKIVE  63

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACEEWGIFQ+VDHGVD  LIS+MT L+  FFA+PPEEKLRFDMSGGKKGGFVVSSHLQGE
Sbjct  64    ACEEWGIFQIVDHGVDTKLISEMTHLSREFFALPPEEKLRFDMSGGKKGGFVVSSHLQGE  123

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              VQ+WREMV YFSYP + RDYSRWPDKPE W  V E+YSE LM +  KLLEVLSEAM LE
Sbjct  124   VVQDWREMVIYFSYPIKDRDYSRWPDKPEEWKKVIEEYSENLMNLGCKLLEVLSEAMDLE  183

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             K+ L+KACVDMDQKIVVN YPKCP+PDLTLG KRHTDPGTITLLLQDQVGGLQATKD GK
Sbjct  184   KDALTKACVDMDQKIVVNLYPKCPKPDLTLGNKRHTDPGTITLLLQDQVGGLQATKDDGK  243

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWIT+QPI GAFVVNLGDHGH+LSNGRFK+ADHQAVVNS   RLSIA FQ P+ +A+VYP
Sbjct  244   TWITIQPIEGAFVVNLGDHGHVLSNGRFKNADHQAVVNSNHDRLSIATFQNPSQDATVYP  303

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIE  1060
             LK+REGEK ++EE ITFAEMY+RKMSKDIE
Sbjct  304   LKIREGEKSLLEEPITFAEMYKRKMSKDIE  333



>gb|AIC32296.1| flavanone 3-hydroxylase [Erythranthe lewisii]
Length=351

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/343 (74%), Positives = 297/343 (87%), Gaps = 0/343 (0%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +T+T LA + TL   FIRDE+ERPKVAYN FSDEIPVISL GI++    G+R  IC +IV
Sbjct  2     ATITELAKKNTLDQKFIRDENERPKVAYNEFSDEIPVISLDGIEEYSGGGKRAEICRKIV  61

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +ACE WGIFQVVDHGVD ++I+ MT LA  FFA+P  EKLRFDMSGGKKGGF+VSSHLQG
Sbjct  62    EACEGWGIFQVVDHGVDPEVIADMTRLAREFFALPAAEKLRFDMSGGKKGGFIVSSHLQG  121

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             E VQ+WRE+VTYFSYP + RDY+RWPDKPE W  VTE+YSE+LM+++ KLL +LSEAMGL
Sbjct  122   EVVQDWREIVTYFSYPTEARDYTRWPDKPECWRAVTEEYSEQLMKLSCKLLVILSEAMGL  181

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             +K+ LSKACV+MDQK+VVNFYPKCP+PDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  182   DKDALSKACVEMDQKVVVNFYPKCPRPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  241

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGDHGH LSNGRFK+ADHQ VVNS S RLSIA FQ PAP+A VY
Sbjct  242   KTWITVQPVDGAFVVNLGDHGHYLSNGRFKNADHQVVVNSNSGRLSIATFQNPAPQAVVY  301

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKMLGI  1096
             PL++ EGE PI+EEAITF+EMY+RKM+KD+E+ARLK     GI
Sbjct  302   PLRIGEGEDPIIEEAITFSEMYKRKMAKDLEIARLKNVAKEGI  344



>ref|XP_003547939.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Glycine 
max]
Length=372

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/367 (72%), Positives = 303/367 (83%), Gaps = 12/367 (3%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             + L  LA EKTL  SF+RDEDERPKVAYN FS+E+PVISL GI +  V GRR  IC +IV
Sbjct  7     TDLAYLAQEKTLELSFVRDEDERPKVAYNEFSNEVPVISLAGIHE--VGGRREEICKKIV  64

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
             +AC+ WGIFQVVDHGVD  L+++MT LA  FF +P +EK+RFDMSGGK+GGF VSSHL+G
Sbjct  65    EACKNWGIFQVVDHGVDQQLMAEMTRLAKEFFILPLDEKIRFDMSGGKRGGFNVSSHLRG  124

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             E+VQ+WRE+V YFSYP ++RDY+RWPD P+GW  VTE YSEKLM +A  LLEVLSEAMGL
Sbjct  125   ESVQDWREIVIYFSYPMRERDYTRWPDTPKGWRSVTESYSEKLMALACNLLEVLSEAMGL  184

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EKE L+KACVDMDQKIVVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+D G
Sbjct  185   EKEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDNG  244

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDH H LSNGRFKSADHQAVVNS  SRLSIA FQ P P A+VY
Sbjct  245   KTWITVQPVEGAFVVNLGDHCHYLSNGRFKSADHQAVVNSNHSRLSIATFQNPVPNATVY  304

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK--QKMLGIGKPHFQ--------P  1117
             PLKVREGEKP+MEE ITFAEMYRRKMSKD+E+A +KK  +K     + HFQ         
Sbjct  305   PLKVREGEKPVMEEPITFAEMYRRKMSKDLEIAGMKKLAKKKDFENEKHFQELEKAKVEA  364

Query  1118  KPIDQLL  1138
             KP+ ++L
Sbjct  365   KPLKEIL  371



>ref|XP_008791262.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Phoenix 
dactylifera]
Length=388

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/333 (78%), Positives = 290/333 (87%), Gaps = 2/333 (1%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDD--GGVNGRRRGICAQIVKACEEW  265
             EKTL  SF+RDEDERPKVAYN+FS++IPVISL GIDD  G    +R  I  +IV ACE+W
Sbjct  42    EKTLRPSFVRDEDERPKVAYNQFSNDIPVISLAGIDDEEGAGGEKREEIRRKIVAACEDW  101

Query  266   GIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNW  445
             GIFQVVDHGVDA+L+S+MT LA  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQGEAVQ+W
Sbjct  102   GIFQVVDHGVDAELVSEMTRLAKEFFALPPEEKLRFDMSGGKKGGFIVSSHLQGEAVQDW  161

Query  446   REMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLS  625
             RE+VT+FS+P   RDYSRWPDKPEGW    + YSEKLM +A KLL VLSEAMGLEKE L+
Sbjct  162   REIVTFFSHPVGARDYSRWPDKPEGWRSAVDSYSEKLMVLACKLLGVLSEAMGLEKEALT  221

Query  626   KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITV  805
             KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLL QDQVGGLQATKDGGKTWI V
Sbjct  222   KACVDMDQKLVVNFYPRCPQPDLTLGLKRHTDPGTITLLYQDQVGGLQATKDGGKTWIAV  281

Query  806   QPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVRE  985
             QP+  AFVVNLGDHGH LSNGRFK+ADHQAVVNS   RLSIAAFQ PAPEA VYPL +RE
Sbjct  282   QPVEAAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYERLSIAAFQNPAPEAIVYPLAIRE  341

Query  986   GEKPIMEEAITFAEMYRRKMSKDIELARLKKQK  1084
             GEK +++E ITFAEMYRRKMSKD+ELA+LKK K
Sbjct  342   GEKLVLDEPITFAEMYRRKMSKDLELAKLKKAK  374



>ref|XP_011083555.1| PREDICTED: flavanone 3-dioxygenase [Sesamum indicum]
 ref|XP_011083556.1| PREDICTED: flavanone 3-dioxygenase [Sesamum indicum]
Length=366

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 290/337 (86%), Gaps = 2/337 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             + LT LA E +L   FIRDEDERPKVAY++FSD+IP+ISL GI  G  +  R  IC +IV
Sbjct  6     TCLTQLAEENSLHQKFIRDEDERPKVAYDQFSDDIPLISLAGI--GESSSERAEICRKIV  63

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACEEWGIFQVVDHG+D+ LI  MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  64    AACEEWGIFQVVDHGIDSKLIEDMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSHLQG  123

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+VTYFSYP + RDYSRWPDKP GW  VTE YSE+LM +  KLLE+LSEAMGL
Sbjct  124   EAVQDWREIVTYFSYPVKARDYSRWPDKPAGWRVVTEAYSEQLMGLGCKLLEILSEAMGL  183

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EK+ LSKAC++MDQK+VVNFYPKCPQP+LTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  184   EKDALSKACLEMDQKVVVNFYPKCPQPNLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  243

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP A VY
Sbjct  244   KTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNLSRLSIATFQNPAPNAIVY  303

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PLK REGE  +MEEAIT+ EMY+RKMS+D+ELARLKK
Sbjct  304   PLKTREGETAVMEEAITYMEMYKRKMSRDLELARLKK  340



>gb|AAB97310.1| flavanone 3-hydroxylase [Chrysanthemum x morifolium]
Length=357

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 285/329 (87%), Gaps = 5/329 (2%)
 Frame = +2

Query  107   SSFIRDEDERPKVAYNRFSDEIPVISLKGIDD-----GGVNGRRRGICAQIVKACEEWGI  271
             + F+RDEDERPKV YN+FS EIPVISLKGIDD     GG+  RR  IC +I+KACE+WGI
Sbjct  9     NRFVRDEDERPKVPYNKFSSEIPVISLKGIDDVEESSGGIKSRRAEICEKIIKACEDWGI  68

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVD  ++S+MT LA  FF MP EEKLRFDM+GGKKGGF+VSSHLQGEAVQ+WRE
Sbjct  69    FQVVDHGVDTKMLSEMTRLAREFFEMPAEEKLRFDMTGGKKGGFIVSSHLQGEAVQDWRE  128

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPDKP+ W  VTEKYSE LM +  KLLEVLSEAMGLEKE L  A
Sbjct  129   IVTYFSYPIKARDYSRWPDKPKEWRAVTEKYSEDLMGLGCKLLEVLSEAMGLEKEALKDA  188

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGKTWITV+P
Sbjct  189   CVDMDQKVVLNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVEP  248

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             I GAFVVNLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAP A VYPL V EGE
Sbjct  249   IEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNTSRLSIATFQNPAPNAIVYPLIVNEGE  308

Query  992   KPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             K IMEEAITF +MY++KMS D+ELARLKK
Sbjct  309   KSIMEEAITFMDMYKKKMSTDLELARLKK  337



>gb|AEY81365.1| flavanone 3-hydroxylase [Reaumuria soongarica]
Length=366

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/364 (74%), Positives = 301/364 (83%), Gaps = 11/364 (3%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             +TLT +A EK+L S FIRDEDERPKVAYN FSDEIPVISL GIDD   + +R  IC +IV
Sbjct  6     TTLTDVAEEKSLQSKFIRDEDERPKVAYNLFSDEIPVISLAGIDD---HSKRGEICKKIV  62

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACE+WG+FQV+DHGVD +LIS MT  A  FFA+P EEKLRFDMSGGKKGGF+VSSHLQG
Sbjct  63    DACEDWGVFQVIDHGVDTNLISDMTRNAREFFALPAEEKLRFDMSGGKKGGFIVSSHLQG  122

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             EAVQ+WRE+V YFSYP + RDY+RWPDKPE W  VTE+YSE +M +A KLL VLSEAMGL
Sbjct  123   EAVQDWREIVIYFSYPIKNRDYTRWPDKPESWRKVTEEYSENVMALACKLLGVLSEAMGL  182

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             E E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG
Sbjct  183   ETEALTKACVDMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGG  242

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
              TWITVQP+ GAFVVNLGDHGH LS    ++ADHQAVVNS  SRLSIA FQ PAPEA+VY
Sbjct  243   NTWITVQPVEGAFVVNLGDHGHYLSM-EVQNADHQAVVNSNYSRLSIATFQNPAPEATVY  301

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK-------QKMLGIGKPHFQPKPI  1126
             PL VREGEKPI++E ITFAEMYRRKMSKD+E ARLKK       Q+     K +   KPI
Sbjct  302   PLAVREGEKPILDEPITFAEMYRRKMSKDLEQARLKKLAKEQQQQQQNQDNKDNLDSKPI  361

Query  1127  DQLL  1138
             +Q+L
Sbjct  362   EQIL  365



>gb|AFI08246.1| F3H [Narcissus tazetta var. chinensis]
Length=365

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/323 (79%), Positives = 288/323 (89%), Gaps = 3/323 (1%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             EKTL   F+RDEDERPKVAYN FSDEIP+ISL GID GGV  +R  IC +IV+ACE+WGI
Sbjct  13    EKTLRPDFVRDEDERPKVAYNEFSDEIPIISLDGID-GGV--KRAAICEKIVEACEDWGI  69

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVD +++++MT +A  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGEAV++WRE
Sbjct  70    FQVVDHGVDGEVVAEMTRMAREFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVRDWRE  129

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPD P+GW  V EKYSEKLME++ KLL VLSE MGL+ E L+KA
Sbjct  130   IVTYFSYPVKARDYSRWPDTPDGWISVVEKYSEKLMELSCKLLGVLSEVMGLDHEALTKA  189

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP
Sbjct  190   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  249

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             + GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A+VYPL +REGE
Sbjct  250   VEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPDATVYPLAIREGE  309

Query  992   KPIMEEAITFAEMYRRKMSKDIE  1060
             +PI+ E ITFAEMYRRKMS+DIE
Sbjct  310   EPILGEPITFAEMYRRKMSRDIE  332



>gb|AAO63022.1| flavanone 3-hydroxylase [Allium cepa]
Length=367

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 288/329 (88%), Gaps = 2/329 (1%)
 Frame = +2

Query  74    LTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKA  253
             L  ++ EKTL SSF+ DEDERPK+AYN FSDEIP+IS  GIDD   NG+R  IC +IV+A
Sbjct  9     LPTISDEKTLRSSFVGDEDERPKIAYNVFSDEIPIISQDGIDDA--NGKRGEICRKIVEA  66

Query  254   CEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEA  433
              E+WG+FQV+DHGV+ ++I  MT +A  FFA+PPEEKLRFDMSGGKKGGF+VSSHLQGEA
Sbjct  67    REDWGVFQVIDHGVEQEVIKDMTKMAREFFALPPEEKLRFDMSGGKKGGFIVSSHLQGEA  126

Query  434   VQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEK  613
             VQ+WRE+VTYFSYP + RDYSRWPDKPEGW  V EKYSEKLM++A KLL + SEAMGL+ 
Sbjct  127   VQDWREIVTYFSYPIRARDYSRWPDKPEGWISVAEKYSEKLMDLACKLLGIPSEAMGLDT  186

Query  614   EGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  793
             E L+KAC+DMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT
Sbjct  187   EALTKACIDMDQKMVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKT  246

Query  794   WITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPL  973
             WITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPE  VYPL
Sbjct  247   WITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPEVIVYPL  306

Query  974   KVREGEKPIMEEAITFAEMYRRKMSKDIE  1060
              +REGEKPI+EE ITFAEMYRRKMSKDIE
Sbjct  307   AIREGEKPILEEPITFAEMYRRKMSKDIE  335



>gb|AGY46122.1| flavanone 3-hydroxylase [Dendrobium hybrid cultivar]
Length=378

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/339 (77%), Positives = 295/339 (87%), Gaps = 1/339 (0%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRG-ICAQ  241
             P   T +  EKTL  SF+RDEDERPKV YN FSDEIPVIS++GID+ G +G RR  IC Q
Sbjct  5     PFLPTAVTEEKTLKESFVRDEDERPKVPYNEFSDEIPVISIQGIDEEGGDGGRRSEICRQ  64

Query  242   IVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHL  421
             +V ACE+WGIFQVVDHGVDA L++ MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHL
Sbjct  65    VVAACEDWGIFQVVDHGVDAGLVADMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSHL  124

Query  422   QGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAM  601
             QGE VQ+WRE+VTYFSYP + RDY+RWPDKPEGW  V E+YS KLME+A KLL VLSEAM
Sbjct  125   QGEVVQDWREIVTYFSYPIRARDYTRWPDKPEGWRVVVEEYSAKLMELACKLLSVLSEAM  184

Query  602   GLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  781
             GL++E L++AC++MDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD
Sbjct  185   GLDREALTQACIEMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKD  244

Query  782   GGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEAS  961
             GG TWITVQP+  AFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAPEA 
Sbjct  245   GGATWITVQPVQNAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEAV  304

Query  962   VYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             VYPL V+EGE+ +MEEAITFAEMYRRKMS+D+ELARLK+
Sbjct  305   VYPLAVKEGERVVMEEAITFAEMYRRKMSRDLELARLKR  343



>dbj|BAJ21534.1| flavanone-3-hydroxylase [Dahlia pinnata]
Length=361

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/322 (79%), Positives = 286/322 (89%), Gaps = 4/322 (1%)
 Frame = +2

Query  113   FIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQVVDHG  292
             F+RDEDERPKV YN+FS+EIPVISLKGIDD G    R  IC +IVKACE+WGIFQVVDHG
Sbjct  18    FVRDEDERPKVPYNKFSNEIPVISLKGIDDIG----RADICDKIVKACEDWGIFQVVDHG  73

Query  293   VDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVTYFSY  472
             VD  L+ +MT LA  FFAMPPEEK RFDM+GGKKGGF+VSSHLQGE VQ+WRE+VTYFSY
Sbjct  74    VDTKLLVEMTRLAREFFAMPPEEKFRFDMTGGKKGGFIVSSHLQGETVQDWREIVTYFSY  133

Query  473   PKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVDMDQK  652
             P + RDYSRWPDKP+ W  +TE+YS +LM +A KLLEVLSEAMGLEKE L+KACVDMDQK
Sbjct  134   PIKARDYSRWPDKPKEWKAITEEYSNELMGLACKLLEVLSEAMGLEKEALTKACVDMDQK  193

Query  653   IVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPINGAFVV  832
             +VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG+ WITV+P+ GAFVV
Sbjct  194   VVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGENWITVEPVEGAFVV  253

Query  833   NLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPIMEEA  1012
             NLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAP+A+VYPLKV EGEKPIME+ 
Sbjct  254   NLGDHGHYLSNGRFKNADHQAVVNSNTSRLSIATFQNPAPDATVYPLKVNEGEKPIMEKP  313

Query  1013  ITFAEMYRRKMSKDIELARLKK  1078
             ITF EMY++KMS D+ELARLKK
Sbjct  314   ITFMEMYKKKMSADLELARLKK  335



>gb|AEP37359.1| flavanone 3-hydroxylase [Chrysanthemum x morifolium]
Length=357

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 285/329 (87%), Gaps = 5/329 (2%)
 Frame = +2

Query  107   SSFIRDEDERPKVAYNRFSDEIPVISLKGIDD-----GGVNGRRRGICAQIVKACEEWGI  271
             + F+RDEDERPKV YN+FS+EIPVISLKGIDD     GG+  RR  IC +I+KACE+WGI
Sbjct  9     NRFVRDEDERPKVPYNKFSNEIPVISLKGIDDVEESSGGIKSRRAEICEKIIKACEDWGI  68

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVD  ++S+MT LA  FF MP EEKLRFDM+GGKKGGF+VSSHLQGEA+Q+WRE
Sbjct  69    FQVVDHGVDTKMLSEMTRLAREFFEMPAEEKLRFDMTGGKKGGFIVSSHLQGEAMQDWRE  128

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPDKP+ W  VTEKYSE LM +  KLLEVLSEAMGLEKE L  A
Sbjct  129   IVTYFSYPIKARDYSRWPDKPKEWRAVTEKYSEDLMGLGCKLLEVLSEAMGLEKEALKDA  188

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQK+V+N+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGKTWITV+P
Sbjct  189   CVDMDQKVVLNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVEP  248

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             I GAFVVNLGDHGH LSNGRFK+ADH AVVNS +SRLSIA FQ PAP A VYPL V EGE
Sbjct  249   IEGAFVVNLGDHGHYLSNGRFKNADHLAVVNSNTSRLSIATFQNPAPNAIVYPLIVNEGE  308

Query  992   KPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             K IMEEAITF +MY++KMS D+ELARLKK
Sbjct  309   KSIMEEAITFMDMYKKKMSTDLELARLKK  337



>emb|CAA61486.1| naringenin 3-dioxygenase [Bromheadia finlaysoniana]
Length=374

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/362 (73%), Positives = 295/362 (81%), Gaps = 14/362 (4%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             E TL  SF+RDEDERPKVAYN FS EIPVISL+G     +      IC +IV ACE+WGI
Sbjct  13    ENTLRESFVRDEDERPKVAYNVFSHEIPVISLRGSTMREMEVEIE-ICWKIVAACEDWGI  71

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVDA LI+ MT LA  FF +PPEEKLRFDMSGGKKGGF+VSSHLQGE VQ+WRE
Sbjct  72    FQVVDHGVDAGLIADMTRLAREFFELPPEEKLRFDMSGGKKGGFIVSSHLQGEVVQDWRE  131

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPDKPEGW  V E+YS KLME+A  LL VLSEAMGL++E L++A
Sbjct  132   IVTYFSYPIRTRDYSRWPDKPEGWRAVVEEYSAKLMELACNLLGVLSEAMGLDREALAQA  191

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG+TWITVQP
Sbjct  192   CVDMDQKLVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGETWITVQP  251

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             +  AFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+  VYPL VREGE
Sbjct  252   VQNAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPDGVVYPLAVREGE  311

Query  992   KPIMEEAITFAEMYRRKMSKDIELARLKKQKML-------------GIGKPHFQPKPIDQ  1132
             KP+MEEAITFAEMYRRKMS+D+ELARLKK   +              IG    +PK +++
Sbjct  312   KPVMEEAITFAEMYRRKMSRDLELARLKKMGKMESKQKGAAGENAEAIGAAATKPKALNE  371

Query  1133  LL  1138
             +L
Sbjct  372   IL  373



>dbj|BAF44478.1| flavanone 3-hydroxylase [Iris x hollandica]
Length=370

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/338 (75%), Positives = 288/338 (85%), Gaps = 0/338 (0%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P  L   + E TL ++F+RDE+ERPKVAYN FSDEIPVISL+GID+  V GRR  I  +I
Sbjct  8     PPFLPTSSNETTLPATFVRDEEERPKVAYNVFSDEIPVISLEGIDEAIVGGRREEIRRKI  67

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               +CE+WGIFQVVDHGVDA L+  MT LA  FFA+PPEEKLRFDM+GGKKGGF+VSSHLQ
Sbjct  68    AASCEDWGIFQVVDHGVDAGLVVDMTRLAREFFALPPEEKLRFDMTGGKKGGFIVSSHLQ  127

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+VTYF+YP   RD+SRWP KP  W  VTEKYSEKLM++A KLL VLSEAMG
Sbjct  128   GEVVQDWREIVTYFTYPIISRDFSRWPGKPGEWRSVTEKYSEKLMQLACKLLGVLSEAMG  187

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LE E L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG
Sbjct  188   LETEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  247

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQPI G+FVVNLGDH H LSNGRFK+ADHQAVVNS S+RLSIA FQ PAP+A V
Sbjct  248   GKTWITVQPIQGSFVVNLGDHAHFLSNGRFKNADHQAVVNSNSNRLSIATFQNPAPDADV  307

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPL +REGE P+++E I F EMYRRKM +D+ELA+LKK
Sbjct  308   YPLAIREGETPVLDEPIKFTEMYRRKMRRDLELAKLKK  345



>gb|AAC97525.1| flavanone 3-hydroxylase [Persea americana]
Length=369

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/332 (77%), Positives = 292/332 (88%), Gaps = 7/332 (2%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGID--DGGVNGRRRGICAQIVKACEEW  265
             EKTL  +F+RDEDERPKVAYN+FS++IP+ISL GID  DG     R  +C +IV+ACE+W
Sbjct  15    EKTLRQNFVRDEDERPKVAYNQFSNDIPIISLAGIDSEDG-----RAEVCKKIVEACEDW  69

Query  266   GIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNW  445
             G+FQVVDHGV+A LIS+MT LA  FF +P EEKLR+DMSGGKKGGFVVSSHL+GEAVQ+W
Sbjct  70    GVFQVVDHGVEAGLISEMTRLAREFFTLPAEEKLRYDMSGGKKGGFVVSSHLKGEAVQDW  129

Query  446   REMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLS  625
             RE+VT+FSYP + RDYSRWPDKPEGW  V + YS+KLM +A KLLEV SEAMGLEKE L+
Sbjct  130   REIVTFFSYPIRSRDYSRWPDKPEGWKEVAQVYSDKLMGLACKLLEVFSEAMGLEKEALT  189

Query  626   KACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITV  805
             KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG +TWITV
Sbjct  190   KACVDMDQKMVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGRQTWITV  249

Query  806   QPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVRE  985
             QP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SR+SIA FQ PAPEA VYPL +RE
Sbjct  250   QPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNFSRMSIATFQNPAPEAIVYPLAIRE  309

Query  986   GEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             GEKPI++E +TFAEMYR+KMS+D+ELA LKKQ
Sbjct  310   GEKPILDEPMTFAEMYRKKMSRDLELANLKKQ  341



>dbj|BAE72878.1| flavanone 3-hydroxylase [Verbena x hybrida]
Length=375

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/338 (76%), Positives = 288/338 (85%), Gaps = 1/338 (0%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGI-DDGGVNGRRRGICAQI  244
             + LT LA E ++   FIRDEDERPKV YN+FSD+IPVISL GI D+ G  G R   C +I
Sbjct  6     TCLTTLAEENSVHQKFIRDEDERPKVPYNQFSDQIPVISLAGIVDETGGGGDRAEACKKI  65

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
             V ACEEWGIFQVVDHG+DA LI  MT LA  FFA+P EEKLRFDMSGGKKGGF+VSSHLQ
Sbjct  66    VAACEEWGIFQVVDHGIDAKLIKDMTRLAREFFALPAEEKLRFDMSGGKKGGFIVSSHLQ  125

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+V YFSYP   RDYSRWPDKPEGW  VTE YSE+LM++  KLLEVLSEAMG
Sbjct  126   GEVVQDWREIVIYFSYPINGRDYSRWPDKPEGWRSVTEMYSEQLMKLNCKLLEVLSEAMG  185

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LE + L+KACV+MDQK+V+NFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  186   LENDALAKACVEMDQKLVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDDVGGLQATRDG  245

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             GKTWITVQP+ GA VVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A V
Sbjct  246   GKTWITVQPVEGAIVVNLGDHGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPDAIV  305

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             YPLK+ EGEK +MEE IT++EMY+RKM+KD+E+ARLKK
Sbjct  306   YPLKINEGEKAVMEEPITYSEMYKRKMNKDLEIARLKK  343



>gb|ABP57073.1| flavanone 3-hydroxylase [Solenostemon scutellarioides]
 gb|ABP57074.1| flavanone 3-hydroxylase [Solenostemon scutellarioides]
Length=363

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 289/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             E++L   FIRDEDERPKVAY++FS++IPVISL GIDD    GRR  +C +IV  CE+WGI
Sbjct  8     ERSLHPKFIRDEDERPKVAYDQFSNDIPVISLAGIDDES-GGRRAEVCRRIVATCEDWGI  66

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGV++ ++ +M SLA  FFA+P  +KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE
Sbjct  67    FQVVDHGVESTVVEKMNSLAREFFALPSHDKLRFDMSGGKKGGFIVSSHLQGEAVQDWRE  126

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP  +RDYSRWPDKPEGW  VTE YS +LM +A KLL +LSEAMGLEKE LSKA
Sbjct  127   IVTYFSYPVAERDYSRWPDKPEGWRRVTEAYSAQLMGLACKLLGILSEAMGLEKEALSKA  186

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPG ITLLLQDQVGGLQAT+DGGKTWITVQP
Sbjct  187   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGLITLLLQDQVGGLQATRDGGKTWITVQP  246

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             + GAFVVNLGD GH LSNGRFK+ADHQAVVNSKSSRLSIA FQ PAP A VYPL++REGE
Sbjct  247   VEGAFVVNLGDFGHYLSNGRFKNADHQAVVNSKSSRLSIATFQNPAPNAKVYPLRMREGE  306

Query  992   KPIMEEAITFAEMYRRKMSKDIELARLKK  1078
               +MEEAITF+EMY+RKM+KD+ELAR+KK
Sbjct  307   TALMEEAITFSEMYKRKMAKDLELARIKK  335



>gb|ADB66755.1| flavanone 3-hydroxylase [Sorghum bicolor]
Length=380

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/339 (75%), Positives = 293/339 (86%), Gaps = 2/339 (1%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P   T   GE TL  SF+R+EDERPKV ++RFSDE+PV+SL+GID GG   RR  I A++
Sbjct  10    PFLPTAATGESTLRPSFVREEDERPKVPHDRFSDEVPVVSLEGIDGGG--ARRAEIRARV  67

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L+++M  LA  FFA+P E+KLRFDMSGGKKGGF+VSSHLQ
Sbjct  68    AAACEDWGIFQVVDHGVDAALVAEMARLARDFFALPAEDKLRFDMSGGKKGGFIVSSHLQ  127

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GE VQ+WRE+VTYFSYP + RD+SRWPDKP  W  V E+YSE+LM +A KLL VLSEAMG
Sbjct  128   GEVVQDWREIVTYFSYPVKSRDFSRWPDKPVAWRAVVERYSEQLMGLACKLLGVLSEAMG  187

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             LE + L+KACVDMDQK+VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  188   LETDALAKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDG  247

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLSIA FQ PAP+A+V
Sbjct  248   GRTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSECSRLSIATFQNPAPDATV  307

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             YPL VREGE PI+++ ITFAEMYRRKM++DIELA+LKKQ
Sbjct  308   YPLAVREGEAPILDDPITFAEMYRRKMARDIELAKLKKQ  346



>dbj|BAJ17667.1| flavanone 3-hydroxylase [Gynura bicolor]
Length=355

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 291/324 (90%), Gaps = 1/324 (0%)
 Frame = +2

Query  107   SSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQVVD  286
             + F+RDEDERPKV YN+FS+EIPVISL+GIDD   +GRR  IC +IVKACE+WGIFQVVD
Sbjct  13    NKFVRDEDERPKVPYNKFSNEIPVISLQGIDDEE-SGRRAEICDKIVKACEDWGIFQVVD  71

Query  287   HGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVTYF  466
             HGVD  L+S+MT LA  FF +P +EKLRFDM+GGKKGGF+VSSHLQGEAVQ+WRE+VTYF
Sbjct  72    HGVDMKLLSEMTKLARDFFHLPTDEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIVTYF  131

Query  467   SYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVDMD  646
             SYP ++RDYSRWPD P+ W  +TE+YS+ LME+A KLLEVLSEAMGLEKE L+KACVDMD
Sbjct  132   SYPIKERDYSRWPDTPKEWRLITEEYSKVLMELACKLLEVLSEAMGLEKEALTKACVDMD  191

Query  647   QKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPINGAF  826
             QK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGK+WITV+PI GAF
Sbjct  192   QKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKSWITVEPIEGAF  251

Query  827   VVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPIME  1006
             VVNLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAPEA VYPLKV EGEK IME
Sbjct  252   VVNLGDHGHYLSNGRFKNADHQAVVNSNTSRLSIATFQNPAPEAIVYPLKVNEGEKSIME  311

Query  1007  EAITFAEMYRRKMSKDIELARLKK  1078
             E ITF +MY++KMS+D++LARLKK
Sbjct  312   EPITFVDMYKKKMSRDLDLARLKK  335



>ref|NP_001130275.1| uncharacterized protein LOC100191369 [Zea mays]
 gb|ACF78446.1| unknown [Zea mays]
 gb|ACF85463.1| unknown [Zea mays]
 gb|ACF85573.1| unknown [Zea mays]
 gb|ACN34557.1| unknown [Zea mays]
Length=366

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 298/360 (83%), Gaps = 6/360 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P   T   GE  L +SF+R+EDERPKV ++RFSDE+PV+SL+GID      RR  I A++
Sbjct  10    PFLPTAAEGETKLRASFVREEDERPKVPHDRFSDEVPVVSLEGID----GARRAEIRARV  65

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L++ M  LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQ
Sbjct  66    AAACEDWGIFQVVDHGVDAALVADMARLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQ  125

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP  W  V E+YSE+LM +A +LL VLSEAMG
Sbjct  126   GEAVQDWREIVTYFSYPVKARDYSRWPDKPAAWRAVVERYSEQLMALACRLLGVLSEAMG  185

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             L+ E L++ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  186   LDTEALARACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDG  245

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLSIA FQ PAP+A+V
Sbjct  246   GRTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSECSRLSIATFQNPAPDATV  305

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKML--GIGKPHFQPKPIDQLL  1138
             YPL VR+GE PI++  ITFAEMYRRKM++DIELARLKKQ        K     KP+D +L
Sbjct  306   YPLAVRDGEAPILDHPITFAEMYRRKMARDIELARLKKQVKADKSANKEFADSKPLDAIL  365



>ref|XP_003612166.1| Flavanone-3-hydroxylase [Medicago truncatula]
 gb|AES95124.1| naringenin 3-dioxygenase (flavanone-3-hydroxylase) [Medicago 
truncatula]
Length=357

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 284/329 (86%), Gaps = 2/329 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             T+T L+ E T  S FIRDEDERPKVAYN+FS+EIPVIS+ GID+  VNGRR  IC +IV+
Sbjct  6     TITSLSEENTFESGFIRDEDERPKVAYNQFSNEIPVISIAGIDE--VNGRREEICKKIVE  63

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACEEWGIFQ+VDHGVD  LIS+MT L+  FFA+PPEEKLRFDMSGGKKGGFVVSSHLQGE
Sbjct  64    ACEEWGIFQIVDHGVDTKLISEMTHLSREFFALPPEEKLRFDMSGGKKGGFVVSSHLQGE  123

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              VQ+WREMV YFSYP + RDYSRWPDKPE W  V E+YSE LM +  KLLEVLSEAM LE
Sbjct  124   VVQDWREMVIYFSYPIKDRDYSRWPDKPEEWKKVIEEYSENLMNLGCKLLEVLSEAMDLE  183

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             K+ L+KACVDMDQKIVVN YPKCP+PDLTLG KRHTDPGTITLLLQDQVGGLQATKD GK
Sbjct  184   KDALTKACVDMDQKIVVNCYPKCPKPDLTLGNKRHTDPGTITLLLQDQVGGLQATKDDGK  243

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWIT+QPI  AFVVNLGDHGH+LSNGRFK+ADHQAVVN   +RLSIA FQ P+ +A+VYP
Sbjct  244   TWITIQPIEDAFVVNLGDHGHILSNGRFKNADHQAVVNPNHNRLSIATFQNPSQDATVYP  303

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDI  1057
             LK+REGEK ++EE ITFAEMYRRKMS DI
Sbjct  304   LKIREGEKSLLEEPITFAEMYRRKMSNDI  332



>gb|KHN36033.1| Naringenin,2-oxoglutarate 3-dioxygenase [Glycine soja]
Length=365

 Score =   526 bits (1354),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 306/366 (84%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPS-TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+ TL  L  EK++ S F+RDEDERPKVAYN FS++IPVISL G+++   +GRR  IC
Sbjct  1     MAPAKTLNSLVEEKSIESRFVRDEDERPKVAYNEFSNDIPVISLAGLEEE--DGRRGEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+A EEWGIFQ+VDHGVD  L+S+MT LA  FFA+PPEEKLRFDM+GGKKGGF+VSS
Sbjct  59    KKIVEAFEEWGIFQIVDHGVDTKLVSEMTRLAKEFFALPPEEKLRFDMTGGKKGGFLVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+V YFS P + RDY+RWP+KPEGW  VTE+YS+ LM +A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVIYFSQPMKSRDYTRWPEKPEGWRKVTEEYSDNLMALACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+KE + KA VDMDQKIVVNFYPKCPQP+LTLG+KRHTDPGTITLLLQD VGGLQAT
Sbjct  179   AMGLDKEAVRKASVDMDQKIVVNFYPKCPQPELTLGVKRHTDPGTITLLLQDLVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D G TWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SR+SIA FQ PA E
Sbjct  239   RDNGNTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSCSRVSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK-----KQKMLGIGKPHFQPK  1120
             A VYPLKV EG KP++EE I+FAEMYRRKM+KD+E+ARLK     K+++  + K   + K
Sbjct  299   AIVYPLKVEEGGKPVLEEPISFAEMYRRKMNKDLEIARLKKLAREKKQLQDLDKVKLESK  358

Query  1121  PIDQLL  1138
             P+D++L
Sbjct  359   PLDEIL  364



>ref|XP_003517175.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Glycine 
max]
Length=365

 Score =   526 bits (1354),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 306/366 (84%), Gaps = 8/366 (2%)
 Frame = +2

Query  59    MKPS-TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             M P+ TL  L  EK++ S F+RDEDERPKVAYN FS++IPVISL G+++   +GRR  IC
Sbjct  1     MAPAKTLNSLVEEKSIESRFVRDEDERPKVAYNEFSNDIPVISLAGLEEE--DGRRGEIC  58

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV+A EEWGIFQ+VDHGVD  L+S+MT LA  FFA+PPEEKLRFDM+GGKKGGF+VSS
Sbjct  59    KKIVEAFEEWGIFQIVDHGVDTKLVSEMTRLAKQFFALPPEEKLRFDMTGGKKGGFLVSS  118

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGEAVQ+WRE+V YFS P + RDY+RWP+KPEGW  VTE+YS+ LM +A KLLEVLSE
Sbjct  119   HLQGEAVQDWREIVIYFSQPMKSRDYTRWPEKPEGWRKVTEEYSDNLMALACKLLEVLSE  178

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
             AMGL+KE + KA VDMDQKIVVNFYPKCPQP+LTLG+KRHTDPGTITLLLQD VGGLQAT
Sbjct  179   AMGLDKEAVRKASVDMDQKIVVNFYPKCPQPELTLGVKRHTDPGTITLLLQDLVGGLQAT  238

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +D G TWITVQPI GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SR+SIA FQ PA E
Sbjct  239   RDNGNTWITVQPIEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSCSRVSIATFQNPAQE  298

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLK-----KQKMLGIGKPHFQPK  1120
             A VYPLKV EG KP++EE I+FAEMYRRKM+KD+E+ARLK     K+++  + K   + K
Sbjct  299   AIVYPLKVEEGGKPVLEEPISFAEMYRRKMNKDLEIARLKKLAREKKQLQDLDKVKLESK  358

Query  1121  PIDQLL  1138
             P+D++L
Sbjct  359   PLDEIL  364



>gb|ABP57075.1| flavanone 3-hydroxylase [Solenostemon scutellarioides]
 gb|ABP57076.1| flavanone 3-hydroxylase [Solenostemon scutellarioides]
Length=364

 Score =   526 bits (1354),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 253/329 (77%), Positives = 288/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             E++L   FIRDEDERPKV Y++FS++IPVISL GIDD    GRRR +C +IV ACE+WGI
Sbjct  8     ERSLHPKFIRDEDERPKVGYDQFSNDIPVISLAGIDDES-GGRRREVCRRIVAACEDWGI  66

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGV++ ++ +M SLA  FFA+P  +KLRFDMSGGKKGGF+VSSHLQGEAVQ+WRE
Sbjct  67    FQVVDHGVESTVVEKMNSLAREFFALPSHDKLRFDMSGGKKGGFIVSSHLQGEAVQDWRE  126

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP  +RDYSRWPDKPEGW  VT  YS +LM +A KLL +LSEAMGLEKE LSKA
Sbjct  127   IVTYFSYPVAERDYSRWPDKPEGWRRVTGAYSAQLMGLACKLLGILSEAMGLEKEALSKA  186

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPG ITLLLQDQVGGLQAT+DGGKTWITVQP
Sbjct  187   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGLITLLLQDQVGGLQATRDGGKTWITVQP  246

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             + GAFVVNLGD GH LSNGRFK+ADHQAVVNSKS RLSIA FQ PAP A VYPL++REGE
Sbjct  247   VEGAFVVNLGDFGHYLSNGRFKNADHQAVVNSKSCRLSIATFQNPAPNAKVYPLRMREGE  306

Query  992   KPIMEEAITFAEMYRRKMSKDIELARLKK  1078
               +MEEAITF+EMY+RKM++D+ELAR+KK
Sbjct  307   TALMEEAITFSEMYKRKMARDLELARIKK  335



>tpg|DAA35528.1| TPA: flavanone 3-hydroxylase1 [Zea mays]
Length=414

 Score =   527 bits (1357),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 298/360 (83%), Gaps = 6/360 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P   T   GE  L +SF+R+EDERPKV ++RFSDE+PV+SL+GID      RR  I A++
Sbjct  58    PFLPTAAEGETKLRASFVREEDERPKVPHDRFSDEVPVVSLEGID----GARRAEIRARV  113

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L++ M  LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQ
Sbjct  114   AAACEDWGIFQVVDHGVDAALVADMARLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQ  173

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP  W  V E+YSE+LM +A +LL VLSEAMG
Sbjct  174   GEAVQDWREIVTYFSYPVKARDYSRWPDKPAAWRAVVERYSEQLMALACRLLGVLSEAMG  233

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             L+ E L++ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  234   LDTEALARACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDG  293

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQP+ GAFVVNLGDHGHLLSNGRFK+ADHQAVVNS+ SRLSIA FQ PAP+A+V
Sbjct  294   GRTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSECSRLSIATFQNPAPDATV  353

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQKML--GIGKPHFQPKPIDQLL  1138
             YPL VR+GE PI++  ITFAEMYRRKM++DIELARLKKQ        K     KP+D +L
Sbjct  354   YPLAVRDGEAPILDHPITFAEMYRRKMARDIELARLKKQVKADKSANKEFADSKPLDAIL  413



>gb|AHJ80978.1| flavanone 3-hydroxylase [Erythranthe lewisii]
Length=375

 Score =   525 bits (1353),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 288/337 (85%), Gaps = 2/337 (1%)
 Frame = +2

Query  68    STLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIV  247
             ++LT LA E+T+   FIRDEDERPKVAYN FSD+IPVISL GI + G  G+R  IC ++V
Sbjct  9     NSLTALAEERTVHKKFIRDEDERPKVAYNEFSDDIPVISLDGIGESG--GKRAEICRKVV  66

Query  248   KACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQG  427
              ACEEWGIFQVVDHGVD+ L+S MT  A  FF +P EEKLRFDMSGG KGGF+VSSHLQG
Sbjct  67    AACEEWGIFQVVDHGVDSKLVSDMTRSAREFFDLPAEEKLRFDMSGGMKGGFIVSSHLQG  126

Query  428   EAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGL  607
             E VQ+WRE+VTYFSYP + RDYSRWPDKPE W  +TE YSE+LME+ SKLLE+LSE MGL
Sbjct  127   EVVQDWREIVTYFSYPIKARDYSRWPDKPECWRPITEAYSEQLMELGSKLLEILSEGMGL  186

Query  608   EKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGG  787
             EK+ LSKAC+DMDQK+VVNFYPKCPQPDLTLG+KRHTDPG +TLLLQD VGGLQAT+D G
Sbjct  187   EKDALSKACIDMDQKVVVNFYPKCPQPDLTLGVKRHTDPGLLTLLLQDHVGGLQATRDAG  246

Query  788   KTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVY  967
             KTWITVQP++GAFVVNLGD GH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP A VY
Sbjct  247   KTWITVQPVDGAFVVNLGDIGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPNAIVY  306

Query  968   PLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             PLK+ EGEK I++E ITF EMY+RKMSKD+EL++LKK
Sbjct  307   PLKIDEGEKSIVDEPITFCEMYKRKMSKDLELSKLKK  343



>gb|AFI08245.1| F3H [Narcissus tazetta var. chinensis]
Length=365

 Score =   523 bits (1346),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/323 (79%), Positives = 284/323 (88%), Gaps = 3/323 (1%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             EKTL   F+RD+DERPKVAYN FSDEIP+ISL GID G V  +R  IC +IV+ACE+WGI
Sbjct  13    EKTLRPDFVRDKDERPKVAYNEFSDEIPIISLDGID-GDV--KRAAICEKIVEACEDWGI  69

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVD ++I++MT +A  FFA+ PE+KLRFDMSGGKKGGF+VSSHLQGEAV++WRE
Sbjct  70    FQVVDHGVDGEVIAEMTRMAREFFALAPEDKLRFDMSGGKKGGFIVSSHLQGEAVRDWRE  129

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPD P GW  V EKYSEKLME++ KLL VLSE MGL+ E L+KA
Sbjct  130   IVTYFSYPIRARDYSRWPDMPGGWISVVEKYSEKLMELSCKLLGVLSEVMGLDHEALTKA  189

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP
Sbjct  190   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  249

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             + GAFVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+A VYPL +REGE
Sbjct  250   VEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPDAIVYPLAIREGE  309

Query  992   KPIMEEAITFAEMYRRKMSKDIE  1060
             +PI+ E ITFAEMYRRKMS+DIE
Sbjct  310   EPILAEPITFAEMYRRKMSRDIE  332



>ref|XP_010245069.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Nelumbo 
nucifera]
Length=359

 Score =   522 bits (1345),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/340 (74%), Positives = 290/340 (85%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M  +TLT L  EKTL  SFIR EDERPKVA+N+FS+EIPVISL GID+    GRR  IC 
Sbjct  1     MGHATLTALVEEKTLPPSFIRCEDERPKVAHNQFSNEIPVISLAGIDES--QGRRMEICQ  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+ACE+WGIFQ++DHGVD +LIS+M  L   FFA+P EEKLR+DM+GGKKGGF+VSSH
Sbjct  59    KIVEACEQWGIFQIIDHGVDGNLISEMARLGREFFALPEEEKLRYDMTGGKKGGFLVSSH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             +QG AVQ+WRE VTYFSYP + RDYSRWPDKPEGW   TE YSEK+M++A +LLEVLSEA
Sbjct  119   IQGGAVQDWREFVTYFSYPLRSRDYSRWPDKPEGWVAATETYSEKMMDLACRLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGL K+ LSKACV+M+QKI+VNFYPKCPQPDLTLG++RHTDPGTIT+LLQDQVGGLQAT+
Sbjct  179   MGLGKDELSKACVEMEQKIIVNFYPKCPQPDLTLGVQRHTDPGTITILLQDQVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQPI GAFVVNLGDHGH LSNGRFK ADHQAVVNS  SRLSIA F  PAPEA
Sbjct  239   DGGKTWITVQPIEGAFVVNLGDHGHYLSNGRFKKADHQAVVNSSCSRLSIATFLYPAPEA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPL++REGE P+++E+ITF EMYRRK   ++E  RLKK
Sbjct  299   IVYPLQIREGETPVLDESITFTEMYRRKFCGELERDRLKK  338



>gb|AEP17012.1| flavanone 3-hydroxylase [Narcissus tazetta var. chinensis]
Length=365

 Score =   522 bits (1345),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 251/323 (78%), Positives = 282/323 (87%), Gaps = 3/323 (1%)
 Frame = +2

Query  92    EKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGI  271
             EKTL   F+RDEDERPKVAYN FSDEIP+ISL GIDD   + +R  IC +IV+ACE+WGI
Sbjct  13    EKTLRPDFVRDEDERPKVAYNEFSDEIPIISLAGIDD---DEKRVAICEKIVEACEDWGI  69

Query  272   FQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWRE  451
             FQVVDHGVD ++I++MT +A  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQGE V++WRE
Sbjct  70    FQVVDHGVDGEVIAEMTRMARGFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEVVRDWRE  129

Query  452   MVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKA  631
             +VTYFSYP + RDYSRWPD P+GW  V EKYSEKLME++ +LL VLSE MGL+ E L+KA
Sbjct  130   IVTYFSYPIKARDYSRWPDMPDGWISVVEKYSEKLMELSCRLLGVLSEVMGLDHEALTKA  189

Query  632   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQP  811
             CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK GGKTWIT+QP
Sbjct  190   CVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKGGGKTWITIQP  249

Query  812   INGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGE  991
             + G FVVNLGDHGH LSNGRFK+ADHQAVVNS  SRLSIAAFQ PAP+A VYPL +REGE
Sbjct  250   VEGTFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIAAFQNPAPDAIVYPLAIREGE  309

Query  992   KPIMEEAITFAEMYRRKMSKDIE  1060
             K I+ E ITFAEMYRRKMS DIE
Sbjct  310   KSILGEPITFAEMYRRKMSGDIE  332



>gb|AAC15414.1| flavanone 3-hydroxylase [Nicotiana tabacum]
Length=621

 Score =   530 bits (1364),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 257/327 (79%), Positives = 283/327 (87%), Gaps = 5/327 (2%)
 Frame = +2

Query  113   FIRDEDERPKVAYNRFSDEIPVISLKGIDD-----GGVNGRRRGICAQIVKACEEWGIFQ  277
             F+RDEDERPKV YN+FS EIPVISLKGIDD     GG+  RR  IC +I+KACE+WGIFQ
Sbjct  11    FVRDEDERPKVPYNKFSSEIPVISLKGIDDVEESSGGIKSRRAEICEKIIKACEDWGIFQ  70

Query  278   VVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMV  457
             VVDHGVD  ++S+MT LA  FF MP EEKLRFDM+GGKKGGF+VSSHLQGEAVQ+WRE+V
Sbjct  71    VVDHGVDTKMLSEMTRLAREFFEMPAEEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIV  130

Query  458   TYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACV  637
             TYFSYP + RDYSRWPDKP+ W  VTEKYSE LM +  KLLEVLSEAMGLEKE L  ACV
Sbjct  131   TYFSYPIKARDYSRWPDKPKEWRAVTEKYSEDLMGLGCKLLEVLSEAMGLEKEALKDACV  190

Query  638   DMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPIN  817
             DMDQK+V+N YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGGKTWITV+PI 
Sbjct  191   DMDQKVVLNSYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVEPIE  250

Query  818   GAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKP  997
             GAFVVNLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAP A VYPL V EGEK 
Sbjct  251   GAFVVNLGDHGHYLSNGRFKNADHQAVVNSNTSRLSIATFQNPAPNAIVYPLIVNEGEKS  310

Query  998   IMEEAITFAEMYRRKMSKDIELARLKK  1078
             IMEEAITF +MY++KMS D+ELARLKK
Sbjct  311   IMEEAITFMDMYKKKMSTDLELARLKK  337


 Score =   292 bits (748),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = +2

Query  113  FIRDEDERPKVAYNRFSDEIPVISLKGIDD-----GGVNGRRRGICAQIVKACEEWGIFQ  277
            F+RDEDERPKV YN+FS EIPVISLKGIDD     GG+  RR  IC +I+ ACE+WGIFQ
Sbjct  426  FVRDEDERPKVPYNKFSSEIPVISLKGIDDVEESSGGIKSRRAEICEKII-ACEDWGIFQ  484

Query  278  VVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMV  457
            VVDHGVD  ++S+MT LA  FF M  EEKLRFDM+GGKKGGF+VSSHLQGEAVQ+WRE+V
Sbjct  485  VVDHGVDTKMLSEMTRLAREFFEMSAEEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIV  544

Query  458  TYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACV  637
            TYFSYP + RDYSRWPDKP+ W  VTEKYSE LM +  KLLE+LSEAMGLEKE L  ACV
Sbjct  545  TYFSYPIKARDYSRWPDKPKEWRAVTEKYSEDLMGLGCKLLEMLSEAMGLEKEALKDACV  604

Query  638  DMDQKIVVNFYPKCPQP  688
            DMDQK+V+N YPKCPQP
Sbjct  605  DMDQKVVLNSYPKCPQP  621



>gb|AAX21536.1| flavone synthase I [Daucus carota]
 gb|AAX21542.1| flavone synthase I [Daucus carota]
Length=357

 Score =   520 bits (1338),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 248/357 (69%), Positives = 299/357 (84%), Gaps = 4/357 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+T+T LA EKTL S F+RDEDERPKVAYN+FS EIP+ISL GIDD   NGRR  +C 
Sbjct  1     MAPTTITALAKEKTLNSDFVRDEDERPKVAYNQFSTEIPIISLAGIDDDS-NGRRPEVCR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+A E+WGIFQVVDHG+D+ LI++M+ L+  FFA+P EEKLR+D +GGK+GGF +S+H
Sbjct  60    KIVEAFEDWGIFQVVDHGIDSGLIAEMSRLSREFFALPAEEKLRYDTTGGKRGGFTISTH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQG+ V++WRE V YFSYP   RDYSR PDKPEGW  VTE YSEKLM + +KLLEVLSEA
Sbjct  120   LQGDDVKDWREFVVYFSYPVDARDYSRCPDKPEGWRSVTEVYSEKLMALGAKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L++ACV+M+QK+++N+YP CPQPDLTLG++RHTDPGTIT+LLQD VGGLQAT+
Sbjct  180   MGLEKEALTEACVNMEQKVLINYYPTCPQPDLTLGVRRHTDPGTITILLQDMVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA  A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSTSSRLSIATFQNPAQNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELA---RLKKQKMLGIGKPHFQPK  1120
              VYPLK+REGEKPI+EEA+T+AEMY++ M+K IE+A   +L K+K L   K   + K
Sbjct  300   IVYPLKIREGEKPILEEAMTYAEMYKKNMTKHIEVATQKKLAKEKRLQNEKAKLETK  356



>gb|EYU38809.1| hypothetical protein MIMGU_mgv1a008381mg [Erythranthe guttata]
Length=375

 Score =   520 bits (1338),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 251/341 (74%), Positives = 286/341 (84%), Gaps = 2/341 (1%)
 Frame = +2

Query  56    IMKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGIC  235
             I+   +LT LA EK +   FIRDEDERPKVAYN FSD+IPVISL GI + G  G R   C
Sbjct  5     IICKKSLTSLAEEKYVNKKFIRDEDERPKVAYNEFSDDIPVISLAGIGECG--GERAETC  62

Query  236   AQIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSS  415
              +IV ACEEWGIFQVVDHGVD +L+  MT  A  FF +P EEKLRFDMSGGKKGGF+VSS
Sbjct  63    RKIVAACEEWGIFQVVDHGVDTELVKDMTRSAREFFDLPAEEKLRFDMSGGKKGGFIVSS  122

Query  416   HLQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSE  595
             HLQGE V++WRE+VTYFSYP + RDYSRWPDKPE W  VTE YSE+LME+  KLLE+LSE
Sbjct  123   HLQGEVVKDWREIVTYFSYPIKARDYSRWPDKPEDWRAVTEAYSEQLMELGCKLLEILSE  182

Query  596   AMGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT  775
              MGLEK+ LSKACV+MDQK+VVNFYPKCPQP+LTLGLKRHTDPG ITLLLQDQVGGLQAT
Sbjct  183   GMGLEKDALSKACVEMDQKVVVNFYPKCPQPNLTLGLKRHTDPGLITLLLQDQVGGLQAT  242

Query  776   KDGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPE  955
             +DGGKTWITVQP+ GAFVVNLGD GH LSNGRFK+ADHQAVVNS  SRLSIA FQ PAP+
Sbjct  243   RDGGKTWITVQPVEGAFVVNLGDCGHYLSNGRFKNADHQAVVNSNYSRLSIATFQNPAPD  302

Query  956   ASVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             A +YPLK+ EGEK ++ E ITFAEMY++KM+ D+EL++LKK
Sbjct  303   AILYPLKIEEGEKSVVNEPITFAEMYKKKMTNDLELSKLKK  343



>gb|ABG78791.1| flavone synthase I [Aethusa cynapium]
Length=355

 Score =   518 bits (1335),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 243/340 (71%), Positives = 293/340 (86%), Gaps = 1/340 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+T+T L+ EK+L   F+RDEDERPKVAYN+FS+EIP+ISL G+DD   NGRR  IC 
Sbjct  1     MAPTTITALSQEKSLNLDFVRDEDERPKVAYNQFSNEIPIISLAGMDDDS-NGRRPEICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+A E+WGIFQVVDHG+D  LISQM+ L+  FFA+P EEKLR+D +GGK+GGF +S+H
Sbjct  60    KIVEAFEDWGIFQVVDHGIDKGLISQMSRLSREFFALPAEEKLRYDTTGGKRGGFTISTH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQG+ V++WRE VTYFSYP + RDYSRWP+KPEGW   TE YSEKLM + +KLLEVLSEA
Sbjct  120   LQGDDVKDWREFVTYFSYPIEDRDYSRWPEKPEGWRSTTEVYSEKLMVLGAKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACV+M+QK+++N+YP CP+PDLTLG++RHTDPGTIT+LLQD VGGLQAT+
Sbjct  180   MGLEKEALTKACVNMEQKVLINYYPTCPEPDLTLGVRRHTDPGTITILLQDMVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA  A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSTSSRLSIATFQNPAQNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPLK+REGEK I++EAIT+AEMY++ M+K IE+A LKK
Sbjct  300   IVYPLKIREGEKAILDEAITYAEMYKKNMTKHIEVAALKK  339



>gb|ABG78793.1| flavone synthase I [Angelica archangelica]
Length=364

 Score =   519 bits (1336),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 242/340 (71%), Positives = 292/340 (86%), Gaps = 2/340 (1%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+T+T LA EKTL  +F+RDEDERPKVAYN+FS+EIP+ISL G+DD    GRR  IC 
Sbjct  1     MAPTTITALAQEKTLNLAFVRDEDERPKVAYNQFSNEIPIISLAGMDDD--TGRRPQICR  58

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+A E+WGIFQVVDHG+D  LIS+MT L+  FFA+P EEKLR+D +GGK+GGF +S+H
Sbjct  59    KIVEAFEDWGIFQVVDHGIDGTLISEMTRLSREFFALPAEEKLRYDTTGGKRGGFTISTH  118

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQG+ V++WRE VTYFSYP   RDYSRWPDKP+GW   TE YSEKLM + +KLLEVLSEA
Sbjct  119   LQGDDVKDWREFVTYFSYPIDDRDYSRWPDKPQGWRSTTEVYSEKLMVLGAKLLEVLSEA  178

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACV+M+QK+++N+YP CP+PDLTLG++RHTDPGTIT+LLQD VGGLQAT+
Sbjct  179   MGLEKEALTKACVNMEQKVLINYYPTCPEPDLTLGVRRHTDPGTITILLQDMVGGLQATR  238

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA  A
Sbjct  239   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSTSSRLSIATFQNPAQNA  298

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPL++REGEK +++EAIT+AEMY++ M+K IE+A LKK
Sbjct  299   IVYPLRIREGEKAVLDEAITYAEMYKKNMTKHIEVATLKK  338



>dbj|BAH36892.1| flavanone 3-hydroxylase [Triticum aestivum]
Length=377

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 251/335 (75%), Positives = 287/335 (86%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   ALAKACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGESSRLSIATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITFAEMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFAEMYRRKMERDLDLAKRKKQ  342



>sp|Q05963.1|FL3H_CALCH RecName: Full=Naringenin,2-oxoglutarate 3-dioxygenase; AltName: 
Full=FHT; AltName: Full=Flavanone-3-hydroxylase; Short=F3H 
[Callistephus chinensis]
 emb|CAA51191.1| naringenin,2-oxoglutarate 3-dioxygenase [Callistephus chinensis]
Length=356

 Score =   518 bits (1333),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 255/338 (75%), Positives = 288/338 (85%), Gaps = 9/338 (3%)
 Frame = +2

Query  107   SSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWGIFQVVD  286
             + F+RDEDERPKV YN FS+EIPVISL GID      RR  IC +IVKACE+WGIFQVVD
Sbjct  17    NKFVRDEDERPKVPYNTFSNEIPVISLAGID----GCRRAEICDEIVKACEDWGIFQVVD  72

Query  287   HGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWREMVTYF  466
             HGVD  L+S MT LA  FF +P +EKLRFDM+GGKKGGF+VSSHLQGEAVQ+WRE+VTYF
Sbjct  73    HGVDTKLLSDMTGLARDFFHLPTQEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIVTYF  132

Query  467   SYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSKACVDMD  646
             SYP + RDYSRWPDKP  W  VTE+YS+ LM +A KLLEVLSEAMGLEKE L+KACVDMD
Sbjct  133   SYPIKARDYSRWPDKPNEWRAVTEEYSKVLMGLACKLLEVLSEAMGLEKEALTKACVDMD  192

Query  647   QKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPINGAF  826
             QK+VVN+YPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQAT+DGG++WITV+P+ GAF
Sbjct  193   QKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGESWITVKPVEGAF  252

Query  827   VVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREGEKPIME  1006
             VVNLGDHGH LSNGRFK+ADHQAVVNS +SRLSIA FQ PAPEA VYPLK+ EGEK IME
Sbjct  253   VVNLGDHGHYLSNGRFKNADHQAVVNSSTSRLSIATFQNPAPEAIVYPLKINEGEKSIME  312

Query  1007  EAITFAEMYRRKMSKDIELARLK-----KQKMLGIGKP  1105
             E +TF EMY++KMS D+ELARLK     KQ+ L + KP
Sbjct  313   EPMTFMEMYKKKMSTDLELARLKKLAKDKQQDLEVVKP  350



>dbj|BAH36894.1| flavanone 3-hydroxylase [Triticum aestivum]
Length=378

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 250/335 (75%), Positives = 287/335 (86%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   ALAKACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGQSSRLSIATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITF+EMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFSEMYRRKMERDLDLAKRKKQ  342



>ref|NP_001266318.1| naringenin,2-oxoglutarate 3-dioxygenase [Zea mays]
 gb|ACG38441.1| naringenin,2-oxoglutarate 3-dioxygenase [Zea mays]
Length=368

 Score =   518 bits (1333),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/362 (70%), Positives = 297/362 (82%), Gaps = 8/362 (2%)
 Frame = +2

Query  65    PSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQI  244
             P   T   GE  L +SF+R+EDERPKV ++RFSDE+PV+SL+GID      RR  I A++
Sbjct  10    PFLPTAAEGETKLRASFVREEDERPKVPHDRFSDEVPVVSLEGID----GARRAEIRARV  65

Query  245   VKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQ  424
               ACE+WGIFQVVDHGVDA L++ M  LA  FFA+PPE+KLRFDMSGGKKGGF+VSSHLQ
Sbjct  66    AAACEDWGIFQVVDHGVDAALVADMARLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQ  125

Query  425   GEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMG  604
             GEAVQ+WRE+VTYFSYP + RDYSRWPDKP  W  V E+YSE+LM +A +LL VLSEAMG
Sbjct  126   GEAVQDWREIVTYFSYPVKARDYSRWPDKPAAWRAVVERYSEQLMALACRLLGVLSEAMG  185

Query  605   LEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDG  784
             L+ E L++ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DG
Sbjct  186   LDTEALARACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDG  245

Query  785   GKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASV  964
             G+TWITVQP+ GAFVVNLGDHGHLLSNGRFK+A HQAVVNS+ SRLSIA FQ PAP+A+V
Sbjct  246   GRTWITVQPVEGAFVVNLGDHGHLLSNGRFKNAYHQAVVNSECSRLSIATFQNPAPDATV  305

Query  965   YPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARL----KKQKMLGIGKPHFQPKPIDQ  1132
             YPL VR+GE PI++  ITFAEMYRRKM++DIELARL    K +K     K     KP+D 
Sbjct  306   YPLAVRDGEAPILDHPITFAEMYRRKMARDIELARLKKQAKAEKKQSANKEFADSKPLDA  365

Query  1133  LL  1138
             +L
Sbjct  366   IL  367



>gb|ABB60206.1| flavanone 3-hydroxylase [Triticum aestivum]
Length=378

 Score =   518 bits (1333),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/335 (75%), Positives = 287/335 (86%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   ALAKACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGQSSRLSIATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITF+EMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFSEMYRRKMERDLDLAKRKKQ  342



>gb|EMT32361.1| Naringenin,2-oxoglutarate 3-dioxygenase [Aegilops tauschii]
Length=378

 Score =   518 bits (1333),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/335 (75%), Positives = 287/335 (86%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   ALAKACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLS+A FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGESSRLSVATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITFAEMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFAEMYRRKMERDLDLAKRKKQ  342



>gb|ABB60207.1| flavanone 3-hydroxylase [Aegilops tauschii]
Length=363

 Score =   517 bits (1331),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/331 (75%), Positives = 286/331 (86%), Gaps = 4/331 (1%)
 Frame = +2

Query  89    GEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKACEEWG  268
             GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  ACE WG
Sbjct  1     GEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAACEGWG  56

Query  269   IFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAVQNWR  448
             IFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAVQ+WR
Sbjct  57    IFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAVQDWR  116

Query  449   EMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKEGLSK  628
             E+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E L+K
Sbjct  117   EIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESEALAK  176

Query  629   ACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQ  808
             ACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTWITVQ
Sbjct  177   ACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTWITVQ  236

Query  809   PINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLKVREG  988
             PI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL VREG
Sbjct  237   PISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGQSSRLSIATFQNPAPDARVWPLAVREG  296

Query  989   EKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             E+PI+EE ITF+EMYRRKM +D++LA+ KKQ
Sbjct  297   EEPILEEPITFSEMYRRKMERDLDLAKRKKQ  327



>gb|ACH72669.1| flavanone 3-dioxygenase [Triticum aestivum]
Length=378

 Score =   517 bits (1332),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 249/335 (74%), Positives = 288/335 (86%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++RFSD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRFSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LME++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMELSCKLLGVLSEAMGLETE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQP+LTLG+KRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   SLAKACVDMDQKVVVNFYPRCPQPELTLGVKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGQSSRLSIATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITF+EMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFSEMYRRKMERDLDLAKRKKQ  342



>gb|ABG78795.1| flavone synthase I [Conium maculatum]
Length=365

 Score =   516 bits (1330),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 241/340 (71%), Positives = 293/340 (86%), Gaps = 1/340 (0%)
 Frame = +2

Query  59    MKPSTLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICA  238
             M P+T+T LA EKTL  +F+RDEDERPKVAYN FS+EIP+ISL G+++   +GRR  IC 
Sbjct  1     MAPTTITALAQEKTLNLAFVRDEDERPKVAYNEFSNEIPIISLAGLENDS-DGRRPEICR  59

Query  239   QIVKACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSH  418
             +IV+A E WGIFQVVDHG+D+ LIS+M+ L+  FFA+P EEKLR+D +GGK+GGF +S+H
Sbjct  60    KIVEAFENWGIFQVVDHGIDSALISEMSRLSREFFALPAEEKLRYDTTGGKRGGFTISTH  119

Query  419   LQGEAVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEA  598
             LQG+ V++WRE VTYFSYP   RDYSRWPDKPEGW  +TE YSE+LM + +KLLEVLSEA
Sbjct  120   LQGDDVRDWREFVTYFSYPIDARDYSRWPDKPEGWRSITEVYSERLMVLGAKLLEVLSEA  179

Query  599   MGLEKEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATK  778
             MGLEKE L+KACV+M+QK+++N+YP CP+PDLTLG++RHTDPGTIT+LLQD VGGLQAT+
Sbjct  180   MGLEKEALTKACVNMEQKVLINYYPTCPEPDLTLGVRRHTDPGTITVLLQDMVGGLQATR  239

Query  779   DGGKTWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEA  958
             DGGKTWITVQP+ GAFVVNLGDHGH LSNGRFK+ADHQAVVNS SSRLSIA FQ PA  A
Sbjct  240   DGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSSSRLSIATFQNPAQNA  299

Query  959   SVYPLKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
              VYPLK+REGEK I++EAIT+AEMY++ M+K IE+A LKK
Sbjct  300   IVYPLKIREGEKAILDEAITYAEMYKKNMTKHIEVATLKK  339



>gb|ABR13013.1| flavanone 3-hydroxylase [Triticum aestivum]
Length=378

 Score =   517 bits (1331),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 250/335 (75%), Positives = 286/335 (85%), Gaps = 4/335 (1%)
 Frame = +2

Query  77    TGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVKAC  256
             T   GE TL  SF+RDEDERPKVA++R SD +PVISL GID      RR  I  ++  AC
Sbjct  12    TAAWGEATLRPSFVRDEDERPKVAHDRLSDAVPVISLDGID----GARRAEIRDRVAAAC  67

Query  257   EEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGEAV  436
             E WGIFQVVDHGVDADLI+ MT L+  FFA+P E+KLR+DMSGGKKGGF+VSSHLQGEAV
Sbjct  68    EGWGIFQVVDHGVDADLIADMTRLSREFFALPAEDKLRYDMSGGKKGGFIVSSHLQGEAV  127

Query  437   QNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLEKE  616
             Q+WRE+VTYFSYP + RDY RWP+KP GW  V E+YSE+LM ++ KLL VLSEAMGLE E
Sbjct  128   QDWREIVTYFSYPVKARDYGRWPEKPAGWRAVVERYSERLMGLSCKLLGVLSEAMGLESE  187

Query  617   GLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTW  796
              L+KACVDMDQK+VVNFYP+CPQPDLTLGLKRHTDPGTITLLLQD VGGLQAT+DGGKTW
Sbjct  188   ALAKACVDMDQKVVVNFYPRCPQPDLTLGLKRHTDPGTITLLLQDLVGGLQATRDGGKTW  247

Query  797   ITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYPLK  976
             ITVQPI+GAFVVNLGDHGH +SNGRFK+ADHQAVVN +SSRLSIA FQ PAP+A V+PL 
Sbjct  248   ITVQPISGAFVVNLGDHGHFMSNGRFKNADHQAVVNGESSRLSIATFQNPAPDARVWPLA  307

Query  977   VREGEKPIMEEAITFAEMYRRKMSKDIELARLKKQ  1081
             VREGE+PI+EE ITFAEMYRRKM +D++LA+ KKQ
Sbjct  308   VREGEEPILEEPITFAEMYRRKMERDLDLAKRKKQ  342



>dbj|BAA19657.1| flavanone 3-hydroxylase [Perilla frutescens]
Length=372

 Score =   516 bits (1329),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 254/336 (76%), Positives = 283/336 (84%), Gaps = 2/336 (1%)
 Frame = +2

Query  71    TLTGLAGEKTLGSSFIRDEDERPKVAYNRFSDEIPVISLKGIDDGGVNGRRRGICAQIVK  250
             +LT  A E TL   FIRDEDERPKVAY++FS EIPVISL  ID+ G   +R  +C +IV 
Sbjct  8     SLTTQAKESTLHPKFIRDEDERPKVAYDQFSSEIPVISLARIDESG--DKRAEVCRRIVA  65

Query  251   ACEEWGIFQVVDHGVDADLISQMTSLATAFFAMPPEEKLRFDMSggkkggFVVSSHLQGE  430
             ACE+WGIFQVVDHGV   ++  MT LA  FFA+P  EKLRFDMSGGKKGGF+VSSHLQGE
Sbjct  66    ACEDWGIFQVVDHGVHPMVVEGMTRLAREFFALPDHEKLRFDMSGGKKGGFIVSSHLQGE  125

Query  431   AVQNWREMVTYFSYPKQKRDYSRWPDKPEGWTGVTEKYSEKLMEVASKLLEVLSEAMGLE  610
              VQ+WRE+VTYFSYP   RDYSRWPDKP  W  VTE YS+ +ME+  KLLE+LSEAMGLE
Sbjct  126   VVQDWREIVTYFSYPITARDYSRWPDKPVEWRAVTEGYSQLVMELGCKLLEILSEAMGLE  185

Query  611   KEGLSKACVDMDQKIVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGK  790
             ++GLSKACV+MDQKIVVNFYPKCPQPDLTLGLKRHTDPG ITLLLQDQVGGLQAT+D G 
Sbjct  186   RDGLSKACVEMDQKIVVNFYPKCPQPDLTLGLKRHTDPGLITLLLQDQVGGLQATRDAGN  245

Query  791   TWITVQPINGAFVVNLGDHGHLLSNGRFKSADHQAVVNSKSSRLSIAAFQIPAPEASVYP  970
             TWITVQPI GAFVVNLGD  H LSNGRFK+ADHQAVVNSK SRLSIA FQ PAP+A VYP
Sbjct  246   TWITVQPIQGAFVVNLGDFAHYLSNGRFKNADHQAVVNSKCSRLSIATFQNPAPDAKVYP  305

Query  971   LKVREGEKPIMEEAITFAEMYRRKMSKDIELARLKK  1078
             LK+REGEK +MEEAITF+EMY+RKMS D+ELARLKK
Sbjct  306   LKLREGEKAVMEEAITFSEMYKRKMSNDLELARLKK  341



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4768103367270