BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25308_g1_i3 len=2767 path=[5058:0-176 9646:177-205 5264:206-295
5353:296-305 875:306-329 899:330-493 1063:494-517 9908:518-532
9234:533-561 1131:562-562 1132:563-593 568:594-628 603:629-865
840:866-944 5953:945-1568 6576:1569-1799 6807:1800-1923
6929:1924-2354 7360:2355-2395 7400:2396-2466 1700:2467-2503
7506:2504-2517 78:2518-2613 7614:2614-2630 1508:2631-2704
7701:2705-2766]

Length=2767
                                                                      Score     E

ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    509   9e-162   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    520   4e-156   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...    483   1e-151   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    466   7e-146   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    462   2e-143   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    460   3e-143   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                456   2e-141   Capsicum chacoense
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    448   5e-139   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    446   3e-138   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...    445   1e-137   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...    444   3e-137   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...    443   1e-136   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...    442   2e-136   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...    442   3e-135   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...    438   3e-135   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...    439   5e-135   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...    437   7e-135   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...    437   8e-135   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...    437   1e-134   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...    441   4e-134   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...    436   4e-134   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...    435   8e-134   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...    434   1e-133   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...    434   2e-133   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...    434   8e-133   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...    434   9e-133   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...    434   2e-132   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg                430   4e-132   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...    430   4e-132   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...    431   7e-132   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg                429   1e-131   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...    432   1e-131   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...    428   3e-131   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    429   5e-131   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    429   5e-131   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...    427   7e-131   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    428   9e-131   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    426   2e-130   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    427   2e-130   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...    426   2e-130   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...    426   4e-130   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...    424   6e-130   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...    424   6e-130   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...    426   8e-130   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...    424   9e-130   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...    424   1e-129   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...    424   1e-129   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...    424   1e-129   
emb|CDP00737.1|  unnamed protein product                                427   2e-129   
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...    424   2e-129   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...    422   7e-129   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...    422   1e-128   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...    422   2e-128   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...    424   2e-128   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...    421   4e-128   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    420   4e-128   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...    419   1e-127   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...    421   1e-127   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...    415   5e-127   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...    417   8e-127   
gb|ABY61745.1|  resistance protein PSH-RGH6                             416   1e-126   Solanum tuberosum [potatoes]
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    416   1e-126   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...    415   3e-126   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...    415   4e-126   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...    414   4e-126   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...    415   4e-126   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...    419   7e-126   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...    412   7e-126   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...    413   1e-125   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...    413   2e-125   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...    413   2e-125   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...    413   2e-125   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...    410   9e-125   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg                411   2e-124   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...    409   2e-124   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...    413   2e-123   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...    404   3e-123   
emb|CDP00691.1|  unnamed protein product                                401   3e-123   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...    408   5e-123   
gb|AEW48205.1|  disease resistance protein RGH2                         405   1e-122   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    405   2e-122   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...    404   3e-122   
emb|CDP10671.1|  unnamed protein product                                401   5e-122   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...    402   9e-122   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                403   1e-121   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...    402   1e-121   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...    402   2e-121   
ref|XP_009603167.1|  PREDICTED: putative late blight resistance p...    401   5e-121   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...    401   1e-120   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...    400   1e-120   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...    399   1e-120   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...    399   2e-120   
gb|AEW48212.1|  disease resistance protein RGH1                         400   2e-120   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...    395   3e-120   
gb|AEW48197.1|  disease resistance protein RGH3                         400   3e-120   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...    398   5e-120   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...    397   6e-120   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    399   6e-120   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...    396   6e-120   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...    398   1e-119   
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...    397   2e-119   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    392   2e-119   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg                396   2e-119   
gb|AEW48214.1|  disease resistance protein RGH4                         396   3e-119   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...    393   3e-119   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...    397   5e-119   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...    394   1e-118   
gb|AEW48209.1|  disease resistance protein RGH5                         394   3e-118   
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...    392   4e-118   
gb|AEW48206.1|  disease resistance protein RGH4                         394   4e-118   
emb|CDP05558.1|  unnamed protein product                                393   6e-118   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...    394   6e-118   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...    394   8e-118   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...    392   1e-117   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...    392   2e-117   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg                391   3e-117   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...    391   3e-117   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...    390   4e-117   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...    391   5e-117   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...    390   6e-117   
gb|AAF76163.1|AF266747_1  RGC1                                          391   9e-117   Solanum tuberosum [potatoes]
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...    389   1e-116   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...    392   1e-116   
emb|CDP00736.1|  unnamed protein product                                388   1e-116   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...    392   2e-116   
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...    389   3e-116   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...    388   3e-116   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                388   6e-116   
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...    387   6e-116   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg                386   6e-116   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...    388   6e-116   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg                388   7e-116   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...    388   1e-115   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...    386   1e-115   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg                385   1e-115   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...    386   1e-115   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...    387   2e-115   
gb|AEW48196.1|  disease resistance protein RGH7                         387   2e-115   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...    385   2e-115   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...    386   2e-115   
ref|XP_006365693.1|  PREDICTED: putative late blight resistance p...    391   2e-115   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...    387   3e-115   
emb|CDP00692.1|  unnamed protein product                                391   3e-115   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg                385   3e-115   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg                384   4e-115   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg                385   6e-115   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    385   6e-115   
gb|AEW48215.1|  disease resistance protein RGH7                         385   7e-115   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...    384   7e-115   
gb|AEW48210.1|  disease resistance protein RGH5                         384   1e-114   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...    384   2e-114   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...    384   2e-114   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...    383   3e-114   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    391   4e-114   
gb|AEW48192.1|  disease resistance protein RGH3                         384   5e-114   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg                380   2e-113   
ref|XP_010312507.1|  PREDICTED: putative late blight resistance p...    380   2e-113   
gb|AEW48208.1|  disease resistance protein RGH4                         380   2e-113   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...    376   2e-113   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1                375   3e-113   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...    380   3e-113   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1                375   4e-113   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1                375   5e-113   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1                375   5e-113   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    380   6e-113   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    379   8e-113   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg                379   2e-112   
gb|AEW48198.1|  disease resistance protein RGH4                         379   2e-112   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1                373   2e-112   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2               378   3e-112   Solanum tuberosum [potatoes]
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...    378   3e-112   
gb|EYU38161.1|  hypothetical protein MIMGU_mgv1a020688mg                375   1e-111   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...    375   3e-111   
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...    375   3e-111   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg                370   5e-111   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    374   6e-111   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...    370   7e-111   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    374   8e-111   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    374   8e-111   
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg                373   1e-110   
gb|AAV88068.1|  NBS-LRR protein                                         372   2e-110   Ipomoea batatas [batate]
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...    370   3e-110   
gb|AET22504.1|  hypothetical protein                                    372   3e-110   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...    372   4e-110   
gb|AEW48217.1|  disease resistance protein RX5                          373   5e-110   
emb|CDP11186.1|  unnamed protein product                                382   5e-110   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg                370   8e-110   
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...    365   1e-109   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...    369   1e-109   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...    370   2e-109   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...    369   3e-109   
gb|ABY61746.1|  resistance protein PSH-RGH7                             370   4e-109   Solanum tuberosum [potatoes]
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...    367   4e-109   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg                369   4e-109   
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...    364   5e-109   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg                369   5e-109   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...    365   5e-109   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg                367   6e-109   
emb|CDP05521.1|  unnamed protein product                                372   7e-109   
gb|AEW48204.1|  disease resistance protein RGH1                         369   8e-109   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg                365   1e-108   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg                369   2e-108   
emb|CDP18682.1|  unnamed protein product                                372   2e-108   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...    367   2e-108   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg                362   2e-108   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1                362   4e-108   
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg               365   5e-108   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    366   8e-108   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg                366   9e-108   
emb|CDP19489.1|  unnamed protein product                                372   2e-107   
emb|CDP12799.1|  unnamed protein product                                370   2e-107   
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg               362   2e-107   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...    362   4e-107   
gb|EYU40390.1|  hypothetical protein MIMGU_mgv1a018316mg                363   4e-107   
emb|CDP20159.1|  unnamed protein product                                371   6e-107   
gb|EYU33968.1|  hypothetical protein MIMGU_mgv1a026820mg                363   7e-107   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg                363   7e-107   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg                361   1e-106   
gb|EYU24185.1|  hypothetical protein MIMGU_mgv1a024774mg                362   1e-106   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg                362   1e-106   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...    361   1e-106   
gb|AEW48218.1|  disease resistance protein RX6                          363   3e-106   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg                362   3e-106   
emb|CAB56299.1|  NBS-LRR protein                                        363   3e-106   Solanum acaule
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...    362   3e-106   
ref|XP_011072171.1|  PREDICTED: putative late blight resistance p...    361   3e-106   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...    357   4e-106   
gb|AEW48193.1|  disease resistance protein RGH4                         362   4e-106   
emb|CAB50786.1|  Rx protein                                             362   5e-106   Solanum tuberosum [potatoes]
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...    363   7e-106   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg                359   1e-105   
gb|AEW48187.1|  disease resistance protein RGH5                         361   1e-105   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...    359   2e-105   
emb|CDP19728.1|  unnamed protein product                                364   2e-105   
gb|EYU24152.1|  hypothetical protein MIMGU_mgv1a018081mg                357   3e-105   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg                358   4e-105   
gb|AEW48195.1|  disease resistance protein RGH6                         359   4e-105   
gb|AEW48190.1|  disease resistance protein RX4                          358   5e-105   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...    357   7e-105   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg                357   7e-105   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg                355   1e-104   
gb|AEW48188.1|  disease resistance protein RGH7                         358   1e-104   
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg                357   1e-104   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...    357   1e-104   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...    365   1e-104   
gb|AEW48201.1|  disease resistance protein RGH9                         356   1e-104   
gb|AEW48202.1|  disease resistance protein RGH4                         357   2e-104   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg                355   2e-104   
gb|AEW48186.1|  disease resistance protein RGH2                         357   2e-104   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...    357   3e-104   
emb|CDP20153.1|  unnamed protein product                                365   5e-104   
emb|CDP18675.1|  unnamed protein product                                362   1e-103   
gb|AEW48199.1|  disease resistance protein RGH6                         355   1e-103   
emb|CDP10323.1|  unnamed protein product                                348   2e-103   
emb|CDP18680.1|  unnamed protein product                                361   2e-103   
emb|CDP18040.1|  unnamed protein product                                361   2e-103   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...    353   2e-103   
emb|CDP11642.1|  unnamed protein product                                363   2e-103   
emb|CDP04885.1|  unnamed protein product                                356   2e-103   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...    352   5e-103   
gb|AEW48216.1|  disease resistance protein RX3                          353   1e-102   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg                353   1e-102   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                348   1e-102   
gb|AEW48191.1|  disease resistance protein RGH2                         352   2e-102   
emb|CDP19132.1|  unnamed protein product                                358   2e-102   
emb|CDP17263.1|  unnamed protein product                                358   2e-102   
gb|AEW48200.1|  disease resistance protein RGH7                         352   2e-102   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg                353   2e-102   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    351   3e-102   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg                349   3e-102   
gb|AEW48194.1|  disease resistance protein RGH5                         351   3e-102   
emb|CDP16255.1|  unnamed protein product                                350   3e-102   
emb|CDP20463.1|  unnamed protein product                                355   6e-102   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...    350   7e-102   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...    350   8e-102   
emb|CDP12770.1|  unnamed protein product                                347   9e-102   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...    347   1e-101   
emb|CDP17943.1|  unnamed protein product                                354   1e-101   
gb|AEW48211.1|  disease resistance protein RGH1                         345   5e-101   
emb|CDP11974.1|  unnamed protein product                                355   1e-100   
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...    340   1e-100   
gb|AEW48189.1|  disease resistance protein RGH9                         347   2e-100   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg                345   2e-100   
ref|NP_001234202.1|  NRC1                                               346   2e-100   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...    345   3e-100   
ref|XP_011088084.1|  PREDICTED: putative late blight resistance p...    337   3e-100   
emb|CDP21300.1|  unnamed protein product                                353   3e-100   
emb|CDP04754.1|  unnamed protein product                                344   6e-100   
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg                339   8e-100   
gb|EYU17661.1|  hypothetical protein MIMGU_mgv1a025742mg                340   1e-99    
emb|CDP18959.1|  unnamed protein product                                344   1e-99    
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...    344   1e-99    
emb|CDP04753.1|  unnamed protein product                                350   2e-99    
emb|CDP08428.1|  unnamed protein product                                350   2e-99    
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg                340   4e-99    
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...    339   7e-99    
emb|CDP08024.1|  unnamed protein product                                337   8e-99    
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...    350   2e-98    
emb|CDP12798.1|  unnamed protein product                                347   2e-98    
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    340   3e-98    
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8                337   4e-98    
emb|CDP10807.1|  unnamed protein product                                346   4e-98    
emb|CDP11825.1|  unnamed protein product                                346   4e-98    
emb|CDP17919.1|  unnamed protein product                                346   7e-98    
gb|EYU34208.1|  hypothetical protein MIMGU_mgv1a026654mg                338   8e-98    
ref|XP_011090484.1|  PREDICTED: putative late blight resistance p...    335   9e-98    
emb|CDP11160.1|  unnamed protein product                                346   1e-97    
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...    348   1e-97    
ref|XP_009618209.1|  PREDICTED: late blight resistance protein R1...    344   1e-97    
ref|XP_004236955.1|  PREDICTED: putative late blight resistance p...    343   2e-97    
emb|CDP19475.1|  unnamed protein product                                334   2e-97    
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...    338   2e-97    
emb|CDP04756.1|  unnamed protein product                                344   2e-97    
emb|CDP20685.1|  unnamed protein product                                342   3e-97    
gb|EYU24159.1|  hypothetical protein MIMGU_mgv1a020220mg                335   3e-97    
ref|XP_009766585.1|  PREDICTED: late blight resistance protein R1...    343   3e-97    
emb|CDP19994.1|  unnamed protein product                                339   4e-97    
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg                335   5e-97    
emb|CDP11163.1|  unnamed protein product                                348   5e-97    
emb|CDP16515.1|  unnamed protein product                                334   7e-97    
gb|EYU22216.1|  hypothetical protein MIMGU_mgv1a019937mg                335   8e-97    
gb|EYU24166.1|  hypothetical protein MIMGU_mgv1a000858mg                337   1e-96    
emb|CDP20519.1|  unnamed protein product                                342   1e-96    
emb|CDP15705.1|  unnamed protein product                                342   2e-96    
ref|XP_009791923.1|  PREDICTED: putative late blight resistance p...    330   2e-96    
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg                335   2e-96    
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...    344   3e-96    
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...    334   3e-96    
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    333   5e-96    
emb|CDP04755.1|  unnamed protein product                                328   5e-96    
emb|CDP16256.1|  unnamed protein product                                329   6e-96    
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...    333   6e-96    
emb|CDP16976.1|  unnamed protein product                                338   7e-96    
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...    333   7e-96    
emb|CDP19634.1|  unnamed protein product                                339   8e-96    
emb|CDP15268.1|  unnamed protein product                                340   1e-95    
emb|CDP15580.1|  unnamed protein product                                339   2e-95    
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg                331   2e-95    
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    332   2e-95    
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...    338   2e-95    
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg                330   3e-95    
emb|CDP11829.1|  unnamed protein product                                337   4e-95    
ref|XP_009765789.1|  PREDICTED: putative late blight resistance p...    327   6e-95    
emb|CDP11649.1|  unnamed protein product                                337   1e-94    
ref|XP_009758684.1|  PREDICTED: late blight resistance protein R1...    336   1e-94    
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...    338   1e-94    
emb|CDP13141.1|  unnamed protein product                                325   2e-94    
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...    325   2e-94    
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...    335   2e-94    
emb|CDP10805.1|  unnamed protein product                                335   2e-94    
ref|XP_006366837.1|  PREDICTED: putative late blight resistance p...    322   2e-94    
emb|CDP12774.1|  unnamed protein product                                335   3e-94    
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...    325   3e-94    
gb|EYU31247.1|  hypothetical protein MIMGU_mgv1a017756mg                332   3e-94    
gb|EYU21177.1|  hypothetical protein MIMGU_mgv1a018978mg                325   4e-94    
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg                332   5e-94    
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...    324   5e-94    
emb|CDP10810.1|  unnamed protein product                                334   5e-94    
emb|CDP05514.1|  unnamed protein product                                327   7e-94    
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...    328   8e-94    
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...    327   1e-93    
emb|CDP15579.1|  unnamed protein product                                333   1e-93    
emb|CDP10797.1|  unnamed protein product                                327   1e-93    
emb|CDP19488.1|  unnamed protein product                                331   2e-93    
emb|CDP11636.1|  unnamed protein product                                328   2e-93    
gb|EYU23506.1|  hypothetical protein MIMGU_mgv1a001122mg                326   3e-93    
ref|XP_009594770.1|  PREDICTED: late blight resistance protein R1...    332   3e-93    
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...    332   3e-93    
emb|CDP21430.1|  unnamed protein product                                322   4e-93    
emb|CDP08038.1|  unnamed protein product                                332   5e-93    
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...    332   6e-93    
gb|AAF76312.1|AF220603_4  Prf                                           334   8e-93    
ref|XP_009608834.1|  PREDICTED: late blight resistance protein R1...    331   8e-93    
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...    319   1e-92    
emb|CDP12797.1|  unnamed protein product                                330   1e-92    
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...    324   1e-92    
gb|AAT39951.2|  Disease resistance protein, putative                    335   1e-92    
emb|CDP15598.1|  unnamed protein product                                322   2e-92    
gb|EYU35783.1|  hypothetical protein MIMGU_mgv1a019778mg                318   3e-92    
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    319   3e-92    
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    325   3e-92    
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    323   3e-92    
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    325   4e-92    
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    324   5e-92    
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...    332   5e-92    
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    324   5e-92    
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    324   5e-92    
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    324   6e-92    
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    324   8e-92    
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg                322   8e-92    
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    324   9e-92    
emb|CDP15581.1|  unnamed protein product                                322   1e-91    
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    325   1e-91    
emb|CAN70214.1|  hypothetical protein VITISV_038742                     322   1e-91    
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    325   1e-91    
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    325   1e-91    
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    324   1e-91    
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    324   1e-91    
gb|ABO93000.1|  putative disease resistance protein                     327   1e-91    
gb|EYU23605.1|  hypothetical protein MIMGU_mgv1a026401mg                322   1e-91    
gb|ABO92985.1|  putative disease resistance protein                     327   1e-91    
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    324   2e-91    
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    324   2e-91    
gb|ABJ99601.1|  NBS-LRR type resistance protein                         322   2e-91    
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...    329   2e-91    
ref|XP_006365692.1|  PREDICTED: putative late blight resistance p...    313   2e-91    
sp|Q60CZ8.1|R1A10_SOLDE  RecName: Full=Putative late blight resis...    327   2e-91    
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...    329   2e-91    
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    324   2e-91    
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...    322   2e-91    
ref|XP_009787579.1|  PREDICTED: putative late blight resistance p...    316   5e-91    
ref|XP_010244072.1|  PREDICTED: probable disease resistance RPP8-...    320   6e-91    
ref|XP_009600432.1|  PREDICTED: putative late blight resistance p...    315   6e-91    
emb|CDP10800.1|  unnamed protein product                                325   1e-90    
gb|AAC49408.1|  PRF                                                     327   1e-90    
ref|XP_009777374.1|  PREDICTED: putative late blight resistance p...    324   1e-90    
gb|AAF76308.1|  Prf                                                     327   1e-90    
ref|XP_009588710.1|  PREDICTED: putative late blight resistance p...    323   1e-90    
gb|AAV31175.1|  Putative disease resistance protein, identical          318   2e-90    
sp|Q6L439.2|R1A4_SOLDE  RecName: Full=Putative late blight resist...    324   2e-90    
ref|XP_010320900.1|  PREDICTED: putative late blight resistance p...    325   2e-90    
ref|XP_009777376.1|  PREDICTED: putative late blight resistance p...    324   2e-90    
ref|XP_010320901.1|  PREDICTED: putative late blight resistance p...    325   2e-90    
emb|CDP08023.1|  unnamed protein product                                325   2e-90    
emb|CDP10267.1|  unnamed protein product                                320   2e-90    
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...    307   2e-90    
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...    318   2e-90    
ref|XP_009787580.1|  PREDICTED: putative late blight resistance p...    313   3e-90    
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...    323   4e-90    
ref|XP_010677242.1|  PREDICTED: putative late blight resistance p...    322   4e-90    
ref|XP_009588709.1|  PREDICTED: putative late blight resistance p...    323   4e-90    
ref|XP_009588708.1|  PREDICTED: putative late blight resistance p...    323   4e-90    
emb|CDP15990.1|  unnamed protein product                                313   4e-90    
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...    322   5e-90    
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...    323   5e-90    
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...    311   5e-90    
emb|CDP15593.1|  unnamed protein product                                325   5e-90    
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...    322   7e-90    
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363    325   1e-89    
ref|XP_009782798.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    322   1e-89    
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...    324   1e-89    
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...    324   2e-89    
ref|XP_009596161.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    321   3e-89    
sp|Q6L400.1|R1B16_SOLDE  RecName: Full=Putative late blight resis...    321   3e-89    
gb|EYU17693.1|  hypothetical protein MIMGU_mgv1a001245mg                314   4e-89    
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...    311   6e-89    
emb|CDP15849.1|  unnamed protein product                                318   9e-89    
emb|CDP20176.1|  unnamed protein product                                314   9e-89    
ref|XP_009608261.1|  PREDICTED: putative late blight resistance p...    318   1e-88    
ref|XP_009623262.1|  PREDICTED: putative late blight resistance p...    314   1e-88    
ref|XP_004239389.1|  PREDICTED: putative late blight resistance p...    318   1e-88    
ref|XP_009798058.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...    318   2e-88    
ref|XP_006603606.1|  PREDICTED: disease resistance protein RPP13-...    312   2e-88    
ref|XP_009777479.1|  PREDICTED: putative late blight resistance p...    317   2e-88    
ref|XP_007139264.1|  hypothetical protein PHAVU_008G014700g             313   2e-88    
ref|XP_009799380.1|  PREDICTED: putative late blight resistance p...    304   2e-88    
ref|XP_006601748.1|  PREDICTED: NBS-LRR disease-resistance protei...    313   2e-88    
ref|XP_009777477.1|  PREDICTED: putative late blight resistance p...    318   2e-88    
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...    320   2e-88    
emb|CDP08020.1|  unnamed protein product                                318   2e-88    
ref|XP_006355462.1|  PREDICTED: putative late blight resistance p...    303   3e-88    
gb|KHN13835.1|  Disease resistance protein RPP13                        312   3e-88    
ref|XP_010320686.1|  PREDICTED: putative late blight resistance p...    317   3e-88    
ref|XP_010258825.1|  PREDICTED: putative disease resistance prote...    311   4e-88    
ref|XP_009777372.1|  PREDICTED: putative late blight resistance p...    316   5e-88    
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg                308   6e-88    
gb|KDP30596.1|  hypothetical protein JCGZ_16249                         311   6e-88    
ref|XP_009777373.1|  PREDICTED: putative late blight resistance p...    317   7e-88    
ref|XP_009777371.1|  PREDICTED: putative late blight resistance p...    317   7e-88    
gb|KHN13874.1|  Disease resistance protein RPP13                        311   8e-88    
emb|CDP17703.1|  unnamed protein product                                316   9e-88    
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8                307   1e-87    
ref|XP_010327575.1|  PREDICTED: putative late blight resistance p...    308   2e-87    
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...    318   2e-87    
gb|AEW48207.1|  disease resistance protein RGH5                         310   2e-87    
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...    301   2e-87    
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...    315   2e-87    
emb|CDP18676.1|  unnamed protein product                                314   2e-87    
emb|CDP05594.1|  unnamed protein product                                315   3e-87    
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...    310   3e-87    
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...    301   3e-87    
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...    315   3e-87    
emb|CDP21728.1|  unnamed protein product                                305   4e-87    
ref|XP_010661285.1|  PREDICTED: putative disease resistance prote...    308   4e-87    
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...    308   4e-87    
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    317   6e-87    
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...    311   6e-87    
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...    311   8e-87    
ref|XP_009760596.1|  PREDICTED: late blight resistance protein R1...    311   8e-87    
emb|CDP11618.1|  unnamed protein product                                311   9e-87    
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...    311   1e-86    
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...    316   1e-86    
ref|XP_009760597.1|  PREDICTED: late blight resistance protein R1...    311   1e-86    
ref|XP_009761661.1|  PREDICTED: late blight resistance protein R1...    305   1e-86    
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...    315   1e-86    
emb|CDP10344.1|  unnamed protein product                                311   2e-86    
ref|XP_010677240.1|  PREDICTED: putative late blight resistance p...    311   2e-86    
gb|AGX27506.1|  NBS-LRR class resistance protein Fy12-Ry1               300   2e-86    
ref|XP_006363252.1|  PREDICTED: putative late blight resistance p...    310   2e-86    
ref|XP_009764259.1|  PREDICTED: late blight resistance protein R1...    312   2e-86    



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   509 bits (1312),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 344/935 (37%), Positives = 517/935 (55%), Gaps = 94/935 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPIL--VVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SLIRT+EL      P+L    D ++EI  L +K+  ++A L+ SEK+++   A
Sbjct  1     MAYASIASLIRTMELLLTSDSPMLSLTFDLREEIIELHKKVSSIEAFLKNSEKQIHNHMA  60

Query  253   EKDVIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDIEGLIEQR  414
               ++ AR+K  +  AED+IE  + E +        G +HE L + LQR+A+DI+ +   +
Sbjct  61    MTELEARIKGFANVAEDKIEFGLREAMITEDEMQRGKAHEELRESLQRVAKDIDCV---Q  117

Query  415   NTTQMLSSYNPGQSNQEHIIAGGAS-----KLQDDAIMVGHAQELERTKEMLLQCSTQER  579
               ++ +  +   Q++   ++   +S      L     MVG  +E ER  E L   S  E 
Sbjct  118   KESKKIQHHKGNQASTLSLLRDTSSSEMLPNLDVSNNMVGRDKEKERMLEELRGGSKDEL  177

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+AK++++ PSI+SRF +  WAT+ ++Y+++ IL  L   +  + D
Sbjct  178   KVIPIVGMGGIGKTTLAKQVFNHPSIQSRFDVRAWATICKEYNVKEILLSLLQSIINIDD  237

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             K  +  +  AELA+ ++++L  +RYL+V+DDIW  + WDD ++CFP D+NGSRILLTTR 
Sbjct  238   KVYS--RDEAELADLLQKKLKCRRYLIVIDDIWCYKAWDDTRQCFPIDNNGSRILLTTRH  295

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESW-MLFSQKLGSINLPPEIEEIGKRIVNKCRGLPLA  1116
              EVA+Y+  S  ++  +  +N++ESW +L S+   + +  PE+E IG++I +KC+GLPL 
Sbjct  296   TEVAIYASSSNLHL-KMNLMNADESWNLLKSKAFANESFTPELETIGEKIASKCQGLPLT  354

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V AGLLSK+KR+ E W+++A  +   +T D ++QC  +L LSYN LP  LKAC LYFG
Sbjct  355   IVVVAGLLSKSKRTKEEWENVAENIKSFVTKDPNEQCLRVLGLSYNYLPNELKACLLYFG  414

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG-N  1473
             IFP+   EI  K L+ LWI EGF+  +     EE A   LQDL+DR LVL+S+ S  G N
Sbjct  415   IFPE-DSEISVKRLVRLWIAEGFLKLEG--DFEEEAKNRLQDLVDRCLVLVSQRSADGRN  471

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR----TT  1641
             +KTCR+HDL+ +LCLRE + + F+   + ++E V ++G          RW++ +    T 
Sbjct  472   VKTCRIHDLVHELCLREAQSQNFLFIRNDKTEYVPQVG---------YRWISIQERQQTG  522

Query  1642  YIQPKFSDKYNFHKS----------------RTLLFFFGVSGASGLPVSWRQNVSFKMIR  1773
              +Q +   +   HK                 R +   F  +  S +  S  +     +IR
Sbjct  523   VVQNEHGYRSLAHKHCFWLIRTPTDDDNSPLRRIRSIFLFAAPSLINNSNLELGHLNLIR  582

Query  1774  VLDLVEISFDEAPTFDISDLILLRYLALGT---IKYVRVLKHHHNLQTLIVKFPNSCRie  1944
             VLDL  ++F   P   I  L LLRYL+  T       R L+   NLQT IV+ P S  I 
Sbjct  583   VLDLNSMNFSSFP-LQILGLFLLRYLSFSTRNSFGIPRGLRKLLNLQTFIVRGPVSSFI-  640

Query  1945  eidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYW---------VP  2097
                       K+ + +W++  LR +K    +  D     + D    L+W         +P
Sbjct  641   ----------KFPELIWETTELRHLKLRNFYLPDPPSSSI-DGERNLFWSNIQSVSGLIP  689

Query  2098  YLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQS  2277
             Y  CTK  + +  N+K L I+   +  ++      +L +L  L  L    I+ +++++  
Sbjct  690   YC-CTKNILSRFQNIKKLCIR-GHVYDYRVHEEDMDLRHLVDLHHLETLSIKVDRYQVSH  747

Query  2278  INS--------------FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEE  2415
              +S              FP  LK+LK+VGT L WE + I+   PNLE LKL      G +
Sbjct  748   WSSRFHKLPVYVPSAIHFPTKLKKLKLVGTRLSWEELNIVGQWPNLEVLKLKPNACRGLK  807

Query  2416  WVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQL  2595
             W   +GGFP+LKFL I G  L  W+  +DHFP LE L + HC +L KIP  F DI +LQL
Sbjct  808   WHPIEGGFPRLKFLLIEGTNLTRWKATNDHFPALEHLVIKHCFHLVKIPIEFADIYSLQL  867

Query  2596  IELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYD  2700
             IEL++C   L+ S   IQEEQ   G+  + VR Y+
Sbjct  868   IELQNCKAKLMASTVRIQEEQEYLGSKPVDVRSYN  902



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   520 bits (1340),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 351/927 (38%), Positives = 518/927 (56%), Gaps = 86/927 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPIL--VVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SLIRT+EL      P+L    D+++EI  L +K+  ++A L+ SEK+++   A
Sbjct  976   MAYASIASLIRTMELLLTSDSPMLSLTFDHREEIIELHKKVSSIEAFLKNSEKQIHNHMA  1035

Query  253   EKDVIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDIEGLIEQR  414
               ++ AR+K  +   ED+IE  + E +        G +HE+L + LQR+A+DI+ + E+ 
Sbjct  1036  MTELEARIKGFANVVEDKIEFGLREAMIAEDEMQRGKAHEKLRESLQRVAKDIDRVQEE-  1094

Query  415   NTTQMLSSYNPGQSNQEHIIAGGAS-----KLQDDAIMVGHAQELERTKEMLLQCSTQER  579
               +Q +  +   Q++   ++   +S      L     MVG  +E +R  E L   S  E 
Sbjct  1095  --SQKIQQHKGSQASTLSLLRDTSSSEILPNLDVSNNMVGRDKEKKRMLEELRGGSKDEL  1152

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+AK++++ PSI+SRF +  WAT+S++Y+++ IL  L   +  + D
Sbjct  1153  KVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYNVKEILLSLLQSIINIDD  1212

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             K  +  +   ELA+ ++++L  +RYL+V+DDIW ++ WDD ++CFP D+NGSRILLTTR 
Sbjct  1213  KVYS--RDEDELADLLQKKLKCRRYLIVIDDIWSNKAWDDTKQCFPIDNNGSRILLTTRH  1270

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKCRGLPLA  1116
              EVA+ +  S   +  +  +NS+ESW LF S+   + + PPE++ IG++I +KC+GLPL 
Sbjct  1271  TEVAI-NASSSNLLLKMNLMNSDESWNLFKSKAFANESFPPELQTIGEKIASKCQGLPLT  1329

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V AGLLSK+KR+ E W+++A  +   +T D  +QC  +L LSYN LP  LKAC LYFG
Sbjct  1330  IVVVAGLLSKSKRTKEEWENVAENIKSFVTKDPDEQCLRVLGLSYNYLPNDLKACLLYFG  1389

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG-N  1473
             IFP+   EI  K L+ LWI EGF+  +    LEE A   LQDL+DR LVL+SK S  G  
Sbjct  1390  IFPE-DSEISVKRLVRLWIAEGFLKLEG--DLEEEAKNRLQDLVDRCLVLVSKRSADGRK  1446

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELG-------------DTEPLFEYA  1614
             IKTCR+HDL+ +LCLRE + + F+   + ++ +V  +G             D E  F   
Sbjct  1447  IKTCRIHDLVHELCLREAQSQNFLFIRNDKTGSVPRVGCQWISIQKSQQTDDDEHWF---  1503

Query  1615  NRWLTFRTTYI--QPKFSDKYNFHKSRTLLFFFG--VSGASGLPVSWRQNVSFKMIRVLD  1782
              R LT +  ++   P   DK    + R++  F     S  S L +         +IRVLD
Sbjct  1504  -RSLTHKLCWLIRTPTDDDKSPLRRIRSIFLFAAPSFSNNSNLELG-----HLNLIRVLD  1557

Query  1783  LVEISFDEAPTFDISDLILLRYLALGTIKYVRV---LKHHHNLQTLIVKFPNSCRieeid  1953
             L  + F   P   I  L LLRYL+  T     +   L    NLQT IV+ P         
Sbjct  1558  LSSMFFSSFP-LQILSLFLLRYLSFSTRNSFGIPGGLCRLLNLQTFIVRGP---------  1607

Query  1954  sdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYW---------VPYLR  2106
                    K+ + +W++  LR +K    +  D     + D    L+W         +PY  
Sbjct  1608  --VISFIKFPELIWETTQLRHLKLRNFYLPDPPSSSI-DGERNLFWPNIQSVSGLIPYC-  1663

Query  2107  CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS  2286
             CTK+ + +  N+K L I+   +  +       +L +L  L +L    ++ +++++   +S
Sbjct  1664  CTKKILSRFQNIKKLCIR-GHVYDYGVHEEVMDLRHLVDLHQLETLSVKVDRYQVSHGSS  1722

Query  2287  ---------FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGF  2439
                      FP  LK+LK+VGT L WE + II   PNLE LKL      G EW   +G F
Sbjct  1723  RFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIGQWPNLEVLKLKPNACHGLEWRPIEGRF  1782

Query  2440  PKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFP  2619
             P+LKFL I G  LK W+  +DHFP LE L + HC +LE+IP  F DI +LQLIEL++C  
Sbjct  1783  PQLKFLLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSA  1842

Query  2620  SLVESAKDIQEEQSSYGNDQLVVRDYD  2700
              LV SA  IQEEQ S G+  + VR Y+
Sbjct  1843  KLVASAGRIQEEQESLGSKAVDVRSYN  1869


 Score =   492 bits (1266),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 318/829 (38%), Positives = 465/829 (56%), Gaps = 73/829 (9%)
 Frame = +1

Query  346   SHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGAS-----KLQDDAI  510
             +HE+L + LQR+A+DI+ + E+   +Q +  +   Q++   ++   +S      L     
Sbjct  1877  AHEKLRESLQRVAKDIDRVQEE---SQKIQQHKGSQASTLSLLRDTSSSEILPNLDVSNN  1933

Query  511   MVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWAT  690
             MVG  +E +R  E L   S  E +VI IVGMGGIGKTT+AK++++ PSI+SRF +  WAT
Sbjct  1934  MVGRDKEKKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAWAT  1993

Query  691   VSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRG  870
             +S++Y+++ IL  L   +  + DK  +  +   ELA+ ++++L  +RYL+V+DDIW ++ 
Sbjct  1994  ISKEYNVKEILLSLLQSIINIDDKVYS--RDEDELADLLQKKLKCRRYLIVIDDIWSNKA  2051

Query  871   WDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSI  1047
             WDD ++CFP D+NGSRILLTTR  EVA+ +  S   +  +  +NS+ESW LF S+   + 
Sbjct  2052  WDDTKQCFPIDNNGSRILLTTRHTEVAI-NASSSNLLLKMNLMNSDESWNLFKSKAFANE  2110

Query  1048  NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQC  1227
             + PPE++ IG++I +KC+GLPL I V AGLLSK+KR+ E W+++A  +   +T D  +QC
Sbjct  2111  SFPPELQTIGEKIASKCQGLPLTIVVVAGLLSKSKRTKEEWENVAENIKSFVTKDPDEQC  2170

Query  1228  STILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAM  1407
               +L LSYN LP  LKAC LYFGIFP+   EI  K L+ LWI EGF+  +    LEE A 
Sbjct  2171  LRVLGLSYNYLPNDLKACLLYFGIFPE-DSEISVKRLVRLWIAEGFLKLEG--DLEEEAK  2227

Query  1408  KYLQDLIDRNLVLISKLSFIG-NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIEL  1584
               LQDL+DR LVL+SK S  G  IKTCR+HDL+ +LCLRE + + F+   + ++ +V  +
Sbjct  2228  NRLQDLVDRCLVLVSKRSADGRKIKTCRIHDLVHELCLREAQSQNFLFIRNDKTGSVPRV  2287

Query  1585  G------------DTEPLFEYANRWLTFRTTYI--QPKFSDKYNFHKSRTLLFFFG--VS  1716
             G            D E   E+  R LT +  ++   P   DK    + R++  F     S
Sbjct  2288  GCQWISIQKSQQTDVEFQDEHWFRSLTHKLCWLIRTPTDDDKSPLRRIRSIFLFAAPSFS  2347

Query  1717  GASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV---LK  1887
               S L +         +IRVLDL  + F   P   I  L LLRYL+  T     +   L 
Sbjct  2348  NNSNLELG-----HLNLIRVLDLSSMFFSSFP-LQILSLFLLRYLSFSTRNSFGIPGGLC  2401

Query  1888  HHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQ  2067
                NLQT IV+ P                K+ + +W++  LR +K    +  D     + 
Sbjct  2402  RLLNLQTFIVRGP-----------VISFIKFPELIWETTQLRHLKLRNFYLPDPPSSSI-  2449

Query  2068  DTLHTLYW---------VPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLT  2220
             D    L+W         +PY  CTK+ + +  N+K L I+   +  +       +L +L 
Sbjct  2450  DGERNLFWPNIQSVSGLIPYC-CTKKILSRFQNIKKLCIR-GHVYDYGVHEEVMDLRHLV  2507

Query  2221  KLEKLIVEDIESEQFELQSINS---------FPQSLKELKIVGTELGWEAITIISMLPNL  2373
              L +L    ++ +++++   +S         FP  LK+LK+VGT L WE + II   PNL
Sbjct  2508  DLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIGQWPNL  2567

Query  2374  ESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLE  2553
             E LKL      G EW   +G FP+LKFL I G  LK W+  +DHFP LE L + HC +LE
Sbjct  2568  EVLKLKPNACHGLEWRPIEGRFPQLKFLLIEGTNLKCWKATNDHFPALEHLVIRHCFHLE  2627

Query  2554  KIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYD  2700
             +IP  F DI +LQLIEL++C   LV S   IQEEQ S G+  + VR Y+
Sbjct  2628  EIPIEFADIYSLQLIELQNCTAKLVASTVLIQEEQESLGSKAVDVRSYN  2676


 Score =   367 bits (942),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 299/929 (32%), Positives = 468/929 (50%), Gaps = 138/929 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPIL--VVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+ T++L       +   + D+++E   L +K+     +  +  +K NVS+ 
Sbjct  96    MAYASVASLLNTIQLLLTSDSQMRSQICDHREEFHALSEKVS-SLEIFLKKFEKSNVSRE  154

Query  253   EKDVIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ A++K+++   E  I+  + +II          + E L   L+++AE+I+ +  Q+
Sbjct  155   MTDLEAQIKEVADGVEITIQLRLTDIIMAKNEMQKKKAREMLCDSLKQVAEEIDRV--QK  212

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASK---LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
              +T++   Y   QS +E+ +   +S    L     MVG   E E+    L +  +   +V
Sbjct  213   ESTKI--QYKAKQSLEEYFVQASSSAKVILNGKNNMVGRRDEREKMMTELTRGFSGVLKV  270

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             I IVGMGGIGKTT+AK++++D  IRS F +  WAT+SQ+++++ IL  L     +  D  
Sbjct  271   IPIVGMGGIGKTTLAKEVFNDAFIRSHFDVRAWATISQEHNVKDILVSLLHSTKEKDDTV  330

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
               E +S  +LA+ +++ L  +RYL+V+DD+W  + WDD                      
Sbjct  331   NTEDES--KLADMLQKSLKSRRYLIVLDDMWSDKAWDD---------------------N  367

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             +++  G  G            ESW LF S    +  LP E E +GK+IV++C+GLPL I 
Sbjct  368   ISLPIGLMGPV----------ESWDLFKSAAFVNEALPSEFETVGKQIVDQCQGLPLTIV  417

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGL SK+KR++E W S+A  +   +T+D  +QC  +L LSYN+L   LK C LYFGIF
Sbjct  418   VVAGLWSKSKRTIEVWGSVAKDVKSFVTNDPDEQCLHVLGLSYNHLTSDLKPCLLYFGIF  477

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIK  1479
             P+   E+  K L+ LWI EGF+  +  + LE  A K LQDLIDR LVL+S+ S     ++
Sbjct  478   PE-DSEVSVKRLVRLWIAEGFLKFE--KDLEGVAEKCLQDLIDRCLVLVSEKSLDETRVR  534

Query  1480  TCRLHDLLFDLCLREVKKEKF------VSAFHQRSENVIELGD-------TEPLFEYANR  1620
              C++H+L+++LCLRE +++        V   +    N+ E  D        E  ++Y   
Sbjct  535   YCKVHNLIYELCLREAQRQSLFVMNDIVYVDYDGDYNLDEDDDWDEYHNLDEDKYDYIKE  594

Query  1621  ----WLTFRTT-------YIQPKFSDKYN--FHKSRTLLFFFGVSGASGLPVSWRQNVSF  1761
                 + ++RT         I+ K  D  N    ++R++ F    SG   L         F
Sbjct  595   GKRGFGSYRTLLTPGHHHLIRRKTDDADNNLLKQTRSIFFNNSYSGTFSLKSKL---FHF  651

Query  1762  KMIRVLDLVEISFDEAPTFDISDLILLRYLA-LGTIKYVRVLKHHHNLQTLIVKFPNSCR  1938
              ++R+LDL  +  +  P F I  L+ LRYL  LG       +    NLQT IV       
Sbjct  652   SLLRILDLSFVLLERFP-FQILCLVWLRYLELLGDFDIPTDICRLWNLQTFIVD------  704

Query  1939  ieeidsdeeiGSK-----WLQGLWKSQSLRFIKYPYPFPIDTDEIPVQD-------TLHT  2082
                       GS      + + +W+   LR ++       ++  + V          +HT
Sbjct  705   ----------GSPGDFGIYPKEIWELTQLRHLELTSFLLPNSPTVSVDGQRYLGLPNIHT  754

Query  2083  LYWVPYLRCTKEFVLKIPNVKVLGIKC--SEIRAFQTETWWDNLHYLTKLEKL---IVED  2247
             +  + +  CTKE +  I NV+ L ++   ++   FQ    ++NL +L  LE L   I  D
Sbjct  755   ILGLSHGCCTKEVISGIRNVRKLKVEGDNNDYEGFQESRLFNNLVHLQHLETLSVTIYAD  814

Query  2248  IE-SEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVT  2424
             +E S    + S  +FP +LK+LK+ GT L W+ + I+  LPNLE LKL+    +GEE   
Sbjct  815   LEDSVPVTIPSAKAFPATLKKLKLYGTGLRWDDLNIVGELPNLEVLKLI-FDAVGEE---  870

Query  2425  GDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
                              LK W   +D+FPVLERL +  C  LE+IP  F++ ++L+LIEL
Sbjct  871   ---------------CHLKYWNITNDNFPVLERLMIIDCTELEEIPIEFSETSSLKLIEL  915

Query  2605  KDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             KDC P L  SA  IQ+EQ   GN+ + VR
Sbjct  916   KDCKPHLEASATRIQQEQEDIGNNPVDVR  944



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score =   483 bits (1242),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 343/933 (37%), Positives = 488/933 (52%), Gaps = 102/933 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFL----------EPRPILVVDYKDEIQCLRQKLCHlkalleese  228
             MAY  +TSL+ T+ L             E    L    K++IQ  RQK+  L+ALLE  E
Sbjct  1     MAYAAVTSLMSTLGLLLQSNSRLNLPNEEQTESLHKRVKEQIQSFRQKVGSLQALLETLE  60

Query  229   kklNVSQAEKDVIARVKDISFRAEDEIES---EVMEIISNGASHERLHQILQRLAEDIEG  399
             K +N  +  +    ++KD +  AE  IES   +  +  +   S E   +  +RL +  E 
Sbjct  61    KNINDPKTIEHCEVKIKDAAHDAEYRIESVLEKFYKAQNEKVSREAYEEFCKRLQKASES  120

Query  400   LIEQRNTTQMLSSYNPGQSNQEHIIAG---GASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +    N+ ++  S   G      +I          Q    MVGH  ELE  K  L++ S+
Sbjct  121   I--DSNSRKLTESMKSGLQATSSLIQSFDLPEHSPQLGNSMVGHENELEDVKCKLMKISS  178

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
              ER+ ++I GMGGIGKTT A+KIYDDP I+S F +L W TVS++Y +R++L  L  C+  
Sbjct  179   DERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWVTVSKEYCVRKMLLQLLHCIPS  238

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
              T++   E +   ELA K+++RL ++RYL+V+DDIW S+ WDD+   FPD   GS ILLT
Sbjct  239   -TEEVRREARDDGELAGKLKQRLWKRRYLVVIDDIWSSKAWDDISLWFPD-CKGSHILLT  296

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGL  1107
             TR   VA Y+   GK   ++  L+  +SW L   KL   + L PE+ +IGK+I   C G+
Sbjct  297   TRCGNVASYAA-PGKTPHHMSSLSPEKSWELLQSKLLEKVELSPELVKIGKKIAENCHGM  355

Query  1108  PLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFL  1287
             PL ITV AG+LSK   ++E W+ +A  +   +  DL  QC  +L LSY  LP HLKACFL
Sbjct  356   PLTITVVAGILSKCNNALEGWKRVAHDVKSAIFKDLGRQCEKVLGLSYYYLPQHLKACFL  415

Query  1288  YFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI  1467
             YFGIFP+   E+  + L+ LW+ +GF+ E   +SLE+ A + LQ+LIDRNLVL+S  SF 
Sbjct  416   YFGIFPE-DEEVDVRRLVELWVAQGFLKEADNKSLEDIAGECLQELIDRNLVLVSGQSFW  474

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYI  1647
             G ++TC++HDLL +LCLR+            RSEN + +  ++PL    NR      + +
Sbjct  475   GEVETCKIHDLLHELCLRQA-----------RSENFLPVTKSKPL----NRVTCVSRSSV  519

Query  1648  QP------KFSDKY-------NFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLV  1788
             Q         SD Y       +  K RT+++      A      ++    FKMIRVLDL 
Sbjct  520   QDCLMIVRSISDFYWLNSLRRDQKKIRTIVYKGERKRAERERFEFK---IFKMIRVLDLR  576

Query  1789  EISFDEAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdee  1965
             ++ FD      + DL+ LRYL+L   K+  + L    NLQ LIV+               
Sbjct  577   KLYFDNGIPTSVFDLVHLRYLSLYIEKHEYIPLSKLQNLQILIVEI--------------  622

Query  1966  iGSKWLQG----LWKSQSLRFIKY-------PYPFPIDTDEIPVQDTLHTLYWVPYLRCT  2112
              G  W       +W+   LR +++       P   PI   E  V   LHTL  V    C 
Sbjct  623   -GKNWADKVPIEIWRMPQLRTVRFVKTGWQCPPNMPIGEREHTVLQHLHTLTGVGAAWCK  681

Query  2113  KEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLE--KLIVEDIESEQFE------  2268
             KE    +PN+K L I    +    T   W  +  L  +E  ++IV  I+   F       
Sbjct  682   KEIFALMPNLKNLEIVLGGV----TRDLWKRISCLPLIEVLRIIVGKIDYSAFSLYRSKA  737

Query  2269  ----LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQ---AYEMGEEWVTG  2427
                 L+  ++FP +L+ L + GT L WEA+ I+ MLPNLE L+L       +    W   
Sbjct  738   HDDFLKYRSTFPPTLRRLTLGGTCLPWEAMDIVGMLPNLEILELEDDACGVKPKTAWKPS  797

Query  2428  DGGFPKLKFLYISGA-KLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
             + GFP+LKFL +        W+   DHFPVLERL + HC  LE+IP+ F +I TLQLIEL
Sbjct  798   EEGFPQLKFLSLCHMLCFTEWKATEDHFPVLERLFISHCPRLEEIPQEFANIFTLQLIEL  857

Query  2605  KDCFPSLVESAKDI-QEEQSSYGNDQLVVRDYD  2700
              DC   L  SA+ I QE++++YG+    V  Y+
Sbjct  858   HDCCIHLAISAQQIEQEQEATYGSQVTNVHTYN  890



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   466 bits (1200),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 332/899 (37%), Positives = 490/899 (55%), Gaps = 66/899 (7%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  +T L+RT+EL       +  L+ ++++E + L +K+     +  ++ +K NVS  
Sbjct  1     MAYASITFLMRTIELLLTSNSQMQSLICNHREEFKLLHEKV-SSLEVFLKNFEKNNVSGE  59

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D  A++K+++   E  I+  + E       I    + E L   LQ+ A +I+ L  Q+
Sbjct  60    MTDFEAQIKEVADDVEHTIQLRLTEAAMENNKIQKEKADEVLCDSLQQAANNIDRL--QK  117

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASK---LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
              +T+ +       SN+  ++   +S    L     M+G   E +R  E L +  + E +V
Sbjct  118   ESTK-IQDKGKLASNKSSLVQDSSSTKDILNVKKNMMGRDDERKRLLEDLTRGFSSECKV  176

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             I I GMGGIGKTT+AK +++D SIRS F +  WAT+SQ YD++ IL  L       T   
Sbjct  177   IPITGMGGIGKTTLAKDVFNDVSIRSHFDVRAWATISQQYDVKEILLSLLRSTMGYTFYM  236

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
              +E    A+LA+ +++ L  +RYL+V+DD+W S+ WD++++CFP  SNGSRILLTTR  E
Sbjct  237   GDE----ADLADMLQKSLKSKRYLIVMDDMWSSKAWDEVKQCFPTQSNGSRILLTTRDTE  292

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             +A Y+G +      + F++ NESW LF +    +  L  E E IGK+I NKC+GLPL I 
Sbjct  293   LACYAG-TKNLSFEMGFMDPNESWNLFVRAAFANEGLASEFETIGKQIANKCQGLPLTIV  351

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGLLS++KR++++W+ IA  +   + +D  +QC  +L LSYN+L   LKAC LYFGIF
Sbjct  352   VVAGLLSRSKRTIKDWEEIAKDVMSFVRNDPDEQCLHVLGLSYNHLTSDLKACLLYFGIF  411

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN-IK  1479
              +   +I  K L+ LWI  GF+    G+ LE  A K LQDLIDR LVL+SK S  G  I+
Sbjct  412   SE-DSDISVKKLVRLWIAAGFL--KLGKDLEGEAKKCLQDLIDRCLVLVSKKSMDGTKIR  468

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK-  1656
             +C++HDL+++LCLRE+ + + +  F     + + +G  EP   +      +R   + PK 
Sbjct  469   SCKVHDLIYELCLRELAQRQDI--FFMNDVSTLVMG-MEPFSRHIPYSGCYRA-LLTPKR  524

Query  1657  -FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS-FKMIRVLDLVEISFDEAPTFDISD  1830
                D   F ++ +++F       +    + R N+  +K + +LDL  I     P  +I  
Sbjct  525   HLYDNNRFKRTCSIIFLCRYPCTT---FTLRSNLRHYKTLTILDLSLIQLSSFPP-EILC  580

Query  1831  LILLRYLALGTIKY------VRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
             LI LRYL L    +        + K   NLQT IV+   S  +            + Q +
Sbjct  581   LICLRYLVLSRYGWWGFDIPPEIFKLV-NLQTFIVEGYGSIDVI-----------FPQHI  628

Query  1993  WKSQSLRFIK---YPYPFPIDTDE-IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI-  2157
             W+   +R +K   +  P P +  E   V   + T+  +    CTKE +  I NVK LGI 
Sbjct  629   WELTGIRHLKLNLFYLPNPPNVSERYLVFSNVQTISGLSPCSCTKEVISSIQNVKKLGIV  688

Query  2158  -KCSEIRAFQTETWWDNLHYLTKLEKLIVE---DIESEQFE---LQSINSFPQSLKELKI  2316
                 + R FQ   ++DNL +L +LE L  +      SEQ     + S  +FP +LK LK+
Sbjct  689   GDGGDYRTFQKSAFFDNLVHLHQLETLKFQFRYVWMSEQISPATIPSAKAFPATLKNLKL  748

Query  2317  VGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETM  2496
             VGT L WE + II  LPNLE LKL+     G+EW   +GGF +LK L I    +K W   
Sbjct  749   VGTGLRWEDLNIIGELPNLEVLKLILDACCGQEWHPIEGGFTRLKLLLIQMCNIKCWNAT  808

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
              D FPVLERL +  C +LE+IP  F DI +LQLIEL  C P L+ SA  IQ+EQ   GN
Sbjct  809   CDSFPVLERLVIISCSDLEEIPFEFADIQSLQLIELDSCTPELMASAVRIQQEQEEIGN  867



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   462 bits (1188),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 342/954 (36%), Positives = 509/954 (53%), Gaps = 119/954 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+RTVEL      PI  L+ D+++EI  L +K+     +  ++ ++ NVS+ 
Sbjct  1     MAYASIASLMRTVELLLTLKSPIQSLICDHREEILTLNEKV-SSLEVFLKNSERSNVSEE  59

Query  253   EKDVIARVKDISFRAEDEIESEVME-IISNG-----ASHERLHQILQRLAEDIEGLIEQR  414
               D+ A +K+++   E  I+  + E +++N       + E     LQ++AEDI  + ++ 
Sbjct  60    MTDLEAWIKEVANVVEYTIQLRLTEAVMANDEMQKETAREMFCDSLQQVAEDISRVQKES  119

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASK---LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
                Q        Q++++ ++ G +S    L     MVG   + +R  E L + S+ E +V
Sbjct  120   MKIQQ----KGKQASKKSLVQGSSSAKDVLNVKKNMVGRDDQRKRLLEDLTRGSSGELKV  175

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             I I+GMGGIGKTT+AK++Y+D SIRS F +  WATVS  ++++ IL  L    ++M D  
Sbjct  176   IPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNIKEILLSLLR--SRMGDTF  233

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
               E    AELA+ +++ L  +RYL+V+DD+W S+ WDD+++CFP ++N SRILLTTR  +
Sbjct  234   YME--DEAELADMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRILLTTRDTD  291

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA Y+G +  +   + F++  ESW LF S    +  LP E E IGK+IV+KC+GLPL I 
Sbjct  292   VACYAG-TENFSLQMSFMDPYESWNLFKSAAFANEELPSEYETIGKQIVDKCQGLPLTIV  350

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGLLSK++R++E+W++IA  +   +T+D   QC  +L LSYN+L  +LKAC LYFG F
Sbjct  351   VVAGLLSKSERTIEDWENIAQDVMSFVTNDPDKQCLHVLGLSYNHLTSNLKACLLYFGAF  410

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIK  1479
             P+  REI  K L+ LWI EGF+  +  +  E  A K L+DL+DR L+L+ +  +    IK
Sbjct  411   PE-DREISVKRLVRLWIAEGFLKLE--KDFEGEAAKCLKDLVDRCLILVCEKKWDETEIK  467

Query  1480  TCRLHDLLFDLCLREVKKEKFVS---AFH--------------QRSENVIELGD----TE  1596
             +C++HDL+++LCLRE + + F+     FH              Q  + V++L D      
Sbjct  468   SCKVHDLIYELCLREAQSQNFIMNDIVFHYLDLDEDDGSDEIAQSHDIVLDLDDEPNPVP  527

Query  1597  PLFEY--------ANRW-------LTFRTTYIQPKF-------------SDKYNFHKSRT  1692
             P   +          RW         +    + P+               + Y   ++R+
Sbjct  528   PKCRHLSRHKIGPCKRWTEHDDIHCGYYRALLTPELHHLIRGQRDDDVDDNNYFLKRTRS  587

Query  1693  LLFFFGVSGASGLPVSWRQN--VSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--G  1860
             ++    +S    LP    ++  + FK++R LDL  I  +  P+  I  LI LRYLAL  G
Sbjct  588   II---SLSNYCPLPNFTLESEIIHFKLLRTLDLSPIEVESFPS-QILCLIWLRYLALSGG  643

Query  1861  TIKYVRVLKHHHNLQTLIVKFPNS-CRieeidsdeeiGSKWLQGLWKSQSLRFIK-----  2022
              I     +    NLQT IVK  +S C I            + + +W+   LR +K     
Sbjct  644   LIDIPPEVCRLWNLQTCIVKGSSSRCII------------FPEQIWELMQLRHLKLNAFY  691

Query  2023  YPYPFPIDTDEIP---VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI-----KCSEIRA  2178
              P P  +  +E     V   + T+Y +    CTKE +  I NVK LGI      C + R 
Sbjct  692   LPNPPSVSAEEESSYLVLSNVQTIYGLSARSCTKEVISGIRNVKKLGIYGDKDDCEDSRL  751

Query  2179  FQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWEAIT  2349
             F      DNL +L +LEKL    +   +F    + S  SFP  LK+L++ GT L WE + 
Sbjct  752   F------DNLVHLHQLEKLRFGLLTPWKFGDATIPSAKSFPAMLKKLELNGTCLRWEDMN  805

Query  2350  IISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLA  2529
             IIS LPNLE LK+L       EW    GGF +LK L I    L  W+   D+FP LE L 
Sbjct  806   IISELPNLEVLKVLSVIH-DNEWYPVAGGFTQLKLLLIDSTSLNYWKATDDNFPALECLV  864

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             L  C+ L ++P  F  I +LQLIEL +C P L  SA  IQ+EQ   GN  L +R
Sbjct  865   LRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEASAAQIQQEQEDIGNKPLDIR  918



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score =   460 bits (1183),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 325/861 (38%), Positives = 466/861 (54%), Gaps = 86/861 (10%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGA-----SHERLHQILQRLAEDI----EGLIE  408
             KD+  +VKD+    EDE+ES+++ I+         ++ERL +IL++  +DI    + LI+
Sbjct  55    KDLQKKVKDVVNEVEDEVESQIVRIMEKDEHIQREANERLREILEQAIQDIYSVNQELIK  114

Query  409   QRNTTQMLSSYNPGQSNQEHIIAGGA-------SKLQDDAIMVGHAQELERTKEMLLQCS  567
             QRN      S N        +  GG+       S L+++  MVGH  E    +  L+   
Sbjct  115   QRNKNNNSLSGN--------LSIGGSTSPRSRVSTLENE--MVGHINEQANMRRRLITGH  164

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQDLC  735
             + + +VISI GMGGIGK+T AKK++ DPS+   F + GW TVS+DY  R+    +LQD  
Sbjct  165   SSQLEVISIAGMGGIGKSTFAKKLFSDPSVVGFFDVRGWITVSKDYSSRKMLISLLQDAT  224

Query  736   GCVAQMTDKEINEVKS-TAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
             G   ++ + +  EV+   AELA+++++    +RYL+VVDDIW +  WDD+ + FP+++N 
Sbjct  225   GVKVEI-NPQYQEVEVINAELADRLQKSFKGKRYLIVVDDIWSTEAWDDISQWFPENNNR  283

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIV  1089
             SRILLTTR  EVA ++  S K    + FL+  ESW LF QK     + P E E +GK +V
Sbjct  284   SRILLTTRSMEVARHAS-SPKNPFQMRFLDPEESWNLFCQKAFSKKDCPAEFESVGKVVV  342

Query  1090  NKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYH  1269
               C+GLPL I+V AG LS +KR++  W  +A +++  +  D + +CS +L LSYN+LP  
Sbjct  343   ENCKGLPLMISVVAGSLS-SKRTLNEWNEVAQSVSSLVNLDDYQRCSGVLALSYNHLPPD  401

Query  1270  LKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLI  1449
             LK CFLYFG+F K   EI  ++L+ LW+ EG       R LE+ A   L DLIDR+L+++
Sbjct  402   LKVCFLYFGVFKKAS-EISVENLIRLWMAEGLFKLRGIRDLEKEACSLLHDLIDRSLIVV  460

Query  1450  SKLSFIGNIKTCRLHDLLFDLCLREVKKEK--FVSAFHQRSENVIELGDTEPLFEYANRW  1623
              K S  G IKTCR+HDLL DLCLRE + E   +VS     + N+ +            RW
Sbjct  461   CKHSLDGKIKTCRIHDLLHDLCLRESESESLLYVSNPSLSATNIPQ----------DRRW  510

Query  1624  LTFRTTYIQPKFSDKY-NFHKSRTLLFF----FGVSGASGLPVSWRQNVSFKMIRVLDLV  1788
             ++F     +  FS  +  + K R+L F     + +    GL         FK+IRVLDL+
Sbjct  511   VSFPQEPARDFFSLPFLTYGKIRSLHFLAVKPYNLEFELGLD-------RFKLIRVLDLL  563

Query  1789  EISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
                    P   +S+L+ LRYL      Y  + K   NLQ++  +  N  +  E       
Sbjct  564   GSGVWHLPN-GLSNLVSLRYLRAHCSGYPPIYKLR-NLQSVSFRKVNKFQPIEFHLP---  618

Query  1969  GSKWLQGLWKSQSLRFIKYPY-----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKI  2133
                   G WK   LR +         P  +D ++  V + L ++Y +  + CTKE    I
Sbjct  619   -----DGTWKMSQLRHLDSASFYLCSPPKVDGNKYRVLENLQSVYGLRPVCCTKEMFEGI  673

Query  2134  PNVKVLGIKCSEIRAFQTETWWDNLHYLTKLE--KLIVEDIESEQF----ELQSINSFPQ  2295
               VK LGI       +      DNL YL +LE  K+++ D     F     +  + SFP 
Sbjct  674   KKVKKLGICGRTGHFYDAPKCLDNLIYLPELEVLKILLYDAYGVDFLHKHPVPCVGSFPP  733

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEE-----WVTGDGGFPKLKFLY  2460
             +LK+L + GT L W  +TIIS LP LE L+L      G+E     W   D GFPKL+FL 
Sbjct  734   NLKKLTLQGTHLLWSQLTIISKLPKLEVLQLKALLFFGDELGETVWEVSDMGFPKLRFLL  793

Query  2461  ISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAK  2640
             +    LKNW    D FP LER+ + +C  L++IP+GF+D  TL+ IEL  C PSLV  AK
Sbjct  794   VENKGLKNWNASDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNFAK  853

Query  2641  DIQEEQSSYGNDQLVVRDYDT  2703
             +IQEEQ   GN+ L V  YDT
Sbjct  854   EIQEEQEILGNNILQVYAYDT  874



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   456 bits (1172),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 331/918 (36%), Positives = 497/918 (54%), Gaps = 75/918 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVE--LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MA+  + SL+RT+E  L F  P   L  D+++E+  LR+K+     +  ++ +K NV   
Sbjct  1     MAHASVASLMRTIESLLTFNSPMQSLSCDHREELCALREKV-SSLEVFVKNFEKNNVFGE  59

Query  253   EKDVIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDIEGLIEQR  414
               D    V++++  AE  I+  +   +          +  R  Q LQ++AED++ + ++ 
Sbjct  60    MTDFEVEVREVASAAEYTIQLRLTGTVLGENKSQKKKARRRFRQSLQQVAEDMDHIWKES  119

Query  415   NTTQMLSSYNPG-QSNQEHIIAGGASKLQD----DAIMVGHAQELERTKEMLLQCSTQER  579
                Q     + G Q ++E ++   +S   D       MVG   + ++  E L +  + E 
Sbjct  120   TKIQ-----DKGKQVSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLEDLTRSYSGEP  174

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+AK++Y+D SI  RF +  WAT+SQ ++ + IL  L     +M D
Sbjct  175   KVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDD  234

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP-DDSNGSRILLTTR  936
             +   ++   AELA+ +++ L R+RYL+V+DDIW    WD ++RCFP +D+ GSRILLTTR
Sbjct  235   RV--KMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTR  292

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKCRGLPL  1113
               EVA Y+G    +   + F++ +ESW LF S    S  LP E E +GK+I ++C GLPL
Sbjct  293   NDEVACYAGVEN-FSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPL  351

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
              I V AGLL K+KR++E+W+++A  +   +T+D  ++CS +L LSY++L   LK C L+F
Sbjct  352   TIVVVAGLL-KSKRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHF  410

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             GIFP+   +IP K+L+  W+ EGF+  ++   LE    K LQ+L+DR LVL+SK S  G 
Sbjct  411   GIFPE-DSDIPVKNLMRSWMAEGFLKLEN--DLEGEVEKCLQELVDRCLVLVSKRSRDGT  467

Query  1474  -IKTCRLHDLLFDLCLREVKKEK-----------------FVSAFHQRSENVIELGDTEP  1599
              I++C++HDL++DLC+REV++E                  ++  +  +    +  GD   
Sbjct  468   KIRSCKVHDLIYDLCVREVQRENIFIMNDIVLDVSYPECSYLCMYKMQPFKRVT-GDEIN  526

Query  1600  LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL  1779
                Y            Q +  D  N  K    +F F +     +  S  + V FK+++VL
Sbjct  527   YCPYGLYRALLTPVNRQLRDHDNNNLLKRTHSVFSFHLEPLYYVLKS--EVVHFKLLKVL  584

Query  1780  DLVEISFDEAPTFDISDLILLRYLAL---GTIKYVRVLKHHHNLQTLIVKFPNSCRieei  1950
             +L     D  P  +I  LI LRYL+L   G       +    NLQT IV+   S  I   
Sbjct  585   ELRHRQIDGFPR-EILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIVQRFRSDIII--  641

Query  1951  dsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLH----TLYWVPYLR---C  2109
                      + + +W+   LR +K P  +  D     V    H     L  + YL    C
Sbjct  642   ---------FAEEIWELMQLRHLKLPRFYLPDCPSGSVDKGRHLDFSNLQTISYLSPRCC  692

Query  2110  TKEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLE--KLIVEDIESEQFELQS  2277
             TKE ++ I NVK LGI  +  + ++F+     +NL YL +LE   LI  D       + S
Sbjct  693   TKEVIMGIQNVKKLGISGNKDDYKSFRDSGLPNNLVYLQQLEILSLISVDYSLLPVIISS  752

Query  2278  INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFL  2457
               +FP +LK+LK+  T L W  + II+ LPNLE LKL+     GEEW     GF +LK L
Sbjct  753   AKAFPATLKKLKLERTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLL  812

Query  2458  YISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA  2637
              I  + LK W+  +D+FPVLERL +  C NL++IP  F DI TLQLIEL++C P L ESA
Sbjct  813   LIKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGESA  872

Query  2638  KDIQEEQSSYGNDQLVVR  2691
               IQ+EQ   GN+ + VR
Sbjct  873   ARIQKEQEDLGNNPVDVR  890



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   448 bits (1153),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 304/858 (35%), Positives = 460/858 (54%), Gaps = 60/858 (7%)
 Frame = +1

Query  238   NVSQAEKDVIARVKDISFRAEDEIESEVME-IISNG-----ASHERLHQILQRLAEDIEG  399
             N S    D+ A++K+++   E  I+  + E +++N       +H RL   L+++AEDI+ 
Sbjct  22    NDSGEMTDLEAQIKEVAEAVEHTIQMTLTEALVANDEMQKEKAHGRLGDCLKQVAEDIDR  81

Query  400   LIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQD-DAIMVGHAQELERTKEMLLQCSTQE  576
             +   R  T+ +       SN+  ++      + +    MVG   E +R  E L +  + E
Sbjct  82    V---RKETKKIQDKGKKASNESLVLDSSTKDIPNLKNNMVGRDDERKRLLENLTRGFSGE  138

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +VI IVGMGGIGKTT+AK++++D SIRS F +  WAT+S  Y+++ I   L     +  
Sbjct  139   PKVIPIVGMGGIGKTTLAKEVFNDASIRSHFDVRAWATISSQYNVKDIYVSLLLFTKETK  198

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D+ ++ +K  A LA+ +++ L  +RYL+V+DD+W S+ WDD+++CFP +  GSRILLTTR
Sbjct  199   DERVH-MKDEAMLADMLQKSLKGKRYLIVMDDMWNSKAWDDVRQCFPSEDKGSRILLTTR  257

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFS-QKLGSINLPPEIEEIGKRIVNKCRGLPL  1113
               EVA Y+G +G     + F+N +ESW LF       ++LP E E IGK IV+KC+GLPL
Sbjct  258   NTEVACYAG-TGNLSLQMDFMNPDESWKLFKCTGFADVSLPHEFETIGKHIVDKCQGLPL  316

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             +I V AGLLSK+KR++E+W+ +A  +   +T D   QC  +L LSYN+L   LKAC LYF
Sbjct  317   SIIVVAGLLSKSKRTLEDWKIVARDVMSFVTDDPDKQCLHVLGLSYNHLTNDLKACLLYF  376

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-G  1470
             GIFP+   EIP K L++LW+ EGF+  ++   L+  A K LQDLIDR LVL+ K S    
Sbjct  377   GIFPE-DSEIPVKKLVSLWMAEGFLKLEN--DLQGEAEKCLQDLIDRCLVLVCKKSLDET  433

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
              I++C++HDL++  CLREV+ E F S        + +L    P + Y++ +       + 
Sbjct  434   KIRSCKVHDLVYGFCLREVQNEIFFS--------LRQLAPGNPDYIYSDHYRILFVPQLI  485

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              + +D  + +    +   F +       +     +    +++LDL  I+ D  P   I  
Sbjct  486   TQQTDGDDENSGNLVRSIFSLYSTYSTFILEPDIIHCNFLKILDLSPITLDIFPP-PILC  544

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK-----WLQGLW  1995
             L  LRYL L T      +             P  CR+  + +    G +     + + +W
Sbjct  545   LSFLRYLVLSTRGGRFDIP------------PEICRLWSLRTFIVEGYRPTYVHFPEQIW  592

Query  1996  KSQSLRFIKY-------PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLG  2154
             +   LR +         P    +D +       +HT+  +    CT+E +  I NVK LG
Sbjct  593   ELWQLRHLGVYQFDLLNPPSISVDEERCLEFSNIHTVSGLCVSSCTEEVISGIRNVKKLG  652

Query  2155  IKCSE--IRAFQTETWWDNLHYLTKLEKLIVE-------DIESEQFELQSINSFPQSLKE  2307
             I   E   + F     +DNL  L +LE L ++        I      + S  +FP +LK+
Sbjct  653   IYADEYEFKTFHGSKLFDNLANLHQLETLSLKISVPLQTKINKVPLTIPSAKAFPATLKK  712

Query  2308  LKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYIS-GAKLKN  2484
             LK+  T L WE + II  LP+LE LKL+     G+EW    GGF +LK L I     LK 
Sbjct  713   LKLDNTCLRWEDMDIIGELPDLEVLKLMLNACCGQEWHPIAGGFTRLKLLLIKHNYHLKY  772

Query  2485  WETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSS  2664
             W+  +D+FPVLERL + +C  LE++P  F D+ +LQLIEL  C   L  SA  IQ+EQ  
Sbjct  773   WKATNDNFPVLERLVITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQEQED  832

Query  2665  YGNDQLVVRDYDTRS*IL  2718
              GN  + VR  DT + +L
Sbjct  833   LGNKPVDVRISDTYNPLL  850



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   446 bits (1148),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 312/891 (35%), Positives = 482/891 (54%), Gaps = 61/891 (7%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  LTSL+ TV  + L+  P       D  +    K  +       +  + +V +++ 
Sbjct  1     MAYAALTSLMGTVG-KILQQNP-------DPEKGEEMKFLYETLGSLRAILEDSVKRSDL  52

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSS  438
             ++I R++  + +    +E +V E+         L+QI   +   +   ++ + + +    
Sbjct  53    EMIKRLEAQTTQMAYALEDKV-ELAMESGILGSLNQIKGHIDSTMNDWMKIKTSYENHVK  111

Query  439   YNPGQSNQEHIIAGGASKL--QDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGI  612
               P         +  +SKL  Q + +MVGH  EL+   + L +  ++E +V+SIVGMGGI
Sbjct  112   ALPANEG----FSPDSSKLSSQPENVMVGHNNELDLMLDHLTR-GSRELKVVSIVGMGGI  166

Query  613   GKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAE  792
             GKTT A +IY DP I SRF      TVSQ++ +RR+L  L   +  +  +  NE  S  +
Sbjct  167   GKTTFATRIYYDPVIVSRFDTRPMVTVSQEFYVRRLLLGLLNSITSIPREICNE--SDGQ  224

Query  793   LANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSG  972
             LA+++R+ L  +RYL+ +DDIW +  WDD++ CFPDD NGSRILLTTR  EVA Y+  + 
Sbjct  225   LADRLRKGLKGRRYLIFIDDIWSTEAWDDMKLCFPDDGNGSRILLTTRNTEVAEYASMNE  284

Query  973   KYVCNLPFLNSNESWMLFSQKLGSI-NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKT  1149
                  +  L+ +ESW LF  K+ +   L  E E+IGK +V KC+GLPL I + AGLLSK 
Sbjct  285   PPFHRMRLLSFDESWNLFHSKVFTKKGLSSEFEKIGKEVVKKCQGLPLTIIIVAGLLSKI  344

Query  1150  KRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPT  1329
                VE W ++A  +N  +      QCS ++ LSY +LP+H+KACFLYFG+F +   EI  
Sbjct  345   HSLVE-WGNVAEDVNSLLYECPDKQCSRLIDLSYRHLPHHIKACFLYFGVFQE-DTEINV  402

Query  1330  KDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIKTCRLHDLLF  1506
             K L+ LW+ EGF+  +  ++LEE A K L+DLIDR+LV   K S   G IKTC++HDLL 
Sbjct  403   KRLVKLWVAEGFLEVEKDKNLEEVAKKCLEDLIDRSLVFADKGSTRNGKIKTCKMHDLLH  462

Query  1507  DLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA--NRWLTFRTTYIQPKFSDKYNFH  1680
               CLRE ++E F+    ++ +++      +P+  +   +R ++  +      + D   ++
Sbjct  463   GFCLREAQRENFLRVIQKKDDDL----HAKPVLFHPKFHRRISILSCDNYKLYFDHDTYN  518

Query  1681  KSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-  1857
             K+R++LF   +     +P    +   FK++RVLD+   +       DI  L  LRYLA  
Sbjct  519   KARSILF---LGKPYYIPDIKLEYSCFKLLRVLDIATDTLRGNFPKDILCLFHLRYLAFT  575

Query  1858  --GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY  2031
               G++     +    NL+T +  +   C              + + +W+ + LR +K   
Sbjct  576   FAGSLDSPLDMSLW-NLETFVFDY-RVCGCIY----------FAEEIWRMEQLRHLK---  620

Query  2032  PFPIDTDEIPVQD------TLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET  2193
              F ++    P Q+       L T   +  L CTKE   +IPNVK L I    ++  ++E 
Sbjct  621   -FSLNCLTQPSQEKCLVLENLQTFSGLNPLNCTKEVFKRIPNVKKLMILGHMVQYGESEM  679

Query  2194  --WWDNLHYLTKLEKL---IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIIS  2358
                +++L  L KLE L   I  +I      L    +FPQ+LK+L  + T + W+ + I+ 
Sbjct  680   PDCFNDLASLGKLESLGFHIQTNINHLNLCLPPPGNFPQNLKKLTFIFTYMPWKNMDIVG  739

Query  2359  MLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHH  2538
             MLPNLE LKL  +  +GEEW   + GF +LKFL +  +    W+  SDHFP+LE L L  
Sbjct  740   MLPNLEVLKLRSSACIGEEWEPSENGFHQLKFLLLHCSDPNYWKATSDHFPLLEHLVLRD  799

Query  2539  CHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             C++L++IP  F D  TLQ IE+++C  S+V SA+ IQEEQ + G D L+VR
Sbjct  800   CYHLQEIPLDFADSLTLQSIEIENCERSVVTSAEQIQEEQRNLGVDDLIVR  850



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score =   445 bits (1144),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 335/915 (37%), Positives = 489/915 (53%), Gaps = 84/915 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSL+ T+E LQ L+    L+  + + +  L +K+  L+ LL   +      +  K
Sbjct  3     AYVALTSLMGTLEQLQLLQSNLDLLDTHVESLNLLYEKVDSLEELLNNFD-----GEQTK  57

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDIEGLIEQ  411
              + A+V+ I+  AEDE+ES++  ++     H+RLHQ         ILQR  E+++ L E+
Sbjct  58    TLHAKVRRIANEAEDEVESQMKVVMDK--QHDRLHQKEALESLFEILQRGIENVDSLKEE  115

Query  412   -----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                   N T    + + G S+   +    AS L++D  MVG+  E E     L   S  E
Sbjct  116   LIKHSHNNTSQAGNSSLGDSSSPRL---HASTLEND--MVGYNIEQENMLSQLTSGSP-E  169

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +VIS+ GMGGIGK+T AKK++  PSI S F + GW TVS++Y  R +L  L    A + 
Sbjct  170   LEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYRNMLLGLL-IDANIG  228

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
              +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+LLTTR
Sbjct  229   KEEDLDKKSNSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLTTR  288

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPL  1113
               EVA Y+  S K    +  L+  +SW LF QK         E E++GK +   C GLPL
Sbjct  289   DVEVAQYAS-SPKDPFRMHLLDQEDSWNLFYQKAFVEKGFAIEFEDVGKEVAKNCNGLPL  347

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
              I V A +LS  K++++ W+ +A +++     D + QCS +L LSYN+LP +LK CFLYF
Sbjct  348   IIAVVAKILS-GKKTLDEWKKVAESVSSLAEVDAYQQCSGVLALSYNHLPSYLKGCFLYF  406

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FPK   EI  + L+ LWI EG +  +    LEE A  +L  LID++LV++SK S  GN
Sbjct  407   GLFPKAS-EISMEKLIRLWIAEGLLKVNGMEGLEEVAASHLNYLIDKSLVIVSKRSMDGN  465

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PLFEYAN--RWLTFRT  1638
             I TC +HDL+ D CL+E             S+N++ + +T+   PL+      RW++  +
Sbjct  466   IMTCMIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLWVIPEGCRWVSQHS  514

Query  1639  --TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAP  1812
                Y + +F D   + K R+    F V+  +   V   ++  FK++RVLDL +    + P
Sbjct  515   WGFYFRRRFPD-LAYSKLRS----FSVNSRTVRNV---ESFPFKLLRVLDLEKKMIFDFP  566

Query  1813  TFDISDLILLRYLALGTIKYVRVLKHHH--NLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
                I DL+LLRYLAL TI+   +L      NLQTL V+ P+                   
Sbjct  567   IV-ILDLVLLRYLAL-TIRRSGILPISKLLNLQTLTVR-PHPIYTSSGKMYSLPNF----  619

Query  1987  GLWKSQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIPNVK  2145
              +WK   LR +         P  +  +E+   V + + T+  +    CTKE    I  VK
Sbjct  620   -IWKLSQLRHLHCWCMYLDSPQMVSENEVKNLVLENIQTVSGLIPSCCTKEIFEAIKKVK  678

Query  2146  VLGIKCSEIRAFQTETWWD-NLHYLTKLEKL---IVEDIESEQFEL---QSINSFPQSLK  2304
              L I   + + FQ+E  W+ NL YL +LE L   ++  + S++          SFP +LK
Sbjct  679   KLEI-AGKAKEFQSEMGWETNLKYLKELEALNVTVLPAVISDRLPCLINPGPGSFPPNLK  737

Query  2305  ELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKN  2484
             +L +  T L W  + I S LPNLE L+L      G+EW   + GFPKLK L +    L+ 
Sbjct  738   KLTLSRTCLPWNCMNIFSKLPNLEVLELKNYAFSGDEWEITEMGFPKLKCLLLEDLYLRY  797

Query  2485  WETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSS  2664
             W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C+  LV  AK IQE    
Sbjct  798   WTATDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCYHPLVTFAKQIQETHEE  857

Query  2665  YGNDQLVVRDYDTRS  2709
              GN+ L V  +D+ S
Sbjct  858   LGNNMLKVYAFDSTS  872



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score =   444 bits (1143),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 329/936 (35%), Positives = 479/936 (51%), Gaps = 104/936 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  +TSL+ T+ L   +    L   +K+ ++ L +K+  L   L+ +    ++    KD
Sbjct  3     AYAAVTSLMGTIHL-ISQSNLDLQDGHKEHLKLLYEKVGSLLEFLDTNSDDGSM----KD  57

Query  262   VIARVKDISFRAEDEIESEVMEIISNG-------------ASHERLHQILQRLAEDI---  393
             +  +VKD++   ED++ES +                     +HERL +ILQR  E I   
Sbjct  58    LQEKVKDLAHEVEDKVESHIQREAQKKLLKMLQRVFHLPTKAHERLLKILQRAIEAIDSI  117

Query  394   -EGLIEQRNTTQML---SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQ  561
              E L +QR    M    SS     S + H+     S L+++  MVG+  E      ML Q
Sbjct  118   KEELFKQRENNNMQAGNSSLGGSNSPESHV-----STLENN--MVGYNDE---QASMLRQ  167

Query  562   CSTQERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC  735
              +   RQ  VISIVGMGGIGK+T AK+++ DPS+   F + GW TVS+DY +R++L  L 
Sbjct  168   LTGDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVTVSKDYSIRKMLLSLL  227

Query  736   GCVA---------------QMTDKEINEV-KSTAELANKVRRRLMRQRYLLVVDDIWGSR  867
                                Q +D+E++ V K    LA+++++ L  +RYL+VVDDIW + 
Sbjct  228   QDAGVELDKVSDEEQADDLQESDEELDHVQKINNALADRLQKSLKGRRYLIVVDDIWSTD  287

Query  868   GWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGS  1044
              WD+++  FP+ +N SRILLTTR  +VA Y+         + FL+  ESW LF QK    
Sbjct  288   AWDEIKLWFPEYNNRSRILLTTRDMKVAQYASFPEDPF-PMRFLDPEESWNLFCQKAFDK  346

Query  1045  INLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQ  1224
                P E+E + K +V  C+GLPL I+V AG LS +KR++  W+ +A +++  +  D + +
Sbjct  347   KACPIELENVAKEVVKNCKGLPLMISVIAGTLS-SKRTLGEWRKVAESVSSLVNLDDYQR  405

Query  1225  CSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGA  1404
             CS +L LSYN+LP HLKACFLYFG+FPK   +I  K L+ LW  EG         LE+ A
Sbjct  406   CSGVLALSYNHLPSHLKACFLYFGVFPKAS-DISVKKLMRLWAAEGLFELKGLEGLEKVA  464

Query  1405  MKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIEL  1584
                L DLID++L+++S+ S  G IKTCR+HDLL DLC RE +    +        N +  
Sbjct  465   AYLLHDLIDKSLIIVSRRSIDGKIKTCRIHDLLHDLCWREAESNSILYVV-----NDVPY  519

Query  1585  GDTEPLFEYANRWLTFR-TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSF  1761
             G     F    RW++        P      +++K+R++ F+         PV   Q   F
Sbjct  520   GGPRRYFPQGRRWVSLHLAGGYYPTLFSALSYNKTRSIHFYAD-------PVYNLQLEHF  572

Query  1762  KMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHHNLQTLIVKFPNSC  1935
             K++RVLDL    F      +I  L+ LRYL +    I     + +  NLQTL++ F  S 
Sbjct  573   KLLRVLDLEATEFQYGFPGEILRLVCLRYLVMKIDEISEHIPISNLQNLQTLVI-FTTSR  631

Query  1936  RieeidsdeeiGSKWLQGLWKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLYWV  2094
             +                G+W    LR       F+  P     +  E P+ + L ++  +
Sbjct  632   KGFINLR---------DGIWDLSQLRNLNCSRIFLYPPRNVSPNEVEYPILENLQSVCGL  682

Query  2095  PYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESE-----  2259
                 CTK     I  VK LGI C+   ++    W  NL+YL +LE L +           
Sbjct  683   SSSCCTKGIFKGIKKVKKLGISCN---SYTESEWLANLNYLHELETLSIASSSYYGYVYS  739

Query  2260  QFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----LQAYEMGEE-WV  2421
              F L    SFP +LK+L + GT L WE +TIIS LP LE L+L      ++  +GE  W 
Sbjct  740   DFRLPCPGSFPPNLKKLTLCGTRLSWEDMTIISKLPKLEVLQLKEDDFARSLSVGERVWE  799

Query  2422  TGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIE  2601
               + GFP+LKFL +    L  W    D+FP LE + + +C +L++IP+GF D  TL+LI 
Sbjct  800   VTEMGFPELKFLLLEKLILDYWRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKLIM  859

Query  2602  LKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDTR  2706
             L+ C PS+V SA  IQ EQ    G+D L V   DTR
Sbjct  860   LQGCSPSVVTSADRIQREQLECSGSDMLKVYAVDTR  895



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score =   443 bits (1139),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 316/878 (36%), Positives = 452/878 (51%), Gaps = 99/878 (11%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISN-------------GASHERLHQILQRLAEDI-  393
             KD+  +VKD++   ED++ES +                     +HERL +ILQR  E I 
Sbjct  46    KDLQEKVKDLAHEVEDKVESHIQREAQKKLLKMLQRVFHLPTKAHERLLKILQRAIEAID  105

Query  394   ---EGLIEQRNTTQML---SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML  555
                E L +QR    M    SS     S + H+     S L+++  MVG+  E      ML
Sbjct  106   SIKEELFKQRENNNMQAGNSSLGGSNSPESHV-----STLENN--MVGYNDE---QASML  155

Query  556   LQCSTQERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQD  729
              Q +   RQ  VISIVGMGGIGK+T AK+++ DPS+   F + GW TVS+DY +R++L  
Sbjct  156   RQLTGDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVTVSKDYSIRKMLLS  215

Query  730   LCGCVA---------------QMTDKEINEV-KSTAELANKVRRRLMRQRYLLVVDDIWG  861
             L                    Q +D+E++ V K    LA+++++ L  +RYL+VVDDIW 
Sbjct  216   LLQDAGVELDKVSDEEQADDLQESDEELDHVQKINNALADRLQKSLKGRRYLIVVDDIWS  275

Query  862   SRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-L  1038
             +  WD+++  FP+ +N SRILLTTR  +VA Y+         + FL+  ESW LF QK  
Sbjct  276   TDAWDEIKLWFPEYNNRSRILLTTRDMKVAQYASFPEDPF-PMRFLDPEESWNLFCQKAF  334

Query  1039  GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLH  1218
                  P E+E + K +V  C+GLPL I+V AG LS +KR++  W+ +A +++  +  D +
Sbjct  335   DKKACPIELENVAKEVVKNCKGLPLMISVIAGTLS-SKRTLGEWRKVAESVSSLVNLDDY  393

Query  1219  DQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEE  1398
              +CS +L LSYN+LP HLKACFLYFG+FPK   +I  K L+ LW  EG         LE+
Sbjct  394   QRCSGVLALSYNHLPSHLKACFLYFGVFPKAS-DISVKKLMRLWAAEGLFELKGLEGLEK  452

Query  1399  GAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVI  1578
              A   L DLID++L+++S+ S  G IKTCR+HDLL DLC RE +    +        N +
Sbjct  453   VAAYLLHDLIDKSLIIVSRRSIDGKIKTCRIHDLLHDLCWREAESNSILYVV-----NDV  507

Query  1579  ELGDTEPLFEYANRWLTFR-TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV  1755
               G     F    RW++        P      +++K+R++ F+         PV   Q  
Sbjct  508   PYGGPRRYFPQGRRWVSLHLAGGYYPTLFSALSYNKTRSIHFYAD-------PVYNLQLE  560

Query  1756  SFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHHNLQTLIVKFPN  1929
              FK++RVLDL    F      +I  L+ LRYL +    I     + +  NLQTL++ F  
Sbjct  561   HFKLLRVLDLEATEFQYGFPGEILRLVCLRYLVMKIDEISEHIPISNLQNLQTLVI-FTT  619

Query  1930  SCRieeidsdeeiGSKWLQGLWKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLY  2088
             S +                G+W    LR       F+  P     +  E P+ + L ++ 
Sbjct  620   SRKGFINLR---------DGIWDLSQLRNLNCSRIFLYPPRNVSPNEVEYPILENLQSVC  670

Query  2089  WVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESE---  2259
              +    CTK     I  VK LGI C+   ++    W  NL+YL +LE L +         
Sbjct  671   GLSSSCCTKGIFKGIKKVKKLGISCN---SYTESEWLANLNYLHELETLSIASSSYYGYV  727

Query  2260  --QFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----LQAYEMGEE-  2415
                F L    SFP +LK+L + GT L WE +TIIS LP LE L+L      ++  +GE  
Sbjct  728   YSDFRLPCPGSFPPNLKKLTLCGTRLSWEDMTIISKLPKLEVLQLKEDDFARSLSVGERV  787

Query  2416  WVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQL  2595
             W   + GFP+LKFL +    L  W    D+FP LE + + +C +L++IP+GF D  TL+L
Sbjct  788   WEVTEMGFPELKFLLLEKLILDYWRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKL  847

Query  2596  IELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDTR  2706
             I L+ C PS+V SA  IQ EQ    G+D L V   DTR
Sbjct  848   IMLQGCSPSVVTSADRIQREQLECSGSDMLKVYAVDTR  885



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score =   442 bits (1138),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 320/916 (35%), Positives = 488/916 (53%), Gaps = 109/916 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+RT++L      PI  L+ D+K+EI  L +K+     +  ++ ++ NVS+ 
Sbjct  1     MAYASIVSLMRTIKLLLTSKSPIQSLIRDHKEEILTLHEKVS-SLEVFLKNSERSNVSEE  59

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ AR+K+++   E  I+  + E       +    +HE     LQ++AEDI  L ++ 
Sbjct  60    MTDLEARIKEVANAVEYTIQLRLTEAAMANDEMQKVTAHEMFCDSLQQVAEDISHLQKES  119

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASK---LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
                Q    +   Q++++ ++ G +S    L     MVG   + +R  E L + S+ E +V
Sbjct  120   MKIQ----HKGKQASKKSLVRGSSSAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKV  175

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             I I+GMGGIGKTT+AK++Y+D SIRS F +  WATVS  ++++ IL  L    ++M D  
Sbjct  176   IPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTF  233

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
               E    AELA+ +++ L  +RYL+V+DD+W S+ WDD+++CFP ++N SR+LLTTR  +
Sbjct  234   YME--DEAELADMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTD  291

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA Y+G +  +   + F++  ESW LF S    +  LP E E IGK+IV+KC+GLPL I 
Sbjct  292   VACYAG-TENFSLQMSFMDPYESWNLFKSAAFANEELPSEYEIIGKQIVDKCQGLPLTIV  350

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGLLSK++R++E+W+++A  +   +T+D   QC  +L LSYN+L  +LKAC LYFG F
Sbjct  351   VVAGLLSKSERTIEDWENVAQDVMSFVTNDPDKQCLHVLGLSYNHLTSNLKACLLYFGAF  410

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIK  1479
             P+  REI  K L+ LW+ EGF+  +  +  E  A K L+DL+DR L+L  +  +    IK
Sbjct  411   PE-DREISVKRLVRLWLAEGFLKLE--KDFEGEAEKCLKDLVDRCLILACEKKWDETEIK  467

Query  1480  TCRLHDLLFDLCLREVKKEKFVS---AFH--------------QRSENVIELGD----TE  1596
             +C++HDL+++LCLRE + + F+     FH              Q  + V+EL D      
Sbjct  468   SCKVHDLIYELCLREAQSQNFIMNDIVFHYLDLDEDDGSDEIAQSHDIVLELDDEPNPVP  527

Query  1597  PLFEY--------ANRWLT-------FRTTYIQPKFS-----------DKYNFHKSRTLL  1698
             P + +          RW         +    + P+             D  N+   RT  
Sbjct  528   PKYRHLSRHKIGPCKRWTEHDDIHCGYYRALLTPELHHLIRGQRDDDVDDSNYFLKRT-R  586

Query  1699  FFFGVSGASGLPVSWRQN--VSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKY  1872
                 +S    LP    ++  + FK++R LDL  I  +  P+  I  LI LRYLAL   ++
Sbjct  587   SIISLSNYCPLPNFTLESEIIRFKLLRTLDLSPIELESFPS-QILCLIWLRYLALSG-RF  644

Query  1873  VRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK-----WLQGLWKSQSLRFIK-----  2022
             + +              P  CR+  + +    GS      + + +W+   LR +K     
Sbjct  645   IDIP-------------PEICRLWNLHTLIFEGSSSECIVFPEQIWELMQLRHLKLNAFY  691

Query  2023  YPYPFPIDTDEIPVQ---DTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET  2193
              P P  +  +E         + T+Y +    CTKE +  I NVK LGI   +   F+   
Sbjct  692   LPNPPSVSAEEEGTHLALSNVQTIYLLSAFSCTKEVISGIENVKKLGIY-GDRDDFEDSR  750

Query  2194  WWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWEAITIISML  2364
              +DNL YL +LE L      + +F    + S  +FP +LK+L++ GT L WE I IIS L
Sbjct  751   LFDNLVYLHQLENLRFYFHSTWKFGEATIPSAEAFPATLKKLELNGTCLRWEDINIISEL  810

Query  2365  PNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCH  2544
             PNLE LK+L   +   EW T  GGF +LK L I   +L  W+   D+FP LE L L  C 
Sbjct  811   PNLEVLKVLSVMK-DNEWYTVAGGFTQLKLLLIDWTRLNYWKATDDNFPALECLVLRSCF  869

Query  2545  NLEKIPEGFTDITTLQ  2592
             NLE+IP  F DI+ L+
Sbjct  870   NLEEIPIEFADISLLR  885



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score =   442 bits (1136),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 339/915 (37%), Positives = 485/915 (53%), Gaps = 83/915 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  LTSL+ T+ L   +    L+  +K+ ++ L +K+      + E     +  +  KD
Sbjct  3     AYAALTSLMGTIHL-ISQSTLDLLEGHKEHLKLLYEKV----GSMLEFLDTNSDDEPMKD  57

Query  262   VIARVKDISFRAEDEIESEVMEIISNGASHERLH---QILQRLAEDIEG----------L  402
             ++ +VKD++   EDE+ES+ + ++S    H R     ++L  L + IEG          L
Sbjct  58    LLKKVKDVAHNVEDEVESQ-LRLVSEKDEHVRTEADERLLAILHQAIEGADSVTKELVKL  116

Query  403   IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQ  582
              E  N      S     S + H+     S L++D  MVG+  E E  +  L+  S+Q  +
Sbjct  117   KENINMQAANRSLEGSSSPRSHV-----SILEND--MVGYNIEQECMRGQLIGRSSQ-LE  168

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC-GCVAQMTD  759
             VISI GMGGIGK+T AKK++ DPSI S F   GW TVS+DY LR++L  L    + +   
Sbjct  169   VISIAGMGGIGKSTFAKKMFYDPSILSFFDFRGWITVSKDYSLRKMLLSLLQDTIVEKEK  228

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             KE  + KS  +LA+ +++ L  +RYL+VVDDIW    WDD++  FP++SN SRILLTTR 
Sbjct  229   KEKLDKKSNGDLADLLQKSLKGRRYLIVVDDIWSREAWDDIRLWFPENSNASRILLTTRD  288

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLA  1116
              +VA Y+          P L   ESW LF QK  G  + P E E + K +V  C+GLPL 
Sbjct  289   MKVAEYASSPEDPFPMRP-LELEESWNLFCQKAFGKKDCPTEFENVAKLVVENCKGLPLM  347

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I+V AG LS +KR +E W+ +A +++  +  D + +CS +L LSY +LP HLKAC+LYFG
Sbjct  348   ISVVAGALS-SKRRLEEWREVAQSVSSLVNLDDYQRCSGVLALSYKHLPSHLKACYLYFG  406

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             +FPK R EI  K L+ LW  EG +       LE+ A   L DLID+NLV++S  S  G I
Sbjct  407   VFPKAR-EISVKKLIRLWAAEGLLELKGLEGLEKLASNLLHDLIDKNLVVVSTRSLCGRI  465

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT-YIQP  1653
             K CR+HDLL DLCLRE K+E  + ++     + I  G  + L E   RW++  +    + 
Sbjct  466   KACRIHDLLHDLCLREAKREMLLYSY---VVDPISYGAGKILPE-GCRWVSVHSNGNFRR  521

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDEAPTFD  1821
                D     K+R+L F      A+ L   W+ ++     FK++RVLDL  + F   P+ +
Sbjct  522   ILFDDLTHSKTRSLHF-----SANDL---WQDSLLSLNHFKLLRVLDLEAVEFSYFPS-E  572

Query  1822  ISDLILLRYLALGTIKYVR--VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ-GL  1992
             I  L+ LRYLAL   K      + +  NLQTL+V              E  G   L  G+
Sbjct  573   ILHLVGLRYLALAIYKIPEDVPISNLWNLQTLVVS-----------QSELDGRISLPIGI  621

Query  1993  WKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVL  2151
             W    LR       ++  P    ++    P+ + L ++  +    CTKE    I  VK L
Sbjct  622   WGLSQLRHLHCTSMYVHSPRKVSVNEVNHPILEKLLSVSGLSLSCCTKEMFEGIKKVKKL  681

Query  2152  GIKCSEIRAFQTETWWDNLHYLTKLEKLIVE----DIESEQFELQSINSFPQSLKELKIV  2319
             GI  +           DNL +L +LE L +     D+    F L  + SFP +LK+L + 
Sbjct  682   GIFGTGNEFIDVPECLDNLIHLHELETLKIAGFNMDLLDFDFRLPRLVSFPPNLKKLTLS  741

Query  2320  GTELGWEAITIISMLPNLESLKL-----LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKN  2484
              T L WE +TIIS LP LE L+L     ++A+   E W   + GFP+LKF+ +    LK 
Sbjct  742   KTYLPWEDMTIISKLPKLEVLQLKNSAFVEAWS-AERWEVTEMGFPELKFVLLEKLDLKY  800

Query  2485  WET--MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             W    + D+FP LER+ + +C  L++IP+ F D  TLQ IEL  C PSLV  AK IQE  
Sbjct  801   WRAADIDDNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLVTFAKKIQENH  860

Query  2659  SSYGNDQLVVRDYDT  2703
                GN+ L V  +DT
Sbjct  861   EDLGNNMLKVYAFDT  875



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score =   438 bits (1127),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 326/877 (37%), Positives = 463/877 (53%), Gaps = 104/877 (12%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNG-------------ASHERLHQILQRLAEDIE  396
             KD++ +VKD++ + EDE+ES +                     +HERL +ILQR  +DI+
Sbjct  2     KDLLKKVKDVAHKVEDEVESHIQREAQKKLLKMLQRVFHLPTKAHERLLKILQRAIKDID  61

Query  397   GL------IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLL  558
              +      + + N      S     S+Q H     AS L+++  MVG+  E E     L 
Sbjct  62    SVNKELMKLRENNMRPGNCSLGASTSSQSH-----ASTLENE--MVGYNIEQELILGQLR  114

Query  559   QCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL-----  723
               S+Q  +VISI GMGGIGK+T AK+I+ DPSI S F + GW  VS+DY++R++L     
Sbjct  115   GHSSQ-LEVISIFGMGGIGKSTFAKRIFSDPSIVSFFDVRGWIVVSKDYNIRKMLLSLLK  173

Query  724   -------------QDLCGCVAQMTDKEINE--VKSTAELANKVRRRLMRQRYLLVVDDIW  858
                           +L  C+ Q +D E+ +   K    LA+++++ L  +RYL+VVDDIW
Sbjct  174   DVGMNEEADSKSDGELSNCL-QKSDGELEDGLQKIDDALADRLQKSLKGRRYLIVVDDIW  232

Query  859   GSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPF----LNSNESWMLF  1026
              +  WD+++  FPD+SN SRILLTTR   VA Y+        N PF    L   ESW LF
Sbjct  233   STEAWDEIKLWFPDNSNRSRILLTTRDMNVAQYASFP-----NDPFPMRLLKPKESWHLF  287

Query  1027  SQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPM  1203
              QK  G    P E+E + + IV  C+GLPL I+V AG LS +K+++E W+ +A  ++  +
Sbjct  288   CQKAFGKKGCPTEVENVARVIVENCQGLPLIISVVAGTLS-SKKTLETWREVAQNVSSLV  346

Query  1204  TSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSG  1383
               D +++CS +L  SY+ LP HLKACFLYFG FPK   EI  K L+ LW+ EG +     
Sbjct  347   NLDDYERCSGVLASSYSYLPSHLKACFLYFGAFPKAN-EISVKKLIRLWVAEGLLELKGL  405

Query  1384  RSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQR  1563
             + LE+     L DLID++LV++SK S  G  KTCR+HDLL DLCLRE +KE  +   +  
Sbjct  406   KELEKLGSSLLHDLIDKSLVVVSKRSLDGKTKTCRIHDLLHDLCLREAEKENLLYVVNP-  464

Query  1564  SENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNF-----HKSRTLLFFFGVSGASG  1728
                 I  G    +F    RWL+  +      FS  + F      K+R+L     +S    
Sbjct  465   ---PISKGH-RTVFPKGRRWLSLHSMR---GFSSSFRFDNLTHSKTRSLHISITISIDY-  516

Query  1729  LPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHHNL  1902
               ++ R N  FK++RVLDL ++ FD  P  +I  L+ LRYLA+   TI     +    NL
Sbjct  517   --LALRLN-HFKLLRVLDLEKVGFDHLPR-EIVHLVSLRYLAMIIRTIPKDLPISKLWNL  572

Query  1903  QTLIVK--FPNSCRieeidsdeeiGSKWLQGLWKSQSLRF-----IKYPYPFPIDTDEIP  2061
             QT +    FPN+  +                +W+   LR      I    P  +  +E+ 
Sbjct  573   QTFVFPQYFPNTIYLS-------------NEIWEMSQLRHLHSSKIYLSSPPKVSANEVK  619

Query  2062  --VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL  2235
               V + L ++Y +    CTKE    +  VK LGI              DNL YL +LE+L
Sbjct  620   YRVLENLQSVYGLSSSCCTKEIFEGVKKVKKLGIFDKNDEYDGKSRCLDNLIYLHELEEL  679

Query  2236  IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQ-AYEMGE  2412
              ++   S    L  ++SFP +LK+L + GT L W+ +T ISMLP L  L+L   A+ +  
Sbjct  680   SIKSYMSSFVRLPRLDSFPPNLKKLTLNGTGLMWKDMTTISMLPKLNVLQLKNGAFRLTT  739

Query  2413  EWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQ  2592
              W   + GFP+LKFL +    L  W    D+FP LER+ + +C  L +IP GFTD  TLQ
Sbjct  740   AWEVTEMGFPELKFLLLEELNLVYWIAAEDYFPCLERVIIRNCRYLREIPRGFTDSVTLQ  799

Query  2593  LIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYD  2700
              IEL  C PSLV  A+ IQ+EQ  S G+D L V  +D
Sbjct  800   QIELHGCIPSLVTFAEQIQKEQLESSGSDMLKVYAFD  836



>ref|XP_009603166.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score =   439 bits (1129),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 330/947 (35%), Positives = 490/947 (52%), Gaps = 114/947 (12%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  LTSL+ T+ L   +    L+  +K+ ++ L +K+  L   L+ +       +  KD
Sbjct  3     AYAALTSLMGTIHL-ISQSNLDLLDGHKEHLKLLYEKVSSLLEFLDTNSD----DEPMKD  57

Query  262   VIARVKDISFRAEDEIESEVMEIISNG-------------ASHERLHQILQRLAEDI---  393
             +  +VKD++   ED++ES +                     +HERL +ILQR  E I   
Sbjct  58    LQEKVKDLAHEVEDKVESHIQREAQKKLLKMLQRVFHLPTKAHERLLKILQRAVEAIDSI  117

Query  394   -EGLIEQRNTTQMLSSYNP-GQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCS  567
              E L +QR    M +  +  G SN    +    S L+++  MVG+  E      ML Q +
Sbjct  118   KEELFKQRENNNMQAGNSSLGGSNS---LGSHVSTLENN--MVGYNDE---QASMLRQLT  169

Query  568   TQERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQD  729
                RQ  VISIVGMGGIGK+T AK+++ DPS+   F + GW T+S+DY +R+    +LQD
Sbjct  170   GDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWITMSKDYSIRKMLLSLLQD  229

Query  730   LCGCVAQMTDKE------------INEVKSTAE------------LANKVRRRLMRQRYL  837
                 + +++D+E             ++++ + E            LA+++++ L  +RYL
Sbjct  230   AGVDLDKVSDEEQADHLQKSDEEQADDLQESDEEPLDYLQKINNALADRLQKSLKGRRYL  289

Query  838   LVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESW  1017
             +VVDDIW +  WD+++  FP+ +N SRILLTTR  +VA Y+         + FL+  ESW
Sbjct  290   IVVDDIWSTDAWDEIKLWFPEYNNRSRILLTTRDMKVAQYASFPEDPF-PMRFLDPEESW  348

Query  1018  MLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMN  1194
              LF QK       P E+E + K +V  C+GLPL I+V AG LS +KR++  W+ +A +++
Sbjct  349   NLFCQKAFDKKTCPIELENVAKEVVENCKGLPLMISVIAGTLS-SKRTLNEWRKVAKSVS  407

Query  1195  LPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVME  1374
               +  D + +CS +L LSYN+LP HLKACFLYFG+FPK   +I  K L+ LW  EG    
Sbjct  408   SLVNLDDYQRCSGVLALSYNHLPSHLKACFLYFGVFPKAS-DISVKKLIRLWAAEGLFEL  466

Query  1375  DSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAF  1554
                  LE+ A   L DLID++L+++S+ SF G IKTCR+HDLL DLC RE + +  +   
Sbjct  467   KGLEGLEKVAAYLLHDLIDKSLIIVSRRSFDGKIKTCRIHDLLHDLCWREAESDSILYVV  526

Query  1555  HQRSENVIELGDTEPLFEYANRWLTFR-TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGL  1731
                  N +  G     F    RW++        P      ++ K+R++ F+         
Sbjct  527   -----NDVPYGGPRRYFPQGRRWVSLHLAGGYYPTLFSALSYRKTRSVHFYAD-------  574

Query  1732  PVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHHNLQ  1905
             PV   Q   FK++RVLDL    F      +I  L+ LRYL +    I     + +  NLQ
Sbjct  575   PVYNLQLEHFKLLRVLDLEATEFQYGFPREILRLVCLRYLVMKIDEISEHIPISNLQNLQ  634

Query  1906  TLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIK----YPYPFP-IDTDEI--PV  2064
             TL++ F  S +                G+W    LR +     + YP P +  +E+  P 
Sbjct  635   TLVI-FTTSRKGFINLR---------DGIWDMSQLRHLNCSRIFLYPPPNVSPNEVEYPS  684

Query  2065  QDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE  2244
              + L ++  +    CTKE    I  VK +GI C    ++    W  NL YL +LE L + 
Sbjct  685   LENLQSVCGLSSSCCTKEIFKGIKKVKKMGISCD---SYSESEWLANLKYLLELEALSIA  741

Query  2245  ------DIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----L  2391
                   ++ S+ F L    SFP +LK+L +  T L WE +TIIS LP LE L+L      
Sbjct  742   SSSYYGNVYSD-FRLPCPGSFPPNLKKLTLCCTRLSWEDMTIISKLPKLEVLQLKEDDFA  800

Query  2392  QAYEMGEE-WVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEG  2568
             ++  +GE  W   + GFP+LKFL +    L  W    D+FP LE + + +C  L++IP+G
Sbjct  801   RSLSVGERVWEVTEMGFPELKFLLLEKLILDYWRATDDYFPCLEHVIIKNCSLLKEIPQG  860

Query  2569  FTDITTLQLIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDTR  2706
             F D  TL+LI L+ C PS+V SA+ IQ EQ  S G D L V   DTR
Sbjct  861   FADSMTLKLIMLQGCSPSVVTSAEWIQREQLESSGTDMLRVYAVDTR  907



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score =   437 bits (1124),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 318/864 (37%), Positives = 461/864 (53%), Gaps = 96/864 (11%)
 Frame = +1

Query  274   VKDISFRAEDEIESEVMEIISN-----GASHERLHQILQRLAEDIEGLIEQ---------  411
             +KDI+   EDE+ES+ + I+         +++RL  IL++  EDI+ + E+         
Sbjct  18    IKDIANEVEDEVESQALRIMEKEEHIRTEANKRLLIILKQAIEDIDSVKEELSKPRKNNK  77

Query  412   --------------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKE  549
                           R+    L +   G S+++ ++  G S  QD   MVGH+ E ER + 
Sbjct  78    LQAGNGSVGGTCSPRSLVSTLENDMVGHSDEQDMV--GHSDEQD---MVGHSDEQERVRG  132

Query  550   MLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL--  723
              L   S+Q  +VISI GMGGIGK+T AKK++ DPSI   F++ GW TVS+DY L+++L  
Sbjct  133   ELTGDSSQ-LEVISITGMGGIGKSTFAKKMFSDPSIVGFFNVCGWITVSKDYSLKKMLLS  191

Query  724   --QDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
               QD  G   Q+ +K  +E      LA+ +++ L ++RYL+VVDDIW    W+D+++ FP
Sbjct  192   LLQDAIGVNEQLDEKPDDE------LADCLQKSLKKRRYLIVVDDIWSIEAWEDIRQWFP  245

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEI  1074
             + +N SRILLTTR+ EVA     S K    + FL+ +ESW LF QK  G  + P E E +
Sbjct  246   EHNNRSRILLTTRITEVA-RDASSPKKPFQMRFLDPDESWNLFCQKAFGKNDCPAEFENV  304

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK I   C GLPL I+V AG LS +++ +  W  +A +++  +  D + +CS +L LSYN
Sbjct  305   GKVIAGNCNGLPLMISVVAGSLS-SEKMLRKWHEVAQSVSSLVNLDEYQRCSGVLALSYN  363

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
             +LP HLKACFLYFG+F K   EI  ++L+ LW+ EG         LE+ A   L DLID+
Sbjct  364   HLPSHLKACFLYFGVFKKAS-EISVENLIRLWMAEGLFKLRGIGELEKEASSLLHDLIDK  422

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA  1614
             +L++  K S  G IKTCR+HDLL DLCL E             SEN++ + +        
Sbjct  423   SLIVACKHSLDGKIKTCRIHDLLHDLCLSE-----------SESENLLYVSNPPTNVRQH  471

Query  1615  NRWLTFRTTYIQPKFSDKY-NFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE  1791
              RW++F    +Q  F   +  + K+R+L F          P  +R  +     ++L +++
Sbjct  472   RRWVSFHQKPMQDYFPLPFPTYGKTRSLHFL------EVKPSYFRYELGLDRFKLLRVLD  525

Query  1792  ISFDEAPTF--DISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdee  1965
             +       F   +S+L+ LRYL  G I     +    NLQ L   F +  +   +D    
Sbjct  526   LLGLGLIHFPKGLSNLVSLRYLRAGFISGYLPIYKLQNLQFL--SFRDVYKYTPVDLCLP  583

Query  1966  iGSKWLQGLWKSQSLRFIKYPY-----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLK  2130
              G+      WK   LR +   +     P  +  ++  V + L +++ +    CTKE    
Sbjct  584   DGT------WKMSQLRHLDSAFFYLCPPPKVSGNKYRVLEHLQSVHGLRPECCTKEMFEG  637

Query  2131  IPNVKVLGIKCSEIRAFQ--TETWWDNLHYLTKLEKLIVE--DIESEQFELQS----INS  2286
             I  VK LGI C     F+   + + +NL YL +LE L +   D  S  F L+     + S
Sbjct  638   IKKVKKLGI-CGRASHFKDAPKKFLNNLIYLPELEALRISLYDRSSSDFLLRQPVPCVGS  696

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKL----LQAYEMGE-EWVTGDGGFPKLK  2451
             FP +LK+L + GT L W  +T+IS LPNLE LKL    L   E+GE  W      FPKLK
Sbjct  697   FPPNLKKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEVSKIEFPKLK  756

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL I    L+ W    D FP LER+ + +C +L+KIP+GF D  TLQLIEL+ C  SLV 
Sbjct  757   FLLIEKKGLEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVN  816

Query  2632  SAKDIQEEQSS-YGNDQLVVRDYD  2700
              A++IQEEQ    GN+ L V  YD
Sbjct  817   FAREIQEEQQQRLGNNILQVYAYD  840



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score =   437 bits (1125),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 337/911 (37%), Positives = 481/911 (53%), Gaps = 90/911 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSL+ T+E LQ L+    L+  +   +  L +K+  L  LL+  +      +  K
Sbjct  3     AYVALTSLMGTIEQLQLLQSNLDLLDTHVQSLNLLYEKVDSLHELLDHFD-----DEQTK  57

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDIEGLIEQ  411
             ++ A+V+ I+  AEDE+ES++  ++     H+RLHQ         ILQR  E+++ L E+
Sbjct  58    NLHAKVRHIANEAEDEVESQMKVVMEE--QHDRLHQKEALESLFEILQRGIENVDSLKEE  115

Query  412   -----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                   N T    + + G S+   +    AS L++D  MVG+  E E     L   S  E
Sbjct  116   LIKHSDNNTSQAGNSSLGDSSSPRL---HASTLEND--MVGYNIEQENMLSQLTSGSP-E  169

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +VIS+ GMGGIGK+T AKK++  PSI S F + GW TVS++Y  R +L  L    A + 
Sbjct  170   LEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYRNMLLGLLK-DANIG  228

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
              +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+LLTTR
Sbjct  229   KEEDLDKKSDSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLTTR  288

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPL  1113
               EVA Y+  S K    +  L+  +SW LF QK     +   E E++GK +   C GLPL
Sbjct  289   DVEVAQYAS-SPKDPFRMHLLDQEDSWNLFYQKAFVEKDFAIEFEDVGKEVAKNCNGLPL  347

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
              I V A +LS  KR++E W+ +A +++     D + QCS +L LSYN+LP +LK CFLYF
Sbjct  348   TIAVVAKVLS-GKRTLEEWRKVAESVSSLADVDAYQQCSGVLALSYNHLPSYLKGCFLYF  406

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FPK   EI  + L+ LWI E  +       LEE A  +L  LID++LV++S+ S  G 
Sbjct  407   GLFPKA-SEISMEKLIRLWIAEELLKVKGMEGLEEVAASHLNYLIDKSLVIVSERSMDGK  465

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PLFEYAN--RWLTFRT  1638
             I TC +HDL+ D CL+E             S+N++ + +T+   PL+      RW++ ++
Sbjct  466   IMTCIIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLWVIPEGCRWVSQQS  514

Query  1639  --TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAP  1812
                  Q +F D   + K R+    F V+  + +    R    FK++RVLDL +I+    P
Sbjct  515   WGFLSQRRFPD-LAYSKLRS----FSVNHKTLIVDVER--CHFKLLRVLDLEKINIFNFP  567

Query  1813  TFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
                I DL+LLRYLAL     G     ++L    NLQTLIV  P   R +   S       
Sbjct  568   -IAIQDLVLLRYLALCISRCGQFPISKLL----NLQTLIVLSPRIFRKKAYRSLP-----  617

Query  1978  WLQGLWKSQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIP  2136
                G+WK   LR +         P  +  +E+   V + + T+  +    CTKE    I 
Sbjct  618   --DGIWKLSQLRHLDCWSMYLDSPQTVSENEVKNLVLENIQTVSELIPSCCTKEIFEAIN  675

Query  2137  NVKVLGIKCSEIRAFQTETWWD-NLHYLTKLEKLIV---EDIESEQFEL---QSINSFPQ  2295
              VK L I       F +ET W+ NL YL +L  L V    D  S++       S  SFP 
Sbjct  676   KVKKLEI-AGTTEEFHSETGWETNLKYLIELGALNVTVPTDFVSDRLPCLINPSPGSFPP  734

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
             ++K+L   GT + W  + I S LPNLE L+L      G+EW   + GFPKLK L +    
Sbjct  735   NIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEITEMGFPKLKCLLLEDLY  794

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L+ W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   LV  AK IQE 
Sbjct  795   LRYWTASDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEN  854

Query  2656  QSSYGNDQLVV  2688
                 GN+ L V
Sbjct  855   HEELGNNMLKV  865



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score =   437 bits (1124),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 337/911 (37%), Positives = 482/911 (53%), Gaps = 90/911 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSL+ T+E LQ L+    L+  +   +  L +K+  L  LL+  +      +  K
Sbjct  13    AYVALTSLMGTIEQLQLLQSNLDLLDTHVQSLNLLYEKVDSLHELLDHFD-----DEQTK  67

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDIEGLIEQ  411
             ++ A+V+ I+  AEDE+ES++  ++     H+RLHQ         ILQR  E+++ L E+
Sbjct  68    NLHAKVRHIANEAEDEVESQMKVVMEE--QHDRLHQKEALESLFEILQRGIENVDSLKEE  125

Query  412   -----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                   N T    + + G S+   +    AS L++D  MVG+  E E     L   S  E
Sbjct  126   LIKHSDNNTSQAGNSSLGDSSSPRL---HASTLEND--MVGYNIEQENMLSQLTSGSP-E  179

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +VIS+ GMGGIGK+T AKK++  PSI S F + GW TVS++Y  R +L  L    A + 
Sbjct  180   LEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYRNMLLGLLK-DANIG  238

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
              +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+LLTTR
Sbjct  239   KEEDLDKKSDSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLTTR  298

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPL  1113
               EVA Y+  S K    +  L+  +SW LF QK     +   E E++GK +   C GLPL
Sbjct  299   DVEVAQYAS-SPKDPFRMHLLDQEDSWNLFYQKAFVEKDFAIEFEDVGKEVAKNCNGLPL  357

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
              I V A +LS  KR++E W+ +A +++     D + QCS +L LSYN+LP +LK CFLYF
Sbjct  358   TIAVVAKVLS-GKRTLEEWRKVAESVSSLADVDAYQQCSGVLALSYNHLPSYLKGCFLYF  416

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FPK   EI  + L+ LWI E  +       LEE A  +L  LID++LV++S+ S  G 
Sbjct  417   GLFPKA-SEISMEKLIRLWIAEELLKVKGMEGLEEVAASHLNYLIDKSLVIVSERSMDGK  475

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PLFEYAN--RWLTFRT  1638
             I TC +HDL+ D CL+E             S+N++ + +T+   PL+      RW++ ++
Sbjct  476   IMTCIIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLWVIPEGCRWVSQQS  524

Query  1639  --TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAP  1812
                  Q +F D   + K R+    F V+  + +    R    FK++RVLDL +I+    P
Sbjct  525   WGFLSQRRFPD-LAYSKLRS----FSVNHKTLIVDVER--CHFKLLRVLDLEKINIFNFP  577

Query  1813  TFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
                I DL+LLRYLAL     G     ++L    NLQTLIV  P   R +   S       
Sbjct  578   -IAIQDLVLLRYLALCISRCGQFPISKLL----NLQTLIVLSPRIFRKKAYRSLP-----  627

Query  1978  WLQGLWKSQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIP  2136
                G+WK   LR +         P  +  +E+   V + + T+  +    CTKE    I 
Sbjct  628   --DGIWKLSQLRHLDCWSMYLDSPQTVSENEVKNLVLENIQTVSELIPSCCTKEIFEAIN  685

Query  2137  NVKVLGIKCSEIRAFQTETWWD-NLHYLTKLEKLIV---EDIESEQFEL---QSINSFPQ  2295
              VK L I  +    F +ET W+ NL YL +L  L V    D  S++       S  SFP 
Sbjct  686   KVKKLEIAGT-TEEFHSETGWETNLKYLIELGALNVTVPTDFVSDRLPCLINPSPGSFPP  744

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
             ++K+L   GT + W  + I S LPNLE L+L      G+EW   + GFPKLK L +    
Sbjct  745   NIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEITEMGFPKLKCLLLEDLY  804

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L+ W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   LV  AK IQE 
Sbjct  805   LRYWTASDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEN  864

Query  2656  QSSYGNDQLVV  2688
                 GN+ L V
Sbjct  865   HEELGNNMLKV  875



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score =   441 bits (1135),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 312/808 (39%), Positives = 434/808 (54%), Gaps = 77/808 (10%)
 Frame = +1

Query  370   LQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDA------IMVGHAQE  531
             L RL ED+  +   R   ++  ++  G+      +  GAS  + D+      ++VG  ++
Sbjct  312   LLRLMEDVISIT--REVIKVKDTFGAGEGLWHSNVLPGASLSRRDSGGVRKNVVVGFDKD  369

Query  532   LERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDL  711
             LE+ K   +  S++  ++ISIVGMGGIGKTT+A+++YDDPSI   F   GW  VSQ+Y L
Sbjct  370   LEQIKTQWIDDSSK-LEIISIVGMGGIGKTTLARQVYDDPSIFYHFDTRGWVAVSQEYSL  428

Query  712   RRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRC  891
             R++L  L      +T++  +E  S A LA  + + L  +RYL+V+DDIW    WD + R 
Sbjct  429   RQVLLGLLDSTKMLTEEMQDE--SDARLAEFLYKCLKGRRYLIVMDDIWDIDIWDAVSRL  486

Query  892   FPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIE  1068
             FPDDSNGSR+LLTTRL +VAVY+  S + +  + FLN ++SW L  +K+ G  + PPE+E
Sbjct  487   FPDDSNGSRVLLTTRLSDVAVYANSSSR-LHQMRFLNVDDSWNLLCKKVFGEKDCPPELE  545

Query  1069  EIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLS  1248
             ++G+ I   C GLPLAI V  GLL K  R+  NW+SIA  +N   + D  +QC  IL LS
Sbjct  546   DVGREIARNCGGLPLAIVVIGGLLYKESRTWRNWRSIAENLNSVFSKD-DEQCLEILGLS  604

Query  1249  YNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLI  1428
             YN LP+ LK CFLY G+FP+   EIP   L+NLW  EGF+   + ++LEE A +YL+DLI
Sbjct  605   YNRLPHRLKPCFLYMGVFPE-DSEIPVSKLINLWAAEGFLKPSTSKTLEEVAEEYLKDLI  663

Query  1429  DRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFE  1608
             +R+L+L  K S  G IKTC +HDLL D+C+R  +KE F+   +         GD   L E
Sbjct  664   ERSLILACKRSCNGRIKTCNIHDLLRDVCVRNAQKENFLDVVNWD-------GD---LTE  713

Query  1609  YANRWLTFRTTYIQPKFSDKYNFHKSRT---LLFFFGVSGASGLPVSWRQNVSFKMIRVL  1779
               NR  + R   I P        H S +   L   F  +G S L       + F+ +RVL
Sbjct  714   EGNR--SRRRLSIHPDALYANTTHHSTSSYSLARSFLCTGKS-LTYPSLVYLGFRFLRVL  770

Query  1780  DLVEISFDEAPTFDISDLILLRYLALGTIK--YVRVLKHHHNLQTLIVKFPNSCRieeid  1953
             D++ I F E P+ DI  L  LRYL   T K      +    NLQT++             
Sbjct  771   DIIVIHFSEFPS-DIIRLFHLRYLGF-TYKGPLPPSISKLRNLQTVV-------------  815

Query  1954  sdeeiGSKWLQG--------LWKSQSLR---FIKYPYPFPID----TDEIPVQDTLHTLY  2088
                     W  G        +W   +LR   F+    P P+      +   V + L  L 
Sbjct  816   -----HHNWTFGKYPLLPIEIWTMPNLRHLYFMPSCLPDPLGGQVLANNFVVLENLQALL  870

Query  2089  WVPYLRCTKEFVLKIPNVKVLGIKCS-------EIRAFQTETWWDNLHYLTKLEKLIVED  2247
              +   RC+K+ + +IPN+K LGI          +   F+ E+   NLH L  L+ +I  D
Sbjct  871   DIRNFRCSKDILKRIPNLKKLGISYDVSSQAYVDWSQFELESLV-NLHQLETLKIVIKND  929

Query  2248  -IESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVT  2424
                + +F      +FPQ LK L + G  L WE +TI+  LPNLE LKL +    G+EW  
Sbjct  930   PYRTSKFVNPPQLAFPQKLKRLTLSGCGLPWETMTIVGSLPNLEVLKLKKDACRGQEWEP  989

Query  2425  GDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
              +  F +LK+L +    L  W T   HFP L+ L +  C  L +IP    DITTLQ+IEL
Sbjct  990   VEEQFCRLKYLLLEELDLVQWRTNEAHFPCLQSLIIRSCFRLREIPSAIGDITTLQMIEL  1049

Query  2605  KDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
              DC PS V SAK IQEEQ S  N+ L V
Sbjct  1050  VDCHPSAVTSAKQIQEEQESMANEDLKV  1077



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score =   436 bits (1120),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 312/906 (34%), Positives = 462/906 (51%), Gaps = 70/906 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  L SL +T+       +    +D K  ++ L   L              +  +   
Sbjct  1     MAYAALVSLTQTLSQIMKHHQYGFFLDEKQRLKSLHTHL------EFLQAFLEDFPEKAN  54

Query  259   DVIARVKDISFRAEDEIESEVMEIISN-----------GASHERLHQI--------LQRL  381
             D+  R++D   +AED IE  + E I +            ++  RLH +        L R+
Sbjct  55    DLEGRIRDAVSQAEDIIEYLLFEQIRSLNSSGSSRQSGRSNARRLHHLTFRKRCERLPRV  114

Query  382   AEDIEGLIEQ----RNTTQM--LSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERT  543
               DIE ++++    +N+  +  L S +        ++            MVG  +++   
Sbjct  115   TGDIESIVKEVSGMKNSLGIPDLQSSDSSPPTSSSVLVQTRRDNTKKDAMVGLEEDVLAM  174

Query  544   KEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL  723
             K  L   S +  + I I GMGGIGKTT+A+  YDD  I   FH+  W TVSQDY ++ +L
Sbjct  175   KSRLCGESCK-LEFIPIYGMGGIGKTTLARSAYDDALIIEHFHIRAWVTVSQDYSIQEML  233

Query  724   QDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD  903
               L   +   ++K   E  S  ++A  V + L  +RYL+V+DD+W ++ WDD++R FPDD
Sbjct  234   FTLVDSIKAFSEKFDEEKHSYEQMAEHVYKNLKGRRYLVVLDDMWSTKAWDDVRRIFPDD  293

Query  904   SNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGK  1080
             +NGSRI++TTRL++VA Y+  S   +  + F+++++SW+L   K+    + PPE+E IGK
Sbjct  294   NNGSRIMITTRLQDVAAYADSSCP-LHEMRFMDADQSWILLHDKVFNEQHCPPELENIGK  352

Query  1081  RIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNL  1260
              I   C+GLPLAI V AG+LS   ++  +W+ IA  +NL +  + ++Q + IL LSY +L
Sbjct  353   MIARSCKGLPLAIVVIAGILSTVNQTQASWEDIAKKVNLAVAEN-NEQFAKILALSYFHL  411

Query  1261  PYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNL  1440
             P+HL+ CFLY G FP+   EI    L+ LW+ EGF+     +S EEGA + L+DL+ R+L
Sbjct  412   PHHLRPCFLYMGGFPE-DYEIHVSKLVKLWVAEGFMKPGVSKSFEEGAQECLEDLVKRSL  470

Query  1441  VLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKF-VSAFHQRSENVIELG-DTEPLFEYA  1614
             VL+++    G IK+C +HDL+ DLC+R+ ++EKF + A  +  +  +  G   +     A
Sbjct  471   VLVARRKSNGKIKSCSVHDLVRDLCIRQAREEKFLLFAMDRYVDRYLPKGIKDQRRLSIA  530

Query  1615  NRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEI  1794
                LT  +    P       F   R L        +S L        SF+++RVLD+V  
Sbjct  531   RSTLTLFSKINSPIIRTALYFEHCRRL--------SSSLQ-------SFRLLRVLDVVVA  575

Query  1795  SFDEAPTFDISDLILLRYLA---LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdee  1965
             +           L  LRYLA   LG       +    NLQTL +     C        + 
Sbjct  576   A-----XXXXLKLFHLRYLAFTFLGNFHIPASILKLQNLQTLFM-----CPYASFLIHQR  625

Query  1966  iGSKWLQGLWKSQSLR--FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPN  2139
                ++   +W+   LR   +    PFP  +    V   L TL  V   +CTKE V  IPN
Sbjct  626   SRVRFPLEIWRMAQLRHLVLSMSDPFPKPSAGTFVLKNLQTLAIVRNFKCTKEIVQMIPN  685

Query  2140  VKVLGIKCSEIRAFQTETWWDNLHYLTKLE--KLIVEDIESEQFELQSINSFPQSLKELK  2313
             +K LGI          E    NL  L +LE  K+ VEDI  E F L    +FP  LK+L 
Sbjct  686   LKKLGILYGVYGIKWREYHLHNLVDLHQLENLKVWVEDISREPFPLWEKLAFPVMLKKLT  745

Query  2314  IVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWET  2493
             + G    WE +T +  L NLE +KL +    G +W T +G FP+LKFL I    L++W T
Sbjct  746   LSGCLFCWEDMTTVGSLQNLEVMKLTRCSFEGCKWETIEGEFPRLKFLKIRWTNLQHWVT  805

Query  2494  MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
              S HFP LE L L  C  L +IP+   +I TL++IE+     SLV+SAK I+EEQ S+GN
Sbjct  806   DSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKSAKQIKEEQQSFGN  865

Query  2674  DQLVVR  2691
             D L VR
Sbjct  866   DYLEVR  871



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score =   435 bits (1119),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 314/906 (35%), Positives = 465/906 (51%), Gaps = 101/906 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL RT++   +   P+  ++ ++++EI  L +K+     +  ++ KK NVS+ 
Sbjct  1     MAYPSIASLTRTIKSLLISNSPVQSIICNHREEILALHEKVS-SLEVFLKNFKKSNVSRK  59

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ A++  +    E  I+  + E+      I    +HER    LQ++A DI+ ++ + 
Sbjct  60    MTDLEAQINKVVNVVEHTIQLRITEMVMANDEIQEEKAHERFCCSLQQVARDIDRVLNES  119

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
             +                               MVG A + +   + L +    E +VI I
Sbjct  120   SKD-----------------------------MVGRADQRKTLLDDLTRGFNDEPKVIPI  150

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+AK ++DD +IRS F +  WAT+S++++++ IL  L     +     I  
Sbjct  151   VGMGGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDG--IIH  208

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             ++  A+LA+ +++ L  +RYL+V+DDIW +  WDD++ CFP ++ GSRILLTTR   VA 
Sbjct  209   IEDEAKLADMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNTGVAC  268

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAA  1131
              +G     +  L F+N +ESW LF   + + + LPPE E +GK+IV +C+GLPL   V A
Sbjct  269   SAGTENLSL-RLDFMNPDESWNLFKSTIPANDALPPEFETVGKQIVERCQGLPLTTVVVA  327

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLLSK KR++E W+ +A  +   + +D   QC  +L LSYN+L   LK C LYFGIFP+ 
Sbjct  328   GLLSKCKRTIEVWKDVAKDVKSFVKNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPE-  386

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS-FIGNIKTCR  1488
               EI  K L+ LW  EGF+        EE A K LQ+LIDR LVL+S+ S +   I++C+
Sbjct  387   NSEISVKRLVRLWTAEGFLKS------EEEAEKCLQELIDRFLVLVSRKSRYETKIRSCK  440

Query  1489  LHDLLFDLCLREVKKEKFV-------------SAFHQRSENVIE--LGDTEPLFEYAN-R  1620
             +HDL+++LCLRE +K  F                +H  S + +   +G T+ +    + R
Sbjct  441   VHDLIYELCLREAEKRTFFVINDIVFNDEPNHVPYHHLSRHKMRRFMGGTDDILRRGSYR  500

Query  1621  WLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISF  1800
              L       +    D  +  ++R++  F   S    L     +   F +IR+LDL  I  
Sbjct  501   ALLIPRNRKKTDDDDNNSLKRTRSIFSFCRDSSTFTLE---SELTHFNLIRILDLSCIKI  557

Query  1801  DEAPTFDISDLILLRYLAL----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
                P   I  LI LRYL L    G+      +    +LQT IV                 
Sbjct  558   HTFPP-QILCLIWLRYLVLRSRRGSFDIPPEISRLWSLQTFIVG-----------GYRLT  605

Query  1969  GSKWLQGLWKSQSLRFIK-----YPYPFPIDTDEIPVQD--TLHTLYWVPYLRCTKEFVL  2127
              + + + +W+   LR ++      P P  +  +E    D   LHT+  +    CTKE + 
Sbjct  606   STIFPEQIWELMQLRHLELSSFHLPNPPIVSVEEEKCLDFPNLHTISGLSLSCCTKEVIS  665

Query  2128  KIPNVKVLGI---KCSEIRAFQTETWWDNLHYLTKLEKLIVE-DIESEQFELQ-----SI  2280
              I NV+ L I   +  E  +F     +DN  +L +LE L +E D     +E+      S+
Sbjct  666   GIRNVRKLRINRGEDDEYESFHVCRLFDNFVHLHQLETLSLELDFRGVLYEISPATIPSV  725

Query  2281  NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLY  2460
              SFP  LK+LK+ GT L WE + II  L NLE LKL +    GEEW   + GF +LK L 
Sbjct  726   KSFPPMLKKLKLYGTGLRWEDLNIIGELRNLEILKLKRYACRGEEWHPSENGFTRLKLLL  785

Query  2461  ISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAK  2640
             I    LK W + +D FPVLERL + HC  LE IP  F  I +LQ IEL DC P L  SA 
Sbjct  786   IEYNDLKYWSSPNDSFPVLERLVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEASAA  845

Query  2641  DIQEEQ  2658
              IQ EQ
Sbjct  846   RIQHEQ  851



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score =   434 bits (1116),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 329/909 (36%), Positives = 482/909 (53%), Gaps = 75/909 (8%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSL+ T+E LQ L+    L+  + + +  L QK+      L E     +  Q  K
Sbjct  3     AYVALTSLMGTIEQLQLLQSNLDLLDTHVESLNLLYQKV----DSLHELLDHFDDGQT-K  57

Query  259   DVIARVKDISFRAEDEIESEVMEIIS--NGASH-----ERLHQILQRLAEDIEGLIEQRN  417
             ++ A+V+ I+  +EDE+ES++  ++   +G+ H     E L +ILQR  E+++ L E+  
Sbjct  58    NLHAKVRHIANESEDEVESQMKVVMDEQHGSLHQKEAFESLFEILQRGIENVDSLKEELI  117

Query  418   TTQMLSSYNPGQSNQEHIIAGG--ASKLQDDAIMVGHAQELERTKEM-LLQCSTQERQVI  588
                  ++   G ++ +   + G  AS L++D  MVG+   +E+   M  L   + E +VI
Sbjct  118   KHSHNNTSQAGNASLDDSSSPGLHASTLEND--MVGY--NIEQANMMSQLTSGSPELEVI  173

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             S+ GMGGIGK+T AKK++  PSI S F + GW TVS++Y  R +L  L    A +  +E 
Sbjct  174   SVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYRNMLLGLL-IDANIGKEED  232

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
              + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+LLTTR  EV
Sbjct  233   LDKKSNSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEV  292

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             A Y+  S K    +  L+  +SW LF QK     +   E E++GK +   C GLPL I V
Sbjct  293   AQYAS-SPKDPFRMHLLDQEDSWNLFYQKAFVEKDFAIEFEDVGKEVAKNCNGLPLIIAV  351

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              A +LS  KR++E W+ +A +++     D + QCS +L LSYN+LP +LK CFLYFG+FP
Sbjct  352   VAKVLS-GKRTLEEWRKVAESVSSLADVDAYQQCSGVLALSYNHLPSYLKGCFLYFGLFP  410

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             K   EI  + L+ LWI EG +       LEE A  +L  LID++LV++SK S  G I TC
Sbjct  411   KAS-EISVEKLIRLWIAEGLLKVKGMEGLEEVAASHLDYLIDKSLVIVSKRSLDGKIMTC  469

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLT--FRTTYIQPKF  1659
              +HDL  D CL+E   +  +   +       ++   + +     RW++   R  Y   +F
Sbjct  470   IIHDLFHDFCLKEADSQNLLYIVNN------DIDGPQWVIPEGCRWVSQQSRGFYFHRRF  523

Query  1660  SD-KYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLI  1836
              D  Y+  +S +L        +S L ++ ++   FK++RVLDL +    + P   I DL+
Sbjct  524   PDLAYSKLRSFSL-------NSSTLILNVKR-CHFKLLRVLDLEKKKIFDFP-IAILDLV  574

Query  1837  LLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ-----GLWK  1998
             LLRYLAL   +  R+ +    NLQTL V+ P+              S W +     G+WK
Sbjct  575   LLRYLALTIRRSGRLPISKLLNLQTLTVR-PHPIYT----------SNWRRYSLPNGIWK  623

Query  1999  SQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
                LR +         P  +  +E+   V + + T+  +    CTKE    I  VK L I
Sbjct  624   LSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFEAIKKVKKLEI  683

Query  2158  KCSEIRAFQTETWW-DNLHYLTKLEKLIVEDIESEQFEL------QSINSFPQSLKELKI  2316
                +   FQ+E  W +NL YL +LE L V       F+        S  SFP +LK+L +
Sbjct  684   -AGKAEEFQSEMGWHNNLKYLKELEALNVTVPPDFIFDRLPCLINPSPGSFPPNLKKLTL  742

Query  2317  VGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETM  2496
               T L W  + I S LPNLE L+L      G EW   + GFPKLK L +    L+ W   
Sbjct  743   SRTCLPWNCMNIFSKLPNLEVLELKARAFSGNEWEITETGFPKLKCLLLEDLYLRYWTAT  802

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGND  2676
              D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   LV  AK IQ +    GN+
Sbjct  803   DDYFECLERVCIRECILLKEIPEGFADSETLQLIELHKCGRPLVTFAKQIQGKHEELGNN  862

Query  2677  QLVVRDYDT  2703
              L V  +D+
Sbjct  863   MLKVYAFDS  871



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score =   434 bits (1115),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 319/859 (37%), Positives = 462/859 (54%), Gaps = 88/859 (10%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDIEGLIE  408
             K++ A+V+ I+  AEDE+ES++  ++     H+RLHQ         ILQR  E+++ L E
Sbjct  57    KNLHAKVRHIANEAEDEVESQMKVVMDE--QHDRLHQKEALENLSEILQRGIENVDSLKE  114

Query  409   Q-----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML--LQCS  567
             +     +N T    + + G S+   +    AS L++D  MVG+  E      ML  L   
Sbjct  115   ELIKHSQNNTSQAGNSSLGDSSSPRL---HASTLEND--MVGYNIE---QANMLGQLTSG  166

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA  747
             + E +VIS+ GMGGIGK+T AK ++  P I S F + GW TVS+DY  R+IL  L    A
Sbjct  167   SPELEVISVTGMGGIGKSTFAKNLFSHPLILSFFDIRGWITVSEDYIYRKILLGLL-IDA  225

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
              +  +E  + K+ ++LA  +++RLM +RYL+VVDDIW    WD+++ C PDD   SR+LL
Sbjct  226   NIGKEEDLDKKNDSDLAVCLKQRLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLL  285

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRG  1104
             TTR  EVA Y+  S K    +  L+  +SW LF QK    N    E E++GK +   C G
Sbjct  286   TTRDVEVAQYAS-SPKDPFRMHLLDQEDSWNLFYQKAFVKNGFAIEFEDVGKEVAKNCNG  344

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPL I V A +LS +KR+++ W+ +A +++     D + QCS +L LSYN+L  +LK CF
Sbjct  345   LPLMIAVVAKVLS-SKRTLDEWKKVAESVSSLAEVDAYQQCSGVLALSYNHLSSYLKGCF  403

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYFG+FPK   EI  + L+ LWI EG +     + LEE A  +L  LID++LV++SK S 
Sbjct  404   LYFGLFPKAS-EISMEKLIRLWIAEGLLKVKGMKGLEEVAASHLNFLIDKSLVIVSKRSM  462

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PLFEYAN--RWLT  1629
              G I TC +HDL+ D CL+E             S+N++ + +T+   PL+      RW++
Sbjct  463   DGKIMTCMIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLWVIPEGCRWVS  511

Query  1630  FRTT--YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFD  1803
              ++   Y   +F D   + K R+    F V+  + L V   ++  FK++RVLDL +    
Sbjct  512   QQSMGFYFHRRFPD-LAYSKLRS----FSVNSRTILNV---ESCHFKLLRVLDLEKKKIP  563

Query  1804  EAPTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
             + P   I DL+ LRYLAL     G +   ++L    NLQTL V+ P+     ++      
Sbjct  564   DFP-IAILDLVRLRYLALTIRRSGKLPISKLL----NLQTLTVR-PHPIYTSKLRRYSLP  617

Query  1969  GSKWLQGLWKSQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVL  2127
                   G+WK   LR +         P  +  +E+   V + + T+  +    CTKE   
Sbjct  618   N-----GIWKLSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFE  672

Query  2128  KIPNVKVLGIKCSEIRAFQTETWW-DNLHYLTKLEKLIVE---DIESEQFEL---QSINS  2286
              I  VK L I   +   FQ+E  W +NL YL +LE L V    D  S++       S  S
Sbjct  673   AIKKVKKLEI-AGKAEEFQSEMGWHNNLKYLKELEALNVTVPPDFISDRLPCLINPSPGS  731

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYIS  2466
             FP +LK+L +  T L W  + I S LPNLE L+L      G EW   + GFPKLK L + 
Sbjct  732   FPSNLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEITEMGFPKLKCLLLE  791

Query  2467  GAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
                L+ W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   LV  AK I
Sbjct  792   DLYLRYWTATDDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQI  851

Query  2647  QEEQSSYGNDQLVVRDYDT  2703
             QE+    GN+ L V  +D+
Sbjct  852   QEKHEELGNNLLKVYAFDS  870



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score =   434 bits (1115),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 336/926 (36%), Positives = 491/926 (53%), Gaps = 106/926 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  +TSL+ T+ L   +    L   +K+ ++ L +K+        +     +  +  KD
Sbjct  51    AYAAVTSLLGTIHL-ISQSSLKLQEGHKEHLRLLYKKV-----RSLQELLDNSDDEPTKD  104

Query  262   VIARVKDISFRAEDEIESEV-----------MEIISN--GASHERLHQILQRLAEDI---  393
             +  +VKD++   ED++ES +           ++ + N    +H RL +I+Q+  +DI   
Sbjct  105   LQEKVKDLAQEVEDKVESRIQREAQKTLLKMLQRVFNLPTKAHGRLLKIMQQAIKDIDSV  164

Query  394   -EGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
              E  I+QR       S     S Q H+     S +++D  MVG+  E E  ++ L   S+
Sbjct  165   KEWFIKQRENN---ISAGASSSAQYHV-----STIEND--MVGYNIEQELMRDQLRGHSS  214

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL----QDLCG  738
             Q  +VISIVGMGGIGK+T AKK++ DPSI S F + GW TVS+DY LRRIL    QD  G
Sbjct  215   Q-LEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWITVSKDYSLRRILLGLLQDAIG  273

Query  739   CVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSR  918
              V +M DK  ++      LA+++++ L  +RYL+VVDDIW    WD ++ CFP+ SN SR
Sbjct  274   -VKEMLDKVSDDA-----LADRLQKSLKGRRYLIVVDDIWSREAWDGIRLCFPEYSNKSR  327

Query  919   ILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPP-EIEEIGKRIVNK  1095
             ILLTTR  +VA Y+    K    + FL   ESW LF QK     + P   E++ K +V  
Sbjct  328   ILLTTRDMKVAQYASFP-KDPFPMRFLELEESWNLFCQKAFDQKVCPIGFEDVAKEVVEN  386

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             C+GLPL I+V AG LS +KR+++ W  +A +++  +  D + +CS +L+LSYN+L  HL+
Sbjct  387   CKGLPLMISVVAGTLS-SKRTLDEWWKVAQSVSSLVNLDDYQRCSGVLSLSYNHLLSHLR  445

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
             ACFLYFG+FPK   EI  K L+ LW+ EGF+       LE+ A   L DLID++LV++SK
Sbjct  446   ACFLYFGVFPKAS-EISVKKLIRLWVAEGFLELKGLEGLEKVAANLLHDLIDKSLVVVSK  504

Query  1456  LSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR  1635
              S  G IKTCR+HDLL DLCLRE + E  +        N +       +     RW++  
Sbjct  505   QSLAGKIKTCRIHDLLHDLCLREAESENLLYM-----ANPVTYEGPRRVSSQGRRWVS--  557

Query  1636  TTYIQPK-------FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS---FKMIRVLDL  1785
                + PK       F D    +K+R+L     ++        W   +    F ++RVLDL
Sbjct  558   ---VHPKRGCFSFIFFDDLTHNKTRSLHISSNIT-------EWHLELELDHFILLRVLDL  607

Query  1786  VEISFDEAPTFDISDLILLRYLALGTIKYVR--VLKHHHNLQTLIVKFPNSCRieeidsd  1959
               + FD  P  +I  L+ LRYLA+  ++      +    NLQT I +             
Sbjct  608   ETLRFDYFPR-EILHLVSLRYLAVTAVEIPEDTSISKLWNLQTFIFR---------QYIP  657

Query  1960  eeiGSKWL-QGLWKSQSLRFIK----YPYPFP-IDTDEIP--VQDTLHTLYWVPYLRCTK  2115
             E  G+ +L  G+WK   LR +     Y Y  P +  +++     + L ++  +    CTK
Sbjct  658   ELSGTIYLSNGIWKMSQLRHLHSTRMYLYSPPNVSANDVKYCFLENLQSVSGMSPRCCTK  717

Query  2116  EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQ----FELQSIN  2283
             +    I  VK LGI  +    ++     DNL YL +LE L +    SE       L    
Sbjct  718   KTFEGIKKVKELGIGGNTSDFYKKPKCLDNLIYLHELEALSIASYNSEPDGLFLRLPCPG  777

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-LQAYE----MGEE-WVTGDGGFPK  2445
              FP +LK+L +  T L WE + IIS LP LE L+L  +A+     +GE  W   + GF +
Sbjct  778   YFPPNLKKLTLCRTFLPWEDMAIISKLPKLEVLQLKARAFAGIDIVGETVWEVTEIGFLE  837

Query  2446  LKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSL  2625
             LKFL +    L  W    D+FP LER+ + +C +L++IP+GF D  TLQLIEL  C PSL
Sbjct  838   LKFLLLEKLHLDYWRATDDYFPCLERIIIKNCSSLQEIPKGFADSMTLQLIELHQCSPSL  897

Query  2626  VESAKDIQEEQ-SSYGNDQLVVRDYD  2700
             V SA+ I++EQ  S GN+ L V  +D
Sbjct  898   VNSAELIRKEQLESLGNNMLKVYAFD  923



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   434 bits (1115),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 328/948 (35%), Positives = 495/948 (52%), Gaps = 98/948 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
              Y  +TSL+ T++L   +    L  D+K+ ++ L  K+  +   L+ +       +  +D
Sbjct  4     VYAAVTSLMGTIQL-ISQSTSDLQEDHKEHLKLLYDKVGSMLEFLDTNSD----DEPMRD  58

Query  262   VIARVKDISFRAEDEIESEV--------MEIISN-----GASHERLHQILQRLAEDIEGL  402
             ++ +VKD++ + EDE+ES +        ++I+         +HERL +ILQR  E+++ +
Sbjct  59    LLKKVKDVAHKVEDEVESHIWRGDHKTLLKILQRVFHLPTKAHERLLKILQRAIEEVDSV  118

Query  403   IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAI---MVGHAQELERTKEMLLQCSTQ  573
              E+ N  +  ++ N  ++    +    + +L    +   MVGH  E E  +  L   S+Q
Sbjct  119   KEELNKLKDNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGHNIEQELMRGQLTGNSSQ  178

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDL---CGCV  744
               +VISI GMGGIGK+T AK++++DPSI S F + GW TVS+DY+LR++L  L    G  
Sbjct  179   -LEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKDYNLRKMLLSLLQDAGVN  237

Query  745   AQMTDKE---------------------------------INEV-------KSTAELANK  804
             A++  K                                  I++V       KS  ELA++
Sbjct  238   AELDKKSDIGEHREEEEGEGGGGGGGGQEEEGNLKKKKKKISDVQLANRMQKSDGELADR  297

Query  805   VRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVC  984
             +++ L  +RYL+VVDDIW +  WD+ +  FP+ +N SRILLTTR  +VA Y+    +   
Sbjct  298   LQKSLKGRRYLIVVDDIWSTEAWDEFRLWFPEYNNRSRILLTTRDIKVAQYASYP-RDPS  356

Query  985   NLPFLNSNESWMLFSQKLGSINLPP-EIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSV  1161
              + FL   ESW LF QK     + P E E I + +V  C GLPL I+V AG LS +KR+V
Sbjct  357   PMRFLKPEESWTLFCQKAFDQKVCPIEFENIAREVVKNCNGLPLMISVVAGALS-SKRTV  415

Query  1162  ENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLL  1341
             + W+ +A +++  +  D + +CS +L LSYN+LP HLKACFLYFG+FPK   EI  K L+
Sbjct  416   DEWRKVAQSVSSLVNLDDYQRCSRVLALSYNHLPSHLKACFLYFGVFPKAS-EISVKKLI  474

Query  1342  NLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLR  1521
              LW+ EGF+       LE+ A   L +LID++LV++ K S    IKTCR+HDLL D CLR
Sbjct  475   RLWVAEGFLELKGFEGLEKVATSLLSNLIDKSLVVVGKRSLNDKIKTCRIHDLLHDFCLR  534

Query  1522  EVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK---FSD-KYNFHKSR  1689
             E + E  +   +     V     +  +     RW++     + PK   FS   +N  K+R
Sbjct  535   EAENENLL---YVTETPVTTYEGSRKVSSQVRRWVS-----VYPKDGRFSPIHFNCRKTR  586

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIK  1869
             +LL +  ++  S   +       FK +RVL L E S+ E P+ ++  L+ LRYL++   +
Sbjct  587   SLLVYSYITEHSRSKLGLDH---FKRLRVLQL-EKSWYEFPS-EVVHLVALRYLSVKVSR  641

Query  1870  YVRVLKHHH--NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPI  2043
               + L   +  NLQT I  FP +    +           +  L   +S R   Y  P  +
Sbjct  642   SPQDLPIFNLMNLQTFI--FPQNMPEYQEVIYLPSEIWEMSQLRHLRSTRMYLYSPPPMV  699

Query  2044  DTDEIPVQ--DTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYL  2217
               +E+  +  + L ++  +    CTKE    I  VK LGI  ++          +NL  L
Sbjct  700   SDNEVKYRALENLQSVCGLIPGCCTKEIFEGIKKVKKLGIYGTKDDFNSEPRCLENLMDL  759

Query  2218  TKLEKLIV---EDIESEQF-ELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLK  2385
              +LE L +       S  F  L    SFP +LK+L +  T L W+ +TI+SMLP LE L+
Sbjct  760   HELEALTIVSYRKFNSNTFLSLPCPGSFPPNLKKLTLCCTFLLWKDMTIVSMLPKLEVLQ  819

Query  2386  LLQ-AYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIP  2562
             L   A+     W   +  FPKLKFL +    +K W    D FP LER+ + +C  L +IP
Sbjct  820   LRNNAFVPNIGWKVTEMQFPKLKFLLLEQLNIKYWRATDDCFPCLERIIIRNCRFLIEIP  879

Query  2563  EGFTDITTLQLIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDT  2703
             + F D  TLQLIEL  C+PSLV SA+ IQ+EQ  S GN+ L V  +DT
Sbjct  880   QEFADSMTLQLIELHQCYPSLVNSAELIQKEQLESLGNNMLKVYAFDT  927



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score =   434 bits (1117),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 317/898 (35%), Positives = 466/898 (52%), Gaps = 119/898 (13%)
 Frame = +1

Query  241   VSQAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQ---  411
             +  ++ ++  +VKD++   EDE++ +V+ I+    ++ERL +IL++  +DI   +E    
Sbjct  117   LDNSDNELQKKVKDLANEVEDEVKPQVVRIMEKKEANERLRKILEQAIKDIANEVEDEHI  176

Query  412   ------------------------------------------------RNTTQMLSSYNP  447
                                                             R+    L +   
Sbjct  177   RTEANKRLLIILKQAIEDIDSVKEELSKPRKNNKLQAGNGSVGGTCSPRSLVSTLENDMV  236

Query  448   GQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTM  627
             G S+++ ++  G S  QD   MVGH+ E ER +  L   S+Q  +VISI GMGGIGK+T 
Sbjct  237   GHSDEQDMV--GHSDEQD---MVGHSDEQERVRGELTGDSSQ-LEVISITGMGGIGKSTF  290

Query  628   AKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL----QDLCGCVAQMTDKEINEVKSTAEL  795
             AKK++ DPSI   F++ GW TVS+DY L+++L    QD  G   Q+ +K  +E      L
Sbjct  291   AKKMFSDPSIVGFFNVCGWITVSKDYSLKKMLLSLLQDAIGVNEQLDEKPDDE------L  344

Query  796   ANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGK  975
             A+ +++ L ++RYL+VVDDIW    W+D+++ FP+ +N SRILLTTR+ EVA     S K
Sbjct  345   ADCLQKSLKKRRYLIVVDDIWSIEAWEDIRQWFPEHNNRSRILLTTRITEVA-RDASSPK  403

Query  976   YVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTK  1152
                 + FL+ +ESW LF QK  G  + P E E +GK I   C GLPL I+V AG LS ++
Sbjct  404   KPFQMRFLDPDESWNLFCQKAFGKNDCPAEFENVGKVIAGNCNGLPLMISVVAGSLS-SE  462

Query  1153  RSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTK  1332
             + +  W  +A +++  +  D + +CS +L LSYN+LP HLKACFLYFG+F K   EI  +
Sbjct  463   KMLRKWHEVAQSVSSLVNLDEYQRCSGVLALSYNHLPSHLKACFLYFGVFKKAS-EISVE  521

Query  1333  DLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDL  1512
             +L+ LW+ EG         LE+ A   L DLID++L++  K S  G IKTCR+HDLL DL
Sbjct  522   NLIRLWMAEGLFKLRGIGELEKEASSLLHDLIDKSLIVACKHSLDGKIKTCRIHDLLHDL  581

Query  1513  CLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKY-NFHKSR  1689
             CL E             SEN++ + +         RW++F    +Q  F   +  + K+R
Sbjct  582   CLSE-----------SESENLLYVSNPPTNVRQHRRWVSFHQKPMQDYFPLPFPTYGKTR  630

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF--DISDLILLRYLALGT  1863
             +L F          P  +R  +     ++L ++++       F   +S+L+ LRYL  G 
Sbjct  631   SLHFL------EVKPSYFRYELGLDRFKLLRVLDLLGLGLIHFPKGLSNLVSLRYLRAGF  684

Query  1864  IKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY----  2031
             I     +    NLQ L   F +  +   +D     G+      WK   LR +   +    
Sbjct  685   ISGYLPIYKLQNLQFL--SFRDVYKYTPVDLCLPDGT------WKMSQLRHLDSAFFYLC  736

Query  2032  -PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQ--TETWWD  2202
              P  +  ++  V + L +++ +    CTKE    I  VK LGI C     F+   + + +
Sbjct  737   PPPKVSGNKYRVLEHLQSVHGLRPECCTKEMFEGIKKVKKLGI-CGRASHFKDAPKKFLN  795

Query  2203  NLHYLTKLEKLIVE--DIESEQFELQS----INSFPQSLKELKIVGTELGWEAITIISML  2364
             NL YL +LE L +   D  S  F L+     + SFP +LK+L + GT L W  +T+IS L
Sbjct  796   NLIYLPELEALRISLYDRSSSDFLLRQPVPCVGSFPPNLKKLTLQGTRLLWSQLTVISKL  855

Query  2365  PNLESLKL----LQAYEMGE-EWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLA  2529
             PNLE LKL    L   E+GE  W      FPKLKFL I    L+ W    D FP LER+ 
Sbjct  856   PNLEVLKLKALKLFGNELGETAWEVSKIEFPKLKFLLIEKKGLEYWTAEDDSFPCLERVI  915

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSS-YGNDQLVVRDYD  2700
             + +C +L+KIP+GF D  TLQLIEL+ C  SLV  A++IQEEQ    GN+ L V  YD
Sbjct  916   IKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNFAREIQEEQQQRLGNNILQVYAYD  973



>gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Erythranthe guttata]
Length=859

 Score =   430 bits (1105),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 292/832 (35%), Positives = 438/832 (53%), Gaps = 69/832 (8%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQ---------R  414
              R+ D +  AED IE    + I  S   +  R  + L+++  D++ +             
Sbjct  58    VRIGDAATEAEDTIEFLTSDQIRPSKYGNRRRNFRDLEKVTGDLDSIAADVMLIKNGAGT  117

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
              T Q++  + PG S           K     +MVG   +L   K  L   S++  +VI I
Sbjct  118   KTAQLIGDFFPGDSVSSSPKLASTGK----NLMVGFNDDLIAVKSRLCGESSK-LEVIPI  172

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
              GMGGIGKTT+A+  YDDP     F + GW T+SQ Y    +L    G V+ M  KE  +
Sbjct  173   FGMGGIGKTTLARSAYDDPLTMQHFVIRGWVTISQHYSAHDLLS---GLVSSM--KEFIK  227

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
              +    +  K+ + L+ +RYL+V+DD+W ++ WDD +R FPD++NGSRILLTTRL +VA 
Sbjct  228   EEPAQAMKQKIYQTLIGRRYLIVLDDMWSTKAWDDTKRIFPDNNNGSRILLTTRLSDVAA  287

Query  955   YSG-CSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             Y+  CS  +   +PF+++++SW L  QK+     N P E+E IGK I   CRGLPLAI V
Sbjct  288   YADPCSPLH--EMPFMDADQSWDLLQQKVFGHEENYPLELENIGKEIARGCRGLPLAIVV  345

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AG+LS   ++  +W+ I+  +N  + +    Q   IL LSY +LP+HL+ CFLY G FP
Sbjct  346   IAGVLSTVSKTRSSWEEISKNINSTVGTK-DGQIEKILYLSYTHLPHHLRPCFLYMGGFP  404

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +   EI    L+ LW+ E F+   S RS EEGA  YL+DL+ R+L+ ++K    G IK+C
Sbjct  405   E-DYEIRASKLVKLWVAESFLKPSSSRSFEEGAEDYLEDLVKRSLIFVTKRKSNGRIKSC  463

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQR--SENVIELGDTEPLFEYANRWLTFRTTYIQPKF  1659
              +HDL+ DLC+R+  +EKF      R  S+ ++E    +     A+ +L   T+      
Sbjct  464   SVHDLVRDLCIRKANEEKFHRHITDRYVSDVLLERIKNQRRICIAHSYLDRETSIYGSSI  523

Query  1660  SDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF-----DI  1824
                  F ++ + L F G               + +++RVLD+V+ +F     +      +
Sbjct  524   RTVICFQRNASSLGFVG---------------NIRLLRVLDVVDANFSPFILYVSLPSKL  568

Query  1825  SDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKS  2001
              +L  LRYLA      +   + +  NLQ+LIV+   +C +              + +W+ 
Sbjct  569   FELFHLRYLAFSYPTTIPSDISNLQNLQSLIVRSVGTCFVPLP-----------REIWRM  617

Query  2002  QSLRFIKY----PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR +      P P P +   + +++ L TL  V    C+++    +PN++ LGI  S 
Sbjct  618   PQLRHLVCRSFGPLPCPDEGATLALEN-LQTLAVVTNFVCSEKITEMLPNLRKLGIVYSG  676

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTEL-GWEAI  2346
                +Q E    NL  L KLE L +E I    F  +    FP+ LKEL + G  +  W+ +
Sbjct  677   DDCYQ-EFHLGNLVLLCKLESLKLEVIGRPHFRTRLNPVFPRLLKELTLSGFGIINWKDM  735

Query  2347  TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERL  2526
             TI+  L NL+ LKL  +   G EW+T +G F +LK+L I  +  + W T SDHFP L  L
Sbjct  736   TIVGSLLNLQVLKLRDSACEGYEWITNEGEFLELKYLLIDNSDPQQWITESDHFPSLRFL  795

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
              LH C NL +IP    DI++L+LIE+K    SLV+SAK I+EEQ SYGN+ L
Sbjct  796   LLHSCRNLSEIPNCVGDISSLELIEVKYGNKSLVDSAKQIEEEQQSYGNEGL  847



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score =   430 bits (1106),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 334/918 (36%), Positives = 491/918 (53%), Gaps = 95/918 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPI-LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSL+ TV+   L    + L   + + +  L +K+       +  ++ L+ S AE+
Sbjct  3     AYVALTSLMGTVQQLQLLQSNLDLWNTHVESLNLLYEKV-------DSLQEFLDSSDAEQ  55

Query  259   DVI--ARVKDISFRAEDEIESE---VMEIISNGASH----ERLHQILQRLAEDIEGLIEQ  411
               I  A+VK I+  AEDE+ES+   VM+   +G       E L +ILQR A +++ L E+
Sbjct  56    MEILQAKVKHIANEAEDEVESQMKVVMDEQYDGLHQKETLESLFEILQR-AINVDSLKEE  114

Query  412   -----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCS--T  570
                  +N      + + G S+   +    AS L++D  MVG+  E      ML Q +  +
Sbjct  115   VFKHSQNNNLQAGNSSLGDSSSPRL---HASTLEND--MVGYNTE---QANMLSQLTRDS  166

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
              E +V ++ GMGGIGK+T AKKI+  P + S F + GW TVS+DY  R++L  L   V  
Sbjct  167   PELEVNAVTGMGGIGKSTFAKKIFAHPPVLSFFDICGWITVSEDYSYRKMLLGLLKDVNI  226

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               ++++++ K+ ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+LLT
Sbjct  227   GKEEDLDK-KNDSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLT  285

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGL  1107
             TR  EVA Y+  S K    +  L  ++SW LF QK       P E E++GK +   C+GL
Sbjct  286   TRDVEVAQYAS-SSKDPFKMHLLGPDDSWNLFQQKAFAGKGFPIEFEDVGKDVAKNCKGL  344

Query  1108  PLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFL  1287
             PL I V A +LS +KR++E W+ +A  ++     D + QCS +L LSYN+LP +LK CFL
Sbjct  345   PLMIAVVAKILS-SKRTLEEWRKVAERVSSLAEVDAYQQCSGVLALSYNHLPSYLKGCFL  403

Query  1288  YFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI  1467
             YFG+FPK   EI  + L+ LWI EG +     + LEE A  +L  LID++LV++SK S  
Sbjct  404   YFGLFPKAS-EISMEKLIRLWIAEGLLKVKGMKGLEEVAASHLNFLIDKSLVIVSKRSMD  462

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PLFEYAN--RWLTF  1632
             G I TC +HDL+ D CL+E             S+N++ + +T+   PL+      RW++ 
Sbjct  463   GKIMTCMIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLWVIPEGCRWVSQ  511

Query  1633  RTT--YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
             ++   Y   +F D   + K R+    F V+  + L V   ++  FK++RVLDL +    +
Sbjct  512   QSMGFYFHRRFPD-LAYSKLRS----FSVNSRTILNV---ESCHFKLLRVLDLEKKKIPD  563

Query  1807  APTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
              P   I DL+ LRYLAL     G +   ++L    NLQTL V+ P+     ++       
Sbjct  564   FP-IAILDLVRLRYLALTIRRSGKLPISKLL----NLQTLTVR-PHPIYTSKLRRYSLPN  617

Query  1972  SKWLQGLWKSQSLRFIK-----YPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLK  2130
                  G+WK   LR +         P  +  +E+   V + + T+  +    CTKE    
Sbjct  618   -----GIWKLSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFEA  672

Query  2131  IPNVKVLGIKCSEIRAFQTETWW-DNLHYLTKLEKLIVE---DIESEQFEL---QSINSF  2289
             I  VK L I   +   FQ+E  W +NL YL +LE L V    D  S++       S  SF
Sbjct  673   IKKVKKLEI-AGKAEEFQSEMGWHNNLKYLKELEALNVTVPPDFISDRLPCLINPSPGSF  731

Query  2290  PQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG  2469
             P +LK+L +  T L W  + I S LPNLE L+L      G EW   + GFPKLK L +  
Sbjct  732   PSNLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEITEMGFPKLKCLLLED  791

Query  2470  AKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQ  2649
               L+ W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   LV  AK IQ
Sbjct  792   LYLRYWTATDDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQ  851

Query  2650  EEQSSYGNDQLVVRDYDT  2703
             E+    GN+ L V  +D+
Sbjct  852   EKHEELGNNLLKVYAFDS  869



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score =   431 bits (1109),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 480/895 (54%), Gaps = 105/895 (12%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEV--------MEIISN-----GASHERLHQILQRLAEDIE  396
             +D++ +VKD++ + EDE+ES +        ++I+         +HERL  ILQR  E+++
Sbjct  57    RDLLKKVKDVAHKVEDEVESHIWRGDHKTLLKILQRVFHLPTKAHERLLMILQRAIEEVD  116

Query  397   GLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAI---MVGHAQELERTKEMLLQCS  567
              + E+ N  +  ++ N  ++    +    + +L    +   MVGH  E E  +  L   S
Sbjct  117   SVKEELNKLKDNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGHNIEQELMRGQLTGNS  176

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDL---CG  738
             +Q  +VISI GMGGIGK+T AK++++DPSI S F + GW TVS+DY+LR++L  L    G
Sbjct  177   SQ-LEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKDYNLRKMLLSLLQDAG  235

Query  739   CVAQMTDKE-------------------------------INEV-------KSTAELANK  804
               A++  K                                I++V       KS  ELA+ 
Sbjct  236   INAELDKKSDIGEHREEEEEEGGGQEEEGNLKKKKKKKKKISDVQLANRMQKSDGELADL  295

Query  805   VRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVC  984
             +++ L  +RYL+VVDDIW +  WD+ +  FP+ +N SRILLTTR  +VA Y+    +   
Sbjct  296   LQKSLKGRRYLIVVDDIWSTEAWDEFRLWFPEYNNRSRILLTTRDIKVAQYASYP-RDPS  354

Query  985   NLPFLNSNESWMLFSQKLGSINLPP-EIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSV  1161
              + FL   ESW LF QK     + P E + I +++V  C GLPL I+V AG LS +KR++
Sbjct  355   PMRFLKPEESWTLFCQKAFDQKVCPIEFKNIARKVVKNCNGLPLMISVVAGALS-SKRTL  413

Query  1162  ENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLL  1341
             + W+ +A +++L +  D + +CS +L LSYN+LP HLKACFLYFG+FPK   EI  K L+
Sbjct  414   DEWRKVAQSVSLLVNLDDYQRCSGVLALSYNHLPSHLKACFLYFGVFPKA-SEISVKKLI  472

Query  1342  NLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLR  1521
              LW+ EGF+       LE+ A   L +LID++LV++ K S    IKTCR+HDLL DLCLR
Sbjct  473   RLWVAEGFLELKGFEGLEKVATNLLSNLIDKSLVVVGKRSLNDKIKTCRIHDLLHDLCLR  532

Query  1522  EVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK---FSD-KYNFHKSR  1689
             E + E  +   +     V +   +  +    +RW++     + PK   FS  ++N  K+R
Sbjct  533   EAESENLL---YVTETPVTKYEGSREVSSKVHRWVS-----VYPKGGRFSPIRFNCRKTR  584

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIK  1869
             +L  +  ++  S   +       FK++RVL+L + S+ E P+ ++  L+ LRYLA+   +
Sbjct  585   SLQVYSYITEHSRSKLRLDH---FKLLRVLEL-KTSWYEFPS-EVVHLVALRYLAVKVSR  639

Query  1870  YVRVLK--HHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG-LWKSQSLRFIK----YP  2028
               + L   +  NLQT I  FP +         E  G  +L   +W+   LR ++    Y 
Sbjct  640   SPKDLPIFNLKNLQTFI--FPQN-------MPEYQGVIYLPSEIWEMSQLRHLRSTRMYL  690

Query  2029  Y-PFPIDTDEIPVQDTLHTLYWVPYLR---CTKEFVLKIPNVKVLGIKCSEIRAFQTETW  2196
             Y P P+ +D       L  L  V  L    CTKE    I  VK LGI  ++         
Sbjct  691   YSPPPMVSDNEVKYRALENLQSVSGLIPRCCTKEIFEGIKKVKKLGIYGTKDDFNIEPRC  750

Query  2197  WDNLHYLTKLEKLIV---EDIESEQF-ELQSINSFPQSLKELKIVGTELGWEAITIISML  2364
              +NL  L +LE L +      +++ F  L    SFP +LK+L +  T L W+ +TI+SML
Sbjct  751   LENLMDLFELEALTIVSYRKFKADTFLRLPCPGSFPPNLKKLTLCCTFLLWKDMTIVSML  810

Query  2365  PNLESLKLL-QAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHC  2541
             P L+ L+L   A+     W   +  FPKLKFL +    ++ W    D FP LER+ + +C
Sbjct  811   PKLKVLQLRNNAFVPNIVWEVTEMQFPKLKFLLLEQLNIRYWRATDDCFPCLERIIIRNC  870

Query  2542  HNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDT  2703
               L++IP+ F D  TLQLIEL  C PSLV SA+ IQ+EQ  S GN+ L V  +DT
Sbjct  871   RFLKEIPQEFADSMTLQLIELHQCSPSLVNSAELIQKEQLESLGNNMLKVYAFDT  925



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score =   429 bits (1103),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 280/736 (38%), Positives = 407/736 (55%), Gaps = 71/736 (10%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             QVI IVGMGGIGKTT+A   Y DP +   F +  W TVSQDY  ++++  L   + ++ +
Sbjct  173   QVIPIVGMGGIGKTTLATNAYQDPLVIENFMIRAWVTVSQDYSPQKVVSSLVDSMKELIN  232

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E    +S  E   KV + L   +YL+V+DD+W +  WDD++  FPD++NGSR++LTTRL
Sbjct  233   TERYRGESDEE---KVYKCLKGMKYLIVMDDVWSTEAWDDVRMIFPDENNGSRVVLTTRL  289

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
              +VA Y   S   +  +  +N+++SW L   ++   G +  P E+E IGK I   CRGLP
Sbjct  290   LDVAAYVD-SSSLLHEMQLMNADQSWDLLRHRVFEQGPL-CPLELEGIGKEIAGSCRGLP  347

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             LAI V AGLLS   ++  +W+ IA  +   + +  H Q   I++LSY +LP+HL+ CFLY
Sbjct  348   LAIVVIAGLLSTVSKTRASWEKIAGNVKSAINATKHGQLEKIMSLSYTHLPHHLRPCFLY  407

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSG-RSLEEGAMKYLQDLIDRNLVLISKLSFI  1467
              G FP+  +EI  + L+ LW+ EGF+   +G +++EE A +YL+DL+ R+LVL+SK  F 
Sbjct  408   MGAFPE-DQEIHVQKLIRLWVGEGFLKYPNGSKTVEEAAEEYLEDLVKRSLVLVSKRKFN  466

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYI  1647
             G IK+CRLHDL+ +LC+R+ ++E+F+     +++                     R    
Sbjct  467   GKIKSCRLHDLMRELCIRKSQQERFLRHAMVKNQR--------------------RVCID  506

Query  1648  QPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD  1821
             Q   S   N + S  RT+L     S  S L         F+ +RVLDLV  +++    FD
Sbjct  507   QSNLSFLENIYGSTTRTILCLMH-SEISSLGCLRH----FRFLRVLDLV-FAYNHRRMFD  560

Query  1822  ----------ISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
                       + +L  LRYLA    ++  R + +  NLQTLI+      R          
Sbjct  561   SEEVASLPPQVFELFHLRYLAFSYAVEIPRAVSNLQNLQTLIIYLGTKFRYRPSTV----  616

Query  1969  GSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDT--------LHTLYWVPYLRCTKEFV  2124
               +    +W+   LR +     F  D    P Q++        L TL  V  L+CT+  +
Sbjct  617   --RLPSEIWRMPQLRHL---ICFNFDQLPDPHQESEITRALLNLQTLSRVRNLKCTETIM  671

Query  2125  LKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLK  2304
               IPNVK LGI  SE + ++ E   +NL +L  L  L +    +  F  +S+N FPQ+LK
Sbjct  672   KMIPNVKKLGIFYSEDK-YKQEYHLENLVHLQNLVNLKLTVRANLSFPNKSLN-FPQTLK  729

Query  2305  ELKIVGTELGWEAITI-ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             +L + G  L W++  + I  LPNL+ LKL      G  W T DGGFP+L+FL I  + L+
Sbjct  730   KLSLSGESLPWQSTMMSIGSLPNLQVLKLRNY--CGYAWKTSDGGFPELEFLLIESSDLR  787

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
             +W T SDHFP L+ L L HC +L +IP+   +I TLQLIE+K    SL ESAK IQEEQ 
Sbjct  788   HWITESDHFPSLKWLLLRHCEHLREIPDAIGEIPTLQLIEVKGGSASLFESAKGIQEEQQ  847

Query  2662  SYGNDQLVVRDYDTRS  2709
             S+GN+ L VR  + RS
Sbjct  848   SWGNEALQVRCIEFRS  863



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score =   432 bits (1110),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 298/826 (36%), Positives = 436/826 (53%), Gaps = 77/826 (9%)
 Frame = +1

Query  325   EIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQD-  501
             E+  N    E LH+I++++   +E +I+ R+ ++        Q    ++ + G+S   D 
Sbjct  163   EVQFNSQEIEALHKIIEKVGSVVEKMIKIRDESEA-----DDQKPMRNLSSAGSSPTGDF  217

Query  502   -----DAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSR  666
                    ++VG   +LE  +  L   S++ R ++SIVGMGGIGKTT+A++ YDD  I   
Sbjct  218   SVGSGKNVVVGFESDLEEMRTRLTGASSK-RDIVSIVGMGGIGKTTLARQAYDDSYIVYH  276

Query  667   FHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVV  846
             F    W TVSQ+Y LR++L  L      +T+K  +  K   ELA+ + + L+ +RYL+V+
Sbjct  277   FDTRAWVTVSQEYSLRQVLIGLLDSAKILTEKMYD--KREEELADCLYKGLVGRRYLIVM  334

Query  847   DDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKY--VCNLPFLNSNESWM  1020
             DDIW ++ WD ++R FP+D NGSRILLTTRL +VA+   C+  +  +  + FL   ESW 
Sbjct  335   DDIWDTQIWDAVRRFFPNDCNGSRILLTTRLSDVAL---CADSFSPLHKMQFLKEGESWN  391

Query  1021  LFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNL  1197
             L  +K+ G  + P E+E+IGK I   C GLPLAI V  GLLSK  R  E W+++A  ++ 
Sbjct  392   LLCKKVFGEKDCPRELEDIGKAIARNCGGLPLAIVVIGGLLSKESRRQEYWRNLAENLSS  451

Query  1198  PMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMED  1377
              +T D  DQC  IL LSYN LP  L+ACFLY  +FP+   EIP   L+ LW  EGF+  +
Sbjct  452   IVTKD-DDQCLKILGLSYNRLPQRLRACFLYMAVFPE-DYEIPVAKLIRLWAAEGFLKPN  509

Query  1378  SGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFH  1557
             + +SLE+ A +YL DLI+RNL+L+SK S  G I+TC +HDLL +LC R  +KEKF+   +
Sbjct  510   ASKSLEDLAEEYLDDLIERNLILVSKRSANGKIRTCNIHDLLRNLCSRNARKEKFLYMVN  569

Query  1558  QRSENVIELGDTEPLFEYAN---------RWLTFRTTY--IQPKFSDKYNFHKSRTLLFF  1704
              + +NV++ G        +N         R L+       IQ +   K   H S      
Sbjct  570   CK-DNVLKQGVNITPHRLSNPPRRLSIPPRRLSIHPDLLSIQSQILYKSEIHNSSAHSLL  628

Query  1705  FGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RV  1881
                +GA  +  S    + ++++RVLDL+ + F   P  +I+ L+ LRYLA    + +   
Sbjct  629   --CTGARLIYPSCVY-LGYRLLRVLDLIIVRFFHFPA-EITKLVHLRYLAFTYNEALPPS  684

Query  1882  LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG--------LWKSQSLRFIKY-PYP  2034
             +    NLQTL+                     W  G        +W    LR +   P  
Sbjct  685   IAELWNLQTLVYH------------------NWTFGKCPVFPVEIWMMPKLRHLCITPCR  726

Query  2035  FPIDTD-EIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWD---  2202
              P+  +  + V   L TL  V  LRC+ +   +IPN+K LGI         +E W     
Sbjct  727   LPVPQNVRMLVLGNLQTLSEVRNLRCSVDIFKRIPNLKELGI---SYEVSPSENWSKYQL  783

Query  2203  ----NLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPN  2370
                 NLH L  L+ L      + +       +FP+ LK L + G  + W ++TI+  LPN
Sbjct  784   EALVNLHQLETLKLLFKYSSHASEIVNPPKLAFPEKLKRLILAGCGIPWSSMTIVGALPN  843

Query  2371  LESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNL  2550
             LE LKL +    G EW   +  F +LK L +    L  W     HFP L+RL +  C+ L
Sbjct  844   LEVLKLRKNACQGIEWEPVEEQFCQLKHLLLEEVDLVQWVANETHFPRLQRLVIRSCYKL  903

Query  2551  EKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             ++IP G  +I TL+LIEL DC  S V SA+ IQEEQ   GN++L V
Sbjct  904   KEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGLGNEELKV  949



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score =   428 bits (1100),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 317/908 (35%), Positives = 478/908 (53%), Gaps = 77/908 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TS++ T+E Q L+  P L+ + +  I  L   L  L+  LE +   +N  +A K
Sbjct  1     MAYAVITSILTTIE-QVLQFNPSLISESRGSIDSLYGTLSFLQDFLENTGNWINDQEALK  59

Query  259   DVIARVKDISFRAEDEIESEVMEII-------SNGASHERLHQILQRLAEDIEGL-----  402
              +   ++D  ++AED I+  +  I         N A H +L+  LQ + E ++ +     
Sbjct  60    ILEKNIRDAGYKAEDTIDGCLRRIHVADTDHNQNNARH-KLYDELQEILEAMDSIQRDVM  118

Query  403   ----IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                 + +R      ++Y P +S+           L ++  +VG        ++ L    T
Sbjct  119   KFKNVHKRIKDVPATTYLPPRSS--------GRVLDEENTLVGMEDVFNNIRDQLFG-QT  169

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
                 V+SIVGMGGIGK+T+A+ +++ PS+  RF +  W TVSQ  D + +L D+      
Sbjct  170   PALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSWVTVSQACDAKEMLLDVLS-FGT  228

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
                K +    S  EL ++V R+L R+RYL+V+DD+W    WD ++R FPDD NGSRI++T
Sbjct  229   PGGKAMYRDMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMIT  288

Query  931   TRLKEVAVYSGCSGKYVC--NLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCR  1101
             TRL EVA    C+G      ++PFL+  +SW L S K+ G+ + PP++EE+GK+I  +C+
Sbjct  289   TRLLEVA---NCAGNDFPPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQ  345

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GL L++ V AGLLSK  R+ ++WQ IA  +N  + S    QC  IL LSYN LP  LKAC
Sbjct  346   GLALSVVVIAGLLSKINRTYDDWQQIADNVNSHIGST-SQQCLAILALSYNYLPCSLKAC  404

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLY G F +   EIPT  L+ +W+ EGF+     +  EE A + L+DL+ R+L++++   
Sbjct  405   FLYMGFFLE-DAEIPTDTLIRIWVAEGFLKTICHKKPEEVAEECLEDLVSRSLIMVNSRG  463

Query  1462  FI-GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             ++ G I++CR+HDL+  LCLR+ K EKF    ++  E   E  ++E      +R L +  
Sbjct  464   WVSGKIRSCRIHDLIRQLCLRKGKTEKFFHVINECYEVSSEGVESE------HRLLLYED  517

Query  1639  TYIQPKFS-DKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS--FKMIRVLDLVEISFDEA  1809
                       + N    RT+L        S L   + + V   F+++RVLD++ I F   
Sbjct  518   AVRNQNLGLQEGNLDSVRTILCICE-PCTSMLEFEYYKIVDTRFQLLRVLDVLMILFRRF  576

Query  1810  PTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             PT +I+ L+ LRYLA  T   V   + +  NLQTLIV+ P   ++            W  
Sbjct  577   PT-EITQLVHLRYLAFLTGGDVPTSISNLWNLQTLIVE-PTENQL-----------SWPV  623

Query  1987  GLWKSQSLRFIK-----YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVL  2151
              +WK  SL++ +      P P P     I   +    L         KE  + +PNV+ L
Sbjct  624   EIWKMSSLKYFQSGGMSMPVPAPPKAQHILGLEKFKKLSLNEASSNWKEICMAVPNVREL  683

Query  2152  GIKCS-EIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS-------FPQSLKE  2307
              +  + +I       +  +L  L  L+KL ++ +E     L  I         FP++LK 
Sbjct  684   DVIINLDIHPNGWNDFIGSLICLVDLQKLSIQ-LEVSSHPLFFIRRPAQLWYVFPENLKS  742

Query  2308  LKIVGTELGWEAITIISMLPNLESLKL-LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKN  2484
             L +V T L W  + ++S LPNLE LKL    +E G  W   +GGF KLK L+I   +L +
Sbjct  743   LTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFE-GSNWNLDEGGFKKLKLLHIHQTRLVH  801

Query  2485  WETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSS  2664
             W+  SD  PVLE L L  C  LE+IP    DI TL+LI+L  C  + V SA++IQEEQ S
Sbjct  802   WQATSDSLPVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEIQEEQKS  861

Query  2665  YGNDQLVV  2688
              GN+ LVV
Sbjct  862   IGNEVLVV  869



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score =   429 bits (1102),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 316/901 (35%), Positives = 464/901 (51%), Gaps = 93/901 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+RT++       P+  ++ ++++EI  L +K+     +  ++ +K N S+ 
Sbjct  44    MAYPSIASLMRTIKSLLTSNSPVQSIICNHREEILALHEKVS-SLEVFLKNFEKSNASRK  102

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ A++K++    E  I+  + E+      I    +H+R    LQ++A+ I+ ++ + 
Sbjct  103   MTDLEAQIKEVVNVVEHTIQLRITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNES  162

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
             +                               MVG A + +R  + L +    E +VI I
Sbjct  163   SKD-----------------------------MVGRADQRKRLLDDLTRGFNDEPKVIPI  193

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+AK ++DD +IRS F +  WAT+S++++++ IL  L     +     I  
Sbjct  194   VGMGGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDG--IIH  251

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             ++   EL   +++ L  +RYL+V+DDIW +  WDD++ CFP ++ GSRILLTTR  EVA 
Sbjct  252   IEDETELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVAC  311

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAA  1131
              +G     +  L F+N +ESW LF   +  +  LP E E +GK+IV KC+GLPL   V A
Sbjct  312   SAGTENLSL-RLDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVA  370

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLLSK KR++E W+++A  +   + +D   QC  +L LSYN+L   LK C LYFGIFP+ 
Sbjct  371   GLLSKCKRTIEVWKNVAKDVKSFVKNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPE-  429

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS-FIGNIKTCR  1488
               EI  K L+ LW  EGF+        EE A K LQ+LIDR LVL+S+ S +   I++C+
Sbjct  430   DSEISVKRLVRLWTAEGFLKS------EEEAEKCLQELIDRCLVLVSRKSRYETKIRSCK  483

Query  1489  LHDLLFDLCLREVKKEKFVS-------------AFHQRSENVIE--LGDTEPLFEYANRW  1623
             +HDL+++LCLRE +K  F                +H  + + +   +G T+ +    + +
Sbjct  484   VHDLIYELCLREAEKRTFFVINDIVFNDEPNHVPYHHLNRHKMRRFMGWTDDILRRGS-Y  542

Query  1624  LTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFD  1803
                 T   + K  D  N    RT   F     +S   +   +   F +IR+LDL  I  +
Sbjct  543   RALLTPRHRRKTDDDDNNSLKRTRSIFSFCRDSSTFTLK-SELTHFNLIRILDLSCIKIN  601

Query  1804  EAPTFDISDLILLRYLAL----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
               P   I  LI LRYL L    G       +    NLQT IV                I 
Sbjct  602   IFPP-QILCLIWLRYLVLHSRRGVFNIPPEISRLWNLQTFIVG--------GYHLTSTIL  652

Query  1972  SKWLQGLWKSQSLRFIKYPYPFP--IDTDEIPVQD--TLHTLYWVPYLRCTKEFVLKIPN  2139
              + + GL + + L    +  P P  +  +E    D   LHT+  +    CTKE +  I N
Sbjct  653   PEQIWGLMQLRHLELSSFHLPNPPIVSVEEEKCLDFSNLHTISGLSLSCCTKEVISGIRN  712

Query  2140  VKVLGI-KCSEIRAFQTETWWDNLHYLTKLEKLIVE-------DIESEQFELQSINSFPQ  2295
             V+ L I +  E  +FQ    +DN  +L +LE L +E       D E     + SI SFP 
Sbjct  713   VRKLRINRGDEYESFQACRLFDNFVHLHQLETLSLELEFRGVLD-EISPATIPSIKSFPP  771

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
              LK+LK+ GT+L WE + II  LPNLE LKL +    GEEW   + GF +LK L I    
Sbjct  772   MLKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYND  831

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             LK W + +D+FPVLERL +  C  LE IP  F  I +LQ IEL DC P L  SA  IQ E
Sbjct  832   LKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHE  891

Query  2656  Q  2658
             Q
Sbjct  892   Q  892



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score =   429 bits (1102),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 316/901 (35%), Positives = 464/901 (51%), Gaps = 93/901 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+RT++       P+  ++ ++++EI  L +K+     +  ++ +K N S+ 
Sbjct  44    MAYPSIASLMRTIKSLLTSNSPVQSIICNHREEILALHEKVS-SLEVFLKNFEKSNASRK  102

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ A++K++    E  I+  + E+      I    +H+R    LQ++A+ I+ ++ + 
Sbjct  103   MTDLEAQIKEVVNVVEHTIQLRITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNES  162

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
             +                               MVG A + +R  + L +    E +VI I
Sbjct  163   SKD-----------------------------MVGRADQRKRLLDDLTRGFNDEPKVIPI  193

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+AK ++DD +IRS F +  WAT+S++++++ IL  L     +     I  
Sbjct  194   VGMGGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDG--IIH  251

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             ++   EL   +++ L  +RYL+V+DDIW +  WDD++ CFP ++ GSRILLTTR  EVA 
Sbjct  252   IEDETELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVAC  311

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAA  1131
              +G     +  L F+N +ESW LF   +  +  LP E E +GK+IV KC+GLPL   V A
Sbjct  312   SAGTENLSL-RLDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVA  370

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLLSK KR++E W+++A  +   + +D   QC  +L LSYN+L   LK C LYFGIFP+ 
Sbjct  371   GLLSKCKRTIEVWKNVAKDVKSFVKNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPE-  429

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS-FIGNIKTCR  1488
               EI  K L+ LW  EGF+        EE A K LQ+LIDR LVL+S+ S +   I++C+
Sbjct  430   DSEISVKRLVRLWTAEGFLKS------EEEAEKCLQELIDRCLVLVSRKSRYETKIRSCK  483

Query  1489  LHDLLFDLCLREVKKEKFVS-------------AFHQRSENVIE--LGDTEPLFEYANRW  1623
             +HDL+++LCLRE +K  F                +H  + + +   +G T+ +    + +
Sbjct  484   VHDLIYELCLREAEKRTFFVINDIVFNDEPNHVPYHHLNRHKMRRFMGWTDDILRRGS-Y  542

Query  1624  LTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFD  1803
                 T   + K  D  N    RT   F     +S   +   +   F +IR+LDL  I  +
Sbjct  543   RALLTPRHRRKTDDDDNNSLKRTRSIFSFCRDSSTFTLK-SELTHFNLIRILDLSCIKIN  601

Query  1804  EAPTFDISDLILLRYLAL----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
               P   I  LI LRYL L    G       +    NLQT IV                I 
Sbjct  602   IFPP-QILCLIWLRYLVLHSRRGVFNIPPEISRLWNLQTFIVG--------GYHLTSTIL  652

Query  1972  SKWLQGLWKSQSLRFIKYPYPFP--IDTDEIPVQD--TLHTLYWVPYLRCTKEFVLKIPN  2139
              + + GL + + L    +  P P  +  +E    D   LHT+  +    CTKE +  I N
Sbjct  653   PEQIWGLMQLRHLELSSFHLPNPPIVSVEEEKCLDFSNLHTISGLSLSCCTKEVISGIRN  712

Query  2140  VKVLGI-KCSEIRAFQTETWWDNLHYLTKLEKLIVE-------DIESEQFELQSINSFPQ  2295
             V+ L I +  E  +FQ    +DN  +L +LE L +E       D E     + SI SFP 
Sbjct  713   VRKLRINRGDEYESFQACRLFDNFVHLHQLETLSLELEFRGVLD-EISPATIPSIKSFPP  771

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
              LK+LK+ GT+L WE + II  LPNLE LKL +    GEEW   + GF +LK L I    
Sbjct  772   MLKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYND  831

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             LK W + +D+FPVLERL +  C  LE IP  F  I +LQ IEL DC P L  SA  IQ E
Sbjct  832   LKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHE  891

Query  2656  Q  2658
             Q
Sbjct  892   Q  892



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score =   427 bits (1098),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 318/861 (37%), Positives = 454/861 (53%), Gaps = 102/861 (12%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDIEGLIE  408
             K++ A+V+ I+  AEDE+ES++  ++     H+ LHQ         ILQR  E+++ L E
Sbjct  57    KNLHAKVRHIANEAEDEVESQMKVVMDE--QHDVLHQKEALESLSEILQRGIENVDSLKE  114

Query  409   Q-----RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML--LQCS  567
             +     +N T    +   G S+   +    A  L++D  MVG+  E      ML  L   
Sbjct  115   ELIKDSQNNTSQAGNSALGDSSSPRL---HALTLEND--MVGYNIE---QANMLSRLTSG  166

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA  747
             + E +VIS+ GMGGIGK+T AKK++  PSI S F + GW TVS+DY  R++L  L    A
Sbjct  167   SPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSEDYSYRKMLLGLL-VDA  225

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
              +  +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD++  C PDD   SR+LL
Sbjct  226   NIGKEEDLDKKSDSDLAVCLKQNLMGRRYLIVVDDIWSKNAWDEISLCLPDDGKRSRVLL  285

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRG  1104
             TTR  EVA Y+  S K    +  L+  +SW LF Q          E E++GK +   C G
Sbjct  286   TTRDVEVAQYAS-SPKDPFRMHLLDQEDSWNLFYQNAFIEKGFAIEFEDVGKEVAKNCNG  344

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPL I V A +LS +KR+++ W  +A +++     D + QCS +L LSYN+LP +LK CF
Sbjct  345   LPLMIAVVAKVLS-SKRTLDEWTKVAESVSSLAEVDAYQQCSGVLALSYNHLPSYLKGCF  403

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYFG+FPK   EI  + L+ LWI E  +       LEE A  +L DLID++LV++SK S 
Sbjct  404   LYFGLFPKAS-EISMEKLIRLWIAEALLKVRGMEGLEEVAASHLNDLIDKSLVIVSKRSM  462

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTE---PL--FEYANRWLT  1629
              G I TC +HDL+ D CL+E             S+N++ + +T+   PL       RW++
Sbjct  463   DGKIMTCMIHDLVHDFCLKEAD-----------SQNLLYIVNTDIDGPLGVIPEGCRWVS  511

Query  1630  FRT--TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFD  1803
              ++   Y   +F D   + K R+    F V+  + L V   ++  FK++RVLDL +    
Sbjct  512   QQSWGLYFHRRFPD-LAYSKLRS----FSVNSRTILNV---ESCHFKLLRVLDLEKKKIL  563

Query  1804  EAPTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
             + P   + DL+LLRYLAL     G +   ++L    NLQTLIV+ P+             
Sbjct  564   DFPV-AVLDLVLLRYLALMIRRSGKLPISKLL----NLQTLIVR-PHPIYT---------  608

Query  1969  GSKW-----LQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYW---------VPYLR  2106
              S W       G+WK   LR + + +   +DT +   ++ +  L           +P   
Sbjct  609   -SSWEMYSLPNGIWKLFQLRHL-HCWCMHLDTPQTVSENEVKNLVLENIQSVSGLIPSC-  665

Query  2107  CTKEFVLKIPNVKVLGIKCSEIRAFQTETWW-DNLHYLTKLEKLIVE---DIESEQFEL-  2271
             CTKE    I  VK L I   +   FQ+E  W +NL YL +LE L+V       S +    
Sbjct  666   CTKEIFEAIKKVKNLEI-AGKAEEFQSEMGWHNNLKYLKELEALMVTVPPGFISNRLPCL  724

Query  2272  --QSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPK  2445
                S  SFP +LK+L +  T L W  + I S LPNLE L+L      G EW   + GFPK
Sbjct  725   INPSSGSFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNLACSGNEWEITEMGFPK  784

Query  2446  LKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSL  2625
             LK L +    L+ W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C   L
Sbjct  785   LKCLLLEDLYLRYWTATDDYFQCLERVCIRECKLLKEIPEGFADSVTLQLIELHKCRRPL  844

Query  2626  VESAKDIQEEQSSYGNDQLVV  2688
             V  AK IQE+    GN+ L V
Sbjct  845   VTFAKQIQEKHEELGNNMLKV  865



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   428 bits (1101),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 316/901 (35%), Positives = 464/901 (51%), Gaps = 93/901 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+RT++       P+  ++ ++++EI  L +K+     +  ++ +K N S+ 
Sbjct  44    MAYPSIASLMRTIKSLLTSNSPVQSIICNHREEILALHEKVS-SLEVFLKNFEKSNASRK  102

Query  253   EKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQR  414
               D+ A++K++    E  I+  + E+      I    +H+R    LQ++A+ I+ ++ + 
Sbjct  103   MTDLEAQIKEVVNVVEHTIQLRITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNES  162

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
             +                               MVG A + +R  + L +    E +VI I
Sbjct  163   SKD-----------------------------MVGRADQRKRLLDDLTRGFNDEPKVIPI  193

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+AK ++DD +IRS F +  WAT+S++++++ IL  L     +     I  
Sbjct  194   VGMGGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDG--IIH  251

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             ++   EL   +++ L  +RYL+V+DDIW +  WDD++ CFP ++ GSRILLTTR  EVA 
Sbjct  252   IEDETELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVAC  311

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAA  1131
              +G     +  L F+N +ESW LF   +  +  LP E E +GK+IV KC+GLPL   V A
Sbjct  312   SAGTENLSL-RLDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVA  370

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLLSK KR++E W+++A  +   + +D   QC  +L LSYN+L   LK C LYFGIFP+ 
Sbjct  371   GLLSKCKRTIEVWKNVAKDVKSFVKNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPE-  429

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS-FIGNIKTCR  1488
               EI  K L+ LW  EGF+        EE A K LQ+LIDR LVL+S+ S +   I++C+
Sbjct  430   DSEISVKRLVRLWTAEGFLKS------EEEAEKCLQELIDRCLVLVSRKSRYETKIRSCK  483

Query  1489  LHDLLFDLCLREVKKEKFVS-------------AFHQRSENVIE--LGDTEPLFEYANRW  1623
             +HDL+++LCLRE +K  F                +H  + + +   +G T+ +    + +
Sbjct  484   VHDLIYELCLREAEKRTFFVINDIVFNDEPNHVPYHHLNRHKMRRFMGWTDDILRRGS-Y  542

Query  1624  LTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFD  1803
                 T   + K  D  N    RT   F     +S   +   +   F +IR+LDL  I  +
Sbjct  543   RALLTPRHRRKTDDDDNNSLKRTRSIFSFCRDSSTFTLK-SELTHFNLIRILDLSCIKIN  601

Query  1804  EAPTFDISDLILLRYLAL----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
               P   I  LI LRYL L    G       +    NLQT IV                I 
Sbjct  602   IFPP-QILCLIWLRYLVLHSRRGVFNIPPEISRLWNLQTFIVG--------GYHLTSTIL  652

Query  1972  SKWLQGLWKSQSLRFIKYPYPFP--IDTDEIPVQD--TLHTLYWVPYLRCTKEFVLKIPN  2139
              + + GL + + L    +  P P  +  +E    D   LHT+  +    CTKE +  I N
Sbjct  653   PEQIWGLMQLRHLELSSFHLPNPPIVSVEEEKCLDFSNLHTISGLSLSCCTKEVISGIRN  712

Query  2140  VKVLGI-KCSEIRAFQTETWWDNLHYLTKLEKLIVE-------DIESEQFELQSINSFPQ  2295
             V+ L I +  E  +FQ    +DN  +L +LE L +E       D E     + SI SFP 
Sbjct  713   VRKLRINRGDEYESFQACRLFDNFVHLHQLETLSLELEFRGVLD-EISPATIPSIKSFPP  771

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
              LK+LK+ GT+L WE + II  LPNLE LKL +    GEEW   + GF +LK L I    
Sbjct  772   MLKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYND  831

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             LK W + +D+FPVLERL +  C  LE IP  F  I +LQ IEL DC P L  SA  IQ E
Sbjct  832   LKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHE  891

Query  2656  Q  2658
             Q
Sbjct  892   Q  892



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score =   426 bits (1096),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 313/869 (36%), Positives = 449/869 (52%), Gaps = 100/869 (12%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISN-------------GASHERLHQILQRLAEDIE  396
             KD+  +VKD++ + E+++ES +                     SHERL++IL +   D++
Sbjct  55    KDLQKKVKDLAIKVEEQVESHIQRRAEKTLLKMLQRVFHLPSKSHERLYKILLQAICDVD  114

Query  397   GLIEQRNTTQMLSSYNPGQSNQEHIIAGGAS-KLQDDAI---MVGHAQELERTKEMLLQC  564
               I+++   QM    N       H I G +S +L    +   MVG+  E E  +  L   
Sbjct  115   S-IKEKLIKQM---KNNKLQAVNHSIGGSSSPRLHVSTLVNDMVGYNIEQEHMRSQLTGH  170

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQDL  732
             S+Q  +VISIVGMGGIGK+T A K++ DPSI S F + GW TVS +Y LR+    +LQD 
Sbjct  171   SSQ-LEVISIVGMGGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDT  229

Query  733   CGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
              G       KE++E K+  ELA+ +++ L  +RYL+VVDD+W    WDD++ CFP+++N 
Sbjct  230   VGAA-----KELDE-KTDGELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNR  283

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIV  1089
             SRILLTTR  +VA Y+  S K +  + FL   ESW LF QK+ G+ + P E E + K +V
Sbjct  284   SRILLTTRDMKVAQYAS-SPKDLFPMRFLEPKESWHLFCQKVFGNKDCPTEYENVAKEVV  342

Query  1090  NKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYH  1269
             + C+GLPL I+V AG LS +K++++ W  +A ++   +  D +  CS +L LSY +LP +
Sbjct  343   SNCKGLPLMISVVAGTLS-SKKTMDEWIKVAQSVISSVDLDDYQHCSRVLGLSYTHLPSY  401

Query  1270  LKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLI  1449
             LK+CFLYFG+FPK   EI  K L  LWI EG +       LE+ A   L  LID++LV++
Sbjct  402   LKSCFLYFGVFPKAS-EISVKKLTRLWIAEGLLELKGSEGLEQVAANILHVLIDKSLVVV  460

Query  1450  SKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLT  1629
             SK S    IKTCR+HDLL DLCLRE + E  +    + S  V   G          RW++
Sbjct  461   SKQSLDDKIKTCRIHDLLHDLCLREAESENLLYVACRGSTRVSSQG----------RWVS  510

Query  1630  FRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEA  1809
                      ++   N   S+     F  +      +S +    FK++RVLDLV I     
Sbjct  511   VNPERGYDSYALLENLTHSKIRSIHFHPTELVRRQLSIKL-FHFKLLRVLDLVAIRLVSF  569

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHHH-----NLQTLI----------VKFPNSCRie  1944
             P   +  L+ LRYLA+  +      +H       NLQT I          V  PN     
Sbjct  570   P-IGVVHLVSLRYLAV--VVNFETSEHQSISNLWNLQTFIFSISLPQIDLVHLPN-----  621

Query  1945  eidsdeeiGSKWLQGLWKSQSLRFIKYP-----YPFPIDTDEIP--VQDTLHTLYWVPYL  2103
                           G+W+   LR +         P  +  +E+   + + L ++  +   
Sbjct  622   --------------GIWEMSQLRHLHSTRMSLFSPPKVSANEVKYRILENLQSVSGLSPC  667

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFE----L  2271
              CTKE    I NV+ LGI  +E          DNL YL +LE+L +      +++    L
Sbjct  668   CCTKEIFEGIKNVRKLGISGTEDEFDYEPICLDNLIYLPELEELKIASYILTRYDVLLRL  727

Query  2272  QSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----LQAYEMGEEWVTGDGG  2436
                 SFP +LK+L +  T L WE +TIIS LP LE L+L     + +Y     W   + G
Sbjct  728   PFAGSFPPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAFVISYPTDTVWEVTEMG  787

Query  2437  FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCF  2616
             F +LKFL +    L  W    D+FP LE + + +C  L++IPEGF D  TLQ I+L  C 
Sbjct  788   FLELKFLLLEWLDLDYWRAADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCT  847

Query  2617  PSLVESAKDIQEEQSSYGNDQLVVRDYDT  2703
              SLV  AK IQE   S GN+ L V  +DT
Sbjct  848   SSLVTFAKQIQENYESLGNNMLKVYSFDT  876



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score =   427 bits (1097),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 313/869 (36%), Positives = 449/869 (52%), Gaps = 100/869 (12%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISN-------------GASHERLHQILQRLAEDIE  396
             KD+  +VKD++ + E+++ES +                     SHERL++IL +   D++
Sbjct  55    KDLQKKVKDLAIKVEEQVESHIQRRAEKTLLKMLQRVFHLPSKSHERLYKILLQAICDVD  114

Query  397   GLIEQRNTTQMLSSYNPGQSNQEHIIAGGAS-KLQDDAI---MVGHAQELERTKEMLLQC  564
               I+++   QM    N       H I G +S +L    +   MVG+  E E  +  L   
Sbjct  115   S-IKEKLIKQM---KNNKLQAVNHSIGGSSSPRLHVSTLVNDMVGYNIEQEHMRSQLTGH  170

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQDL  732
             S+Q  +VISIVGMGGIGK+T A K++ DPSI S F + GW TVS +Y LR+    +LQD 
Sbjct  171   SSQ-LEVISIVGMGGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDT  229

Query  733   CGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
              G       KE++E K+  ELA+ +++ L  +RYL+VVDD+W    WDD++ CFP+++N 
Sbjct  230   VGAA-----KELDE-KTDGELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNR  283

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIV  1089
             SRILLTTR  +VA Y+  S K +  + FL   ESW LF QK+ G+ + P E E + K +V
Sbjct  284   SRILLTTRDMKVAQYAS-SPKDLFPMRFLEPKESWHLFCQKVFGNKDCPTEYENVAKEVV  342

Query  1090  NKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYH  1269
             + C+GLPL I+V AG LS +K++++ W  +A ++   +  D +  CS +L LSY +LP +
Sbjct  343   SNCKGLPLMISVVAGTLS-SKKTMDEWIKVAQSVISSVDLDDYQHCSRVLGLSYTHLPSY  401

Query  1270  LKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLI  1449
             LK+CFLYFG+FPK   EI  K L  LWI EG +       LE+ A   L  LID++LV++
Sbjct  402   LKSCFLYFGVFPKAS-EISVKKLTRLWIAEGLLELKGSEGLEQVAANILHVLIDKSLVVV  460

Query  1450  SKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLT  1629
             SK S    IKTCR+HDLL DLCLRE + E  +    + S  V   G          RW++
Sbjct  461   SKQSLDDKIKTCRIHDLLHDLCLREAESENLLYVACRGSTRVSSQG----------RWVS  510

Query  1630  FRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEA  1809
                      ++   N   S+     F  +      +S +    FK++RVLDLV I     
Sbjct  511   VNPERGYDSYALLENLTHSKIRSIHFHPTELVRRQLSIKL-FHFKLLRVLDLVAIRLVSF  569

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHHH-----NLQTLI----------VKFPNSCRie  1944
             P   +  L+ LRYLA+  +      +H       NLQT I          V  PN     
Sbjct  570   P-IGVVHLVSLRYLAV--VVNFETSEHQSISNLWNLQTFIFSISLPQIDLVHLPN-----  621

Query  1945  eidsdeeiGSKWLQGLWKSQSLRFIKYP-----YPFPIDTDEIP--VQDTLHTLYWVPYL  2103
                           G+W+   LR +         P  +  +E+   + + L ++  +   
Sbjct  622   --------------GIWEMSQLRHLHSTRMSLFSPPKVSANEVKYRILENLQSVSGLSPC  667

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFE----L  2271
              CTKE    I NV+ LGI  +E          DNL YL +LE+L +      +++    L
Sbjct  668   CCTKEIFEGIKNVRKLGISGTEDEFDYEPICLDNLIYLPELEELKIASYILTRYDVLLRL  727

Query  2272  QSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----LQAYEMGEEWVTGDGG  2436
                 SFP +LK+L +  T L WE +TIIS LP LE L+L     + +Y     W   + G
Sbjct  728   PFAGSFPPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAFVISYPTDTVWEVTEMG  787

Query  2437  FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCF  2616
             F +LKFL +    L  W    D+FP LE + + +C  L++IPEGF D  TLQ I+L  C 
Sbjct  788   FLELKFLLLEWLDLDYWRAADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCT  847

Query  2617  PSLVESAKDIQEEQSSYGNDQLVVRDYDT  2703
              SLV  AK IQE   S GN+ L V  +DT
Sbjct  848   SSLVTFAKQIQENYESLGNNMLKVYSFDT  876



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score =   426 bits (1095),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 317/914 (35%), Positives = 487/914 (53%), Gaps = 83/914 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  + SLI T+E +  +   IL    K++I+CL  K+  L+  LE+  +K   S+  K
Sbjct  1     MAYASVVSLIETLE-EIRDGHEILY--NKEQIECLLSKVSFLQTFLEDFSQKN--SKEVK  55

Query  259   DVIARVKDISFRAEDEIESEVMEIISN------GASHERLHQILQRLAEDIEG----LIE  408
             ++  +++D ++ A++ I+S +   + +        S+    + LQR+ E+ +     ++E
Sbjct  56    ELETQIRDAAYAAQNMIDSYISNQLLSMCECCVDRSYTVFCEELQRVVENFDSAKLQVME  115

Query  409   QRNT-TQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
              RN  ++ L+  N   +    + +GG +       MVG   E+ + K+ L    + +  V
Sbjct  116   FRNMGSKNLAPKNSFSAGSLRLASGGKNS------MVGFVDEMLQIKDRLTGQPSYKLDV  169

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             ISIVGMGG GKTT+A+ +YDD  I   F+   W T+SQ+Y LR IL  L   + ++T K+
Sbjct  170   ISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWVTISQEYHLREILLGLLMSMKKLTGKK  229

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
               +  S  ELA  + + L  +RYL+V+DD+W  + W++++  FPDD NGSRI+LT+R+ +
Sbjct  230   CED--SYEELAEYLYKSLKGRRYLIVLDDMWDIQVWNEIKLLFPDDGNGSRIILTSRISD  287

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA+Y+  S     N+ FLN+NESW L  +K+    N P E+E +GK+I   C+GLPLAI 
Sbjct  288   VALYAS-SNSPPYNIRFLNNNESWDLLKEKVFQDENCPTELEGLGKKIARSCQGLPLAIL  346

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLH-DQCSTILTLSYNNLPYHLKACFLYFGI  1299
             +  GLL+K +R+  +W+++A   N+P     H DQC  IL+LSYN+LP HLK CFLY G+
Sbjct  347   LVGGLLAKIQRTQNHWRNVAE--NVPSIISTHNDQCLEILSLSYNHLPQHLKMCFLYMGV  404

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FP+   +IP   L+ LW  EGF+      SL++   KYLQDLIDR++VL+SK    G I+
Sbjct  405   FPE-DYQIPVSKLIRLWAAEGFLKPCGDESLDDVGEKYLQDLIDRSIVLVSKRKLSGKIR  463

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL---------TF  1632
             TC +HDL+ DLC+RE +KEKF+     R+    +   +E  F Y    L         +F
Sbjct  464   TCSIHDLVRDLCVREAQKEKFI-----RTIKTDDDLSSEDAFGYRRLCLHSSILHDDASF  518

Query  1633  RTTYI-------QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE  1791
             R   +         +  + Y+  +S  L+     +G    P++    + F ++RVLD + 
Sbjct  519   RRDSVIAVREHSDGRLKEIYDAMRSSPLIHCLIFTGTYHKPLNIF--LRFGLLRVLDALS  576

Query  1792  ISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
             ++F   P  ++ +L+ LR+LAL    +  R++    NL+ LIV                 
Sbjct  577   VTFFWFP-IEVLELVNLRHLALTFDGELPRMVSDLQNLEILIVH----------QVFWGP  625

Query  1969  GSKWLQGLWKSQSLR--------FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFV  2124
              S     +W+   LR        F  YP       +   +++ L TL  +   R T++  
Sbjct  626   LSYLPLEIWRMPRLRHLEFKEVFFPNYPGTLYYGKNTFSLEN-LQTLVGIRDFRVTEDVY  684

Query  2125  LKIPNVKVLGIKCSEIRAFQTETW----WDNLHYLTKLEKLIVE--DIESEQFELQSINS  2286
               IPNVK L I     +   T  W     DNL +L +LE L     D   ++ +L  + +
Sbjct  685   KSIPNVKKLEIVYD--KNSNTTEWSLYCLDNLVHLHQLESLKCHFLDAHRQKPDLPDL-T  741

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYIS  2466
             FP  LKEL ++G E+  + +T I  L NLE LKL       +EW   +G F +LK L + 
Sbjct  742   FPSKLKELSLLGWEIPSKYMTTIGSLHNLEILKLRFCSLRDDEWELSEGEFYRLKILVLE  801

Query  2467  GAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
             G  +  W   +DHFP LE+L + HC  LE+IP GF DI TLQLI++ +   S   SA  I
Sbjct  802   GMNIVQWRAEADHFPSLEQLIIKHCRKLEEIPPGFGDIPTLQLIKVVEGSRSCESSAMQI  861

Query  2647  QEEQSSYGNDQLVV  2688
              E+Q S GN  L V
Sbjct  862   LEDQQSLGNYGLKV  875



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score =   426 bits (1094),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 339/924 (37%), Positives = 477/924 (52%), Gaps = 103/924 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSLI T++ LQ L     L       +  L +K+       +   + L+ S AE+
Sbjct  3     AYVALTSLIGTIQQLQLLHSNLNLGDTSLKSLNLLYEKV-------DSLHELLDNSDAEQ  55

Query  259   --DVIARVKDISFRAEDEIESE---VMEIISNG----ASHERLHQILQRLAEDI----EG  399
               ++ A VK I+   EDE+ES+   VM+   +G     + E L +ILQR  E +    EG
Sbjct  56    TENLHAEVKHIANEVEDEVESQMQVVMDEQHDGLHKQEALESLFEILQRAIEKVDSLKEG  115

Query  400   LIEQRNTTQML---SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCS-  567
             LI+      +    SS     S + H     A  L++D  MVG+  E      ML Q + 
Sbjct  116   LIKHSQNENLQAGNSSLCDSSSPRLH-----APTLEND--MVGYNIE---QANMLSQLTG  165

Query  568   -TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              +   +VIS+ GMGGIGK+T AK +   PSI S F + GW TVS+DY  R++L  L    
Sbjct  166   GSAPLEVISVTGMGGIGKSTFAKNLSSHPSILSFFDICGWVTVSEDYSFRKMLLGLLK-D  224

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
             A +  +E  E K+   LA+++++ L  +RYL+VVDDIW    WDD++ C PD    SR+L
Sbjct  225   ANIAKEEELENKNDQVLADRLKKGLKGRRYLIVVDDIWSKEAWDDIRLCLPDYGIRSRVL  284

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  S K    +  LN ++SW LF QK  + N  P E E +GK +   C+
Sbjct  285   LTTRDVEVAQYAS-SSKDPFRMHLLNPDDSWNLFYQKAFAENCFPVEFENVGKEVARNCK  343

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL I V A +LS +KR+++ W+ +A +++     D + QCS +L LSYN+LP +LK  
Sbjct  344   GLPLMIAVVAKILS-SKRTLDEWRKVAQSVSSLADVDAYRQCSGVLALSYNHLPSYLKGS  402

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYFG+FPK   EI    L+ LWI EG +       LE+ A  +L  LID++LV++SK S
Sbjct  403   FLYFGLFPKAS-EISVGKLIRLWIAEGLLKVKGMERLEKVAASHLDYLIDKSLVIVSKRS  461

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL---TF  1632
               G I TC +HDL+ D CLRE  ++  +  + + ++N         +F    RW+   + 
Sbjct  462   MDGEIMTCLIHDLVHDFCLREADRQSLL--YIENTDN----AGPGLVFPQGCRWILRKSE  515

Query  1633  RTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
             R+T+   +F   YN   S  R+L  +        L V+   +  FK++RVLD+ E  F +
Sbjct  516   RSTHFSSRF---YNLDHSKLRSLSLY---HSDMYLDVA---HFHFKLLRVLDMEENRFFD  566

Query  1807  APTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
              P   I DL+ LRYLAL     G +   ++L    NLQTL V+ P S             
Sbjct  567   FP-IAILDLVFLRYLALTFKRSGQLPISKLL----NLQTLTVR-PLS-----------YI  609

Query  1972  SKWLQGL----WKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
             S W   L    WK   LR       +++ P     +  +  V +++ T+  +    CTKE
Sbjct  610   SDWSMSLPNEIWKLSQLRHLHCWCMYLESPQTVSGNKVKNLVLESIQTVSGLTPSCCTKE  669

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVED-----IESEQFELQSIN  2283
                 I  VK L I         T  W +NL YL +LE L V       +       +SIN
Sbjct  670   VFEGIKKVKKLEIAGKAEEFHSTTGWENNLKYLKELETLNVAVWHRLVMFRSNAVPRSIN  729

Query  2284  ----SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLK  2451
                 SFP +LK+L + GT L W  + I S LPNLE L+L     +G EW   + GFPKLK
Sbjct  730   PSPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLK  789

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL +    L  W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C  SLV 
Sbjct  790   FLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVI  849

Query  2632  SAKDIQEEQSSYGNDQLVVRDYDT  2703
              A+ IQE     GN+ L V  +D+
Sbjct  850   FAEQIQETHEELGNNLLKVYAFDS  873



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score =   424 bits (1091),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 314/862 (36%), Positives = 445/862 (52%), Gaps = 97/862 (11%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESE---VMEIISNGASH----ERLHQILQRLAEDIEGLIEQR  414
             +D+  + +DI+  AEDE+ES+   VME   +G       E L +ILQR  E+++ L E+ 
Sbjct  57    EDLHEKARDIANEAEDEVESQMKVVMEEQHDGLHQKEALESLFEILQRGIENVDSLKEE-  115

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELE--------RTKEMLLQCS-  567
                  L  ++P  + Q      G S + D +    HA   E            ML Q + 
Sbjct  116   -----LIKHSPNNNLQ-----AGNSSIGDSSSPRLHAPTHENDMVGYNIEQANMLSQLTR  165

Query  568   -TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              + E +VIS+ GMGGIGK+T AKK++  PS+ S F + GW TVS+DY  R +L  L    
Sbjct  166   DSPELEVISVTGMGGIGKSTFAKKLFSHPSVLSFFDIRGWVTVSEDYSYRNMLLGLLE-D  224

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
             A +  +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+L
Sbjct  225   ANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVL  284

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  S K    +  L  ++SW LF QK       P E E++GK I   C+
Sbjct  285   LTTRDVEVAQYAS-SAKDPFRMHLLGPDDSWNLFYQKAFAEKGFPIEFEDVGKYIAKNCK  343

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL I V A  LS +KR++E W+ +A +++     D + QCS +L LSYN+LPY+LK C
Sbjct  344   GLPLMIAVVAKFLS-SKRTLEEWRKVAKSLSSLADVDAYQQCSEVLALSYNHLPYYLKGC  402

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYFG+FPK  + I  + L  LWI EG +       LEE A  +L  LID++LV++SK S
Sbjct  403   FLYFGLFPKASK-ISMERLKRLWIAEGLLKVKGMEGLEEVAASHLNYLIDKSLVIVSKRS  461

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF--EYANRWLTF-  1632
               G I  C +HDL+ D CL+E   +  +   +   +         PL+      RW++  
Sbjct  462   MDGKIIRCMIHDLVHDFCLKEADGQNLLYFVNTNIDG--------PLWFIPEGCRWMSLQ  513

Query  1633  -RTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEIS  1797
              R  Y +  F D             FG S      V+ +Q +     FK++RVLD+ +  
Sbjct  514   SRRFYFRRPFPD-------------FGYSKLRSFSVNCKQIILDRCHFKLLRVLDMEKRK  560

Query  1798  FDEAPTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsde  1962
                 P   I +L+LLRYLAL     G +   ++L    NLQTLIV+  ++          
Sbjct  561   ILHFP-IAILELVLLRYLALRIRKPGKLPISKLL----NLQTLIVRPIHTGIWGMYSLP-  614

Query  1963  eiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQD--------TLHTLYWVPYLRCTKE  2118
                     G+WK   LR + + +   +D+ ++  Q+         L T+Y +    CTKE
Sbjct  615   -------NGIWKLSQLRHL-HCWCMYLDSPQLASQNEAKNLILENLQTVYGLRPSCCTKE  666

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWW-DNLHYLTKLEKLIVEDIESEQFELQ------S  2277
                 I  VK L I   E + F +ET W +NL Y  +LE L V       F+        S
Sbjct  667   IFEGIKKVKKLEI-AGEAQEFNSETGWHNNLKYFEELEALKVTVSLYCGFDYPPCLINPS  725

Query  2278  INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFL  2457
               SFP +LK+L +  T L W  + I S LPNLE L+L      G+EW   + GFPKLKFL
Sbjct  726   SGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEITEMGFPKLKFL  785

Query  2458  YISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA  2637
              +    L  W+   D+F  LE + +  C  L++IPEGF D  TLQLIEL  C   LV  A
Sbjct  786   LLEDLLLIYWKATDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFA  845

Query  2638  KDIQEEQSSYGNDQLVVRDYDT  2703
             K IQE+    GN+ L V  +D+
Sbjct  846   KQIQEKHEELGNNMLKVYAFDS  867



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score =   424 bits (1091),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 314/862 (36%), Positives = 445/862 (52%), Gaps = 97/862 (11%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESE---VMEIISNGASH----ERLHQILQRLAEDIEGLIEQR  414
             +D+  + +DI+  AEDE+ES+   VME   +G       E L +ILQR  E+++ L E+ 
Sbjct  57    EDLHEKARDIANEAEDEVESQMKVVMEEQHDGLHQKEALESLFEILQRGIENVDSLKEE-  115

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELER--------TKEMLLQCS-  567
                  L  ++P  + Q      G S + D +    HA   E            ML Q + 
Sbjct  116   -----LIKHSPNNNLQ-----AGNSSIGDSSSPRLHAPTHENDMVGYNIEQANMLSQLTR  165

Query  568   -TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              + E +VIS+ GMGGIGK+T AKK++  PS+ S F + GW TVS+DY  R +L  L    
Sbjct  166   DSPELEVISVTGMGGIGKSTFAKKLFSHPSVLSFFDIRGWVTVSEDYSYRNMLLGLLE-D  224

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
             A +  +E  + KS ++LA  +++ LM +RYL+VVDDIW    WD+++ C PDD   SR+L
Sbjct  225   ANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVL  284

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  S K    +  L  ++SW LF QK       P E E++GK I   C+
Sbjct  285   LTTRDVEVAQYAS-SAKDPFRMHLLGPDDSWNLFYQKAFAEKGFPIEFEDVGKYIAKNCK  343

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL I V A  LS +KR++E W+ +A +++     D + QCS +L LSYN+LPY+LK C
Sbjct  344   GLPLMIAVVAKFLS-SKRTLEEWRKVAKSLSSLADVDAYQQCSEVLALSYNHLPYYLKGC  402

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYFG+FPK  + I  + L  LWI EG +       LEE A  +L  LID++LV++SK S
Sbjct  403   FLYFGLFPKASK-ISMERLKRLWIAEGLLKVKGMEGLEEVAASHLNYLIDKSLVIVSKRS  461

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF--EYANRWLTF-  1632
               G I  C +HDL+ D CL+E   +  +   +   +         PL+      RW++  
Sbjct  462   MDGKIIRCMIHDLVHDFCLKEADGQNLLYFVNTNIDG--------PLWFIPEGCRWMSLQ  513

Query  1633  -RTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEIS  1797
              R  Y +  F D             FG S      V+ +Q +     FK++RVLD+ +  
Sbjct  514   SRRFYFRRPFPD-------------FGYSKLRSFSVNCKQIILDRCHFKLLRVLDMEKRK  560

Query  1798  FDEAPTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsde  1962
                 P   I +L+LLRYLAL     G +   ++L    NLQTLIV+  ++          
Sbjct  561   ILHFP-IAILELVLLRYLALRIRKPGKLPISKLL----NLQTLIVRPIHTGIWGMYSLP-  614

Query  1963  eiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQD--------TLHTLYWVPYLRCTKE  2118
                     G+WK   LR + + +   +D+ ++  Q+         L T+Y +    CTKE
Sbjct  615   -------NGIWKLSQLRHL-HCWCMYLDSPQLASQNEAKNLILENLQTVYGLRPSCCTKE  666

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWW-DNLHYLTKLEKLIVEDIESEQFELQ------S  2277
                 I  VK L I   E + F +ET W +NL Y  +LE L V       F+        S
Sbjct  667   IFEGIKKVKKLEI-AGEAQEFNSETGWHNNLKYFEELEALKVTVSLYCGFDYPPCLINPS  725

Query  2278  INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFL  2457
               SFP +LK+L +  T L W  + I S LPNLE L+L      G+EW   + GFPKLKFL
Sbjct  726   SGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEITEMGFPKLKFL  785

Query  2458  YISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA  2637
              +    L  W+   D+F  LE + +  C  L++IPEGF D  TLQLIEL  C   LV  A
Sbjct  786   LLEDLLLIYWKATDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFA  845

Query  2638  KDIQEEQSSYGNDQLVVRDYDT  2703
             K IQE+    GN+ L V  +D+
Sbjct  846   KQIQEKHEELGNNMLKVYAFDS  867



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score =   426 bits (1094),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 322/955 (34%), Positives = 494/955 (52%), Gaps = 127/955 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  LTS + ++EL      P+L  +  K++I  L +++   +  L + E   + ++  
Sbjct  1     MAYAALTSAVCSLELFRQCNHPLLNNLQRKEQISSLSKRIIAFQEFLTDYETIKHRNERL  60

Query  256   KDVIARVKDISFRAEDEIESEVME-IISNGASHER-----LHQILQRLAEDIEGLI----  405
             K +  ++K  +++ ED ++S++ +  ++  A++ R     L + LQ   E++E +     
Sbjct  61    KMLEGKIKVKTYQVEDIVDSKLRKYFLAKNANYRRKAFEVLCKRLQVAIEEMEFIKKEVM  120

Query  406   ----EQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ  573
                 E+ +T +  S  +P +    H+     +  Q     VG   +LE+  + L      
Sbjct  121   KIKGEKISTLKFRSKVSPAR----HVSTSSPNVQQKP---VGFQDDLEKIIDRL-NGRPS  172

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
             E  +I+IVGM GIGKTT+AK+ Y+DPS+ +RF +  W TVSQ+Y    IL  L   V + 
Sbjct  173   ELDIITIVGMAGIGKTTLAKRAYNDPSVVNRFDVRAWITVSQEYKETDILFGLFYSVVRP  232

Query  754   TDKEINEV-----------------------KSTAELANKVRRRLMRQRYLLVVDDIWGS  864
             T+ EIN+                        +   E A++V++ L  +R+L+VVDD+W +
Sbjct  233   TN-EINQESDKQAADQLHGGQMTHSSKEMYERRNQETADRVKKSLKYKRFLIVVDDMWKT  291

Query  865   RGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-G  1041
               WD++   FPDD+ GSRI+LT+RL +VA Y+    +    L FL+++E W L  QKL G
Sbjct  292   DAWDNVSMLFPDDNQGSRIILTSRLIDVATYAN-PDRQPHRLNFLSNDEGWELLHQKLFG  350

Query  1042  SINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHD  1221
                 P E+EEIG+ I  KC+GLPLAI V AG LSK  ++ + W +IA ++   +  +   
Sbjct  351   KKGCPFELEEIGRSIAEKCQGLPLAIVVVAGHLSKMSKTTDCWNTIAESVGSVVNRE-PG  409

Query  1222  QCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEG  1401
             QC  IL LSYN LP HLKACFLY G FP+   EIP   L+ LW+ EGF+      ++EE 
Sbjct  410   QCLDILALSYNYLPQHLKACFLYMGAFPE-DFEIPVWKLIRLWVAEGFLNATGLTTMEEI  468

Query  1402  AMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIE  1581
             A + L+DLIDR+LVL  K S  G +KTC+LHD++ D CL E K++ F+    ++S +V+ 
Sbjct  469   AEECLEDLIDRSLVLAVKRSN-GKLKTCKLHDIMRDFCLEEAKRQNFLHFLKKQSLDVLS  527

Query  1582  LGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFF------FGVSGASGLPVSW  1743
              G T      A R ++F  + I   FS  Y+FH +  ++ F      F +S +S      
Sbjct  528   EGIT------ALRRVSFNCSTI---FSS-YSFHPTDPIVSFSRSILGFDISQSSIFSY--  575

Query  1744  RQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKF  1923
                + FK++RVLD+    F + P+ +I+ L+ LRYLAL + ++   +    +LQTLI+  
Sbjct  576   ---IDFKLLRVLDITSQHFPQFPS-EITQLVNLRYLALASSEFPPAVSQFWSLQTLILHV  631

Query  1924  PNSCRieeidsdeeiGSKWLQGLWKSQSLRF--IKYPYPFPIDTDE------IPVQDTLH  2079
                             S   + +WK  +LR   IK     P  T+E        V + L 
Sbjct  632   ------------YSRDSTLPREIWKMPNLRHLHIKPSICLPSQTNEERSGHNSLVLNNLQ  679

Query  2080  TLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIR------------AFQTETWWD-------  2202
             TL  +    CT +     P +K LGI C  +              + +E  W        
Sbjct  680   TLTNITLADCTTDVFSSTPKLKKLGI-CETVEYTYPVQIPWSDFLYTSENLWPYCSDTIS  738

Query  2203  --------NLHYLTKLEKL----IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAI  2346
                     NL  L +L+ L    +   ++  +  L  +++ P++LK+L +  T L WE++
Sbjct  739   DLWSDCLRNLALLPQLKALKIVGLTPPVQVPKLALH-LDALPENLKKLTLSFTYLPWESM  797

Query  2347  TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERL  2526
               +  LPNLE LKL      G +W   + GF  LK L I  + +K+W   +DHFPVLE L
Sbjct  798   ASLCRLPNLEVLKLKNYAFTGPKWEQVEEGFGSLKLLLIEISDIKHWSASNDHFPVLEHL  857

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L  C +L+ IP    DI TLQ+IEL++   S V SAK+IQEEQ S GN+ L VR
Sbjct  858   VLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQSMGNETLEVR  912



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score =   424 bits (1091),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 275/738 (37%), Positives = 394/738 (53%), Gaps = 69/738 (9%)
 Frame = +1

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATV------SQDYDLRRILQDLC  735
             +RQVI IVGMGGIGKTT+A++IY+DP I   F++  W T+      SQ Y +R +   L 
Sbjct  173   DRQVIPIVGMGGIGKTTLAERIYNDPFIIYHFYVRAWITIPQKHLMSQPYRVREMFLGLL  232

Query  736   GCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGS  915
              C A +T        S  EL  KV + L   RYL+V+DD+W +R WD L R  PDD NGS
Sbjct  233   KCFANVTYN--TSQMSNEELGEKVYKALKGMRYLVVLDDMWQTRDWDILTRFLPDDKNGS  290

Query  916   RILLTTRLKEVAVY--SGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRI  1086
             RI+LT+RL ++A Y     SG +   + FL + ESW L   KL    + P E+ E+GKRI
Sbjct  291   RIMLTSRLGDIAAYVDPTSSGHH---MHFLQAAESWELLESKLFPKESCPQELIEVGKRI  347

Query  1087  VNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPY  1266
               KC+GLPLAI V AG+LSK  ++  +W  +A +++  + ++  + C  IL LSYN LP 
Sbjct  348   AVKCQGLPLAIVVVAGILSKMDKTPGSWTRLAESVDQSIVAEDPEHCMNILALSYNYLPN  407

Query  1267  HLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVL  1446
              LKACFLY G FPK   EIP   L+ LWI EGFV+    + LE+ A  YL+DL++RNL+L
Sbjct  408   FLKACFLYMGAFPK-DYEIPVSRLIWLWIAEGFVLPVRSKCLEDVANDYLEDLVNRNLIL  466

Query  1447  ISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEP---------  1599
             + K    G IKTCR+HDLL DLC+ E + E F+    +R      +G   P         
Sbjct  467   VGKRRLNGRIKTCRIHDLLRDLCMIEARNENFLHVI-ERYAQAFLMGAVAPRRISLLHAN  525

Query  1600  LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL  1779
             +  +  R +    +++       Y+  K+   +F   V             + FK++RVL
Sbjct  526   IVHFKVRPMPLTRSFLL------YDIQKNLPDMFLLEV----------MDRLDFKLLRVL  569

Query  1780  DLVEISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeids  1956
             D+  +  +  P  +I +LI LRYLAL    +  R +    NLQTLI+             
Sbjct  570   DIELLQSNHFP-IEIVELIHLRYLALAINCELPRSIFKLQNLQTLIID------------  616

Query  1957  deeiGSKWLQGLWKSQSLRFIK------YPYPFPIDTDEIPVQDTLHTLYWVPYL----R  2106
                 G    + +W    LR I+      +P P+     E   Q  L  L  +  L     
Sbjct  617   HIWEGQYLPREIWMMPQLRHIRLKRGCYFPLPYSRGIKE-KSQFVLQNLQTISTLTGPFS  675

Query  2107  CTKEFVLKIPNVKVLGIKCSEI--RAFQTETWWDNLHYLTKLEKLIVEDI-ESEQFELQS  2277
             C+KE    +P +K L I  +E   +A QT  ++ NL  L  LE L    +    +  L S
Sbjct  676   CSKEVFACLPALKKLEIFATESNSKAEQTSEYFSNLASLNLLETLKCSFLYRPRKHRLPS  735

Query  2278  INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFL  2457
              + FP +LK+L + G+ L WE +  +++LP LE LKL      G+ W   +GGF +LK L
Sbjct  736   GDHFPANLKKLTLSGSFLPWEDMAKLAVLPKLEVLKLRSFAFEGQIWGAVEGGFFQLKLL  795

Query  2458  YISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA  2637
              +  +   +W+  + HFP L++L L  CH L +IP+G  DITTLQ+IE++DC   +V SA
Sbjct  796   LVENSDPMSWDADASHFPSLQQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRSA  855

Query  2638  KDIQEEQSSYGNDQLVVR  2691
             + I ++Q   GND+L +R
Sbjct  856   RKIHQQQQILGNDELGIR  873



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score =   424 bits (1089),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 315/900 (35%), Positives = 477/900 (53%), Gaps = 78/900 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSLI T+ L F +   I +  + ++++  R   +K C++   LE       ++ 
Sbjct  1     MAYAAITSLITTI-LDFPQHADIYLQPFIEKLKSFRAIIEKPCNITGDLEV------LTM  53

Query  250   AEKDVIARVKD----ISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRN  417
              E ++I  +      I  +    I+++    I    +  RL  +L+R    I        
Sbjct  54    MEAEIIELLNTTEDMIILKTRKAIKAKT--TIKRRVAFWRLRSLLKRAPTRIHS-----K  106

Query  418   TTQMLSSYNPGQSNQEHIIAGGASK--LQDDAIMVGHAQELERTKEMLLQCSTQERQVIS  591
               + L+  N      +++I    S+   Q + +MVGH    E  ++ L + +T E QVIS
Sbjct  107   MNKWLAMQNSKDLRAQNLIVANTSQHDFQSENMMVGHENAFEIMQDQLARGAT-ELQVIS  165

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA-QMTDKEI  768
             IVGMGGIGK+T+A K+Y+DP I S F +     VSQ+Y  R +L  +   ++   T  E 
Sbjct  166   IVGMGGIGKSTLAIKLYNDPFIMSHFDIRAKVIVSQEYCKRNVLLGILSSISGSGTIGEF  225

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
              E +   +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD + GSRILLTTR  +V
Sbjct  226   YEQQDDGQLADRLQKYLKGKRYLIVIDDIWTTIAWDDVKLCFPDCNCGSRILLTTRNMKV  285

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             A Y+  SG     +  LN NESW L  +K+  +   PPE E IGK+I   C+GLPLAI V
Sbjct  286   AEYAS-SGNPPYQMRLLNFNESWYLLHKKVFENTYFPPEFENIGKQIALNCKGLPLAIVV  344

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AGLL K  +S++ W++IA  +   +++D    C  +L LSY++LP+HLK CFLYF IFP
Sbjct  345   IAGLLLKIGQSLDEWENIAENIVSMVSTDPDVPCMRMLALSYHHLPHHLKPCFLYFAIFP  404

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +    I    L+ LW  EGF+  +  +S+EE A +YL+DL+DR L+ I  LSF G IK C
Sbjct  405   E-DELIFVNKLVKLWAAEGFLKREREKSIEEVAEQYLKDLVDRGLIFIRYLSFDGKIKAC  463

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSD  1665
              +HD++ +LCLRE +K  FV        NVI + +  P  E +  + T R   IQ + S 
Sbjct  464   GMHDMIRELCLREARKLNFV--------NVI-MENQNPC-EQSMHFSTKRRICIQSEESS  513

Query  1666  KYN-------FHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDI  1824
                       ++K+ ++L F      SG+    ++   FK +R+L+L   + D  P+  I
Sbjct  514   FVANQLAMVLYNKAHSILLFIRNPSNSGI---MQELERFKKLRILELASPTLDAFPSC-I  569

Query  1825  SDLILLRYLALG--------TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKW  1980
               L  LRYLAL          I     +     LQ+LI+KFP   R  +           
Sbjct  570   VGLFQLRYLALTFYSSTDDQDIYVPPSINGLQYLQSLILKFPKYFRCPKFSFIL---PSQ  626

Query  1981  LQGLWKSQSLRFIKYPYPFPIDTDEIP----VQDTLHTLY-WVPYLRCTKEFVLKIPNVK  2145
             +  LW+ + L   +       DT E      + + +  L  W P L CT     + PN+K
Sbjct  627   IFNLWRLRHLSLDRNNS----DTCEFGERSLILNNMQCLSGWNP-LCCTSSVFKQFPNLK  681

Query  2146  VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSI---NSFPQSLKELKI  2316
              L I   +   + T      LH L  L++L  E+++ +     ++    +FP++LK+L  
Sbjct  682   KLQIS-GDHEEYITSYEMKGLHNLCNLDQL--EELKFDGMPHSTLPHPEAFPKNLKKLSF  738

Query  2317  VGTELGWEAITIISMLPNLESLKL-LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWET  2493
               T +  E + I+S LP LE+LKL   +  +G EW   + GFP+LKFL +S   +++W  
Sbjct  739   SKTHVNLEDLRILSKLPKLEALKLKFCSSNIGMEWEVTEEGFPQLKFLLLSRLGIRHWRA  798

Query  2494  MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYG  2670
              SDHFP LERL L  C N+  IPE F +ITTLQLI+++ C  S+V SAK IQ+E + +YG
Sbjct  799   SSDHFPRLERLFLVECANMISIPEDFVEITTLQLIDIRMCKESVVNSAKKIQQEIEDNYG  858



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score =   424 bits (1091),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 327/894 (37%), Positives = 477/894 (53%), Gaps = 49/894 (5%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAE-  255
             MAY  + SL +T+E Q     P L  D K  IQ L   L + KA L++S K     Q   
Sbjct  1     MAYASVVSLAQTLE-QLSTRIPGLFSDPK--IQSLSASLDYFKAFLDDSSKSSYYHQENI  57

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQ-----RNT  420
             KD++ + +D    AE+ IE ++ EI   G  +E L   L  + + IE L E+        
Sbjct  58    KDLVGKSRDALNEAENIIELKICEIHQRG--NEDLVGSLVPVVQKIELLREELVLSLETC  115

Query  421   TQMLSSYNPGQSNQEHIIAGGASKLQDDAIM----VGHAQELERTKEMLLQCSTQERQVI  588
             T       P + + E  + G  S+   +A +    VG   +LE+  E LL  S+ ER+V+
Sbjct  116   TSHDHDIEPTEDHFETRL-GSPSRPSFNANLENNVVGLDDDLEKVIERLLGYSS-EREVV  173

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             +I GMGGIGKTT+AKK YD P +RSRF +  W TVS++Y +RR+L  L  C+  MT  ++
Sbjct  174   AITGMGGIGKTTLAKKAYDYPRVRSRFDVHAWVTVSREYGMRRLLLSLVRCIPGMTTDKL  233

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
              E K+  +LA  + R+L  +RYL+V+DDIW ++ WDD+ RCFPDD NGSRI+LT+RLK+V
Sbjct  234   VE-KTEDQLAESLYRKLKDRRYLIVIDDIWSTKVWDDVTRCFPDDDNGSRIILTSRLKDV  292

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAIT  1122
             A Y+      +  +  L+ ++SW L S K+  +N   P E+E+IGK+I  +C GLPLAI 
Sbjct  293   AAYANPDSP-LHEMGVLSLDDSWKLLSIKVFGVNDLCPSELEDIGKQIAERCGGLPLAIL  351

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AG LSK  R  E+W  +A  +N  + +D  D+C  +L +SYN L  HLK CFL  G F
Sbjct  352   VVAGHLSKISRRRESWIIVAKTVNSVVAND-PDKCLGVLGMSYNYLSNHLKPCFLSMGAF  410

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKT  1482
             P+   EI  + L+ +W+ EGF+  +  +SLE+ A + L+DLI RNL++I K  F G I++
Sbjct  411   PE-DFEIKARTLIQVWVAEGFLKAERVKSLEKVAEECLEDLISRNLIMIRKRRFNGEIRS  469

Query  1483  CRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFS  1662
             C +HDLL DL LRE +KEKF+     R  +       E       R  +F +  I    S
Sbjct  470   CGIHDLLRDLSLREAQKEKFLHVTSTRYVSNFLAQRNE------GRGFSFLSN-ISLNDS  522

Query  1663  DKYNFHKSRTLLFFFGVSGASGLPVSWRQ---NVSFKMIRVLDLVEISFDEAPTFDISDL  1833
              + + H +R+ +FF+G    S  P   RQ     SFK IRVL +    F   P  +I+ L
Sbjct  523   SELSSHVTRS-MFFWGKLLISAPP--HRQISLFASFKHIRVLAIFSHMFPAFPA-EITQL  578

Query  1834  ILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
               LRYL + +   +   + H +NLQTL+ + P             +  + +  + + + L
Sbjct  579   THLRYLWIQSNGGLPASVSHLYNLQTLVFQQPE----LYYMHKTLVLPRDIWNMTQLRRL  634

Query  2011  RFIKYPY----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRA  2178
             R +   Y         TD++     L  L  + +  CT+E    +PN++ L I   +  +
Sbjct  635   RLLSGNYLSKPKRSTTTDDVLGLSNLEELSHLCFSSCTEEVFSCLPNIRKLSIL--DAAS  692

Query  2179  FQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIIS  2358
                  +  NL +L KLE L       ++  L +  +   S+K L + G  L  E +  ++
Sbjct  693   DDASEYLKNLVHLEKLETLKCICYGQKRLTLSNWCASLTSVKRLVLSGCLLLSEDMASLA  752

Query  2359  MLPNLESLKLLQAYEMGEEWVTGD-GGFPKLKFLYISGAKLKNWETMSDHFPVLERLALH  2535
              LPNLE LKL      G  W   D   F +LKFL +S  +L NWE  S +FP L++L L 
Sbjct  753   ALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLSEPRLVNWEAGSVNFPNLQKLVLR  812

Query  2536  HCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDY  2697
              C  LE+IP    +I TL++IEL  C  S   SA +I+EEQ S GN  L +R Y
Sbjct  813   KCIRLEEIPLDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRVY  866



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score =   424 bits (1089),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 321/908 (35%), Positives = 488/908 (54%), Gaps = 66/908 (7%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TS++ T+E Q L+  P L+ + ++ +  L   L  L++ LE++ K+++  +A  
Sbjct  1     MAYAVITSIMTTIE-QVLQFNPSLISECRESVDSLYGTLSFLQSFLEDTGKQISDQEALM  59

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQ-RLAEDIEGLIEQRNTTQ--M  429
              +  +++D  ++AED I+  +  I  + A  E++    + +L +++  +IE  ++ Q  +
Sbjct  60    FLEEKIRDAGYKAEDTIDLCLRRI--HVADSEKVQNNARCKLYDELLQIIEVMDSIQGEV  117

Query  430   LSSYNPGQSNQEHI---IAGGASKLQ-------DDAIMVGHAQELERTKEMLLQCSTQER  579
             +   N   +NQ+ I    A  +S L+       ++  +VG   +    ++ L +  T E 
Sbjct  118   MKFKNDRHNNQQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFR-QTPEL  176

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
              V+SIVGMGGIGK+T+A+ +++ PS+  RF +  W TVSQ YD + +L D+         
Sbjct  177   NVVSIVGMGGIGKSTLARSLFNHPSVSPRFDISSWVTVSQAYDAKEMLLDVLS-FGTPGG  235

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             K +    S  EL ++V R+L R+RYL+V+DD+W    WD ++R FPDD NGSRI++TTRL
Sbjct  236   KAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRL  295

Query  940   KEVAVYSGCSGKYVC--NLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLP  1110
              EVA    C+G      ++PFL+  +SW L S K+ G+ + PP++EE+GK+I  +C+GL 
Sbjct  296   LEVA---NCAGNDFPPHHIPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLA  352

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L++ V AGLLSK  R+ ++WQ IA  +N  + S    QC  IL LSYN LP  LKACFLY
Sbjct  353   LSVVVIAGLLSKIIRTYDDWQQIADNVNSHIGST-SQQCLAILALSYNYLPCSLKACFLY  411

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-  1467
              G+F +   +I    L+ +W+ EGF+  +S +  +E   + L++L+ R+L++++   ++ 
Sbjct  412   MGVFLE-DADISADKLIRIWVAEGFLKRNSHKKPKEVGEECLEELVSRSLIMVNSRGWVS  470

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEP-LFEYANRWLTFRTTY  1644
             G IK+CR HDL+  +CLRE K EKF     +  E   E  ++E  LF Y +         
Sbjct  471   GKIKSCRTHDLIRLICLREGKAEKFFHVISECYEVSSEGVESEHRLFLYED------AVQ  524

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS--FKMIRVLDLVEISFDEAPTF  1818
              Q    +K N    RT+        AS L     + V   F+++RVLD++ I F   PT 
Sbjct  525   NQNIGLEKGNLDSVRTISCTHK-PHASLLDYECYKIVDSRFQLLRVLDVLLIYFLRFPT-  582

Query  1819  DISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLW  1995
             +I+ L+ LRYLAL T   V   + +  NLQTLIV                    W   +W
Sbjct  583   EITQLVHLRYLALATSTSVPASISNLWNLQTLIVH------------SVANELSWPLEIW  630

Query  1996  KSQSLRFIKYP----YPFPIDTDEIPVQDTLHTLYWVPYLRCT-KEFVLKIPNVKVLGIK  2160
             K  SL    YP     P P         + L  L          KE  + IP+VKVL + 
Sbjct  631   KISSLIHF-YPGKMYVPAPPKAPNFLGLENLEELSLSTATSSDLKEIFMAIPHVKVLDV-  688

Query  2161  CSEIRAFQTETWWDNLHYLTKLEKLIV---EDIESEQFELQS---INSFPQSLKELKIVG  2322
               E+     +   DNL YL  L+ L +      +++ F+  S    + FP +LK L +  
Sbjct  689   --ELNQDGWDNVIDNLIYLADLQNLRILLRLPFDAQLFQRPSARPFDVFPANLKSLILAE  746

Query  2323  TELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSD  2502
             T L W  +T++S LPNLE LKL      G  W   +GGF KLK L I   +L +W   SD
Sbjct  747   THLLWTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQTELVHWHATSD  806

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
               P LE L L HC+ L++IP    DI TL+L+EL  C  S V SA++I EEQ   GN+ L
Sbjct  807   SLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILEEQQCLGNEIL  866

Query  2683  VVRDYDTR  2706
              VR Y+TR
Sbjct  867   AVRAYNTR  874



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   427 bits (1098),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 308/809 (38%), Positives = 430/809 (53%), Gaps = 66/809 (8%)
 Frame = +1

Query  304   EIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQR---NTTQMLSSYNPGQS-NQEHI  471
             + E+EV +I         +H  LQ+  EDI  + E+    N T +  +   G + N +  
Sbjct  229   DFEAEVQKICDKKYG---IHHCLQQTVEDIVDIREEMRKINDTLVNGNLKLGDTLNDDSS  285

Query  472   IAGGASK-----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
             ++  A K     L DD +++  ++ L R    L        +V++IVGMGGIGKTT+A+K
Sbjct  286   LSPPAQKNEAVGLDDDLMLM--SERLSRVPSRL--------EVVTIVGMGGIGKTTLARK  335

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRR  816
             I+DDPS    FH   W  VSQ Y LR +L  L  CV Q+ D+  N  KS  ELA  + R 
Sbjct  336   IFDDPSTICNFHACAWVQVSQVYRLRNLLLGLLKCVTQLKDE--NCAKSNEELAEDLYRS  393

Query  817   LMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPF  996
             L  +RYL+V+DD+W +R WDD++R FPDD N SRI+LTTR+ EVA Y   S      +  
Sbjct  394   LKGKRYLIVIDDVWSTRTWDDVKRIFPDDKNASRIVLTTRVGEVADYVN-SKSASHRMRL  452

Query  997   LNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQ  1173
             L+ ++SW L  +K+ GS +   E  +IGK I  KC+GLPLAI V AGLLSK +R+ + W+
Sbjct  453   LDIDQSWDLLQKKVFGSQSCNLEFVDIGKEIARKCQGLPLAIVVVAGLLSKIRRTRDCWE  512

Query  1174  SIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWI  1353
              IA +++  + S   +QC  IL LSYN+LP HLKACFLY G FP+   EI  + L+ LW+
Sbjct  513   GIAGSVSS-LVSSGPEQCLEILALSYNHLPQHLKACFLYMGAFPE-DSEIEVEKLIALWV  570

Query  1354  TEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
              EGF+ +    S E  A  YL+DLIDR+LVLI K  F G +KTC LHDLL +LCLRE +K
Sbjct  571   AEGFLDKKDSLSAERVAEDYLEDLIDRSLVLIGKRRFNGKVKTCYLHDLLRELCLREARK  630

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLL--FFF  1707
             EKF+    +R+++ +     +            R   I   F        S TL+  F  
Sbjct  631   EKFLFVIDRRAQSFLSGIKNQ------------RRLSIHLDFHADLQLIPSVTLVRSFLC  678

Query  1708  GVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-GTIKYVRVL  1884
                G+S +P+      SFK++RVLD++ +S    P  +I DL+ LRYLAL  T +    +
Sbjct  679   FSLGSSFVPMFIS---SFKLLRVLDIIFLSSKYFP-LEILDLVHLRYLALTATYELPASI  734

Query  1885  KHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPF----PIDTD  2052
                 +LQTL++  P   R      ++      L   W    LR +    P     P D  
Sbjct  735   SKLRSLQTLVIHGPWINR------NQGESPTLLFEYWIMPWLRHLHISMPCYLSNPFDPS  788

Query  2053  EIPVQDT-LHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET---WWDNLHYLT  2220
               P+    L TL  + +  CT +  L +P ++ LGI C     F T+    W  NL  L 
Sbjct  789   RCPLAPRYLQTLSTIRFASCTSDVFLVMPYLRKLGI-CETKEDFITDMSCRWLKNLANLQ  847

Query  2221  KLEKLIV----EDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL  2388
              LE L      ++ E+ +    S+  FP +L++L +  + L W+ I  I+MLPNLE LKL
Sbjct  848   YLEALKCSFYKQNAEAPRILRPSVLHFPLTLRKLTLSWSYLPWKDIACIAMLPNLEVLKL  907

Query  2389  LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEG  2568
                   G +W   +  F +LK   I    L+NWE  SD+FP LE L L  C  L+ IP+G
Sbjct  908   KNYAFQGPDWEPTEEAFRRLKHFLIDSTNLENWEASSDNFPCLEHLVLRGCKFLKGIPDG  967

Query  2569  FTDITTLQLIELKDCFPSLVESAKDIQEE  2655
               +I TLQ  EL  C  S   SAK I+ E
Sbjct  968   IEEINTLQRFELHYCSESAEISAKGIEVE  996



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score =   424 bits (1089),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 320/908 (35%), Positives = 485/908 (53%), Gaps = 70/908 (8%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNV-SQAEK  258
             AY  LTSL+ T++         L  ++K  ++ L++K               NV  +  K
Sbjct  3     AYAALTSLLGTIDQLLQSNLSGLQENHKRHLKSLKEKF------GSLQASFGNVDGEPTK  56

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGA-----SHERLHQILQRLAEDI----EGLIEQ  411
             ++ AR+KD++   EDE+ES V +++         S  +L +I Q+  ++I    E LI+Q
Sbjct  57    EMQARIKDVARDTEDEVESLVKQLMEQDELLQVESCAKLAKISQQATQEIDSFKEELIKQ  116

Query  412   RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQEL-ERTKEMLLQCSTQERQVI  588
              N      S +   S+   +    AS L++D  M G+  E     +++  +  + +R+V 
Sbjct  117   ENNNLQGESSSTSGSSSPRL---DASILEND--MEGYNVERGSMVQQLTRRSGSDQREVF  171

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM--TDK  762
             S+VGM GIGK+T AK I+  PSIR  FH+ GW TVS+DYDLR++L  L   + +    D 
Sbjct  172   SVVGMPGIGKSTFAKTIFLHPSIRRVFHIRGWITVSKDYDLRKMLLVLLDAIGKKDPVDA  231

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
             +I+      +LA +++  L R+RYL+VVDDIW    W  + + FPD  N SRILLT+R K
Sbjct  232   KID----IGKLAERLKNGLKRERYLIVVDDIWSKEAWIRIAQWFPDSGNKSRILLTSRDK  287

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPP--EIEEIGKRIVNKCRGLPLA  1116
             EVA Y+          P LN+NES  LF +K  + N  P    +E+ + +   C+GLPL 
Sbjct  288   EVAEYASFPRSCFQMRP-LNTNESQNLFYRKTFAKNDNPGSAFKEVVEEVAKNCKGLPLM  346

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             IT  AG+LS +K ++  W ++A +++  +  D + QC  +L LSYN+LP H+KACFL+FG
Sbjct  347   ITAVAGILS-SKSTLGEWNTVAQSVSSLVNDDAYQQCLKVLALSYNHLPSHVKACFLHFG  405

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             +FPK   EI  K L+ LW+ EG +        E+ A   L +LI+++LV+I K SF G I
Sbjct  406   VFPKA-HEISVKKLIRLWVAEGLLNLKGVEEFEQVAGHLLYNLIEKSLVIIGKRSFDGKI  464

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             KTC +HDL  DLCL E K E  +   +  S++ I   + +  F    RW++ ++    P 
Sbjct  465   KTCMIHDLFHDLCLEEAKSENLL---YVPSDSTI--FEVQRYFPKGCRWVSVQSGLTNPP  519

Query  1657  --FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
               ++D     ++R+L     ++G S      R  + FK++RVLDL E S   +P   + D
Sbjct  520   RYYNDYSTLVETRSLY----LNGRSWQIPDLRPFL-FKLLRVLDLEETSSSFSPVVMMGD  574

Query  1831  LILLRYLALGTIKYVRVLKHHH--NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQ  2004
             L+ LRYLA+ + + +  L + +  NLQTLI +         +  D E  +   + +W+  
Sbjct  575   LVCLRYLAVMSHRILEDLTNSNLCNLQTLIFR-------RHVVYDGERAATLPKAIWQMS  627

Query  2005  SLRFIKYPYPFPIDTDEIP-----VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
              LR + Y   F + +  +      V   L ++  +    CTKE    I  V+ LGI C+ 
Sbjct  628   QLRHL-YAACFSLCSPRMVSVEHLVLRNLRSVSGLSPSCCTKEIFEGIKKVQKLGILCTR  686

Query  2170  IRAFQTETWWDNLHYLTKLEKL-------IVEDIESEQFELQSINSFPQSLKELKIVGTE  2328
                 +   W DNL YL +LE+L       + E  E E F L S ++ P +LK+LK+  T 
Sbjct  687   KEYPRDPKWIDNLQYLPELEELSIATQGYLFEREEVECFSLTSPDALPLNLKKLKLSKTY  746

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDG-GFPKLKFLYISGAKLKNWETM--S  2499
             L W+ + +I  LP LE L+L     +G EW   D   F +LKFL +    L+NW T   +
Sbjct  747   LQWKYMAVIGKLPKLEVLQLKDHAFVGNEWKATDQVRFHELKFLLLDCLYLRNWRTTDSN  806

Query  2500  DHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQ  2679
             DHF  LER+ +  C+ L++IPEGF     L+LIEL  C PS+V  A+ IQE+   YG  +
Sbjct  807   DHFSSLERVIIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKIQEKHEYYGRCK  866

Query  2680  LVVRDYDT  2703
             L V DYDT
Sbjct  867   LKVIDYDT  874



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score =   422 bits (1084),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 318/893 (36%), Positives = 477/893 (53%), Gaps = 51/893 (6%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAE-  255
             MAY  + SL +T+  Q     P L  D K  IQ L   L + KA L++S       Q   
Sbjct  1     MAYASVVSLAQTLG-QLNTRIPGLFSDPK--IQSLAASLDYFKAFLDDSSNSSYYHQENI  57

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQ-----RNT  420
             KD++ + +D    AE+ IE ++ EI      H+R ++ L  + + IE L E+        
Sbjct  58    KDLVGKFRDALNEAENIIELKICEI------HQRGNEDLVPVVQKIELLREELVLSLETC  111

Query  421   TQMLSSYNPGQSNQEHIIAGGASK------LQDDAIMVGHAQELERTKEMLLQCSTQERQ  582
             T       PG+ + E  + G  SK      L++D  +VG   +LE+  E LL  S+ ER+
Sbjct  112   TSHDHDTEPGEDHFETRV-GSPSKPSFNANLEND--VVGLDDDLEKVIERLLGYSS-ERE  167

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK  762
             V++I GMGGIGKTT+AKK YD P +RSRF +  W TVS++Y +RR+L  L  C+  MT  
Sbjct  168   VVAITGMGGIGKTTLAKKAYDYPRVRSRFDVHAWVTVSREYGMRRLLLSLARCIPGMTAD  227

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
             ++ E K+  +LA  + R+L  +RYL+V+DDIW ++ WDD+ RCFPDD NGSRI+LT+RLK
Sbjct  228   KLVE-KTEDQLAESLYRKLKDRRYLIVIDDIWSTKVWDDVTRCFPDDDNGSRIILTSRLK  286

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLA  1116
             +VA Y+      +  +  L+ ++SW L S K+  +N   P E+E+IGK+I  +C GLPLA
Sbjct  287   DVAAYANPDSP-LHEMGVLSLDDSWKLLSIKVFGVNDLCPFELEDIGKQIAERCGGLPLA  345

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V AG LSK     E+W ++A  +N  + +D  D+C  +L +SYN L  HLK CFL  G
Sbjct  346   ILVVAGHLSKISMRRESWITVAKTVNSVVAND-PDKCLGVLGMSYNYLSNHLKPCFLSIG  404

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
              FP+   EI  + L+ +W+ EGF+  +   SLE+ A + L+DLI RNL++I K  F G I
Sbjct  405   AFPE-DFEIKARTLIQVWVAEGFLKAERVESLEKVAEECLEDLISRNLIMIKKRRFNGEI  463

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             ++C +HDLL DL LRE +KEKF+     R  +       E       R  +F +  I   
Sbjct  464   RSCGMHDLLRDLSLREAQKEKFLHVTSARYVSNFLAQRNE------GRGFSFLSN-ISLN  516

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLI  1836
              S + + H +R++ F+  +S +S          SFK IRVL ++   F   P  +I+ L 
Sbjct  517   DSSELSSHVTRSMFFWGELSISSPPHRQISLFASFKHIRVLAIISHMFPAFPA-EITQLT  575

Query  1837  LLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR  2013
              LRYL + +   +   + H +NLQTL+ + P             +  + +  + + + LR
Sbjct  576   HLRYLWIRSNGGLPASVSHLYNLQTLVFQQPE----LYYMHKTLVLPRDIWNMTQLRRLR  631

Query  2014  FIKYPY----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAF  2181
              +   Y         TD++     L  L  + +  CT+E    +P+++ + I   +  + 
Sbjct  632   LLSGNYLSKPKRSTTTDDVLGLSNLEELSHLCFASCTEEVFSCLPSIRKVSIL--DAASD  689

Query  2182  QTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISM  2361
                 +  NL +L KLE L       ++  L +  +   S+K L + G  L  + +  ++ 
Sbjct  690   DASEYLQNLVHLEKLETLKCVCYGQKRLTLSNWCASLTSVKRLILSGCLLLSQDMASLAA  749

Query  2362  LPNLESLKLLQAYEMGEEWVTGD-GGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHH  2538
             LPNLE LKL      G  W   D   F +LKFL ++  +L NWE  S +FP L++L L  
Sbjct  750   LPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLAEPRLLNWEAGSVNFPNLQKLVLRK  809

Query  2539  CHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDY  2697
             C  LE+IP    +I TL++IEL  C  S   SA +I+EEQ S GN  L +R Y
Sbjct  810   CICLEEIPIDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRVY  862



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score =   422 bits (1085),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 339/924 (37%), Positives = 474/924 (51%), Gaps = 103/924 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSLI T++ LQ L     L       +  L +K+       +   + L+ S AE+
Sbjct  3     AYVALTSLIGTIQQLQLLHSNLNLGDTSLKSLNLLYEKV-------DSLHELLDNSDAEQ  55

Query  259   --DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDI----  393
               ++ A VK I+   EDE+ES++  ++     H+ LHQ         ILQR  E +    
Sbjct  56    TENLHAEVKHIANEVEDEVESQMQVVMDE--QHDGLHQQEALENLFEILQRAIEKVDSLK  113

Query  394   EGLIE--QRNTTQML-SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
             EGLI+  Q N  Q   SS     S + H     A  L++D  MVG+  E       L   
Sbjct  114   EGLIKHSQNNNLQAGNSSLCDSSSPRLH-----APTLEND--MVGYNIEQADMLSQLTGG  166

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
             ST   +VIS+ GMGGIGK+T  KK+   P++ S F + GW TVS+DY  R+ L  L    
Sbjct  167   ST-PLEVISVTGMGGIGKSTFTKKLSSHPAVLSFFDIRGWVTVSEDYSFRKTLLGLLKN-  224

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
             A +  +E  E KS   LA+++++ L  +RYL+VVDDIW    WDD++ C PD    SR+L
Sbjct  225   ANIAKEEELENKSDQVLADRLKKGLKGRRYLIVVDDIWSKEAWDDIRLCLPDYGIRSRVL  284

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  S K    +  LN ++SW LF QK  + N  P E E +GK +   C+
Sbjct  285   LTTRDVEVAQYAS-SSKDPFRMHLLNPDDSWNLFYQKAFAENCFPVEFENVGKEVALNCK  343

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL I V A +LS +KR+++ W+ +A ++      D + QCS +L LSYN+LP +LK  
Sbjct  344   GLPLMIAVVAKILS-SKRTLDEWRKVAQSVTSLADVDAYRQCSGVLALSYNHLPSYLKGS  402

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYFG+FPK   EI    L+ LWI EG +       LE+ A   L  LID++LV++SK S
Sbjct  403   FLYFGLFPKAN-EISVGKLIRLWIAEGLLKVKGMERLEKVAASLLDYLIDKSLVIVSKRS  461

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL---TF  1632
               G I TC +HDL+ D CLRE  ++  +  + + ++N         +F    RW+   + 
Sbjct  462   MDGEIMTCLIHDLVHDFCLREADRQSLL--YIENTDN----AGAGLVFPQGCRWILRKSE  515

Query  1633  RTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
             R+T+   +F   YN   S  R+L  +      S L ++   + +FK++RVLD+ E  F +
Sbjct  516   RSTHFSSRF---YNLDHSKLRSLSLYH-----SDLYLNI-AHFNFKLLRVLDMEENRFFD  566

Query  1807  APTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
              P   I DL+ LRYLAL     G +   ++L    NLQTL V+ P S             
Sbjct  567   FP-IAILDLVFLRYLALTFKRSGQLPISKLL----NLQTLTVR-PLS-----------YI  609

Query  1972  SKWLQGL----WKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
             S W   L    WK   LR       +++ P     +  +  V + + T+  +    CTKE
Sbjct  610   SDWSVSLPNDIWKLSQLRHLHCWCMYLESPQTVSGNKLKNLVLENIQTVSGLTPSCCTKE  669

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE-----DIESEQFELQSIN  2283
                 I  VK L I          + W  NL YL +LE L V       + S     +SIN
Sbjct  670   VFEGIKKVKKLEIAGKAEEFHSKKGWETNLKYLKELEALNVAVWHRLAMFSSNAMPRSIN  729

Query  2284  ----SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLK  2451
                 SFP +LK+L + GT L W  + I S LPNLE L+L     +G EW   + GFPKLK
Sbjct  730   PCPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLK  789

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL +    L  W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C  SLV 
Sbjct  790   FLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVI  849

Query  2632  SAKDIQEEQSSYGNDQLVVRDYDT  2703
              A+ IQE     GN+ L V  +++
Sbjct  850   FAEQIQEMHEELGNNLLKVYAFES  873



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score =   422 bits (1084),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 339/924 (37%), Positives = 474/924 (51%), Gaps = 103/924 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AYV LTSLI T++ LQ L     L       +  L +K+       +   + L+ S AE+
Sbjct  14    AYVALTSLIGTIQQLQLLHSNLNLGDTSLKSLNLLYEKV-------DSLHELLDNSDAEQ  66

Query  259   --DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQ---------ILQRLAEDI----  393
               ++ A VK I+   EDE+ES++  ++     H+ LHQ         ILQR  E +    
Sbjct  67    TENLHAEVKHIANEVEDEVESQMQVVMDE--QHDGLHQQEALENLFEILQRAIEKVDSLK  124

Query  394   EGLIE--QRNTTQML-SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
             EGLI+  Q N  Q   SS     S + H     A  L++D  MVG+  E       L   
Sbjct  125   EGLIKHSQNNNLQAGNSSLCDSSSPRLH-----APTLEND--MVGYNIEQADMLSQLTGG  177

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
             ST   +VIS+ GMGGIGK+T  KK+   P++ S F + GW TVS+DY  R+ L  L    
Sbjct  178   ST-PLEVISVTGMGGIGKSTFTKKLSSHPAVLSFFDIRGWVTVSEDYSFRKTLLGLLKN-  235

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
             A +  +E  E KS   LA+++++ L  +RYL+VVDDIW    WDD++ C PD    SR+L
Sbjct  236   ANIAKEEELENKSDQVLADRLKKGLKGRRYLIVVDDIWSKEAWDDIRLCLPDYGIRSRVL  295

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  S K    +  LN ++SW LF QK  + N  P E E +GK +   C+
Sbjct  296   LTTRDVEVAQYAS-SSKDPFRMHLLNPDDSWNLFYQKAFAENCFPVEFENVGKEVALNCK  354

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL I V A +LS +KR+++ W+ +A ++      D + QCS +L LSYN+LP +LK  
Sbjct  355   GLPLMIAVVAKILS-SKRTLDEWRKVAQSVTSLADVDAYRQCSGVLALSYNHLPSYLKGS  413

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYFG+FPK   EI    L+ LWI EG +       LE+ A   L  LID++LV++SK S
Sbjct  414   FLYFGLFPKAN-EISVGKLIRLWIAEGLLKVKGMERLEKVAASLLDYLIDKSLVIVSKRS  472

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL---TF  1632
               G I TC +HDL+ D CLRE  ++  +  + + ++N         +F    RW+   + 
Sbjct  473   MDGEIMTCLIHDLVHDFCLREADRQSLL--YIENTDN----AGAGLVFPQGCRWILRKSE  526

Query  1633  RTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
             R+T+   +F   YN   S  R+L  +      S L ++   + +FK++RVLD+ E  F +
Sbjct  527   RSTHFSSRF---YNLDHSKLRSLSLYH-----SDLYLNI-AHFNFKLLRVLDMEENRFFD  577

Query  1807  APTFDISDLILLRYLAL-----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
              P   I DL+ LRYLAL     G +   ++L    NLQTL V+ P S             
Sbjct  578   FP-IAILDLVFLRYLALTFKRSGQLPISKLL----NLQTLTVR-PLS-----------YI  620

Query  1972  SKWLQGL----WKSQSLR-------FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
             S W   L    WK   LR       +++ P     +  +  V + + T+  +    CTKE
Sbjct  621   SDWSVSLPNDIWKLSQLRHLHCWCMYLESPQTVSGNKLKNLVLENIQTVSGLTPSCCTKE  680

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE-----DIESEQFELQSIN  2283
                 I  VK L I          + W  NL YL +LE L V       + S     +SIN
Sbjct  681   VFEGIKKVKKLEIAGKAEEFHSKKGWETNLKYLKELEALNVAVWHRLAMFSSNAMPRSIN  740

Query  2284  ----SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLK  2451
                 SFP +LK+L + GT L W  + I S LPNLE L+L     +G EW   + GFPKLK
Sbjct  741   PCPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMGFPKLK  800

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL +    L  W    D+F  LER+ +  C  L++IPEGF D  TLQLIEL  C  SLV 
Sbjct  801   FLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVI  860

Query  2632  SAKDIQEEQSSYGNDQLVVRDYDT  2703
              A+ IQE     GN+ L V  +++
Sbjct  861   FAEQIQEMHEELGNNLLKVYAFES  884



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score =   424 bits (1089),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 308/815 (38%), Positives = 434/815 (53%), Gaps = 88/815 (11%)
 Frame = +1

Query  364   QILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHA------  525
             Q L RL E+I  + ++    +++ ++  G+      +  GAS  + D+  VG        
Sbjct  212   QELFRLMEEIISITKE--VIKVMDTFGAGECLWHSSVLPGASLSRRDSGGVGKNVVVGFD  269

Query  526   QELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDY  705
             ++LE  K   +  S++  ++ISIVGMGGIGKTT+A++IYDDPSI   F   GW  VSQ+Y
Sbjct  270   KDLEEIKTRWIDDSSK-LEIISIVGMGGIGKTTLARQIYDDPSIFYHFDTRGWVAVSQEY  328

Query  706   DLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQ  885
              LR++L  L      +T++  +E  S   LA  + + L  +RYL+V+DDIW    WD ++
Sbjct  329   SLRQVLLGLLDSTKMLTEEMQDE--SDPRLAEFLYKCLKGRRYLIVMDDIWDIDIWDAVR  386

Query  886   RCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPE  1062
             R FPDDSNGSR+LLTTRL +VAVY+  S + +  + FLN  +SW L  +K+ G  + PPE
Sbjct  387   RLFPDDSNGSRVLLTTRLSDVAVYANSSSR-LHQMRFLNEADSWNLLCKKVFGEKDCPPE  445

Query  1063  IEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILT  1242
             +E++G+ I   C GLPLAI V  GLL K  R+  NW+SIA  +N  ++ D  +QC  IL 
Sbjct  446   LEDVGREIARNCGGLPLAIVVIGGLLYKDSRTWRNWRSIAENLNSILSKD-DEQCLEILG  504

Query  1243  LSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQD  1422
             LSYN LP+ LK CFLY G+FP+   EIP   L+NLW  EGF+   + ++LEE A +YL+D
Sbjct  505   LSYNRLPHRLKPCFLYMGVFPE-DSEIPVSKLINLWAAEGFLKPSTSKTLEEVAEEYLKD  563

Query  1423  LIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPL  1602
             LI+R+L+L+ K S  G IKTC +HDLL D+C+R  +KE F+   +         GD   L
Sbjct  564   LIERSLLLVCKRSCNGRIKTCNIHDLLRDVCVRNAQKENFLHVVNW-------YGD---L  613

Query  1603  FEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGA---SGLPVSWRQNV--SFKM  1767
              E  NR    R   I P   D    + +  L+  +  + +   +G  +++   V   F++
Sbjct  614   TEAGNR--RRRRVSIHP---DALYANTTHQLISSYSHARSYLCTGKSLTYPSLVYLGFRL  668

Query  1768  IRVLDLVEISFDEAPTFDISDLILLRYLALG-------TIKYVRVLKHHHNLQTLIVKFP  1926
             +RVLD++ I F E P+ DI  L  LRYL          +I  +R      NLQT++    
Sbjct  669   LRVLDIILIHFSEFPS-DIIRLFHLRYLGFTYNGPLPPSISKLR------NLQTVV----  717

Query  1927  NSCRieeidsdeeiGSKWLQG--------LWKSQSLRFIK-YPYPFPIDTDEI-----PV  2064
                              W  G        +W   +LR +   P   P    EI      V
Sbjct  718   --------------HHNWTFGKYHLLPIEIWTMPNLRHLYCMPSCLPDPVGEILANNFVV  763

Query  2065  QDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETW------WDNLHYLTKL  2226
              + L TL  V   RC+K  + +IPN+K LGI          + W        NLH L  L
Sbjct  764   LENLQTLLDVRNFRCSKNILKRIPNLKKLGISYDVSSQAYVDRWQFNLESLANLHQLETL  823

Query  2227  EKLIVED-IESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYE  2403
             + +I  D   + +F      SFP+ L  L + G  L WE +TI+ +LP LE LKL +   
Sbjct  824   KIIIKNDPYRTSKFVNPPKLSFPRKLNRLTLSGCGLPWERMTIVGLLPCLEVLKLKKDAC  883

Query  2404  MGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDIT  2583
              G+EW T +  F +LK+L +    L  W T    FP L+ L +  C  L +IP    DIT
Sbjct  884   RGQEWETVEEQFCRLKYLLLEELDLVQWRTKEAPFPRLQSLIIRSCFRLREIPSAIGDIT  943

Query  2584  TLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             TLQ+IEL DC PS V  AK IQEEQ S  N+ L V
Sbjct  944   TLQMIELVDCHPSAVTWAKQIQEEQESMANEDLKV  978



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score =   421 bits (1083),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 332/957 (35%), Positives = 505/957 (53%), Gaps = 123/957 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  LTS + ++EL      P+L  +  K++I  L +++   +  L +SE   +  +  
Sbjct  1     MAYAALTSAVCSLELFMQCNHPLLNNLKRKEQILSLSKRIIAFQEFLTDSETIKHRHERL  60

Query  256   KDVIARVKDISFRAEDEIESEVME-IISNGASHER-----LHQILQRLAEDIEGLIEQRN  417
             K +  ++K+ +++ ED ++S++ +  ++  A++ R     L + LQ   E++E  I++  
Sbjct  61    KMLEGKIKEKTYQVEDIVDSKLRKYFVAKNANYRRKAFEVLCRRLQVAIEEME-FIKKEV  119

Query  418   TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIM--VGHAQELERTKEMLLQCSTQERQVIS  591
             T       +  + +++ + A   S    D     VG  ++LE+  + L +    E  +I 
Sbjct  120   TKIKGDKISTLKFHKQVLPARHISTSSPDVQQKPVGFQEDLEKIIDRL-RGGPSELDIIC  178

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEIN  771
             IVGM GIGKTT+AK+ Y+D S+ +RF +  W TVSQ+Y  R IL DL   V   TD EIN
Sbjct  179   IVGMAGIGKTTLAKRAYNDISVVNRFDVRAWVTVSQEYRERDILFDLFYSVVPPTD-EIN  237

Query  772   E-----------VKSTAEL--------ANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCF  894
             +            +S+ E+        A++VR+ L+ +R+L+VVDD+W +  WD+L R F
Sbjct  238   QESDKQNADQLMTRSSKEIYERRDQETADRVRKSLICKRFLIVVDDMWSTDAWDNLSRLF  297

Query  895   PDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEE  1071
             PDD NGSRI+LT+RL ++A Y     +    L FL+++E W L  +K+ G    P E+EE
Sbjct  298   PDDDNGSRIILTSRLIDLATYVN-PDRQPHRLDFLDNDEGWELLRRKIFGKRGCPFELEE  356

Query  1072  IGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSY  1251
             IG+ I  KC+GLPLAI V AG LSK  ++ + W ++A +++  +  +   QC  IL LSY
Sbjct  357   IGRSIAEKCQGLPLAIVVVAGHLSKMSKTTDCWNNVAESVDSVVNRE-PGQCLDILALSY  415

Query  1252  NNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLID  1431
             ++LP HLKACFLY G FP+   EI    L+ LW+ EGF+      ++EE A + L+DLID
Sbjct  416   SHLPQHLKACFLYMGAFPE-DFEIHVWKLIRLWVAEGFLNATGVTTVEEIAEECLEDLID  474

Query  1432  RNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEY  1611
             R+LVL  K S  G +KTC+LHD++ D CL E K++ F+    ++S +V+  G T      
Sbjct  475   RSLVLAVKRSN-GKLKTCKLHDIMRDFCLEEAKRQNFLHFLKKQSLDVLSEGIT------  527

Query  1612  ANRWLTFRTTYIQPKFSDKYNFHK-------SRTLLFFFGVSGASGLPV-SWRQN-----  1752
             A R ++F  + I   FS  Y+FH        SR+LL F      S  P+ S+ Q+     
Sbjct  528   ALRRVSFNCSTI---FS-SYSFHPTDPTVSFSRSLLGF----NVSQSPIFSFPQSPIFSF  579

Query  1753  VSFKMIRVLDLVEISFDEAPTF--DISDLILLRYLALGT-IKYVRVLKHHHNLQTLIVKF  1923
             + FK++RVLD+++I+F   P F  +I  L+ LRYLAL T  ++   +    +LQTLI+  
Sbjct  580   MDFKLLRVLDILDINFQHFPQFPSEIMQLVNLRYLALATSSEFPPTVSQFWSLQTLILHV  639

Query  1924  PNSCRieeidsdeeiGSKWLQGLWKSQSLR--FIKYPYPFPIDTDE------IPVQDTLH  2079
                             S   + +WK  +LR   IK     P  T+E        V + L 
Sbjct  640   ------------YSRNSTLPREIWKMPNLRHLHIKPSICLPSQTNEERNGYNSLVLNNLQ  687

Query  2080  TLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIR------------AFQTETWWD-------  2202
             TL  +    CT +     P +K LGI C  +              + +E  W        
Sbjct  688   TLTNITLADCTTDVFSSTPKLKKLGI-CETVEYTYPVQIPWSDFLYTSENLWPYCSDTIS  746

Query  2203  --------NLHYLTKLEKLIVEDIESE------QFELQSINSFPQSLKELKIVGTELGWE  2340
                     NL  L +LE L +  + +        F L   ++ P++LK+L +  T L WE
Sbjct  747   DLWSDCLRNLALLPQLEALKIVGLRAPVQVPKLAFHL---DALPENLKKLTLSFTYLPWE  803

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
             ++T +  LPNLE LKL      G +W   + GF  LK L I    L++W   +DHFPVLE
Sbjct  804   SMTSLCRLPNLEVLKLKPYAFTGTKWEQVEEGFCSLKLLQIEMFDLEHWSASNDHFPVLE  863

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L L  C +L+ IP    DI TLQ+IEL++   S V SAK+IQEEQ + GN+ L V+
Sbjct  864   HLVLKCCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQNIGNETLEVQ  920



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score =   420 bits (1079),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 303/856 (35%), Positives = 447/856 (52%), Gaps = 71/856 (8%)
 Frame = +1

Query  244   SQAEKDVIA-RVKDISFRAEDEIESEVMEIISNGAS----------------HERLHQIL  372
             SQ E D +  R++D +   ED +E  V E +   +                 ++ L ++L
Sbjct  53    SQEEVDSLEIRIRDSASVIEDLVEFYVSEQVYEDSDRFIAWLDSPTDLENWEYQELDEVL  112

Query  373   QRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDA-----IMVGHAQELE  537
               +   +E L+  R   + L         ++H+   G+S+   DA     +MVG  +++ 
Sbjct  113   VEIDSLVEELLNDRCGLKDLLP-------RQHLPVLGSSR---DARVGKNVMVGFDEDVM  162

Query  538   RTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR  717
               K  L    ++  QVI I GMGG+GKTT+A+ +YDD  ++  F L  W T+SQ Y +  
Sbjct  163   ELKHRLTGWESK-LQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDD  221

Query  718   ILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
             +++ L      + ++   + KS  +L   + + L  +RY++V+DD+W ++ WDD++R FP
Sbjct  222   VIRGLLANFGVVINRP--KEKSVQDLTQTLWKFLKGRRYIIVLDDMWSTQVWDDMKRMFP  279

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPE---I  1065
             DD NGSRI+LTTRL+ VAVY+  S      +  L+ ++SW L  Q++ G    PPE   +
Sbjct  280   DDGNGSRIMLTTRLQGVAVYATDSFSPPHRIRLLDKDKSWHLLCQEVFGQEGCPPEFQEL  339

Query  1066  EEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTL  1245
             E+IGK I + C+GLPLA  V  GLL+ +  + E W  +A  +N  +T +  +QCS IL+L
Sbjct  340   EDIGKMIAHNCKGLPLAARVVGGLLANSAMTREFWGYVADNVN-SITIENDEQCSEILSL  398

Query  1246  SYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDL  1425
             SYN+LP+HLK CFLY G FP+   EIP   L+ LWI EGF+     +SLE  A  YL DL
Sbjct  399   SYNHLPHHLKPCFLYLGAFPE-DYEIPVTKLIRLWIAEGFLRPSRSKSLEVAAEGYLNDL  457

Query  1426  IDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF  1605
             IDRNLV++ +    G  +TC +HDLL DLCL+E + E F+   ++ ++       + P  
Sbjct  458   IDRNLVIVRQRGSNGKTRTCTMHDLLRDLCLKEAQNENFLHIINRSAQF------SPPDM  511

Query  1606  EYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDL  1785
             +   R L        P+ +D     +S TL      +G     V + Q  SF+ +RVLD 
Sbjct  512   DNIPRRLIMHLDI--PEGNDITECMESMTLTRSVLCTGRVLSTVPFYQ--SFRFLRVLDF  567

Query  1786  VEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNL----QTLIVKFPNSC--Riee  1947
             +E  F E P F    L+ LRYLA  T +   VL    +L    Q LI+K   +   R   
Sbjct  568   LETEFSEFP-FAFLFLVNLRYLAF-TFQSFPVLPSKISLLWKLQILIIKDQQNLLNREYF  625

Query  1948  idsdeeiGSKWLQGLWKSQSLRFIKYP---YPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
                           +++   LR ++      P PID +   V   L TL  V   RCT+E
Sbjct  626   PYFQSYCEVDTPSEVFQMAQLRHVQMTEIFLPNPIDKENPVVLKDLETLCTVANFRCTEE  685

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETW--WD--NLHYLTKLEKL-IVEDIESEQFELQSIN  2283
              + K PN+K LG+          E W  +D  NL  L+KLE L  V +    +  L ++ 
Sbjct  686   VLRKFPNLKKLGVY---YYGAGIEDWSAYDLKNLVRLSKLENLKCVFNWPPNETLLPNL-  741

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYI  2463
             SFPQSLK+L + G+ L W+ ++II  LP+LE LKL Q    G  W   +  F +LKFL I
Sbjct  742   SFPQSLKKLTLDGSNLSWKGMSIIGSLPHLEVLKLKQYAFTGAVWKPVEREFSRLKFLLI  801

Query  2464  SGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKD  2643
                +L  W   + HFP LE L +  CH+L+ IP G  DI TL++I++ DC  S V S + 
Sbjct  802   EKMRLVRWIAENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQ  861

Query  2644  IQEEQSSYGNDQLVVR  2691
             I EEQ    N+ L VR
Sbjct  862   ILEEQRDMENNVLQVR  877



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score =   419 bits (1076),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 311/906 (34%), Positives = 474/906 (52%), Gaps = 73/906 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TS++ T+E Q  +  P L+ + ++ I  L   L  L+  LE++   +N   A K
Sbjct  1     MAYAVITSILTTIE-QVFQFNPRLISESRESIDSLYGTLSILQDFLEDTGNWINDQDALK  59

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHE------RLHQILQRLAEDIEGL------  402
              +  +++D  ++AED I+  +  I      HE      + +  LQ + E ++ +      
Sbjct  60    LLEKKIRDAGYKAEDTIDCCLRRIHVADTDHEQNNARRKFYDELQEIIEAMDSIQGDVMK  119

Query  403   ---IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ  573
                + +R      ++Y P +S            L ++  +VG        ++ L    T 
Sbjct  120   FKNVHKRIKDVPATTYLPPRS--------PGRVLDEENTLVGMEDVFNNIRDQLFG-QTP  170

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
                V+SIVGMGGIGK+T+A+ +++ PS+  RF +  W TVSQ Y+ + +L D+      +
Sbjct  171   ALNVVSIVGMGGIGKSTLARSLFNHPSVSRRFDISSWVTVSQAYNAKEMLLDVLS-FGIL  229

Query  754   TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTT  933
               K +    S  EL ++VRR+L R+RYL+V+D+IW    WD+++R FPDD NGSRI++TT
Sbjct  230   DGKAMYRNTSEDELLDQVRRKLKRKRYLIVLDNIWTIEAWDEVRRSFPDDENGSRIMITT  289

Query  934   RLKEVAVYSGCSGKYVC--NLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRG  1104
             RL EVA    C+       ++P L+  +SW L S K+ G+ + PP++EE+G +I  +C+G
Sbjct  290   RLLEVA---NCASNDFSPHHMPLLSLEDSWKLLSLKVFGNEDCPPQLEEVGNQIAKQCQG  346

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             L L+I V AGLLSK  R+ + WQ IA  +N  + S    QC  IL LSYN LP  LKACF
Sbjct  347   LALSIVVIAGLLSKINRTHDEWQQIADNVNSHIGST-SRQCLAILALSYNYLPCSLKACF  405

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LY G+F +   EIPT  L+ +W+ EGF+     +  EE A + L+DL+ R+L++++   +
Sbjct  406   LYMGVFLE-DAEIPTDTLIRIWVAEGFLKTICHKKPEEVAEECLEDLVSRSLIMVNSRGW  464

Query  1465  I-GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             + G I+TC++HDL+  LCLR+ K EKF    ++  E   E  ++E      +R L +   
Sbjct  465   VSGKIRTCKIHDLIRLLCLRKGKTEKFFHVINECYEVSSEGVESE------HRLLLYEDA  518

Query  1642  YIQPKFS-DKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS--FKMIRVLDLVEISFDEAP  1812
                      + N    RT+L        S L   + + V   F+++RVLD++ I F   P
Sbjct  519   VQNQNLGLQEGNLDSVRTILCICE-PCTSMLEFEYYKIVDTHFQLLRVLDVLMILFQLFP  577

Query  1813  TFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG  1989
             T +I+ L+ LRYLA  T   V   + +  NLQTLIV+ P   ++            W   
Sbjct  578   T-EITQLVHLRYLAFTTGGDVPTSISNLWNLQTLIVE-PTENQL-----------SWPVE  624

Query  1990  LWKSQSLRFIK-----YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLG  2154
             +WK  SL++ +      P P P     I   +    L         +E  + +PNVK L 
Sbjct  625   IWKMSSLKYFQSGGMSMPVPAPPKAQHILGLEKFKKLSLNEASSNWEEICMAVPNVKELD  684

Query  2155  IKCS-EIRAFQTETWWDNLHYLTKLEKLIVE-DIESEQF-----ELQSINSFPQSLKELK  2313
             +  + +I       +  +L  L  L+KL ++  + S          Q    FP++LK L 
Sbjct  685   VIINLDIHPNGWNDFIGSLICLVDLQKLSIQLKVSSHPLFFIRRPAQLWYVFPENLKSLT  744

Query  2314  IVGTELGWEAITIISMLPNLESLKL-LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE  2490
             +V T L W  + ++S LPNLE LKL    +E G  W   +GGF KLK L+I   +L +W+
Sbjct  745   LVATHLEWTDMPMLSSLPNLEVLKLEFYGFE-GSNWNLDEGGFKKLKLLHIHQTRLVHWQ  803

Query  2491  TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYG  2670
               SD  PVLE L L  C  LE+IP    DI TL+LI+L  C  + V SA +I EEQ S G
Sbjct  804   AASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAGEILEEQKSIG  863

Query  2671  NDQLVV  2688
             N+ LVV
Sbjct  864   NEVLVV  869



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score =   421 bits (1083),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 320/933 (34%), Positives = 480/933 (51%), Gaps = 139/933 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD---------------YKDEIQCL---RQKLCHl  204
             MA   + SL+R++E + ++ +P L+ D               ++D ++     RQK C  
Sbjct  1     MANAAVISLVRSLE-ELVQRKPHLISDETRRMVDSVLDSLEYFQDFLESTSKRRQKYCR-  58

Query  205   kalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQR  378
                         V + E+++   V+    +AED IE ++M  I    G S   L  ++ +
Sbjct  59    -----------KVEELEREIRMEVE----KAEDVIELKIMYGIMKKEGLSKTFLRTLVGK  103

Query  379   LAEDIE------------GLIEQRNTTQMLSSYNPGQ------SNQEHIIAGGAS----K  492
             +    E              I+   +  M SS+   Q      S  E ++ G +S    K
Sbjct  104   IDAPRERKAIRKTLLPFVKKIDAVKSNVMGSSFGTNQVQGYDDSTNEDLLPGLSSRNVAK  163

Query  493   LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFH  672
             L  + I+VG   +L R    L +  T  R++I I+GMGGIGKTT+A+K +DD   R RF 
Sbjct  164   LNPENIVVGLEDDLVRIIRRL-KGPTLTREIIPILGMGGIGKTTLARKAFDDFETRHRFD  222

Query  673   LLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDD  852
             +  W TVSQ+Y ++ +L D+  C    T  E NE KS   L + + ++L   RYL+V+DD
Sbjct  223   IRIWVTVSQEYRIKGMLLDILRC----TSDETNE-KSNDRLMDMIYKKLKGWRYLVVMDD  277

Query  853   IWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGC-SGKYVCNLPFLNSNESWMLFS  1029
             IW +  WD + R FPDD+NGSRI+LT+R +EVA ++   S  +  NL  LNS+ SW L  
Sbjct  278   IWSNDVWDLMTRTFPDDNNGSRIILTSRQEEVANHADPHSNPHKMNL--LNSDNSWKLLR  335

Query  1030  QKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPM  1203
              K+  +    PPE+E+IG+++  +C+GLPLA+ V AG LSK  R+ E+W+ +A +++  +
Sbjct  336   DKVFGVEHACPPELEDIGEQVAQRCQGLPLALLVVAGHLSKISRTQESWKDVAKSVS-KV  394

Query  1204  TSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMED-S  1380
              +D  D C  +L++SYN LP HLK CFLY G+FP+    +    L+NLWI+EGF+ ++  
Sbjct  395   VADESDICLGVLSMSYNYLPDHLKPCFLYMGVFPE-DSVVNIVRLINLWISEGFISDELE  453

Query  1381  GRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKF--VSAF  1554
             GR         L+DL+ RNLV++   SF G  KTC +HDL+ DL LRE +KEKF  V+  
Sbjct  454   GRDC-------LEDLVSRNLVMVRNRSFNGEAKTCGVHDLIRDLILREAEKEKFLEVTRI  506

Query  1555  HQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKS------------RTLL  1698
             H+ +    E                      + + + +Y FH              RTL 
Sbjct  507   HEAANPSAE----------------------KLRSARRYCFHSCDQTVFWKLSSIIRTLH  544

Query  1699  FFFGVSGASG-LPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV  1875
             FF G    S  +P+     VSFK++RVL ++ ++F   P  +I+ L+ LRYL       +
Sbjct  545   FFDGFQKLSKQVPLL----VSFKLLRVLAILNVTFQTFP-LEITKLVQLRYLQFTCYDDI  599

Query  1876  R-VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPID  2046
                +   HNLQT I+ +              +      G+W+  +LR +     + FPI 
Sbjct  600   HWSVSKLHNLQTFILGY---------GVAGLLPPTIPAGIWQMSNLRHLHIGDFFSFPIP  650

Query  2047  TDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKL  2226
             ++++     L  L  +    CT E    IPN+K L I  + +   + E   ++L  L KL
Sbjct  651   SNKL---QNLQELSRLALTSCTSELFSAIPNLKKLKIIGNYLMEMKRER-LNSLSCLKKL  706

Query  2227  EKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
             E L   D   +  ++ S    P SLK L +  T L W+ +  +  LPNLE LK+     +
Sbjct  707   EILKYRDDGIQPSQIPSKYVLPASLKRLTLSCTSLPWKDMANVITLPNLEVLKIKDNGFL  766

Query  2407  GEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDIT  2583
             G+EW+  D   F +LKFL IS   LK+W+  S +FP L+RL L  C NLEKIP+ F +I 
Sbjct  767   GDEWMLNDEEIFKQLKFLLISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEKIPQDFGEIC  826

Query  2584  TLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
             TL+ IEL  C  S  +S KDIQEEQ S GN+ L
Sbjct  827   TLESIELHKCSISAAKSGKDIQEEQESMGNECL  859



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score =   415 bits (1066),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 294/824 (36%), Positives = 440/824 (53%), Gaps = 76/824 (9%)
 Frame = +1

Query  343   ASHERLHQI----LQRLAEDIEG----LIEQRNT-TQMLSSYNPGQSNQEHIIAGGASKL  495
             AS +R + +    LQR+ E+ +     ++E RN  ++ L+  N   +    + +GG +  
Sbjct  14    ASFQRSYTVFCEELQRVVENFDSAKLQVMEFRNMGSKNLAPKNSFSAGSLRLASGGKNS-  72

Query  496   QDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHL  675
                  MVG   E+ + K+ L    + +  VISIVGMGG GKTT+A+ +YDD  I   F+ 
Sbjct  73    -----MVGFVDEMLQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHFYT  127

Query  676   LGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDI  855
               W T+SQ+Y LR IL  L   + ++T K+  +  S  ELA  + + L  +RYL+V+DD+
Sbjct  128   RAWVTISQEYHLREILLGLLMSMKKLTGKKCED--SYEELAEYLYKSLKGRRYLIVLDDM  185

Query  856   WGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK  1035
             W  + W++++  FPDD NGSRI+LT+R+ +VA+Y+  S     N+ FLN+NESW L  +K
Sbjct  186   WDIQVWNEIKLLFPDDGNGSRIILTSRISDVALYAS-SNSPPYNIRFLNNNESWDLLKEK  244

Query  1036  L-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSD  1212
             +    N P E+E +GK+I   C+GLPLAI +  GLL+K +R+  +W+++A   N+P    
Sbjct  245   VFQDENCPTELEGLGKKIARSCQGLPLAILLVGGLLAKIQRTQNHWRNVAE--NVPSIIS  302

Query  1213  LH-DQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRS  1389
              H DQC  IL+LSYN+LP HLK CFLY G+FP+   +IP   L+ LW  EGF+      S
Sbjct  303   THNDQCLEILSLSYNHLPQHLKMCFLYMGVFPE-DYQIPVSKLIRLWAAEGFLKPCGDES  361

Query  1390  LEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSE  1569
             L++   KYLQDLIDR++VL+SK    G I+TC +HDL+ DLC+RE +KEKF+     R+ 
Sbjct  362   LDDVGEKYLQDLIDRSIVLVSKRKLSGKIRTCSIHDLVRDLCVREAQKEKFI-----RTI  416

Query  1570  NVIELGDTEPLFEYANRWL---------TFRTTYI-------QPKFSDKYNFHKSRTLLF  1701
                +   +E  F Y    L         +FR   +         +  + Y+  +S  L+ 
Sbjct  417   KTDDDLSSEDAFGYRRLCLHSSILHDDASFRRDSVIAVREHSDGRLKEIYDAMRSSPLIH  476

Query  1702  FFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALG-TIKYVR  1878
                 +G    P++    + F ++RVLD + ++F   P  ++ +L+ LR+LAL    +  R
Sbjct  477   CLIFTGTYHKPLNIF--LRFGLLRVLDALSVTFFWFP-IEVLELVNLRHLALTFDGELPR  533

Query  1879  VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR--------FIKYPYP  2034
             ++    NL+ LIV                  S     +W+   LR        F  YP  
Sbjct  534   MVSDLQNLEILIVH----------QVFWGPLSYLPLEIWRMPRLRHLEFKEVFFPNYPGT  583

Query  2035  FPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETW----WD  2202
                  +   +++ L TL  +   R T++    IPNVK L I     +   T  W     D
Sbjct  584   LYYGKNTFSLEN-LQTLVGIRDFRVTEDVYKSIPNVKKLEIVYD--KNSNTTEWSLYCLD  640

Query  2203  NLHYLTKLEKLIVE--DIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLE  2376
             NL +L +LE L     D   ++ +L  + +FP  LKEL ++G E+  + +T I  L NLE
Sbjct  641   NLVHLHQLESLKCHFLDAHRQKPDLPDL-TFPSKLKELSLLGWEIPSKYMTTIGSLHNLE  699

Query  2377  SLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEK  2556
              LKL       +EW   +G F +LK L + G  +  W   +DHFP LE+L + HC  LE+
Sbjct  700   ILKLRFCSLRDDEWELSEGEFYRLKILVLEGMNIVQWRAEADHFPSLEQLIIKHCRKLEE  759

Query  2557  IPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             IP GF DI TLQLI++ +   S   SA  I E+Q S GN  L V
Sbjct  760   IPPGFGDIPTLQLIKVVEGSRSCESSAMQILEDQQSLGNYGLKV  803



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score =   417 bits (1072),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 320/940 (34%), Positives = 477/940 (51%), Gaps = 103/940 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  + SL++T++L    P P L     D+   L +KL +LK  LE   +        K
Sbjct  1     MAYAAVNSLLQTLDLVIF-PNPYLTSQDDDQFASLGEKLRYLKGFLEGFVRSRGDHGKVK  59

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLS-  435
              +  +++D   RAED +E+ +  + S   S     +  +   E ++ +IE+ ++ +  + 
Sbjct  60    VLERQIEDSVNRAEDIVETYLYTVRSTVKSKNSRRKDYKIFQEGLKQVIEEIDSVKKEAV  119

Query  436   -----SYNPGQSNQEHIIAGGASKLQDDAI--MVGHAQELERTKEMLLQCSTQERQVISI  594
                   Y+P   +    + G +S     +   +VG   +L + K+ L        ++++I
Sbjct  120   EICGNPYDPNNLHSGRYLFGSSSWHVPSSANPVVGLDNDLVKIKDQLTGLPYN-LEILTI  178

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK----  762
             VGM GIGK+T+AK +YDDP I   F++  W TVSQ+Y+++ IL  L   VAQ+TD     
Sbjct  179   VGMAGIGKSTLAKIVYDDPLIVYHFYVRAWITVSQEYEVKNILIGLIRSVAQLTDDISAK  238

Query  763   -------------EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD  903
                           IN++ S  +LA ++ R L  +RYL+++DDIW +  WDD++R FPDD
Sbjct  239   YDDSEQHYKVLKDGINQL-SDQKLAEQLYRSLKGKRYLIIMDDIWCNTAWDDVKRSFPDD  297

Query  904   SNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGK  1080
              NGSRI+LT+RL EVA+Y   SG    ++ FL+ ++ W L   K         E+EEIGK
Sbjct  298   KNGSRIILTSRLTEVALYVN-SGSPPHHMRFLSVDQGWELLKLKAFPKQGCSLELEEIGK  356

Query  1081  RIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNL  1260
             +I  KC+GLPLAI V AG LSK  +  + W ++A  +   + +   +Q   I+ +SYN+L
Sbjct  357   QIAEKCQGLPLAIVVVAGHLSKLSKKRDLWLNVADNVG-SLVARNREQFLNIIAMSYNHL  415

Query  1261  PYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNL  1440
             P+HLKACFLY G FP+   EIP   L++LWI EGF+  + G+S+E+ A +YL+DLIDR+L
Sbjct  416   PHHLKACFLYMGAFPE-NVEIPVWRLISLWIAEGFLKRELGKSVEKVAQEYLEDLIDRSL  474

Query  1441  VLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSA-------FHQRSENVIELGDTEP  1599
             +L  K +    + TCR+HDLL D CLRE +KE F          F +  +N   L     
Sbjct  475   ILAEKRTN-DRVTTCRMHDLLRDFCLREAEKESFWHVMRRNDLFFPEGLQNHRRLCVQSD  533

Query  1600  LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFF----FGVSGASGLPVSWRQNVSFKM  1767
             +F YA       T Y  P+     + + S  L FF    F + G             FK+
Sbjct  534   IFSYA------ITEYSNPQVRTFLSSNFSTRLSFFSESVFALMG-------------FKL  574

Query  1768  IRVLDLVEISFDEAPTFDISDLILLRYLALGTIK----------------YVRVLKHHH-  1896
             +R+LD++   F+  PT  +  +I LR+L L T                  Y+   K    
Sbjct  575   LRILDMISYYFNHFPT-QVLKMIHLRFLGLSTSGELPAASSKLRRGSGKWYLPFSKRSEL  633

Query  1897  --------NLQTLIVKF---PNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPI  2043
                     NLQ LIV +    N C   +I +  ++    L+G         + +   F  
Sbjct  634   PVSISNLVNLQILIVNWGWRENHCLPFDIQTMTQLRHIRLKG-------AVVYFDDLFLA  686

Query  2044  DTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYL  2217
             +T      V   L TL  V     +K+ V  IPN+K LGI  S+        + + L  L
Sbjct  687   ETSRANPLVLSNLQTLLTVSSTNFSKKIVSIIPNLKKLGILVSKKNDEHPTNFLNYLSSL  746

Query  2218  TKLEKLIVE-DIESEQFE-LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLL  2391
               LE L +   +++E+   +   N+FP +L+ L + G+ L WE +  +  +PNLE LKL 
Sbjct  747   HCLETLNLSFSLQNEKSSTISQWNAFPPNLRALTLSGSHLPWEEMVTVGKIPNLEVLKLK  806

Query  2392  QAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGF  2571
                  G+ W   DGGF  LKFL +   +L+ W+  S H+P L+ L L  C  L +IP G 
Sbjct  807   DRAFSGQVWEPIDGGFLALKFLLLENNELEIWKATSTHYPSLQHLVLRLCDALIEIPCGI  866

Query  2572  TDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              +I TLQ+IEL  C  S V SAK I EEQ S GND L VR
Sbjct  867   GEIPTLQIIELYSCGHSAVRSAKRIHEEQQSIGNDDLEVR  906



>gb|ABY61745.1| resistance protein PSH-RGH6 [Solanum tuberosum]
Length=873

 Score =   416 bits (1068),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 319/927 (34%), Positives = 483/927 (52%), Gaps = 119/927 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++I+ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKIESLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q   T+  +    P  S+     EH         Q + IMVG+  E E   + L++   
Sbjct  108   KQWMATSDSMKDLKPQTSSLVSLPEHAFE------QPENIMVGYENEFEMMLDQLVR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I  RF +   ATVSQ+Y +R +LQ L   ++ 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPCIMPRFDIRAKATVSQEYCVRNVLQGLLSSISD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD +NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTETWDDIKLCFPDCNNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +N  ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPHHMRLMNFEESWNLLYKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  ++++ WQ++A  ++  +++DL  QC  +L LSY++LP HLK+
Sbjct  329   GGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAQCMRVLALSYHHLPSHLKS  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   +I   +L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  L
Sbjct  389   CFLYFAIFAE-DEQIYVNNLVELWGVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNL  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I+ C +HD+  +LCLRE +   FV+    +S+        +  F+  +R      
Sbjct  448   SFDGEIERCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRICIHNE  507

Query  1639  TYIQ-PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPT  1815
               +   + S+ ++   SR    F  V+            +SFK++RVLDL    F   P+
Sbjct  508   EELAWCRNSEAHSIIMSRR---FKCVT----------LELSFKLVRVLDLGLTRFPIFPS  554

Query  1816  FDISDLILLRYLALGTIKYVR-VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
               +S LI LRYL+L     ++  L     + + I+  P S               +LQ  
Sbjct  555   GVLS-LIHLRYLSLCFYPCLKQYLGSKEAVPSSIIDIPLSISSLC----------YLQT-  602

Query  1993  WKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR----------------------  2106
             +K     F +YP+  P +   +P    LH + W  YL+                      
Sbjct  603   FKLYFPFFYRYPFILPSEILTMPQLRKLH-MGW-NYLQSHEPTENRLVLKNLQCLTQLNP  660

Query  2107  --CTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVED---IESEQ  2262
               CT  F    PN+K   V G+       F+      +  YL +LEKL+       +   
Sbjct  661   RYCTGSFFRPFPNLKKFEVFGVP----EDFRNHKDLYDFRYLYQLEKLVFSSYYPTDVPT  716

Query  2263  FELQSINSFPQSLKELKIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGF  2439
               L   ++FPQ+LK L   G   L W+ ++I+  LP LE L+L     +GEEW   + GF
Sbjct  717   LLLPPPDAFPQNLKSLAFKGNFLLAWKDLSIVGKLPKLEVLQLSGNAFIGEEWEVVEEGF  776

Query  2440  PKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFP  2619
             P LKFL++    ++ W   SDHFP LERL L  C+NL+ IP  F DITTL LI++ DC  
Sbjct  777   PHLKFLFLDNLNIQYWRASSDHFPYLERLFLRGCNNLDSIPRDFADITTLALIDISDCQQ  836

Query  2620  SLVESAKDIQEE-QSSYGND-QLVVRD  2694
             S+  SAK IQ++ Q +YG+  ++  RD
Sbjct  837   SVGNSAKQIQQDIQDNYGSSIEVYTRD  863



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score =   416 bits (1070),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 323/945 (34%), Positives = 471/945 (50%), Gaps = 120/945 (13%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
              Y  +TSL+ T++L   +    L  D+K+ ++ L  K+      + E     +  +  KD
Sbjct  4     VYAAVTSLMGTIQL-ISQSTSDLQEDHKEHLKLLYDKV----GSMLEFLDTNSDDEPMKD  58

Query  262   VIARVKDISFRAEDEIESE---------------VMEIISNGASHERLHQILQRLAEDIE  396
             ++  VKD++ + EDE+ES                V  + +N  +H RL  ILQR  +DI+
Sbjct  59    LLKNVKDVAHKVEDEVESHIQREAQKKLLKMLQRVFHLPTN--AHSRLLMILQRAIKDID  116

Query  397   G----LIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
                  L++ R       + + G S         AS L+ + +     QEL   +   L+ 
Sbjct  117   SVNRELLKLRENNMRAGNCSLGASTSSQ---SNASTLEKEIVGYNIEQELMLGQ---LRG  170

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQDL  732
              + + +VISI GMGGIGK+T AK+I+ DPSI S F +  W  VS+DY +R+    +LQ+ 
Sbjct  171   HSSQLEVISIFGMGGIGKSTFAKRIFFDPSILSFFDIRAWIVVSKDYSIRKMLLSLLQNA  230

Query  733   CGCVAQMTDKEINEV-----KSTAEL-----------ANKVRRRLMRQRYLLVVDDIWGS  864
              G   +   K   E      KS  +L           A+++++ L  +RYL+VVDDIW  
Sbjct  231   IGVDEEADKKSDGEQPNRLQKSDGDLEDGLQKIDDALADRLQKSLKGRRYLIVVDDIWSR  290

Query  865   RGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-G  1041
               WDD++ CFP+++N SRILLTTR  +VA Y+  S K +  + FL   ESW LF QK+ G
Sbjct  291   EAWDDVRLCFPENNNRSRILLTTRDMKVAQYAS-SPKDLFPMRFLEPKESWHLFCQKVFG  349

Query  1042  SINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHD  1221
               + P E E + K +V+ C+GLPL I+V AG LS +K++++ W  +A ++   +  D + 
Sbjct  350   KKDCPTEFENVAKEVVSNCKGLPLMISVVAGTLS-SKKTMDGWIKVAQSVISSVDLDDYQ  408

Query  1222  QCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEG  1401
              CS +L LSYN+LP +LKACFLYFG+FPK   EI  K L  LWI EG +       L + 
Sbjct  409   HCSRVLGLSYNHLPSYLKACFLYFGVFPKAS-EISVKKLTRLWIAEGLLELKGSEGLGQV  467

Query  1402  AMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIE  1581
             A   L DLID++LV++SK S    IKTCR+HDLL DLCLRE + E  +   +  S  V  
Sbjct  468   AANILHDLIDKSLVVVSKQSLDDKIKTCRIHDLLHDLCLREGESENLLYVAYLGSRRVSS  527

Query  1582  LGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSF  1761
              G          RW++         ++   N   S+     F  S      +S +    F
Sbjct  528   QG----------RWVSVNPERGYDSYALLENLTHSKIRSIHFHPSDLVRHQLSIKL-FHF  576

Query  1762  KMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHH-----NLQTLI----  1914
             K++RVLDLV I     P   +  L  LRYLA+  +      +H       NLQT I    
Sbjct  577   KLLRVLDLVTIRLVSFP-IGVVHLASLRYLAV--VVNFETSEHQSISNLWNLQTFIFSIS  633

Query  1915  ------VKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP-----YPFPIDTDEIP  2061
                   V  PN                   G+W+   LR +         P  +  +E+ 
Sbjct  634   LPQIDLVHLPN-------------------GIWEMSQLRHLHSTRMSLYSPPKVSANEVK  674

Query  2062  --VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL  2235
               V + L ++  +    CTKE    I NV+ LGI  +E          DNL YL +LE+L
Sbjct  675   YCVLENLQSVSGLSPCCCTKEIFEGIKNVRKLGISGTEDEFDYEPICLDNLIYLHELEEL  734

Query  2236  IVEDIESEQFE----LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----  2388
              +      +++    L   +SFP +LK+L +  T L WE +TIIS LP LE L+L     
Sbjct  735   KISSYILTRYDVLLSLPFASSFPPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAF  794

Query  2389  LQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEG  2568
             + +Y +   W   + GF +LKFL +    L  W    D+FP LE + + +C  L++IPEG
Sbjct  795   VISYPVDTVWEVTEMGFLELKFLLLEWLDLDYWRAADDYFPCLEHIVIRNCRTLKEIPEG  854

Query  2569  FTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDT  2703
             F D  TLQ I+L  C  SLV  A+ IQE   S GN+ L V  ++T
Sbjct  855   FADSLTLQQIQLHRCTSSLVTFAEQIQENHESLGNNMLKVYSFNT  899



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score =   415 bits (1066),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 318/931 (34%), Positives = 480/931 (52%), Gaps = 116/931 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAYV + SLIRT+E Q ++ +P LV    DE + L     HL +L    +   N S+  K
Sbjct  1     MAYVAVISLIRTLE-QLVQRKPHLV---SDETRTLMDS--HLDSLEYFQDFVENTSKGSK  54

Query  259   DV-----IAR-VKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEG-------  399
             D      + R ++ +   AED IE ++ E I   A  + L + L  L  ++ G       
Sbjct  55    DCGKVEELERLIRKVVEEAEDVIELKIYETIKRDALSKILLRTLDALKREVMGCRFGKNN  114

Query  400   -----------------LIEQRNTTQ---MLSSYNPGQ-------SNQE----HIIAGGA  486
                              LIE+ +  +   M SS+   +       +N+E      + G +
Sbjct  115   VLNETMEKKALRKTLSRLIEKIDVVKRNVMESSFGTNELQGYGDPTNEELQTRDSLLGHS  174

Query  487   SK----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPS  654
             S+    L  + ++VG   +L + K  L    +  R+++SI+GMGGIGKTT+AKK YDDP 
Sbjct  175   SRQVANLNLENVVVGLEDDLLKIKRRLTGPPST-REIVSILGMGGIGKTTLAKKAYDDPE  233

Query  655   IRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA--ELANKVRRRLMRQ  828
             IR RF +  W TVSQ+Y +R +L  +   ++Q+T    N++K++   EL   + ++L  +
Sbjct  234   IRHRFDIHIWVTVSQEYRVRVLLLGVVSFLSQLT----NKIKTSTDDELMEAIYKKLKGR  289

Query  829   RYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSN  1008
             RYL+V+DDIW S  W+ + R FPDD+ GSRI+LT+RLK++A+ +         +   NS+
Sbjct  290   RYLVVMDDIWSSEVWELMTRIFPDDNCGSRIILTSRLKDLAMQAD-PNSTPHEMRLFNSD  348

Query  1009  ESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIA  1182
             ESW L ++K+  +    PPE+E +G+++  KC+GLPLAI V AG LSK  R+ E+W  +A
Sbjct  349   ESWKLLNEKVFGVEQVCPPELEVLGRQVAQKCQGLPLAILVVAGHLSKIARTRESWIEVA  408

Query  1183  SAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEG  1362
              +++  + ++  D C  +L +SYN LP HLK CFLY G+F +   E+  + L+NLW++EG
Sbjct  409   KSVS-KVVANESDICLGVLAMSYNYLPNHLKPCFLYMGVF-REDSEVNIETLINLWVSEG  466

Query  1363  FVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKF  1542
             F++E      E      L+DL+ RNL+++ K  F G  KTC +HDL+ DL LRE +KEK 
Sbjct  467   FLLE------EFVGKDCLEDLVSRNLIMVRKRRFNGEGKTCGVHDLIRDLILREAEKEKL  520

Query  1543  VSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGA  1722
             +         VI       +  Y+     +   +    F+        RT+ FF G+S  
Sbjct  521   L--------QVIPSARKLRVRRYSIHSYAYGVAFRDSSFT--------RTVHFFHGLSR-  563

Query  1723  SGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKHHHN  1899
                P+  R    FK++RVL +    F + P   I++L+ LRYL L     + R++   +N
Sbjct  564   --FPLLER----FKLLRVLAIHNCCFQDFPVV-ITNLVHLRYLELYCEDNIHRLVSELYN  616

Query  1900  LQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPIDTDEIPVQDT  2073
             LQTLI                   S+  + +W+ + LR +     + FPI + E+     
Sbjct  617   LQTLIFHHQR-----------LYTSRVPETIWQIEHLRHLHVTDFFSFPITSREVKPGFK  665

Query  2074  LHTLYWVPYL---RCTKEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLEKLI  2238
             L  L  +  L    CT E    IPN+K L +     E    +   + ++L  L +LE L 
Sbjct  666   LQNLERLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELEMLK  725

Query  2239  VEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW  2418
                   +   + S  + P  LK L +  T L WE +  I MLPNL+ LK+      G+ W
Sbjct  726   FNGDGLQLPRIPSKFALPVCLKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVW  785

Query  2419  VTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQL  2595
                D   F +LKFL IS   LK+WE  S +FP LERL L  C+ LE+IP+   +I TL  
Sbjct  786   KLNDEEVFNQLKFLLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLAS  845

Query  2596  IELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             IEL +C  S  +S  +IQEEQ S GND L V
Sbjct  846   IELHECSISAAKSVNEIQEEQESMGNDCLSV  876



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score =   415 bits (1067),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 270/753 (36%), Positives = 407/753 (54%), Gaps = 82/753 (11%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +V  ++GM GIGKTT  KK+YD P +   F++  W T+SQ Y++R +L  +  CV  ++ 
Sbjct  178   KVFPVIGMAGIGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYIS-  236

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             KEI E K   EL  +V R L  +RYL+V+DD+W +  WDDL+R FPDD NGSR++LT+RL
Sbjct  237   KEIYE-KRDEELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRL  295

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLA  1116
             +++AV++ C      ++  L+ +ESW L S K+      P E+  IGK+I  KC+GLPLA
Sbjct  296   RDIAVHA-CQDTSPHSMRCLSIHESWELLSSKIFVDEPCPMELLTIGKQIACKCQGLPLA  354

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V  GLLSK  + ++ W ++A ++   +  +  D C  IL LSYN+LP HLKACFLY G
Sbjct  355   IVVVGGLLSKMDKKLDVWDNVAQSVGSLVLGE-ADHCQNILALSYNHLPDHLKACFLYMG  413

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             IFP+   EI  K L+ LW+ EGF+     +SLEE A  YL+DLI R+L+++ + S  G I
Sbjct  414   IFPE-DYEISVKKLVWLWVAEGFIRLSMFKSLEEVAGDYLEDLIARSLIMVKRRSANGRI  472

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRW-----------  1623
             KTC +HDL+ +LC+ E +KE F     + SE +I       L++   +W           
Sbjct  473   KTCYIHDLMRELCVHESQKEGFFLVI-KSSEQLI----LTNLYDDKQKWTIGTKESAAVD  527

Query  1624  --------LTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL  1779
                     L+F +  +  K+ +  +F   +++++F  +S     P+ +    +F +++VL
Sbjct  528   KHLHNLRRLSFHSNIL--KYINTTSFQLVQSIMYFKKLSLPD--PLQYLGMKNFMLLKVL  583

Query  1780  DLVEISFDEAPTFDISDLILLRYLALGTIKYVRV--LKHHHNLQTLIVKFP-NSCRieei  1950
             D++ I     P+  I+DLILL+++AL  +    +        LQ LI+    + C     
Sbjct  584   DIMNIHLSIVPSV-IADLILLKFMALTIVNDFSMDSFITLRGLQILIIDCEWDGCLARI-  641

Query  1951  dsdeeiGSKWLQGLWKSQSLRFIKYP----------YPFPIDTDEIPVQDT---------  2073
                          LW    LR  +            Y     T  + +QD          
Sbjct  642   -------------LWDMLELRHFRLKRSCLSNSPIYYTKSASTSVLSLQDAEVRLRVLKN  688

Query  2074  LHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL------  2235
             L TL  +  + CT+E  L +PN++ LGI  +E   ++   W++ L +L +LE L      
Sbjct  689   LQTLSTIRPISCTQEVFLSVPNLRKLGIYQTE-EDYRFRGWFEQLVHLQELETLKYAFSN  747

Query  2236  --IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMG  2409
               +   ++ ++  L S  SFP  L +L + GT L WE +  +SMLP LE LKL      G
Sbjct  748   PFVSSALKPDR--LPSWRSFPPKLVKLTLSGTSLPWEDMVELSMLPKLEVLKLRNYAFSG  805

Query  2410  EEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTL  2589
               W + +GGFP+LKFL I    L+ W+    HFP L++L L HC  L++IP G ++   L
Sbjct  806   SVWKSREGGFPRLKFLLIGSTNLEIWDADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLL  865

Query  2590  QLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             + IEL  C  S V SA+ +QEEQ S GND L +
Sbjct  866   EKIELHCCKDSAVISARHLQEEQQSLGNDGLKI  898



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score =   414 bits (1065),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 318/931 (34%), Positives = 480/931 (52%), Gaps = 116/931 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAYV + SLIRT+E Q ++ +P LV    DE + L     HL +L    +   N S+  K
Sbjct  1     MAYVAVISLIRTLE-QLVQRKPHLV---SDETRTLMDS--HLDSLEYFQDFVENTSKGSK  54

Query  259   DV-----IAR-VKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEG-------  399
             D      + R ++ +   AED IE ++ E I   A  + L + L  L  ++ G       
Sbjct  55    DCGKVEELERLIRKVVEEAEDVIELKIYETIKRDALSKILLRTLDALKREVMGCRFGKNN  114

Query  400   -----------------LIEQRNTTQ---MLSSYNPGQ-------SNQE----HIIAGGA  486
                              LIE+ +  +   M SS+   +       +N+E      + G +
Sbjct  115   VLNETMEKKALRKTLSRLIEKIDVVKRNVMESSFGTNELQGYGDPTNEELQTRDSLLGHS  174

Query  487   SK----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPS  654
             S+    L  + ++VG   +L + K  L    +  R+++SI+GMGGIGKTT+AKK YDDP 
Sbjct  175   SRQVANLNLENVVVGLEDDLLKIKRRLTGPPST-REIVSILGMGGIGKTTLAKKAYDDPE  233

Query  655   IRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA--ELANKVRRRLMRQ  828
             IR RF +  W TVSQ+Y +R +L  +   ++Q+T    N++K++   EL   + ++L  +
Sbjct  234   IRHRFDIHIWVTVSQEYRVRVLLLGVVSFLSQLT----NKIKTSTDDELMEAIYKKLKGR  289

Query  829   RYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSN  1008
             RYL+V+DDIW S  W+ + R FPDD+ GSRI+LT+RLK++A+ +         +   NS+
Sbjct  290   RYLVVMDDIWSSEVWELMTRIFPDDNCGSRIILTSRLKDLAMQAD-PNSTPHEMRLFNSD  348

Query  1009  ESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIA  1182
             ESW L ++K+  +    PPE+E +G+++  KC+GLPLAI V AG LSK  R+ E+W  +A
Sbjct  349   ESWKLLNEKVFGVEQVCPPELEVLGRQVAQKCQGLPLAILVVAGHLSKIARTRESWIEVA  408

Query  1183  SAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEG  1362
              +++  + ++  D C  +L +SYN LP HLK CFLY G+F +   E+  + L+NLW++EG
Sbjct  409   KSVS-KVVANESDICLGVLAMSYNYLPNHLKPCFLYMGVF-REDSEVNIETLINLWVSEG  466

Query  1363  FVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKF  1542
             F++E      E      L+DL+ RNL+++ K  F G  KTC +HDL+ DL LRE +KEK 
Sbjct  467   FLLE------EFVGKDCLEDLVSRNLIMVRKRRFNGEGKTCGVHDLIRDLILREAEKEKL  520

Query  1543  VSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGA  1722
             +         VI       +  Y+     +   +    F+        RT+ FF G+S  
Sbjct  521   L--------QVIPSARKLRVRRYSIHSYAYGVAFRDSSFT--------RTVHFFHGLSR-  563

Query  1723  SGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKHHHN  1899
                P+  R    FK++RVL +    F + P   I++L+ LRYL L     + R++   +N
Sbjct  564   --FPLLER----FKLLRVLAIHNCCFQDFPVV-ITNLVHLRYLELYCEDNIHRLVSELYN  616

Query  1900  LQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPIDTDEIPVQDT  2073
             LQTLI                   S+  + +W+ + LR +     + FPI + E+     
Sbjct  617   LQTLIFHHQR-----------LYTSRVPETIWQIEHLRHLHVTDFFSFPITSREVKPGFK  665

Query  2074  LHTLYWVPYL---RCTKEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLEKLI  2238
             L  L  +  L    CT E    IPN+K L +     E    +   + ++L  L +LE L 
Sbjct  666   LQNLERLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELEMLK  725

Query  2239  VEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW  2418
                   +   + S  + P  LK L +  T L WE +  I MLPNL+ LK+      G+ W
Sbjct  726   FNGDGLQLPRIPSKFALPVCLKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVW  785

Query  2419  VTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQL  2595
                D   F +LKFL IS   LK+WE  S +FP LERL L  C+ LE+IP+   +I TL  
Sbjct  786   KLNDEEVFNQLKFLLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLAS  845

Query  2596  IELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             IEL +C  S  +S  +IQEEQ S GND L V
Sbjct  846   IELHECSISAAKSVNEIQEEQESMGNDCLSV  876



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score =   415 bits (1066),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 302/876 (34%), Positives = 452/876 (52%), Gaps = 105/876 (12%)
 Frame = +1

Query  268   ARVKDISFRAEDEIE----SEVMEIISNGAS---------------------HERLHQIL  372
             AR++D +  AED +E     E++ + SNG +                      ++ +Q L
Sbjct  56    ARMRDAANEAEDILEYLLFEEILSLDSNGGTPTFDLSPYRSRRSEAHRFQRKFQKQYQKL  115

Query  373   QRLAEDIEGLIEQ-------------------RNTT---QMLSSYNPGQSNQEHIIAGGA  486
               +A+D + ++E+                   R T+   Q+  S+ P  S+   ++A   
Sbjct  116   PGVADDFKSIVEEVVEAKSSLGVQHLQLTDSSRPTSAPMQLSDSFAPTSSS---VLAPA-  171

Query  487   SKLQDDAIMVGHAQELERTKEMLLQCS-TQERQVISIVGMGGIGKTTMAKKIYDDPSIRS  663
                ++DA MVG   +L   K  L  C  ++  + + I GMGGIGKTT+A+  YDD  I  
Sbjct  172   ---KNDA-MVGFEDDLMAIKTRL--CGESRNLEFVPIYGMGGIGKTTLARNAYDDRLIIQ  225

Query  664   RFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLV  843
              F    W TVSQDY ++ +L  +   +    +    +  S   +A    + L  +RYL+V
Sbjct  226   HFDTRAWLTVSQDYSIQEMLFAIIDSINAFNETFDEKKHSYERMAEHAYKGLKGRRYLVV  285

Query  844   VDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWML  1023
             +DDIW ++ WDD++R FPDD+NGSRI+LTTRL++VA Y+  S   +  + F++ ++SW L
Sbjct  286   LDDIWSTKAWDDMRRIFPDDNNGSRIILTTRLQDVAAYADPSSP-LHEMHFMDMDQSWNL  344

Query  1024  FSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLP  1200
               QKL      P E+E IGK I   C+GLPLAI V AGLLS   ++  +W+ IA  +N  
Sbjct  345   LRQKLFKEEPCPSELENIGKMIARSCKGLPLAIIVIAGLLSTVSQTQTSWEDIAEKVNSA  404

Query  1201  MTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDS  1380
             +T++  ++ + IL+LSY++LP+HL+ CFLY G FP+   EI    L+ LW+ EGF+    
Sbjct  405   VTAN-GEEFAKILSLSYSHLPHHLRPCFLYMGAFPE-DHEILVAKLVKLWVAEGFMKPSV  462

Query  1381  GRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQ  1560
              +S EE A +YL+DL+ R+LVL+++    G IK+C +HDL+ DLC R+ ++EKF+     
Sbjct  463   SKSFEERAEEYLEDLVKRSLVLVTRRKCNGKIKSCGVHDLVRDLCKRKAQEEKFLLNATD  522

Query  1561  RSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLP  1734
             R  N I L   E + +     +   +  + P  +   N +    RT+L F         P
Sbjct  523   RVGNKILL---ESMKDQHRLSICPSSLTVPPSLTLLSNIYSPIIRTILCF---QNCQSFP  576

Query  1735  VSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-----GTIKYVRVLKHHHN  1899
              S +   SF+++RVLD++++   E P   + +L  LRYLA      G +     +    N
Sbjct  577   SSLK---SFRLLRVLDVLKLIVMEFPA-QVLELFHLRYLAFSYGYKGDLYVPASISKLQN  632

Query  1900  LQTLIVKFPN-------SCRieeidsdeeiGSKWLQGLWKSQSLR----FIKYPYPFPID  2046
             LQTL + FP        SCRI            +   +W+   LR    FI  P P P  
Sbjct  633   LQTLFI-FPYWRNNEDCSCRI-----------HFPAEIWRMAQLRHLVSFILDPLPSPCS  680

Query  2047  TDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKL  2226
                    + L TL  V   +C K      P++K LG+  +  R F       NL +L +L
Sbjct  681   KSF--SLENLQTLALVANFKCAKRIGQIFPSLKKLGLIYNRDRIFLQVYQLHNLIHLRQL  738

Query  2227  EKL-IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYE  2403
             EKL I      ++  L    +FP +L++L + G  L  + +  +  LPNL  LKL +   
Sbjct  739   EKLKICIGSYWDRHPLWEKLAFPTTLQKLTLSGCVLSQQDMATVGSLPNLHVLKLRRCSF  798

Query  2404  MGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDIT  2583
                +W T +G FP+LKFL I    LK+W T S HFP LERL LH C  L +IP+G  +I 
Sbjct  799   RRGKWETTEGEFPRLKFLQIESENLKHWVTDSSHFPNLERLVLHDCGELGEIPDGIGEIP  858

Query  2584  TLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             TL+LIE+     SLV+SA  I+EEQ   GND L VR
Sbjct  859   TLELIEVPHWPKSLVDSAMRIKEEQQESGNDFLQVR  894



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score =   419 bits (1077),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 300/870 (34%), Positives = 462/870 (53%), Gaps = 103/870 (12%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEIISNGASHERLHQ------ILQRLAEDIEGLIEQRNTTQM  429
             A + +++   ED ++SE  +I+    + ER++       IL++ AE ++  ++Q     +
Sbjct  224   AEIIEVACNTEDMVDSESRKILFAETADERINAFWELFFILEQAAECVDSTMKQ--WMAI  281

Query  430   LSSYNPGQSNQEH---IIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVG  600
                YN  +  +     ++      L+ + +MVGH  E E  ++ + +   +E +V+SIVG
Sbjct  282   WDRYNNTRDQEIQNFSLVDISQHALEMENMMVGHENEFEIIQDQIAR-GARELEVVSIVG  340

Query  601   MGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVK  780
             MGGIGKTT+A +IY DP I SRF +   AT+SQ++ +R +L  L       TD E  E +
Sbjct  341   MGGIGKTTLANRIYCDPFIVSRFDIRAKATLSQEHCVRNVLLRLLSSTRGKTD-ECYEEQ  399

Query  781   STAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYS  960
                +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD +NG RILLTTR  EVA Y+
Sbjct  400   DDGQLADRLQKLLKGKRYLVVIDDIWTTEAWDDIKLCFPDCNNGGRILLTTRNVEVAEYA  459

Query  961   GCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAAGL  1137
               SGK   ++  +N +ESW L  +K+       PE E+IGKRI +KC GLPLAI V AGL
Sbjct  460   S-SGKPPYHMRLMNFDESWNLLHKKVFEKEYFSPEFEKIGKRIASKCGGLPLAIAVIAGL  518

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRR  1317
             LSK  ++++ WQS+A  ++  +++++  QC T+L LSY++LP+HLK CFLYF IFP+   
Sbjct  519   LSKMGKALDEWQSVAENVSSVVSTNIDVQCMTVLALSYHHLPHHLKPCFLYFAIFPE-DE  577

Query  1318  EIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHD  1497
              I    L+ LW +EGF+     +S+EE A K L++LIDR+L+ I  LSF G I++C +HD
Sbjct  578   LIFVDKLMELWASEGFLKVGEMKSIEEVAKKCLKELIDRSLICIHNLSFDGEIESCWMHD  637

Query  1498  LLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNF  1677
             ++ +LCLRE +   FV+    ++     L  T   F   +R    R +    ++ D    
Sbjct  638   VIRELCLREARNMNFVNVLRAKNGQTPRLQSTH--FSSISR---VRISVHLARYPDI---  689

Query  1678  HKSRTLLFFFGVSGASGLPVSW-RQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLA  1854
              + R+++ F G         +W  + + FK++RVLDL  +  D  P+ +I DLI LRYLA
Sbjct  690   -EVRSIICFSG---------NWFSELLHFKLVRVLDLTLMRCDRFPS-EILDLIHLRYLA  738

Query  1855  LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG----------LWKSQ  2004
             L     +       ++QTLI   P  C +  +++    G  W +G          +    
Sbjct  739   LTLSPSL------CHMQTLIDIPPQICSLCHLETFILSGD-WRRGWLYPLILPSEILVMP  791

Query  2005  SLRFIKYPYPFPI---DTDEIPVQDTLHTLY-WVPYLRCTKEFVLKIPNVKVLGIK----  2160
              LR ++  + + +    T++  V   L  LY W P+  C    +   PN+K L I+    
Sbjct  792   QLRLLRLDWNYFVYLEPTEKSLVLKNLQYLYGWNPWY-CNGSLLF--PNLKKLQIRGIGE  848

Query  2161  ----CSEIRAFQTETWWDNLHYLTK---------LEKLIVEDIESE------QFELQSI-  2280
                 C E+  F+     + L +            LE +      S+      +F ++S  
Sbjct  849   DFSSCKELYDFRCLDQLEELEFCLAYRNVDAACFLETVTPSGATSQDLLRRLKFSMESTS  908

Query  2281  ------------------NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
                               ++FPQ LK+L   GT L W  ++I+  LP LE LKL     +
Sbjct  909   LPLLPTDDALPHLLLPPPDAFPQRLKKLAFSGTCLQWMDLSIVGKLPKLEVLKLENDACI  968

Query  2407  GEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             G+EW   D GFP LK L +   K++ W    DHFP LERL L  C  L+ IP+ FTDITT
Sbjct  969   GDEWEVVDEGFPYLKLLLLERLKIRYWRASCDHFPCLERLFLERCLGLDSIPQDFTDITT  1028

Query  2587  LQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             L LI +  C  S+  S K IQ++ Q +YG 
Sbjct  1029  LALINVSSCAESVGNSTKQIQQDIQDNYGT  1058



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   412 bits (1059),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 303/844 (36%), Positives = 451/844 (53%), Gaps = 65/844 (8%)
 Frame = +1

Query  271   RVKDISFRAEDEIESEVMEIISNGASHERLHQILQ-RLAEDIEGLIEQRNTTQ--MLSSY  441
             +++D  ++AED I+  +  I  + A  E++    + +L +++  +IE  ++ Q  ++   
Sbjct  6     KIRDAGYKAEDTIDLCLRRI--HVADSEKVQNNARCKLYDELLQIIEVMDSIQGEVMKFK  63

Query  442   NPGQSNQEHI---IAGGASKLQ-------DDAIMVGHAQELERTKEMLLQCSTQERQVIS  591
             N   +NQ+ I    A  +S L+       ++  +VG   +    ++ L +  T E  V+S
Sbjct  64    NDRHNNQQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFR-QTPELNVVS  122

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEIN  771
             IVGMGGIGK+T+A+ +++ PS+  RF +  W TVSQ YD + +L D+         K + 
Sbjct  123   IVGMGGIGKSTLARSLFNHPSVSPRFDISSWVTVSQAYDAKEMLLDVLS-FGTPGGKAMY  181

Query  772   EVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVA  951
                S  EL ++V R+L R+RYL+V+DD+W    WD ++R FPDD NGSRI++TTRL EVA
Sbjct  182   RNMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVA  241

Query  952   VYSGCSGKYVC--NLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
                 C+G      ++PFL+  +SW L S K+ G+ + PP++EE+GK+I  +C+GL L++ 
Sbjct  242   ---NCAGNDFPPHHIPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVV  298

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGLLSK  R+ ++WQ IA  +N  + S    QC  IL LSYN LP  LKACFLY G+F
Sbjct  299   VIAGLLSKIIRTYDDWQQIADNVNSHIGST-SQQCLAILALSYNYLPCSLKACFLYMGVF  357

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIK  1479
              +   +I    L+ +W+ EGF+  +S +  +E   + L++L+ R+L++++   ++ G IK
Sbjct  358   LE-DADISADKLIRIWVAEGFLKRNSHKKPKEVGEECLEELVSRSLIMVNSRGWVSGKIK  416

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEP-LFEYANRWLTFRTTYIQPK  1656
             +CR HDL+  +CLRE K EKF     +  E   E  ++E  LF Y +          Q  
Sbjct  417   SCRTHDLIRLICLREGKAEKFFHVISECYEVSSEGVESEHRLFLYED------AVQNQNI  470

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS--FKMIRVLDLVEISFDEAPTFDISD  1830
               +K N    RT+        AS L     + V   F+++RVLD++ I F   PT +I+ 
Sbjct  471   GLEKGNLDSVRTISCTHK-PHASLLDYECYKIVDSRFQLLRVLDVLLIYFLRFPT-EITQ  528

Query  1831  LILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS  2007
             L+ LRYLAL T   V   + +  NLQTLIV                    W   +WK  S
Sbjct  529   LVHLRYLALATSTSVPASISNLWNLQTLIVH------------SVANELSWPLEIWKISS  576

Query  2008  LRFIKYP----YPFPIDTDEIPVQDTLHTLYWVPYLRCT-KEFVLKIPNVKVLGIKCSEI  2172
             L    YP     P P         + L  L          KE  + IP+VKVL +   E+
Sbjct  577   LIHF-YPGKMYVPAPPKAPNFLGLENLEELSLSTATSSDLKEIFMAIPHVKVLDV---EL  632

Query  2173  RAFQTETWWDNLHYLTKLEKLIV---EDIESEQFELQS---INSFPQSLKELKIVGTELG  2334
                  +   DNL YL  L+ L +      +++ F+  S    + FP +LK L +  T L 
Sbjct  633   NQDGWDNVIDNLIYLADLQNLRILLRLPFDAQLFQRPSARPFDVFPANLKSLILAETHLL  692

Query  2335  WEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPV  2514
             W  +T++S LPNLE LKL      G  W   +GGF KLK L I   +L +W   SD  P 
Sbjct  693   WTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQTELVHWHATSDSLPS  752

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRD  2694
             LE L L HC+ L++IP    DI TL+L+EL  C  S V SA++I EEQ   GN+ L VR 
Sbjct  753   LEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILEEQQCLGNEILAVRA  812

Query  2695  YDTR  2706
             Y+TR
Sbjct  813   YNTR  816



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score =   413 bits (1062),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 313/911 (34%), Positives = 470/911 (52%), Gaps = 85/911 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDY---KDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  L+SL+ T++ Q L+P   LV      +  ++   Q LC L+  L+E+ ++    +
Sbjct  1     MAYSALSSLMHTLQ-QLLQPNQRLVCGSCIPQQHVESTYQSLCALQVFLDEATEEAKDIE  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISN--GASHERLHQILQRLAEDIEGLIEQRNTT  423
               K +  R++D+ ++ E  ++S +  +I    G   ER  +      +++E  ++     
Sbjct  60    TLKRLEKRLRDVVYKVEYRVDSRLRNVIVADCGDDRERACKAFNEELQEVEKEVDSLKKE  119

Query  424   QMLSSYNPGQSNQEHIIAGGASKLQ---DDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
              M   +N   S    +    +S  +   +   +VG   +     + L    T E  VI +
Sbjct  120   VMQIEFNKRGSKSAELATTSSSSRRYASEQNTVVGMEDDFNAILDRL-TAQTHELTVIPV  178

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+A+K YDD SIR RF +  W TVS++Y+ R++L D+   +++    E  E
Sbjct  179   VGMGGIGKTTLARKAYDDSSIRYRFDIHSWVTVSENYNERQVLLDVIISISRDRTDESYE  238

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
               S  +LA  V + L  +R+L+++DD+W +  WD +QR FP+D+N SRILLTTRL  VA 
Sbjct  239   TMSINQLAEIVYKGLKGRRFLIIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD  298

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSINL-PPEIEEIGKRIVNKCRGLPLAITVAA  1131
             Y+        ++ FL+ + SW LF++ L   +L PP++++IGK I+ +CRGLPL+I V A
Sbjct  299   YASPDFP-PHSMSFLSLDNSWNLFTEMLFKKDLCPPQLQKIGKHIIQQCRGLPLSIVVIA  357

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLL K   + +NW+ I   +N      + +QC  IL+LSY+ LP +LKACFLY G FP+ 
Sbjct  358   GLLGKMDLTHDNWKKIEENLN-SFFGTVSEQCQAILSLSYSYLPQYLKACFLYVGGFPE-  415

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRL  1491
               EI    L+ LWI+E F+   S + LE  A +YLQDLIDR+L+L  K    G ++TC++
Sbjct  416   DMEINVSKLIRLWISEQFIKARSYKRLEVVAEEYLQDLIDRSLILAGKRRANGRMRTCKI  475

Query  1492  HDLLFDLCLREVKKEKFVSAFHQR----------SENVIELGDTEPLFEYANRWLTFRT-  1638
             HDLL  LC+ E   E  V A +               VI   D +    Y  R  +  T 
Sbjct  476   HDLLRQLCIIEAHNENVVHAMNANVPMFSEAINDQRRVIVPFDIKEKHVYPTRHSSVITS  535

Query  1639  ---TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEA  1809
                T+I  K+SD  +F +    LF   VS              FK+++VLD+  +  D +
Sbjct  536   MTRTFIFTKYSD-LDFAE----LFCSIVS-------------QFKLLKVLDVYNVRCDFS  577

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL--  1983
                 I  LI LRY+A   I     L    NLQT+I++                 SK L  
Sbjct  578   SV--IPKLIHLRYVA-ANIDEAPSLAKLWNLQTIILR--------------NFASKDLHL  620

Query  1984  -QGLWKSQSLRF------IKYPYPFPIDT----DEIPV-QDTLHTLYW--VPYLRCTKEF  2121
              Q +W    +R       I  P P   ++    +E P+  + L TL     PYL    E 
Sbjct  621   PQEIWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTLVLPSSPYL---AEI  677

Query  2122  VLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSL  2301
             + + P +  L I   E R  +     D +  L +LE L +E        + S + FP +L
Sbjct  678   LRRTPYLNKLTI-LDESRHPEYPAILDPISLLQELETLTIEADLGSDLMILSRDIFPPNL  736

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKL  2478
             K+LK+  T L WE + +++ LPNLE LK   A+E G  W +  D  F KLK+L +    L
Sbjct  737   KQLKLSYTTLQWEDMVVLANLPNLEVLKAYSAFE-GTNWKLNEDVVFQKLKYLRLQYGGL  795

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             + WE  +D FP+LE+L L+    LE+IP+   DI  L+LI+++ C  + V SAK IQEEQ
Sbjct  796   ERWEATNDSFPMLEQLLLYGFRKLEEIPQSIGDIMILKLIQIERCSAAAVTSAKKIQEEQ  855

Query  2659  SSYGNDQLVVR  2691
              S GN +L VR
Sbjct  856   QSLGNYELQVR  866



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score =   413 bits (1061),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 316/934 (34%), Positives = 479/934 (51%), Gaps = 122/934 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAYV + SLI+T+E Q ++ +P LV    DE + L   L  L +L    +   N S+  K
Sbjct  1     MAYVAVISLIQTLE-QLVQRKPNLV---SDETRTLMASL--LDSLEYFQDFLENTSKGSK  54

Query  259   D-------------VIARVKD-----------------ISFRAEDEIESEVM-------E  327
             D              +   +D                 I FR  D ++ EVM        
Sbjct  55    DCGKVEELEREIRKAVEEAEDVIELKIFEAMKRDALSKILFRTLDALKREVMGCRFGKNN  114

Query  328   IISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHI---------IAG  480
             +++     + LH+ L R  E I+  + +RN T      N  Q   + I         + G
Sbjct  115   VLNETMGKKALHKTLSRFIEKID--VVKRNVTGSSFGTNELQGYGDPINEELQTRDSLLG  172

Query  481   GASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDD  648
              +S+    L  + ++VG   +L + K  L    +  R+++SI+GMGGIGKTT+AKK YDD
Sbjct  173   HSSREVANLNLENVVVGLEDDLLKIKRRLTGAPST-REIVSILGMGGIGKTTLAKKAYDD  231

Query  649   PSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAE--LANKVRRRLM  822
             P IR RF +  W TVSQ+Y +R +L  +   ++Q+T    N++K++ +  L   + ++L 
Sbjct  232   PEIRHRFDIHIWVTVSQEYRVRVLLLGVVSFLSQLT----NKIKTSTDDDLMEAIYKKLK  287

Query  823   RQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLN  1002
              +RYL+V+DDIW S  W+ + R FPDD+ GSRI+LT+RLK++A+ +         +   N
Sbjct  288   GRRYLVVMDDIWSSEVWELMTRIFPDDNCGSRIILTSRLKDLAMQAD-PNSTPHEMKLFN  346

Query  1003  SNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQS  1176
             S+ESW L  +K+  +    PPE+E +G+++  KC+GLPLAI V AG LSK  R+ E+W  
Sbjct  347   SDESWKLLHEKVFGVEQFCPPELEALGRQVAQKCQGLPLAILVVAGHLSKIARTQESWIE  406

Query  1177  IASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWIT  1356
             +A +++  + S+  D C  +L +SYN LP HLK CFLY G+F +   E+  + L+NLW++
Sbjct  407   VAKSVS-KVVSNESDLCLGVLAMSYNYLPNHLKPCFLYMGVF-REDSEVNIETLINLWVS  464

Query  1357  EGFVMED-SGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
             EGF++E   G+         L+DL+ RNL+++ K  F G  KTC +HDL+ DL LRE +K
Sbjct  465   EGFLLEKFVGKDC-------LEDLVSRNLIMVRKRRFNGEGKTCGVHDLIRDLILREAEK  517

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGV  1713
             EKF+               T    +   R  +  +      F D  +F  +RT+ FF G+
Sbjct  518   EKFLQV-------------TPSARKLRVRRYSLHSYAYGAAFRDS-SF--TRTVHFFHGL  561

Query  1714  SGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKH  1890
             S     P+  R    FK++RVL +    F + P   I++L+ LRYL L     + R++  
Sbjct  562   SR---FPLLER----FKLLRVLAIHNCCFQDFPVV-ITNLVHLRYLELYCEDNIHRLVSE  613

Query  1891  HHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPIDTDEIPV  2064
              +NLQTLI                   S+  + +W+ + LR +     + FPI + E+  
Sbjct  614   LYNLQTLIFHHQR-----------LYTSRVPETIWQIEHLRHLHVTGFFSFPITSREVKP  662

Query  2065  QDTLHTLYWVPYL---RCTKEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLE  2229
                L  L  +  L    CT E    IPN+K L +     E    +   + ++L  L +LE
Sbjct  663   GFKLQNLERLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELE  722

Query  2230  KLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMG  2409
                +     +   + SI + P  LK L +  T L WE +  I +LPNL+ LK+      G
Sbjct  723   MFKLNGDGLQLPRIPSIFALPICLKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDG  782

Query  2410  EEWVTGDG-GFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             + W   D   F +LKFL IS   LK+WE  S +FP LERL L  C+ LE+IP+   +I T
Sbjct  783   DVWKLNDEEAFNQLKFLLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICT  842

Query  2587  LQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             L  IEL +C  S  +S  +IQEEQ+S GN+ L V
Sbjct  843   LASIELHECSISAAKSVNEIQEEQASMGNNCLSV  876



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score =   413 bits (1061),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 316/934 (34%), Positives = 479/934 (51%), Gaps = 122/934 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAYV + SLI+T+E Q ++ +P LV    DE + L   L  L +L    +   N S+  K
Sbjct  1     MAYVAVISLIQTLE-QLVQRKPNLV---SDETRTLMASL--LDSLEYFQDFLENTSKGSK  54

Query  259   D-------------VIARVKD-----------------ISFRAEDEIESEVM-------E  327
             D              +   +D                 I FR  D ++ EVM        
Sbjct  55    DCGKVEELEREIRKAVEEAEDVIELKIFEAMKRDALSKILFRTLDALKREVMGCRFGKNN  114

Query  328   IISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHI---------IAG  480
             +++     + LH+ L R  E I+  + +RN T      N  Q   + I         + G
Sbjct  115   VLNETMGKKALHKTLSRFIEKID--VVKRNVTGSSFGTNELQGYGDPINEELQTRDSLLG  172

Query  481   GASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDD  648
              +S+    L  + ++VG   +L + K  L    +  R+++SI+GMGGIGKTT+AKK YDD
Sbjct  173   HSSREVANLNLENVVVGLEDDLLKIKRRLTGAPST-REIVSILGMGGIGKTTLAKKAYDD  231

Query  649   PSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAE--LANKVRRRLM  822
             P IR RF +  W TVSQ+Y +R +L  +   ++Q+T    N++K++ +  L   + ++L 
Sbjct  232   PEIRHRFDIHIWVTVSQEYRVRVLLLGVVSFLSQLT----NKIKTSTDDDLMEAIYKKLK  287

Query  823   RQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLN  1002
              +RYL+V+DDIW S  W+ + R FPDD+ GSRI+LT+RLK++A+ +         +   N
Sbjct  288   GRRYLVVMDDIWSSEVWELMTRIFPDDNCGSRIILTSRLKDLAMQAD-PNSTPHEMKLFN  346

Query  1003  SNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQS  1176
             S+ESW L  +K+  +    PPE+E +G+++  KC+GLPLAI V AG LSK  R+ E+W  
Sbjct  347   SDESWKLLHEKVFGVEQFCPPELEALGRQVAQKCQGLPLAILVVAGHLSKIARTQESWIE  406

Query  1177  IASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWIT  1356
             +A +++  + S+  D C  +L +SYN LP HLK CFLY G+F +   E+  + L+NLW++
Sbjct  407   VAKSVS-KVVSNESDLCLGVLAMSYNYLPNHLKPCFLYMGVF-REDSEVNIETLINLWVS  464

Query  1357  EGFVMED-SGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
             EGF++E   G+         L+DL+ RNL+++ K  F G  KTC +HDL+ DL LRE +K
Sbjct  465   EGFLLEKFVGKDC-------LEDLVSRNLIMVRKRRFNGEGKTCGVHDLIRDLILREAEK  517

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGV  1713
             EKF+               T    +   R  +  +      F D  +F  +RT+ FF G+
Sbjct  518   EKFLQV-------------TPSARKLRVRRYSLHSYAYGAAFRDS-SF--TRTVHFFHGL  561

Query  1714  SGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKH  1890
             S     P+  R    FK++RVL +    F + P   I++L+ LRYL L     + R++  
Sbjct  562   SR---FPLLER----FKLLRVLAIHNCCFQDFPVV-ITNLVHLRYLELYCEDNIHRLVSE  613

Query  1891  HHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPIDTDEIPV  2064
              +NLQTLI                   S+  + +W+ + LR +     + FPI + E+  
Sbjct  614   LYNLQTLIFHHQR-----------LYTSRVPETIWQIEHLRHLHVTGFFSFPITSREVKP  662

Query  2065  QDTLHTLYWVPYL---RCTKEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLE  2229
                L  L  +  L    CT E    IPN+K L +     E    +   + ++L  L +LE
Sbjct  663   GFKLQNLERLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELE  722

Query  2230  KLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMG  2409
                +     +   + SI + P  LK L +  T L WE +  I +LPNL+ LK+      G
Sbjct  723   MFKLNGDGLQLPRIPSIFALPICLKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDG  782

Query  2410  EEWVTGDG-GFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             + W   D   F +LKFL IS   LK+WE  S +FP LERL L  C+ LE+IP+   +I T
Sbjct  783   DVWKLNDEEAFNQLKFLLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICT  842

Query  2587  LQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             L  IEL +C  S  +S  +IQEEQ+S GN+ L V
Sbjct  843   LASIELHECSISAAKSVNEIQEEQASMGNNCLSV  876



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score =   413 bits (1061),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 301/856 (35%), Positives = 446/856 (52%), Gaps = 71/856 (8%)
 Frame = +1

Query  244   SQAEKDVIA-RVKDISFRAEDEIESEVMEIISNGAS----------------HERLHQIL  372
             SQ E D +  R++D +   ED +E  V E +   +                 ++ L ++L
Sbjct  53    SQEEMDSLEIRIRDSASVIEDLVEFYVSEQVCKDSDRFIAWLDSPTDLENWEYQELDEVL  112

Query  373   QRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDA-----IMVGHAQELE  537
               +   +E L+  R   + L         ++H+   G+S+   DA     +MVG  +++ 
Sbjct  113   VEIDSLVEELLNDRCGLKDLLP-------RQHLPVLGSSR---DARVGKNVMVGFDEDVM  162

Query  538   RTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR  717
               K  L    ++  QVI I GMGG+GKTT+A+ +YDD  ++  F L  W T+SQ Y +  
Sbjct  163   ELKHRLTGWESK-LQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDD  221

Query  718   ILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
             +++ L      + ++   + KS  +L   + + L  +RY++V+DD+W ++ WDD++R FP
Sbjct  222   VIRGLLANFGVVINRP--KEKSVQDLTQTLWKFLKGRRYIIVLDDMWSTQVWDDMKRMFP  279

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPE---I  1065
                 GSRI+LTTRL+ VAVY+  S      +  L+ ++SW L  Q++ G    PPE   +
Sbjct  280   FRMIGSRIMLTTRLQGVAVYATDSFSPALRIRLLDKDKSWHLLCQEVFGQEGCPPEFQEL  339

Query  1066  EEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTL  1245
             E+IGK I + C+GLPLA  V  GLL+ +  + E W  +A  +N  +T +  +QCS IL+L
Sbjct  340   EDIGKMIAHNCKGLPLAARVVGGLLANSAMTREFWGYVADNVN-SITIENDEQCSEILSL  398

Query  1246  SYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDL  1425
             SYN+LP+HLK CFLY G FP+   EIP   L+ LWI EGF+     +SLE  A  YL DL
Sbjct  399   SYNHLPHHLKPCFLYLGAFPE-DYEIPVTKLIRLWIAEGFLRPSRSKSLEVAAEGYLNDL  457

Query  1426  IDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF  1605
             IDRNLV++ +    G  +TC +HDLL DLCL+E + E F+   ++ ++       + P  
Sbjct  458   IDRNLVIVRQRGSNGKTRTCTMHDLLRDLCLKEAQNENFLHIINRSAQF------SPPDM  511

Query  1606  EYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDL  1785
             +   R L        P+ +D     +S TL      +G     V + Q  SF+ +RVLD 
Sbjct  512   DNIPRRLIMHLDI--PEGNDITECMESMTLTRSVLCTGRVLSTVPFYQ--SFRFLRVLDF  567

Query  1786  VEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNL----QTLIVKFPNSC--Riee  1947
             +E  F E P F    L+ LRYLA  T +   VL    +L    Q LI+K   +   R   
Sbjct  568   LETEFSEFP-FAFLFLVNLRYLAF-TFQSFPVLPSKISLLWKLQILIIKDQQNLLNREYF  625

Query  1948  idsdeeiGSKWLQGLWKSQSLRFIKYP---YPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
                           +++   LR ++      P PID +   V   L TL  V   RCT+E
Sbjct  626   PYFQSYCEVDTPSEVFQMAQLRHVQMTEIFLPNPIDKENPVVLKDLETLCTVANFRCTEE  685

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETW--WD--NLHYLTKLEKL-IVEDIESEQFELQSIN  2283
              + K PN+K LG+          E W  +D  NL  L+KLE L +V +    +  L ++ 
Sbjct  686   VLRKFPNLKKLGVY---YYGAGIEDWSSYDLKNLVRLSKLENLKLVFNWPLNEVLLPNL-  741

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYI  2463
             SFPQSLKEL +  ++L WE ++II  LP+LE LKL +    G  W   +G F +LKFL +
Sbjct  742   SFPQSLKELTLNASKLSWEDMSIIGSLPHLEVLKLKEHAFTGGVWEPVEGEFSRLKFLLM  801

Query  2464  SGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKD  2643
                +L  W   + HFP LE L +  CHNL+ IP G  DI TL++I++ DC  S V S + 
Sbjct  802   DRMELVWWIAENTHFPCLEHLIIRSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQ  861

Query  2644  IQEEQSSYGNDQLVVR  2691
             I EEQ    N+ L VR
Sbjct  862   ILEEQRDMENNVLQVR  877



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score =   410 bits (1055),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 293/789 (37%), Positives = 428/789 (54%), Gaps = 88/789 (11%)
 Frame = +1

Query  421   TQMLSSYNPGQSNQEHIIAGGAS----KLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
             T  + SY+   +N E ++ G +S    KL  + I+VG   +L R    L +  T  R++I
Sbjct  138   TNQVQSYDDTTTN-EDLLPGHSSRNVAKLNPENIVVGLEDDLVRIIRRL-KGPTLSREII  195

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
              I+GMGGIGKTT+A+K +DD   R+RF +  W TVSQ+Y +R +L D    + + T +E 
Sbjct  196   PILGMGGIGKTTLARKAFDDFETRNRFDIHIWVTVSQEYRIRGMLLD----ILRSTSEET  251

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
             NE  +   L + + ++L   RYL+V+DDIW S  WD + R FPDD+NGSRI+LT+R +EV
Sbjct  252   NEESNIDRLMDMIYKKLKGWRYLVVMDDIWSSEVWDLMTRTFPDDNNGSRIILTSRQEEV  311

Query  949   AVYSGC-SGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAI  1119
             A ++   S  +  NL  LN + SW L   ++  +    PPE+E+IG++I  +C+GLPLA+
Sbjct  312   ASHADPDSNPHKMNL--LNLDNSWKLIRDRVFGVEHACPPELEDIGEQIAQRCQGLPLAL  369

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V AG LSK  R+ E+W  ++ +++  + +D  D C  +L +SYN LP HLK CFLY G+
Sbjct  370   LVVAGHLSKISRTRESWNDVSKSVS-KVVADESDICLGVLAMSYNYLPDHLKPCFLYMGV  428

Query  1300  FPKVRREIPTKDLLNLWITEGFVMED-SGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             FP+    +    L+NLWI+EGF+ ++  GR         ++DL+ RNLV++   SF G  
Sbjct  429   FPE-DSVVNIVRLINLWISEGFISDELVGRDC-------MEDLVSRNLVMVRNRSFNGET  480

Query  1477  KTCRLHDLLFDLCLREVKKEKF--VSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             KTC +HDL+ DL LRE +KEKF  V+  H+          T P  E        R+T   
Sbjct  481   KTCGVHDLIRDLILREAEKEKFLEVTRIHEA---------TNPSAE------KLRSTR--  523

Query  1651  PKFSDKYNFHKS------------RTLLFFFGVSGASG-LPVSWRQNVSFKMIRVLDLVE  1791
                  +Y FH              RTL FF G    S  +P+     VSFK++RVL ++ 
Sbjct  524   -----RYCFHSHNQAAFWKLSSIIRTLHFFDGFQKLSKQVPLL----VSFKLLRVLAILN  574

Query  1792  ISFDEAPTF--DISDLILLRYLALGTIKYVR-VLKHHHNLQTLIVKFPNSCRieeidsde  1962
              +F   PTF  +I+ L+ LRYL       +   +   +NLQT I+ +             
Sbjct  575   DTF---PTFPLEITKLVQLRYLQFTCYDNIHWSVSKLYNLQTFILGY---------GVAG  622

Query  1963  eiGSKWLQGLWKSQSLRFIKYP--YPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIP  2136
              +     +G+W+ ++LR +     + FPI ++++     L  L  +    CT E    IP
Sbjct  623   LLPPTIPEGIWQMRNLRHLHIGDFFSFPIPSNKL---QNLQELSRLALSSCTCELFSAIP  679

Query  2137  NVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKI  2316
             N+K L I  + +   + E   ++L  L KLE L   D   +  ++ S    P SLK L +
Sbjct  680   NLKKLKIIGNYLMEMKRERL-NSLSCLEKLEILKYRDDGIQPSQIPSKYVLPASLKRLTL  738

Query  2317  VGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG-FPKLKFLYISGAKLKNWET  2493
               T L WE +  I  LPNLE LK+     +G+ W+  D   F +LKFL IS   LK+W+ 
Sbjct  739   SCTSLPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFKQLKFLLISWTGLKHWKA  798

Query  2494  MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
              S +FP L+RL L  C NLE+IP+ F DI TL+ IEL  C  S   S K+IQEEQ S GN
Sbjct  799   GSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSISAATSGKNIQEEQESIGN  858

Query  2674  DQLVVRDYD  2700
             + L V  Y+
Sbjct  859   ECLSVLIYN  867



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score =   411 bits (1057),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 288/773 (37%), Positives = 417/773 (54%), Gaps = 64/773 (8%)
 Frame = +1

Query  457   NQEHI-----IAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKT  621
             N EHI     I            MVG  ++L   K+ L   S++  Q+I +VGMGGIGKT
Sbjct  177   NTEHIFQVTRIFSAEVNSPRKTTMVGFDEDLMEIKDQLCGDSSK-LQIIPLVGMGGIGKT  235

Query  622   TMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKS-TAELA  798
             T+A  I+ DP I   FH+  W T+SQ Y++R I++ L   ++  TDK   E +    ELA
Sbjct  236   TLATNIFHDPLIEYHFHIRAWITISQRYNIREIIRSLLSSISTNTDKLSRETEDREMELA  295

Query  799   NKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKY  978
               + + L  +++L+V+DDIW +  WDD++  FPDD NGSRI+LTTRL +VAVY+   G +
Sbjct  296   VCLYKSLKGRKFLIVLDDIWSTEAWDDIKMLFPDDRNGSRIVLTTRLVDVAVYANSFGPF  355

Query  979   VCNLPFLNSNESWMLFSQKLGSINL-PPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKR  1155
               N+ FLN ++SW L  +K+ +  + PPE+EEIGK I   CRGLPL+I V AG+LS+  +
Sbjct  356   -HNIQFLNEDQSWNLLREKVFAEEICPPELEEIGKLIARNCRGLPLSIVVVAGILSRVNK  414

Query  1156  SVENWQSIASAMNLPMT--SDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPT  1329
             +   W++IA  ++  +T  +D H   S IL+LSY +LP+HLKACFLY G FP+   EIP 
Sbjct  415   TRYKWENIARDVSSAVTRVNDEHFS-SKILSLSYEHLPHHLKACFLYLGNFPE-DYEIPV  472

Query  1330  KDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFD  1509
               L+ LW+ EGF+     +S EE A+ YL+DL+ R+LVL++K    G  + CR+HDLL D
Sbjct  473   FKLITLWVAEGFLKPILSKSSEEVAVDYLKDLVKRSLVLVTKKRSNGGFRFCRIHDLLRD  532

Query  1510  LCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSR  1689
             LC+R+   E F   F    +  +E            R L F   +      + Y+F  + 
Sbjct  533   LCIRKADGENFFH-FINGIQYTVE----------GKRRLCFSKAF------ESYHFENAN  575

Query  1690  TLLFFFGVSGASGLPVSWRQNVS-FKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT-  1863
             T +        S     + + V+ F ++RVLD++E+ F+  P  ++ +L  LRY+A  T 
Sbjct  576   TAI---RSPLRSVFSCYYNERVTGFSLLRVLDVLEVVFESFPV-ELLELFHLRYIAFSTG  631

Query  1864  -IKYVRV---LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKY--  2025
              I++  +   L    NLQTLIV       +    +D  + +K    +W+   LR + +  
Sbjct  632   FIRHCTLPPSLPKLRNLQTLIV----GSSVTFGITDRMVAAKL--PIWEMPQLRHLVFLN  685

Query  2026  --PYPFPIDTD-EIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVL-----GIKCSEIRAF  2181
                 PFP +TD E  V   L TL  V   R T+E V  IPN+K L     G     +  +
Sbjct  686   ITLSPFPCETDKEFAVLKNLQTLSRVRNFRFTREAVEMIPNLKKLKLVYMGRSHVHMSVY  745

Query  2182  QTETWWDNLHYLTKLEKLIVEDIESEQFELQSIN---SFPQSLKELKIVGTELGWEAITI  2352
             + E    NL +  KLE L ++   S  +    +      P +LK+L + G  L  E +T+
Sbjct  746   ELE----NLVHFQKLETLNLKFQTSSDWWRNPVPVRFGLPLNLKKLTLSGCGLSLEDMTM  801

Query  2353  ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLAL  2532
             I  L NLE LKLL    +G  W   +  +  L+FL +    +K W   S  FP LERL +
Sbjct  802   IGSLANLEVLKLLNMSLVGALWEVVEEEYSCLRFLMMEWLDIKTWLAESGCFPSLERLVI  861

Query  2533  HHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              HC  LE IP G  DI TL++IE+ D      +SA++I EEQ   GND L VR
Sbjct  862   RHCSALENIPSGIGDIPTLRVIEVDDS-EMAEDSAEEILEEQQDLGNDVLQVR  913



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score =   409 bits (1051),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 305/890 (34%), Positives = 473/890 (53%), Gaps = 72/890 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRP----ILVVDYKDEIQCLRQKLCHlkalleesekklNVS  246
             MAY  L SL++ +E Q L        IL  + + +I  L QK+C LK L+E S   +   
Sbjct  1     MAY-NLESLVKILE-QILHHDHSQSWILDPNKRPQIASLLQKVCFLKDLVENSSSAVTSC  58

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEI---ISNGASHERLHQILQRLAEDIEGLIEQRN  417
             + ++ + +R++D +  AED +ES++ E+   I  G S       L+++ E+++  I++  
Sbjct  59    RKQR-LESRIRDAAQGAEDILESKLTELFLSIREGESFIFSPPDLEKVIEEVDT-IKKEM  116

Query  418   TTQMLSSYNPGQSNQEHIIAGGASKLQD---DAIMVGHAQELERTKEMLLQCSTQERQVI  588
              T M  ++    S+     A  +S  QD   + I+VG AQ+L + K+ L    ++  QVI
Sbjct  117   MTMMDGNHKADTSS-----AALSSSRQDPNPNNIIVGVAQDLIQLKDRLFGQPSKALQVI  171

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             +IVGMGGIGKT +A+ +YDDPS+ S F    WAT+SQDY + ++ + L G +  +  K  
Sbjct  172   AIVGMGGIGKTALARNLYDDPSVISHFDACAWATISQDYSMEKLQEILLGLLDCLIGKPE  231

Query  769   NEV--KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
             +E+  ++  ELA ++ + L+ +RYL+++DD+W  + WDD++R FPD SNGSRI++TTR  
Sbjct  232   DEMLEETNDELALRLHQALIGRRYLIILDDMWDVKLWDDIRRFFPDQSNGSRIIVTTREL  291

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLA  1116
              VA Y+G    +   +  L  +ESW L  QK+       PPE+E++GK+I   CRGLPLA
Sbjct  292   GVADYTGTESLH-HQMNLLKDDESWNLLRQKVFASEETCPPELEKVGKKIAKDCRGLPLA  350

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V  G+LS+ K S + W  ++  ++    +D  +Q S IL+LSYN LP HL+ CFLY G
Sbjct  351   IHVIGGILSQAKTSQDFWDQVSDNVS-STVADKGEQFSNILSLSYNYLPDHLRPCFLYMG  409

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
              FP+   EI T  L+ LW  EGFV     +SLEE A  +L+ L+DRNL+ + +     N+
Sbjct  410   AFPE-DYEIRTSRLIKLWAAEGFVRPIPNKSLEEAAKMHLKALVDRNLLFVRRQETKENV  468

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             K+  +HDLL DLC+R+  +EKF+   H  +   + +  +     Y  R  T         
Sbjct  469   KSYSIHDLLRDLCVRKAHQEKFL-VVHGWTPGNLPINTS-----YLCRVCTHGPFSSDDA  522

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLI  1836
             +        +R+ L F         PV+W+     +++RVLD++ IS  E P  +I  LI
Sbjct  523   YISTEQIRLARSWLDFG--------PVNWKILSESRLLRVLDILWISLLEFPE-EILQLI  573

Query  1837  LLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ----GLWKS  2001
              LRYLA  + K +   +    NLQTLI +                 S+W +    G+   
Sbjct  574   NLRYLAFSSAKGLPSSISRLLNLQTLIAQ-------------RSTNSRWPRDIAPGILYM  620

Query  2002  QSLRFIKYPYPFP--IDTDEIP---VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCS  2166
               LR IK+       +D D +    +QD L TL  +        F+ KIPN++ LG+ C 
Sbjct  621   TQLRHIKFKRTHVRFLDKDNLASFVLQDKLQTLSTIALSEINHWFLDKIPNLQKLGVICD  680

Query  2167  EIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAI  2346
             EI+  + +        L++L KL    + S +F+      FP  LK+L +    +    +
Sbjct  681   EIQDTEKD--------LSRLHKLHTLKLSSTRFQFTFNVIFPPYLKKLTLKRCTVLDHHL  732

Query  2347  TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERL  2526
               I  L NLE LKL +       W   +G F +L+FL +    L NW     +FP L+ L
Sbjct  733   NAIGKLLNLEILKLQECKFKSLRWEPNEGEFCQLQFLRMDLVDLVNWVVDDTNFPRLDHL  792

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGND  2676
              +  C +LE+IP    DI TL++IE+ +  PS++ SA++IQ+ Q   GND
Sbjct  793   VIRGCRHLEEIPLAIGDIPTLKVIEVDNSSPSVLASAREIQQAQLDSGND  842



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score =   413 bits (1062),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 299/763 (39%), Positives = 417/763 (55%), Gaps = 56/763 (7%)
 Frame = +1

Query  511   MVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWAT  690
             MVG+  E E  +  L   S+Q  +VISI GMGGIGK+T AKK++ DPSI   F + GW T
Sbjct  375   MVGYKDEQESMRGKLTGHSSQ-LEVISIAGMGGIGKSTFAKKMFSDPSILEFFDVRGWIT  433

Query  691   VSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRG  870
             VS+DY +R++L  L      +  KE  +  S  +LA  +++RL  +RYL+VVDDIW    
Sbjct  434   VSRDYSVRKMLLSLLQDATAV--KENLDNVSDGDLAGLLKKRLNSRRYLIVVDDIWSIEA  491

Query  871   WDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN  1050
             WDD+++ FP++SN SRILLTTR  +VA Y+  S K    + FL   ESW LF QK  +  
Sbjct  492   WDDIRQWFPENSNTSRILLTTRDMKVARYAS-SPKDPFPMRFLEPKESWNLFCQKAFAQK  550

Query  1051  LPP-EIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQC  1227
             + P E E++ K +V  C G PL I+V AG L  +K+++  W+ +A +++     D + +C
Sbjct  551   VCPLEFEDVAKEVVRNCEGFPLMISVVAGTLF-SKKTLNEWEEVAESVSSFADLDDYQRC  609

Query  1228  STILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAM  1407
             S +L LSYN+LP ++KACFLYFG+FPK R EIP K L+ LW+ EG +       LE+ A 
Sbjct  610   SGVLALSYNHLPSNVKACFLYFGVFPKAR-EIPVKKLIRLWVAEGLLELKGVEVLEKVAA  668

Query  1408  KYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFV----SAFHQRSENV  1575
               LQ+ ID++LV++SK S  G IKT R+HDLL D CLRE ++EK +    S   Q    V
Sbjct  669   NLLQEFIDKSLVVVSKRSLDGKIKTFRIHDLLHDFCLREAEEEKILYVANSMLSQEHRMV  728

Query  1576  IELGDTEPLFEYANRWLTFRTTYIQ--PKFSDKYNFHKSRTLLFFFGVSGA------SGL  1731
              E+           RW++    Y Q  P   D    H + T+LF             S  
Sbjct  729   SEIPQ-------GRRWVSVHPDYGQFPPILFDD---HSNPTILFDDLTHRKTRSLHHSSN  778

Query  1732  PVSWRQN---VSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHH  1896
              +  R +   V FK++RVLDL  + F   P+ +I  L+ LRYLA+   +I     + +  
Sbjct  779   EIVQRHDLGLVHFKLLRVLDLETMRFGLFPS-EILHLVSLRYLAVMVSSIPKDMTISNLL  837

Query  1897  NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFI----KYPYPFP-IDTDEIP  2061
             NLQT I  FP          D  IG      +W+   LR +     Y Y  P +  +E+ 
Sbjct  838   NLQTFI--FPQYVPELSGTIDLPIG------IWEMSQLRHLYSTMMYLYSPPMVSANEVS  889

Query  2062  --VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL  2235
               V + L ++  +    CT+E    I  VK LGI  SE          DNL YL +LE L
Sbjct  890   YRVLENLQSVSGLSPRCCTEEIFEAIKKVKNLGISGSENEFHSEPRCLDNLIYLHELEAL  949

Query  2236  IVEDIESEQ----FELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQ-AY  2400
              +     +       L  ++SFP +LK+L +  T L WE +TIIS LP LE L+L + A+
Sbjct  950   SIVSYSRQPDGLFLRLPHLDSFPPNLKKLTLRRTWLSWEDMTIISELPELEVLQLKEDAF  1009

Query  2401  EMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDI  2580
                  W     GFPKLKFL +    L  W    D+FP LER+ + +C  L++IP+GF D 
Sbjct  1010  AGNTVWEVTKEGFPKLKFLLLEELDLGYWVADDDYFPCLERIIIRNCTYLKEIPQGFADS  1069

Query  2581  TTLQLIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDTR  2706
             TTLQ IEL+ C PSLV  A+ IQ++Q    GN+ L V  +DT+
Sbjct  1070  TTLQQIELRRCSPSLVTLAEKIQKKQEEEIGNNILKVCVFDTK  1112


 Score =   219 bits (557),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 207/331 (63%), Gaps = 23/331 (7%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGA-----SHERLHQILQRLAEDI----EGLIE  408
             KD+  +V D++  AEDE+ES++  ++         ++ERL + LQ++ EDI    E LI+
Sbjct  57    KDLRKKVIDLTHEAEDEVESQLRLVMEEDEDVQIEANERLLENLQQVIEDIDSVKEELIK  116

Query  409   QR-NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             QR N      +++ G S+         S L++D I +    E ER ++ L + S+ E +V
Sbjct  117   QRKNNNLQAGNHSVGGSSSP---LSHVSALENDVISI----EEERMRDQLTRGSS-ELEV  168

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             ISIVGMGGIGK+T A+K+Y DPSI S   +  W TVS+DY LR +L  L      MT KE
Sbjct  169   ISIVGMGGIGKSTFARKMYSDPSIVSFHDVRAWITVSKDYSLRNMLLCLLRDAIGMT-KE  227

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
             +++ +S  ELA ++R+ LM +RYL+VVDDIW    WDD++ CFP+++N SRILLTTR  +
Sbjct  228   LDK-RSDGELAERLRKHLMAKRYLIVVDDIWSREAWDDVRLCFPENNNRSRILLTTRDMK  286

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA Y+  S K +  +  LN  E   LF QK+ G+ + P E E + K I   C+GLPLAI+
Sbjct  287   VAQYAS-SPKDLFQMRLLNPKERLSLFCQKVFGNKDCPTEFENVAKEIAEHCKGLPLAIS  345

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDL  1215
             + AG+LS +KR+V+ W+ +A  +++ + +D+
Sbjct  346   LVAGILS-SKRTVDEWREVAQILSINLETDM  375



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score =   404 bits (1038),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 283/789 (36%), Positives = 421/789 (53%), Gaps = 61/789 (8%)
 Frame = +1

Query  385   EDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
             +++   I+    T  LSS++ G+             L ++  +VG        ++ L   
Sbjct  12    KNVHKRIKDAPATTYLSSFSSGRV------------LDEENTLVGMDDVFNNIRDQLFG-  58

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              T    V+S+VGMGGIGK+T+A+ +++ PS+  RF +  W TVSQ YD + +L D+    
Sbjct  59    QTPALNVVSVVGMGGIGKSTLARSLFNHPSVSRRFDISSWVTVSQSYDAKEMLLDVLS-F  117

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                  K +    S  EL ++VRR+L R+RYL ++DDIW    WD ++R FPDD NGSRI+
Sbjct  118   GTPDGKAMYRNTSEDELLDQVRRKLKRKRYLKLLDDIWTIEAWDQVRRSFPDDENGSRIM  177

Query  925   LTTRLKEVAVYSGCSGKYVC--NLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNK  1095
             +TTRL EVA    C+G      ++PFL+  +SW L S K+ G+ + PP++EE+GK+I  +
Sbjct  178   ITTRLLEVA---NCAGNDFPPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQ  234

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             C+GL L++ V AGLLSK  R+ ++WQ IA  +N  + S    QC  IL LSYN LP  LK
Sbjct  235   CQGLALSVVVIAGLLSKINRTYDDWQQIADNVNSHIGST-SQQCLAILALSYNYLPCSLK  293

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
             ACFLY G+F +   +IPT  L+ +W+ EGF+     +  EE A + L+DL+ R+L++++ 
Sbjct  294   ACFLYMGVFLE-DAKIPTDTLIRIWVAEGFLKTICHKKPEEVAEECLEDLVSRSLIMVNS  352

Query  1456  LSFI-GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTF  1632
               ++ G I++C++HDL+  LCLR+ K EKF    ++  E   E  ++E      +R L +
Sbjct  353   RGWVSGKIRSCKIHDLIRLLCLRKGKTEKFFHVINECYEVSSEGVESE------HRLLLY  406

Query  1633  RTTYIQPKFS-DKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS--FKMIRVLDLVEISFD  1803
                         + N    RT+L        S L   + + V   F+++RVLD++ I F 
Sbjct  407   EDAVQNQNLGLHEDNLDSVRTILCICE-PCTSMLEFEYYKIVDTHFQLLRVLDVLMILFQ  465

Query  1804  EAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKW  1980
               PT +I+ L+ LRYLA  T   V   + +  NLQTLIV+              E    W
Sbjct  466   LFPT-EITQLVHLRYLAFTTGGDVPTSISNLWNLQTLIVE------------PIENQLSW  512

Query  1981  LQGLWKSQSLRFIK-----YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVK  2145
                +WK  SL++ +      P P P     I   +    L         +E  + +PNVK
Sbjct  513   PVEIWKMSSLKYFQSGGMSMPVPAPPKAQHILGLEKFKKLSLNEASSNWEEICMAVPNVK  572

Query  2146  VLGIKCS-EIRAFQTETWWDNLHYLTKLEKLIVE-DIESEQF-----ELQSINSFPQSLK  2304
              L +  + +I       +  +L  L  L+KL ++  + S          Q    FP++LK
Sbjct  573   ELDVIINLDIHPNGWNDFIGSLICLVDLQKLSIQLKVSSHPLFFIRRPAQLWYVFPENLK  632

Query  2305  ELKIVGTELGWEAITIISMLPNLESLKL-LQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
              L +V T L W  + ++S LPNLE LKL    +E G  W   +GGF KLK L+I   +L 
Sbjct  633   SLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFE-GSNWNLDEGGFKKLKLLHIHQTRLV  691

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
             +W+  SD  PVLE L L  C  LE+IP    DI TL+LI+L  C  + V SA++I EEQ 
Sbjct  692   HWQAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEILEEQK  751

Query  2662  SYGNDQLVV  2688
             S GN+ LVV
Sbjct  752   SIGNEVLVV  760



>emb|CDP00691.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   401 bits (1031),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 269/703 (38%), Positives = 377/703 (54%), Gaps = 45/703 (6%)
 Frame = +1

Query  601   MGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVK  780
             MGGIGKTT+A+K ++DP     F+   W TVSQ Y  R +L  L   +AQ TDK +   K
Sbjct  1     MGGIGKTTLARKAFNDPYTVYHFYCRAWITVSQVYQARDLLLALWSSIAQSTDKMVE--K  58

Query  781   STAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYS  960
             S A+LA  V RRL  +RY++V+DD+W S  W+D++RCFPDD NGSRI++T+R KE+A   
Sbjct  59    SNAQLAEIVYRRLKGKRYVIVMDDLWSSDAWNDVKRCFPDDENGSRIVVTSRFKELATNV  118

Query  961   GCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGL  1137
                    C +  LN  +SW L  + + G+ + P E+  +GK+I  +CRGLPLAI V AG+
Sbjct  119   SPKKPPHC-MNLLNIEQSWELLEKLIFGTASCPHELVGVGKQIAKRCRGLPLAIVVIAGV  177

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRR  1317
             LS+   +   W  IA  ++  +++D  + C  IL LSYN LP+HLKACFLY GIFP+   
Sbjct  178   LSRDIGAYNCWNEIAEEVSSVVSTD-PENCLDILALSYNCLPHHLKACFLYMGIFPE-DC  235

Query  1318  EIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHD  1497
             EI    L+NLW  EGF+  +S + LE+    Y++DLI RNLVL+ K  F G +KTCRLHD
Sbjct  236   EIEVSKLINLWAAEGFLYLNSEKQLEQIGEDYVEDLIGRNLVLVEKKRFGGEVKTCRLHD  295

Query  1498  LLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNF  1677
              L +LCL+E +KE F+    +RS   ++ G          R L+F         +     
Sbjct  296   FLRELCLKEAQKENFMHVIQRRSAKGVQAGTRN------QRRLSFHLDPYSHATTAPAIP  349

Query  1678  HKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL  1857
             H S  + F     G   +P      + FK++RVLD+  + FD  P   I  LI LRYLAL
Sbjct  350   HVSSFVCFTL---GTDIVPDILFFQLGFKLLRVLDVFFLHFDYFPV-QILKLIHLRYLAL  405

Query  1858  G-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY-  2031
               T +    +    NLQTL++  P  C+              L   W   SLR +     
Sbjct  406   YVTYELPASVSQLRNLQTLVIHGPWLCQESGGRPTL------LLEYWSMPSLRHVHVTVA  459

Query  2032  -----PFPIDTDEIP---VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQT  2187
                  PF +  D +P     + L TLY + +  CTKE    +P++K LGI C     +  
Sbjct  460   CHLKNPFTVQ-DNLPRPFASEHLQTLYTIQFSSCTKEVFSVMPHLKKLGI-CETKEDYSI  517

Query  2188  ETW---WDNLHYLTKLEKLIVEDIESEQFELQSINS---FPQSLKELKIVGTELGWEAIT  2349
             +++    +NL YL +LE L      ++  E++ I      P +LK L +  + L W+ +T
Sbjct  518   DSFSQVLNNLVYLQELETLEC-SFHTQNREVRRILGLALLPVTLKHLSLSWSYLPWKYMT  576

Query  2350  IISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE-TMSDHFPVLERL  2526
              I+MLPNLE L+L      G +W   + GF  LK L I    L +WE T+  HF  L+ L
Sbjct  577   SIAMLPNLEVLELKNYAFQGPKWGPTEEGFRSLKHLLIENMALIHWEATIFRHFRCLQHL  636

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
              L  C  LEK P G   +  LQ +E+  C   +  SAK+IQEE
Sbjct  637   VLKSCKLLEKFPFG---VENLQRLEVHYCSGPIENSAKEIQEE  676



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score =   408 bits (1048),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 318/946 (34%), Positives = 488/946 (52%), Gaps = 104/946 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  LTS + ++EL      P+L  +  K++I  L +++   +  L + EK ++     
Sbjct  1     MAYAALTSAVCSLELFLQCNHPLLNNLQRKEQILSLCKRILSFQEFLVDYEKLMHKHVGL  60

Query  256   KDVIARVKDISFRAEDEIESEVME--IISNGASHERLHQIL-QRLAEDIEG--LIEQRNT  420
             K +  ++K+ +++ ED ++S++ +  +  N    ++ + +L +RL   IE   LI++   
Sbjct  61    KLLEGKIKEKTYQVEDIVDSKLRKYFLAKNAKDRKKAYSVLCRRLQVAIEEMELIKKEAR  120

Query  421   T------QMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQ  582
             T      +  + +          ++  +  LQ     VG   +LE+  + L +  + E  
Sbjct  121   TIKGDKIRTWNFHTRASPPARRDVSTSSPNLQQQT-PVGFQDDLEKIIDRL-RGDSSELD  178

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA-----  747
             +I+IVGM GIGKTT+AK+ Y+ PS+  RF +  W T+SQ+Y  R  L DL   V      
Sbjct  179   IITIVGMAGIGKTTLAKRAYNHPSVVYRFDVRAWTTISQEYRERDTLLDLFYSVVPPANG  238

Query  748   --QMTDKEINE----------VKST-----AELANKVRRRLMRQRYLLVVDDIWGSRGWD  876
               Q +DKE  +           K T      E+A+++ + L  +R+L+VVDD+W +  WD
Sbjct  239   SNQESDKEAADQLYGRLMTQPSKETYEGRNQEMADRLHKSLKGKRFLIVVDDMWSTDAWD  298

Query  877   DLQRCFPDDSNGSRILLTTRLKEVAVYSGCS-GKYVCNLPFLNSNESWMLFSQKL-GSIN  1050
             ++    PDD+N SR++LT+RL +VA Y+  +  +    L FLN +E W L  +KL G   
Sbjct  299   NVSMLLPDDNNKSRVILTSRLIDVATYANANPDRQPHRLSFLNKDEGWELLREKLFGKRG  358

Query  1051  LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCS  1230
              P E+E IGK I  KC+GLPLAI V AG LSK  ++ ++W ++A ++   +  +   QC 
Sbjct  359   CPFELEVIGKSIAEKCQGLPLAIVVVAGHLSKMSKTPDSWNTVAESVGSVVNRE-PGQCL  417

Query  1231  TILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMK  1410
              IL LSYN LP HLKACFLY G FP+   EIP   L+ LW+ EGF+      ++E+ A +
Sbjct  418   DILALSYNYLPQHLKACFLYMGAFPE-DFEIPVWKLIRLWVAEGFLNATGHTTVEDIAEE  476

Query  1411  YLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGD  1590
              L+DLIDR+LVL  K S  G +KTC++HD++ D CL E K++ F+    + S +V+    
Sbjct  477   CLEDLIDRSLVLAGKRSN-GKLKTCKVHDIMRDFCLEEAKRQNFLHVL-KHSLDVLSESI  534

Query  1591  TEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMI  1770
             T       N    F +  IQP  S       SR++L F  +S +S         + FK++
Sbjct  535   TALRRFSINCSTIFSSYSIQPTDSTA---SVSRSILGF-NISESSIF-----SYIDFKLL  585

Query  1771  RVLDLVEISFDEAPTFDISDLILLRYLALGT-IKYVRVLKHHHNLQTLIVKFPNSCRiee  1947
             RVLD+    F + P+ +I  L+ LRYLA+ T  ++  ++    +LQTLI+          
Sbjct  586   RVLDITFQHFPQFPS-EILQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHL--------  636

Query  1948  idsdeeiGSKWLQGLWKSQSLRF------IKYPYPFPIDTDEIP--VQDTLHTLYWVPYL  2103
                     S     +W   +LR       I  P P  ++ +     V + L TL  +   
Sbjct  637   ----YSRSSTLPWEIWTMPNLRHLHVKPSICLPSPTKVECNRYSSLVLNNLQTLVNITLA  692

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIR--------------------AFQTET----WWD---  2202
              CTK+     P +K LGI C  I                      + +ET    W D   
Sbjct  693   DCTKDVFSSTPKLKKLGI-CESIEYTYPVQIPWSDFLYTSEKLWPYGSETISDLWSDCFR  751

Query  2203  NLHYLTKLEKLIVEDIESEQFELQ---SINSFPQSLKELKIVGTELGWEAITIISMLPNL  2373
             NL  L +LE L +  ++    EL+    +++ P++LK+L +  T L WE++T +  LPNL
Sbjct  752   NLALLPQLEALKIFGLKPPVQELKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNL  811

Query  2374  ESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLE  2553
             E LKL      G +W   + GF  LK L I  + L++W   +DHFP LE L L  C +L+
Sbjct  812   EVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEHWSASNDHFPCLEHLVLKGCLHLD  871

Query  2554  KIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              IP    DI TLQ+IEL++   S + SAK+IQEEQ SYGND L VR
Sbjct  872   SIPHELGDIPTLQIIELENSSQSALLSAKEIQEEQQSYGNDALEVR  917



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score =   405 bits (1041),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 302/915 (33%), Positives = 464/915 (51%), Gaps = 106/915 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TS +RT+  Q +E     +  + ++++ LR  L          EK  N++   +
Sbjct  1     MAYAAVTSFMRTIH-QSMELTGCDLQPFYEKLKSLRAIL----------EKSCNITGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
             ++      + ++++  ED ++ E   +       ER      +  +L++  E I+  ++Q
Sbjct  50    ELTILEVEIVEVAYTTEDMVDLESRSVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVIS  591
                T         Q++        A + Q + IMVG   E E   + L++   +E +V+S
Sbjct  110   WMATSYSMKDLKLQTSSLVSFPEHAYE-QPENIMVGRENEFEMMLDQLVR-GGRELEVVS  167

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEIN  771
             IVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L   ++   D +  
Sbjct  168   IVGMGGIGKTTLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLHGLLSSISDEPDDQ--  225

Query  772   EVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVA  951
                    LA+++++ L  +RYL+V+DDIW + GWDD++ CFPD  NGSRI LTTR  EVA
Sbjct  226   -------LADRLQKHLKGRRYLVVIDDIWTTEGWDDIKLCFPDCYNGSRIFLTTRNVEVA  278

Query  952   VYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
              Y+  SGK + ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC GLPLAI
Sbjct  279   EYAS-SGKPLHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGGLPLAI  335

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
             TV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK CFLYF +
Sbjct  336   TVIAGLLSKMGQRLDEWQRIAENVSSAVSTDPEAQCIRVLALSYHHLPSHLKPCFLYFAV  395

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             F +  R I    ++ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   SF G I+
Sbjct  396   FAEDER-IYVNKIVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFHGRIE  454

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKF  1659
             +C +HD+  +LCLRE +   FV+    +S+        +  F+  +R     + + + + 
Sbjct  455   SCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRI----SIHNEEEL  510

Query  1660  SDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLIL  1839
                 N  ++ +++ F+     +         +SFK++RVLDL        P F +  LI 
Sbjct  511   VWCRN-SEAHSIITFYDFKFVT-------LELSFKLVRVLDLGWTICPFFP-FGVLSLIH  561

Query  1840  LRYLALGTIKYVRVLK-HHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRF  2016
             LRYL+L     ++  +     + + I+  P S           I S      +K     +
Sbjct  562   LRYLSLCFKPCLQQYRGSKEAVPSSIIDIPLS-----------ISSLCFLQTFKLYLPSY  610

Query  2017  IKYPYPFPIDTDEIPVQDTLHTLYWVPYLR------------------------CTKEFV  2124
               +P+  P +   +P   TL  + W  YLR                        CT  F 
Sbjct  611   SDHPFILPSEILTMPQLRTL-CMGW-NYLRSHEPTENRLVLKSLQCLNQLNPRYCTGSFF  668

Query  2125  LKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-------IVEDIESEQFELQ  2274
                PN   +KV G+       F+      +  YL +LEKL            +     L 
Sbjct  669   RLFPNLKKLKVFGVP----EDFRNHKDLYDFRYLYQLEKLEFQTERATAPPTDVPTLLLP  724

Query  2275  SINSFPQSLKELKIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLK  2451
               ++FPQ+LK L   G   L W+ ++I+  LP LE LKL     +GE W   + GFP LK
Sbjct  725   PPDAFPQNLKSLTFSGDFNLAWKDLSIVGKLPKLEVLKLSGHAFIGEGWEVVEEGFPHLK  784

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL++    ++ W   SDHFP LERL L  C+ L+ IP  F DITTL L ++  C  S+V 
Sbjct  785   FLFLDEVYIRYWRASSDHFPYLERLFLRDCYFLDSIPRDFADITTLALTDISSCRQSVVN  844

Query  2632  SAKDIQEE-QSSYGN  2673
             SAK IQ++ Q +YG+
Sbjct  845   SAKQIQQDIQDNYGS  859



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   405 bits (1041),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 294/898 (33%), Positives = 464/898 (52%), Gaps = 97/898 (11%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L++D K +++ L   L   KA L++S +K +  +  K+++ +++D+ + AED I++    
Sbjct  23    LILDIKVQVEFLYNDLSLFKAFLKDSTEKRSKHETLKELVKQIRDVVYEAEDAIDT----  78

Query  328   IISNGASHERLHQI------------LQRLAEDIEGLIEQ-----RNTTQMLSSYNPGQS  456
              +++ A H+    I            L+ +A+DIE +  +      N      + + G  
Sbjct  79    FVAHAAVHKARKHIEKAFHIFDYPAKLRSVAKDIEQIRAKVKDIYENKKFGFEALHVGDG  138

Query  457   NQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
                         +++D + VG   E E+    LL   + E +VISIVGM G+GKTT+AK 
Sbjct  139   ADRGTKEKKPPIVEEDNV-VGFEDEAEKVIN-LLTGGSDELEVISIVGMPGLGKTTLAKM  196

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKVR  810
             IY DP I   F+   W  +SQDY  + +  ++     Q+TD   ++N+      LA ++ 
Sbjct  197   IYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQLTDSMYKMND----ENLAKELC  252

Query  811   RRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNL  990
             R L + +YL+V+DD+W    W+DL+  FP ++  SRIL+T+R+K VA ++  S +   NL
Sbjct  253   RILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRIKRVARHANPS-REPHNL  311

Query  991   PFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVEN  1167
              FL  +ESW L  ++ LG+ N P E+ + GK I N+CRGLPLAI V  G+L   ++  + 
Sbjct  312   RFLTPDESWRLLQRRALGAENCPEELVKDGKHIANECRGLPLAIVVIGGIL--LQKGTDW  369

Query  1168  WQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNL  1347
             W+ +A +++  +  D   +    + LSYN+LPYHLKACF+YFG+FP+   EIP   L+ L
Sbjct  370   WEQVAKSVDAYIAMDQEKRMDNFIALSYNHLPYHLKACFIYFGMFPE-DCEIPVWKLVRL  428

Query  1348  WITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREV  1527
             WI EGF+ +    SLE+   +YL+DL++RNLV++      G IKTCR+HD+L + C +E 
Sbjct  429   WIAEGFIQQKEEMSLEDIGEEYLEDLVNRNLVMVGLYRSNGKIKTCRIHDMLHEFCTKEA  488

Query  1528  KKEKFVSAFHQRSENVIELGDTEPLFEYA-----NRWLTFRTTY-IQPKFSDKYNFHKSR  1689
             K+E F     +  +    +     L  Y      +R L + +T  + P+      F    
Sbjct  489   KEENFFQEI-KNFDQCTYMSSNPALERYRRLCIHSRVLNYISTKPVGPRVRSFLCFSNEE  547

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT-I  1866
             T+L    +S   G         +FK++RVLD   I F   PT D++ L+ LRY+ L +  
Sbjct  548   TILQAEHISSIPG---------AFKLLRVLDAKSIIFTRFPT-DLTQLVHLRYIVLSSNF  597

Query  1867  KYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ---GLWKSQSLRFIKY---  2025
             K + V      N+QTL++                  S+ L+    +WK   LR +K    
Sbjct  598   KVLPVAFSSLWNIQTLVI---------------VTSSRTLEIKADIWKMIQLRHLKTNAS  642

Query  2026  -PYPFPIDT-----DEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQT  2187
                P P+       D+  +  +L TL  V    CT++   + PN+KVLGI+    +  + 
Sbjct  643   TALPGPLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKLLEN  702

Query  2188  ET---WWDNLHYLTKLEKL-IVEDI------ESEQFELQSINSFPQSLKELKIVGTELGW  2337
             ++    +D+L  L+ LE L ++ D+      E +   L     FP  LK+L +  T L W
Sbjct  703   KSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNLPQRYKFPPKLKKLTLSDTLLDW  762

Query  2338  EAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVL  2517
               ++ + ML NLE LKL      GE W   DGGF  L+ L+I  + L +W   + HFP L
Sbjct  763   NDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHFPRL  822

Query  2518  ERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQE-------EQSSYG  2670
             + L + HC +LE +P GF DI++LQL+EL     S   SA+ IQE       EQS+ G
Sbjct  823   KHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVEQSTRG  880



>ref|XP_006345285.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like, 
partial [Solanum tuberosum]
Length=873

 Score =   404 bits (1038),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 281/765 (37%), Positives = 414/765 (54%), Gaps = 82/765 (11%)
 Frame = +1

Query  508   IMVGHAQELERTKEMLLQCSTQERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLG  681
             IMVGH  E E    ML Q +  ER+  V+SIVGMGGIGKTT+A K+Y DP I S F +L 
Sbjct  145   IMVGHENEFEM---MLNQVAGGERELEVVSIVGMGGIGKTTLATKLYRDPRIMSHFDILA  201

Query  682   WATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWG  861
              ATVSQ+Y +R +L  L    ++  D +         LA+++++RL  +RYL+V+DDIW 
Sbjct  202   KATVSQEYCVRNVLLALLASTSEEPDDQ---------LADQLQKRLKGKRYLVVIDDIWT  252

Query  862   SRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESW-MLFSQKL  1038
                WDD+++CFPD +N SRILLTTR  EVA Y+  SGK   ++  ++ +ESW +L+ +  
Sbjct  253   KGAWDDIRQCFPDCNNRSRILLTTRNVEVAGYAR-SGKPPYHMRVMDFDESWSLLYEKVF  311

Query  1039  GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLH  1218
                + P E E++GK+I  KC GLPLAI V AGLLSKT ++++ WQSIA  ++  +++DL 
Sbjct  312   AKDSFPSEFEQLGKQIALKCGGLPLAIIVIAGLLSKTGKTLDVWQSIAENVSSVVSTDLE  371

Query  1219  DQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEE  1398
              QC  +L LSY++LP HLK CFLYF IFP+  R I    LL+LW+ EGF+  +   ++EE
Sbjct  372   AQCMRVLALSYHHLPSHLKPCFLYFAIFPE-DRLIFVNKLLDLWVAEGFLKVEEMENIEE  430

Query  1399  GAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENV-  1575
              A K L DL+DR+L+ IS   F G    C +HD+  +LCLRE +   FV+     S+ + 
Sbjct  431   VAEKCLTDLVDRSLISISHSIFDGKKARCGMHDVTRELCLREARNVNFVNVLRGTSDQIP  490

Query  1576  -----------IELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGA  1722
                        I + D + L  Y N              S+ ++       +F FG+   
Sbjct  491   CTQSMQTSRGRISIHDKQKLVRYLN--------------SEAHS-------IFMFGIYQF  529

Query  1723  SGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNL  1902
                   +   +SFK +RVL L  I F   P   +S LI LRY+AL    +  +++  H+ 
Sbjct  530   ------YEPELSFKRVRVLYLDSIKFQTFPRVILS-LIHLRYIALN---FRLLIEGDHSA  579

Query  1903  Q------TLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPID---TDE  2055
             +       L + +  + R+   D  ++        +     LR +     F  D   T++
Sbjct  580   KIDIPPSILNLCYLETLRLNVSDPYDKAALILPLEILMLPQLRHLHLTRNFLYDHGITEK  639

Query  2056  IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL  2235
               V   LH L  +    CT+ F  + PN+K L I+   +  F +     + HYL +LE+L
Sbjct  640   SLVLKNLHCLIGLNPRYCTEFFFRRFPNLKELQIRGFFV-DFCSRKDLRDFHYLDQLEEL  698

Query  2236  IVEDIESEQFELQSINS---------FPQSLKELKIVGT-ELGWEAITIISMLPNLESLK  2385
                      F+ +++ S         FPQ LK+L   G   L  + ++I+  LP LESLK
Sbjct  699   EFLLENLTSFDRKTVGSSLLLPPPCAFPQGLKKLAFTGEFFLPLKDLSIVGKLPKLESLK  758

Query  2386  LLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPE  2565
             L     +G+EW   + GFP+LKFL +     ++W   SDHFP LERL +  C  L  IP+
Sbjct  759   LEYDAFIGDEWEVAEEGFPRLKFLLLRCLHFRHWRASSDHFPCLERLIIDACWKLHSIPQ  818

Query  2566  GFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGND-QLVVRD  2694
              F +ITTL LI++K C  ++  SAK IQ++ +  YG   ++ +RD
Sbjct  819   DFANITTLALIDIKICAQAVGNSAKQIQQDIEDDYGRSIEVYIRD  863



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   401 bits (1030),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 293/890 (33%), Positives = 461/890 (52%), Gaps = 138/890 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +T+L+  +E   L+  P  ++ YK++++ L  K+  L+  LEESEK+ +   + K
Sbjct  1     MAYADITALLENLEF-LLQSDPHPILHYKEQVESLHDKVNLLRGFLEESEKRYD-RGSMK  58

Query  259   DVIARVKDISFRAEDEIESEVMEIIS--NGASHERLHQILQR----LAEDIEGLIEQRN-  417
              +   ++D+ ++A   I+S+++ + +  +  S ++  +IL+R    L E ++ ++++ N 
Sbjct  59    HLELEIRDVFYKARKVIDSKLLNVYAAKSAKSWKKARRILRRSLRKLTEKVDFILKKLNK  118

Query  418   -TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
              + +  ++ +      E ++ G + ++  +  +VG   +L+  K+ L Q S    + I I
Sbjct  119   ISQKRKNAASADLQAGEPVLGGLSRRVYMENHVVGLNNDLQIVKDRLTQ-SPLRLETIPI  177

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGG+GKTT+A+++Y+DPSI   FH+  W TVSQD+ +R +LQDLC       D E+N 
Sbjct  178   VGMGGVGKTTLARRLYEDPSIVLHFHVRLWVTVSQDFQIRILLQDLCQL---GNDNEMN-  233

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
                 A+LA  + + L  +RYL+V+DDIW +  WD ++  FPDD+NGSRI+LT+RLKEVAV
Sbjct  234   ---NADLAEHLYKSLKGRRYLIVLDDIWCTEAWDAVKSIFPDDNNGSRIILTSRLKEVAV  290

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPPEIEEIGKRIVNKCRGLPLAITVAAG  1134
             ++  + K   ++  L+                      E+GK I  KC+GLPLAI V AG
Sbjct  291   HA--NRKKPLHIKLLDP---------------------EVGKEIAAKCQGLPLAIVVVAG  327

Query  1135  LLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVR  1314
              L K  R+ + W + A ++   +T D   QC  I+ LSYN LP  LKACFLYFG FP+  
Sbjct  328   YLLKIDRTRDCWDNFADSVASYVTGD-PQQCLDIIALSYNQLPPPLKACFLYFGAFPE-D  385

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
             REIP   L+ LW+ EGF+ + +G+SLEE A + L DLIDRNL+L+ ++S+ G IKTC +H
Sbjct  386   REIPVSRLIYLWVAEGFLKQVTGKSLEEIAEECLMDLIDRNLILVRRVSY-GRIKTCIIH  444

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYN  1674
             D+L DLCLRE +KE F+   +  S                                  + 
Sbjct  445   DILRDLCLREAEKENFMHVVNHNS----------------------------------HV  470

Query  1675  FHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLA  1854
             FH+ +T+                 Q +SF M       + SF    T  I  L       
Sbjct  471   FHEGKTI----------------AQRLSFHM-------DCSFPILSTTHIDSL-------  500

Query  1855  LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY-  2031
                      + H  NLQTL++   + C              W   LW  Q LR + + + 
Sbjct  501   ------PSTISHLWNLQTLVLNIYSGCTTL----------PW--KLWTIQQLRHLHFNFC  542

Query  2032  ---PFP----IDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTE  2190
                P P    I+     V   L TL  + +  CT + +  +PN+K LG+  +        
Sbjct  543   SFLPNPAGAEINGQGDLVLRNLQTLSKLSFSSCTMQVIASLPNLKKLGLYETAEAHSNCW  602

Query  2191  TWWDNLHYLTKLEKLIVEDIE---SEQFELQSINSFPQSLKELKIVGTELGWEAITIISM  2361
             ++  N+  L +LE L +  I     E+  +  ++ FP +LK+L +  + L W+ + ++SM
Sbjct  603   SYISNVAQLHQLEILKLNFINLFAEERRWVPCVDEFPPNLKKLTLSSSYLPWKDMNVLSM  662

Query  2362  LPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHC  2541
             LPNLE LKL     +G +W   + GF +LK+L I    L +W   S  FP L+ L L  C
Sbjct  663   LPNLEVLKLKNNAFVGSDWEQYEEGFSRLKYLLIDKTDLVHWRATSTQFPSLKHLRLFRC  722

Query  2542  HNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
               L ++P  F +I  LQ+I++   + + V S   I++EQ S GND L+VR
Sbjct  723   RCLREVPLDFAEIPYLQIIDVYGSYDA-VRSVMQIKQEQESVGNDDLLVR  771



>ref|XP_011071868.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=859

 Score =   402 bits (1034),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 301/904 (33%), Positives = 457/904 (51%), Gaps = 99/904 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL   +E LQ    R  L +D+ +++Q L QK+     L         +SQ  +
Sbjct  5     AYASLLSLSHVMENLQHPARRTRLHLDW-NQVQTLHQKV--QFLLEFLEVDSGRISQEME  61

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHER------------LHQILQRLAEDIEGL  402
             D+  ++  ++  AED I+  V+  + +G+  +             +H+++Q++   +  L
Sbjct  62    DLARQISILAHEAEDVIDLHVVYQLGHGSGDKSQDVAALSSFYIDIHKVIQKIDSIMNEL  121

Query  403   -IEQRNTT-----QMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
              I Q + T     QM+ S  P  S+     +G +S       MVG  + L R  + L + 
Sbjct  122   RIIQEDCTDVSKQQMVVSV-PDNSSTAFTSSGKSST------MVGFDEHLFRVMDELTR-  173

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
             +  +  +I I GMGGIGKTT+AK  +D+P +   F    W T+SQ+Y  R IL  L   +
Sbjct  174   NEPDLNIIPITGMGGIGKTTLAKNTFDNPYVVHHFDKRIWFTISQEYKAREILVRL---L  230

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                 D+E +E  + AEL  ++ + L  +RYL+V+DD+W    WD+L+  FP++ NGSRIL
Sbjct  231   NDGKDQESSE--TLAELGQRLHQSLFGRRYLIVMDDMWSISAWDNLRLFFPNNRNGSRIL  288

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLP-PEIEEIGKRIVNKC  1098
             +TTR+  VA+  G    YV  + FLN ++SW L  +K  G  N P PE+EEIGK I  KC
Sbjct  289   VTTRISNVAISLGSHNPYV--MDFLNEDKSWNLLCRKAFGEDNCPYPELEEIGKTIAKKC  346

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLA+ V  GLL+ + R++E+W+S+A ++N     +  D+C  IL+LSY+NLP HLK 
Sbjct  347   NGLPLAVVVIGGLLANSNRTLEHWESVAKSINSFSNLEYSDRCLKILSLSYDNLPIHLKP  406

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLY  +FP+   EI    L+ LW+ EGF+     ++LEE A +YL++ IDRNL+L+ + 
Sbjct  407   CFLYMRMFPE-DDEIEASKLIKLWVAEGFLKPSRAKTLEEVAEEYLRNFIDRNLILVRRW  465

Query  1459  SFIG-NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELG--------DTEPLFEY  1611
             ++ G   KTC +HDLL DLCLR+ +KE  +     +  +V E          D +   + 
Sbjct  466   NYEGKKAKTCSIHDLLRDLCLRQFQKECLICVPKAQCISVFEPQCFLCGSQLDEDQRMDL  525

Query  1612  ANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE  1791
                 +T ++T +                     +S      + +   V  +++R    V+
Sbjct  526   PEVQVTSQSTSLA-------------------SLSVCDDCRIMYPNLVRLRLLR----VK  562

Query  1792  ISFDEAPTFDISDLILLRYLALGTIKY--VRVLKHHHNLQTLIVKFPNSCRieeidsdee  1965
                D+      + L  L+   +  +K+  +  +    NLQTL +                
Sbjct  563   ACMDDMDFLHPTKLCYLKMSCIKQLKFESLSTISLLWNLQTLTLHL-------------F  609

Query  1966  iGSKWLQGLWKSQSLRFI----KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKI  2133
              G      +W    LR +        P P+ T +  + + L TL  +   RCT + + ++
Sbjct  610   FGVNLPSEIWDMPQLRHLIGRRNVVLPHPVVTQDSMIMENLQTLAALQNFRCTIDVLDRV  669

Query  2134  PNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELK  2313
             PN+K LGI    +   +     +NL  L KLE L + +   E   L +  SFP SLK+L 
Sbjct  670   PNLKKLGI----VHLKKGSGGLENLARLQKLESLYLLE---ENVSLLANISFPTSLKKLS  722

Query  2314  IVGTELGWEAITII-SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE  2490
             +    + WE +T+  S+LPNLE L L      G EW   +G FP+LK L I  + L  W 
Sbjct  723   LSNCCIPWEKMTVFGSILPNLEKLTLNCNAFKGPEWSPVEGQFPQLKVLRIWESDLVKWR  782

Query  2491  TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYG  2670
               S HFP LERL L++   LE+IP G  DI TL  I L  C  S V SAK I EEQ S+G
Sbjct  783   ADSIHFPNLERLHLYNMFCLEEIPWGIGDIPTLLSIHLLKCSDSCVNSAKQILEEQQSFG  842

Query  2671  NDQL  2682
             N+ L
Sbjct  843   NETL  846



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   403 bits (1035),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 293/898 (33%), Positives = 463/898 (52%), Gaps = 97/898 (11%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L++D K +++ L   L   KA L++S +K +  +  K+++ +++D+ + AED I++    
Sbjct  23    LILDIKVQVEFLYNDLSLFKAFLKDSTEKRSKHETLKELVKQIRDVVYEAEDAIDT----  78

Query  328   IISNGASHERLHQI------------LQRLAEDIEGLIEQ-----RNTTQMLSSYNPGQS  456
              +++ A H+    I            L+ +A+DIE +  +      N      + + G  
Sbjct  79    FVAHAAVHKARKHIEKAFHIFDYPAKLRSVAKDIEQIRAKVKDIYENKKFGFEALHVGDG  138

Query  457   NQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
                         +++D + VG   E E+    LL   + E +VISIVGM G+GKTT+AK 
Sbjct  139   ADRGTKEKKPPIVEEDNV-VGFEDEAEKVIN-LLTGGSDELEVISIVGMPGLGKTTLAKM  196

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKVR  810
             IY DP I   F+   W  +SQDY  + +  ++     Q+TD   ++N+      LA ++ 
Sbjct  197   IYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQLTDSMYKMND----ENLAKELC  252

Query  811   RRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNL  990
             R L + +YL+V+DD+W    W+DL+  FP ++  SRIL+T+R+K VA ++  S +   NL
Sbjct  253   RILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRIKRVARHANPS-REPHNL  311

Query  991   PFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVEN  1167
              FL  +ESW L  ++ LG+ N P E+ + GK I N+CRGLPLAI V  G+L   ++  + 
Sbjct  312   RFLTPDESWRLLQRRALGAENCPEELVKDGKHIANECRGLPLAIVVIGGIL--LQKGTDW  369

Query  1168  WQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNL  1347
             W+ +A +++  +  D   +    + LSYN+LPYHLKACF+YFG+FP+   EIP   L+ L
Sbjct  370   WEQVAKSVDAYIAMDQEKRMDNFIALSYNHLPYHLKACFIYFGMFPE-DCEIPVWKLVRL  428

Query  1348  WITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREV  1527
             WI EGF+ +    SLE+   +YL+DL++RNLV++      G IKTCR+HD+L + C +E 
Sbjct  429   WIAEGFIQQKEEMSLEDIGEEYLEDLVNRNLVMVGLYRSNGKIKTCRIHDMLHEFCTKEA  488

Query  1528  KKEKFVSAFHQRSENVIELGDTEPLFEYA-----NRWLTFRTTY-IQPKFSDKYNFHKSR  1689
             K+E F     +  +    +     L  Y      +R L + +T  + P+      F    
Sbjct  489   KEENFFQEI-KNFDQCTYMSSNPALERYRRLCIHSRVLNYISTKPVGPRVRSFLCFSNEE  547

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT-I  1866
             T+L    +S   G         +FK++RVLD   I F   PT D++ L+ LRY+ L +  
Sbjct  548   TILQAEHISSIPG---------AFKLLRVLDAKSIIFTRFPT-DLAQLVHLRYIVLSSNF  597

Query  1867  KYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ---GLWKSQSLRFIKY---  2025
             K + V      N+QTL++                  S+ L+    +WK   LR +K    
Sbjct  598   KVLPVAFSSLWNIQTLVI---------------VTSSRTLEIKADIWKMIQLRHLKTNAS  642

Query  2026  -PYPFPIDT-----DEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQT  2187
                P P+       D+  +  +L TL  V    CT++   + PN+KVLGI+    +  + 
Sbjct  643   TALPGPLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKLLEN  702

Query  2188  ET---WWDNLHYLTKLEKL-IVEDI------ESEQFELQSINSFPQSLKELKIVGTELGW  2337
             ++    +D+L  L+ LE L ++ D+      E +         FP  LK+L +  T L W
Sbjct  703   KSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNPPQRYKFPPKLKKLTLSDTLLDW  762

Query  2338  EAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVL  2517
               ++ + ML NLE LKL      GE W   DGGF  L+ L+I  + L +W   + HFP L
Sbjct  763   NDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHFPRL  822

Query  2518  ERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQE-------EQSSYG  2670
             + L + HC +LE +P GF DI++LQL+EL     S   SA+ IQE       EQS+ G
Sbjct  823   KHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVEQSTRG  880



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score =   402 bits (1033),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 288/838 (34%), Positives = 438/838 (52%), Gaps = 60/838 (7%)
 Frame = +1

Query  244   SQAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERL---HQILQRLAEDIEGLIEQR  414
             S  ++ + +R++D S  AED +ES ++E I +    E        L R+  +++   E+ 
Sbjct  58    SYGKQSLESRIRDASHDAEDILESHLVEQILSCQGDESFVFSPPDLDRVIRELDSAKEEM  117

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
                  +SS  P  S+   + +      +D  I+VG  ++L +  + L+   ++  QVI I
Sbjct  118   MMMMTMSSSPPADSSSPALSSSQDPNPKD--IIVGVGEDLIQLMDRLVGQPSKALQVIPI  175

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYD---LRRILQDLCGCVAQMTDKE  765
             VGMGGIGKTT+A+ +YDDPS+ S F    WAT+SQDY+   ++ +L  L GCV    + E
Sbjct  176   VGMGGIGKTTLARHLYDDPSVISHFDTHAWATISQDYNRGKVQDVLTSLLGCVIGKPNAE  235

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
             + E ++ A+L   + + L+ +RYL+V+DD+W  + WDD++R FP+  NGSRI++TTR   
Sbjct  236   MLE-RAGADLGLHLYQALIGRRYLIVLDDMWDIKPWDDIRRFFPNKENGSRIIVTTRESS  294

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSI--NLPPEIEEIGKRIVNKCRGLPLAI  1119
             VA Y+  SG     +  L  +ESW L  QK+ +      PE+E+IG+RI   CRGLPLAI
Sbjct  295   VADYTA-SGSSHHQVNLLKDDESWNLLRQKVFAPQETCSPELEKIGRRIAKGCRGLPLAI  353

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V  G+LS+ KRS + W+ ++  ++    +D  +Q + IL+LSYN+LP HLK+CFLY G 
Sbjct  354   HVICGILSQAKRSQDLWEQVSDNVS-STIADKGEQFTNILSLSYNHLPDHLKSCFLYMGA  412

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FP+    I +  L+NL + EG V   S +SLEE A  YL+ L+DRNL+ + +    GN+K
Sbjct  413   FPE-DYAIRSSTLINLLVAEGLVRPISDKSLEEAAEMYLKALVDRNLIFVYRKGTNGNVK  471

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKF  1659
             +  +HDLL DLC+R+V +EKF+              D     + A      R    + +F
Sbjct  472   SYSIHDLLRDLCVRKVHEEKFLFV------------DGWAPDDLARNTACLRRVSSRGRF  519

Query  1660  SDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLIL  1839
             S KY   +   L   F + G  G  ++       +++RVLD++ I F E P  ++  LI 
Sbjct  520   STKYISREQIRLARSFLLFGYMGQSLASAGVYELRLLRVLDILRIMFKEFPE-EVLQLIN  578

Query  1840  LRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRF  2016
             LRYLAL   + +   +    NLQT++V    S RI             + G+     LR 
Sbjct  579   LRYLALTIGRCLPSSISRLRNLQTILVVRGGSLRIVGAIMV-------MPGILDMSQLRH  631

Query  2017  IK------YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRA  2178
             I+      Y      D +   V D L TL  +     T   +  +P+++ LGI       
Sbjct  632   IRLKGQRTYIKYHGEDRNLFVVLDKLQTLSPIAVSDFTDRHIETLPHLEKLGI-------  684

Query  2179  FQTETWWD-------NLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGW  2337
                  +WD       ++ +L KL  L     +  ++ + S    P S+K+L + G  +  
Sbjct  685   -----FWDEEVDHVRDVSHLHKLHTLKCRSSKYNRYNILSNIILPPSIKKLTLKGCRIRD  739

Query  2338  EAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVL  2517
               +  I  LPNLE LKL   Y     W   DG F +L+FL + G KL NW     HFP L
Sbjct  740   HELNEIGKLPNLEILKLQYCYFESGNWEGEDGEFCRLQFLLMKGLKLVNWTADDTHFPRL  799

Query  2518  ERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             E L + +C  L++IP    DI TL+++E+  C  S   SA++I E Q   GND+L VR
Sbjct  800   EELVIQYCFELKEIPLAIGDIPTLKVMEVLRCGDSAKASAREIMEAQVDNGNDELQVR  857



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score =   402 bits (1032),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 307/904 (34%), Positives = 469/904 (52%), Gaps = 65/904 (7%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L S++ T+E Q L      +  +K  ++ L +K   L+  LE  +      +   D
Sbjct  3     AYAALNSVMGTIE-QLLTSNLSCLQGHKQHLKLLYEKFGSLQESLENID-----GEPTTD  56

Query  262   VIARVKDISFRAEDEIESEVMEIISNGA-----SHERLHQILQRLAEDIE----GLIEQR  414
             +  +VK +++ AEDE+ES   +           S ER  +  Q+  ++I+     LI+Q+
Sbjct  57    LQVKVKGVAYEAEDEVESLAKQFAEKNEVLPFESSERFGKFCQQATQEIDYVKAQLIKQK  116

Query  415   NTTQML---SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
                 +    SS +   S + H     AS L+DD  MVG   E +R    L + S +  +V
Sbjct  117   ENKNLQAGNSSTDGSSSLRPH-----ASILEDD--MVGRTIERDRIINKLKRRSNK-LEV  168

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             IS+VGM GIGK+T+AK I+ D  I+  FH+  W TVS++ + R++L DL    A    +E
Sbjct  169   ISVVGMAGIGKSTLAKDIFQDTFIKQYFHIRKWITVSENCNFRKMLLDLLQD-ATAKKEE  227

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
             +N+ K+  +LA   +  L  +RYL++VDDIW    W+ +   FPD  N SR++LT+R + 
Sbjct  228   LNK-KTDGDLAGIFQNSLKVERYLIIVDDIWSKEAWNRMIHWFPDCENNSRLVLTSRDQP  286

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA ++  S + V  +  L  ++SW LF QK+    + P E +EIG+ +V +C+GLPL IT
Sbjct  287   VADHA-TSPEDVIRMHLLEPDKSWDLFHQKVFAKRDYPVEFKEIGREVVKECKGLPLMIT  345

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
               AG+LS +K +++ W+ +A  M+  + +D + +C  ++ LSYN+LP H+KACFL FG+F
Sbjct  346   AVAGILS-SKSTLDEWKKVAKNMSSLVNNDDYQRCLEVVDLSYNHLPSHMKACFLNFGVF  404

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKT  1482
             PK   EI  K L+ LW+ +G +     +  E+ A K L DLI +NLV+I K S  GNIKT
Sbjct  405   PKAI-EISVKKLIRLWVAKGLLKLKGVKEWEKVAAKVLLDLIGKNLVIIDKQSLDGNIKT  463

Query  1483  CRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT--TYIQPK  1656
             CR+HDL  DLCLRE ++E  +   +  S+  I     +       RW++  +  +   P 
Sbjct  464   CRIHDLFHDLCLREAERENLL---YVTSDATISASGIQRNLPKDRRWVSIHSSGSVSYPS  520

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLI  1836
                    H     L+F G      + +   +   FK +RVLDL  +  D    F    L 
Sbjct  521   MRSADLTHSKAHSLYFMGSFFWFEMDL---EPFLFKRLRVLDLEGMMVDLFHIFK-GGLY  576

Query  1837  LLRYLALGTIKYVRVLKHHH--NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
              LRYLA+ T  +  +L   +  N+QTLI     S R    ++       + + +W+   L
Sbjct  577   RLRYLAVMTGDWSEILPISNLWNIQTLIF----SPRPGISNNYI----SYQKEIWQMSQL  628

Query  2011  RF-----IKYPYPFPIDTDEIP--VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
             R+     I    P  I  +E+   V   L T+  +    CTKE +  I  VK L I+ + 
Sbjct  629   RYLYARGISLCSPGLISGNEVERLVLGNLLTVSGLSPSCCTKEVIEGIKKVKKLAIRSTR  688

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQ-----FELQSINSFPQSLKELKIVGTELG  2334
                 +   W DNL YL +LE L + D          F L S +S P SLK+LK+  T L 
Sbjct  689   HDFSKDPEWIDNLKYLDELEALSIADNNYPSRTCPFFRLTSQDSLPPSLKKLKLTTTHLP  748

Query  2335  WEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMS-DHFP  2511
             WE + II  LPNLE L+L +    G EW   +  F  LK+  +  +  + W++ S DHFP
Sbjct  749   WEYMAIIGKLPNLEVLQLKKWAFEGNEWKVTE-IFKNLKYFLLDQSYFQYWKSDSNDHFP  807

Query  2512  VLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              LE+L +  C  L++IP+ F    TL+LIE+  C   +V+  K I + Q   G D+L V 
Sbjct  808   NLEQLIIRDCSFLKEIPQEFNTSKTLELIEVHGCTRRVVDLFKGILDFQDLLGRDKLKVN  867

Query  2692  DYDT  2703
             D++T
Sbjct  868   DFNT  871



>ref|XP_009603167.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   401 bits (1030),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 318/947 (34%), Positives = 470/947 (50%), Gaps = 142/947 (15%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  LTSL+ T+ L   +    L+  +K+ ++ L +K+  L   L+ +       +  KD
Sbjct  3     AYAALTSLMGTIHL-ISQSNLDLLDGHKEHLKLLYEKVSSLLEFLDTNSD----DEPMKD  57

Query  262   VIARVKDISFRAEDEIESEVMEIISNG-------------ASHERLHQILQRLAEDI---  393
             +  +VKD++   ED++ES +                     +HERL +ILQR  E I   
Sbjct  58    LQEKVKDLAHEVEDKVESHIQREAQKKLLKMLQRVFHLPTKAHERLLKILQRAVEAIDSI  117

Query  394   -EGLIEQRNTTQMLSSYNP-GQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCS  567
              E L +QR    M +  +  G SN    +    S L+++  MVG+  E      ML Q +
Sbjct  118   KEELFKQRENNNMQAGNSSLGGSNS---LGSHVSTLENN--MVGYNDE---QASMLRQLT  169

Query  568   TQERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR----ILQD  729
                RQ  VISIVGMGGIGK+T AK+++ DPS+   F + GW T+S+DY +R+    +LQD
Sbjct  170   GDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWITMSKDYSIRKMLLSLLQD  229

Query  730   LCGCVAQMTDKE------------INEVKSTAE------------LANKVRRRLMRQRYL  837
                 + +++D+E             ++++ + E            LA+++++ L  +RYL
Sbjct  230   AGVDLDKVSDEEQADHLQKSDEEQADDLQESDEEPLDYLQKINNALADRLQKSLKGRRYL  289

Query  838   LVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESW  1017
             +VVDDIW +  WD+++  FP+ +N SRILLTTR  +VA Y+         + FL+  ESW
Sbjct  290   IVVDDIWSTDAWDEIKLWFPEYNNRSRILLTTRDMKVAQYASFPEDPF-PMRFLDPEESW  348

Query  1018  MLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMN  1194
              LF QK       P E+E + K +V  C+GLPL I+V AG LS +KR++  W+ +A +++
Sbjct  349   NLFCQKAFDKKTCPIELENVAKEVVENCKGLPLMISVIAGTLS-SKRTLNEWRKVAKSVS  407

Query  1195  LPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVME  1374
               +  D + +CS +L LSYN+LP HLKACFLYFG+FPK   +I  K L+ LW  EG    
Sbjct  408   SLVNLDDYQRCSGVLALSYNHLPSHLKACFLYFGVFPKAS-DISVKKLIRLWAAEGLFEL  466

Query  1375  DSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAF  1554
                  LE+ A   L DLID++L+++S+ SF G IKTCR+HDLL DLC RE + +  +   
Sbjct  467   KGLEGLEKVAAYLLHDLIDKSLIIVSRRSFDGKIKTCRIHDLLHDLCWREAESDSILYVV  526

Query  1555  HQRSENVIELGDTEPLFEYANRWLTFR-TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGL  1731
                  N +  G     F    RW++        P      ++ K+R++ F+         
Sbjct  527   -----NDVPYGGPRRYFPQGRRWVSLHLAGGYYPTLFSALSYRKTRSVHFYAD-------  574

Query  1732  PVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL--GTIKYVRVLKHHHNLQ  1905
             PV   Q   FK++RVLDL    F      +I  L+ LRYL +    I     + +  NLQ
Sbjct  575   PVYNLQLEHFKLLRVLDLEATEFQYGFPREILRLVCLRYLVMKIDEISEHIPISNLQNLQ  634

Query  1906  TLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIK----YPYPFP-IDTDEI--PV  2064
             TL++ F  S +                G+W    LR +     + YP P +  +E+  P 
Sbjct  635   TLVI-FTTSRKGFINLR---------DGIWDMSQLRHLNCSRIFLYPPPNVSPNEVEYPS  684

Query  2065  QDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE  2244
              + L ++  +    CTKE    I  VK +GI C    ++    W  NL YL +LE L + 
Sbjct  685   LENLQSVCGLSSSCCTKEIFKGIKKVKKMGISCD---SYSESEWLANLKYLLELEALSIA  741

Query  2245  ------DIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKL-----L  2391
                   ++ S+ F L    SFP +LK+L +  T L WE +TIIS LP LE L+L      
Sbjct  742   SSSYYGNVYSD-FRLPCPGSFPPNLKKLTLCCTRLSWEDMTIISKLPKLEVLQLKEDDFA  800

Query  2392  QAYEMGEE-WVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEG  2568
             ++  +GE  W   + GFP+LKFL +    L  W    D+FP LE                
Sbjct  801   RSLSVGERVWEVTEMGFPELKFLLLEKLILDYWRATDDYFPCLEH---------------  845

Query  2569  FTDITTLQLIELKDCFPSLVESAKDIQEEQ-SSYGNDQLVVRDYDTR  2706
                           C PS+V SA+ IQ EQ  S G D L V   DTR
Sbjct  846   -------------GCSPSVVTSAEWIQREQLESSGTDMLRVYAVDTR  879



>ref|XP_004251533.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=930

 Score =   401 bits (1031),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 299/892 (34%), Positives = 466/892 (52%), Gaps = 116/892 (13%)
 Frame = +1

Query  271   RVKDISFRAEDEIESEVMEIIS------NGASHERLHQILQRLAEDIEGLIEQ-------  411
             ++ ++++RAE EI+S+ +E++        G +  +L   L+++ E+I+ ++++       
Sbjct  57    QIVEVAYRAEKEIDSKSIEVVRAKTDTLRGRAFWKLSCFLEQVVENIDSIMKEWMAIRDG  116

Query  412   ----------------------------------RNTTQMLSSYNPGQS--------NQE  465
                                                +   M++ +   QS          +
Sbjct  117   CNNMKEYMIVSESSKSFLAKTEMRQGLTFWKRAVGHVDSMMNKWRKKQSICTKSKDVEAQ  176

Query  466   HIIAGGASK--LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKI  639
             ++  G  S+  L+ + +MVGH  E E  ++ L + ++ + +V+SIVGMGGIGKTT+A KI
Sbjct  177   NLTLGSTSRHSLEHENVMVGHENEFEMMQDQLTRGAS-DLEVVSIVGMGGIGKTTLANKI  235

Query  640   YDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRL  819
             Y DP + S F      T+SQDY +R +L  L   ++  T +   E +   +LA+++++ L
Sbjct  236   YTDPFVMSCFDKRAKVTISQDYCVRNVLLRLLSSISGKTHQTYEE-QDDGQLADQLQKLL  294

Query  820   MRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFL  999
                RYL+V+DDIW +  WDD++ CFPD +  SRIL+TTR  EVA Y+  SG     +  +
Sbjct  295   KGPRYLVVIDDIWTTGAWDDIKLCFPDCNCRSRILMTTRNMEVAEYAS-SGSPPYQMRLM  353

Query  1000  NSNESWMLFSQKLGSINL-PPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQS  1176
             N +ESW L  +K+ +    P E E++GK+I +KC+GLPL I V AGLLSK    ++ W+S
Sbjct  354   NFDESWSLLYEKVFARGFFPHEFEQLGKQIASKCKGLPLMIVVIAGLLSKIGNRLDRWRS  413

Query  1177  IASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWIT  1356
             +A  ++  M +DL  QC  +L LSY +LP+HL+ACFLYF +FP+  + I   +L+ LW  
Sbjct  414   VAENVSSVMNTDLDVQCMRVLALSYYHLPHHLRACFLYFALFPE-DKLIFVNELVKLWAA  472

Query  1357  EGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL-SFIGNIKTCRLHDLLFDLCLREVKK  1533
             EGF+  D  +S+E+ A + L+DL+DR+LV I ++ SF G IK C +HD++ +LCLRE +K
Sbjct  473   EGFLKVDETKSMEQVAKQSLKDLVDRSLVFIQRVSSFDGKIKACGMHDVIRELCLREARK  532

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT-TYIQPKFSDK-------YNFHKSR  1689
               FV        NVI   D +   E A  + T R    IQ K S              S 
Sbjct  533   INFV--------NVIM--DNQNPSEQAKHFSTTRVRISIQSKQSKTVVNRLSMVRNDDSC  582

Query  1690  TLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT--  1863
             +++       +S +  + ++   FK++RVLDL   + +  P+  I +L  LRYLAL    
Sbjct  583   SIVLSVDDPSSSNMMQALKR---FKVLRVLDLASSTLNAFPSC-IVELFHLRYLALSVYS  638

Query  1864  ------IKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKY  2025
                   I     +     LQTLI+K P S   +               ++K   LR +  
Sbjct  639   STDDRGIDIPPSIASLQYLQTLILKSPTSLAWKYSRPFILPSE-----IFKMSQLRHLSL  693

Query  2026  PYPFPIDTDEIPVQDTLHTLY----WVPYLRCTKEFVLKIPNVK---VLGIKCSEIRAFQ  2184
              + +    + I     L  L     W P L CT      +PNVK   + GI+   IR+ +
Sbjct  694   DWNYLKQHESIERSWLLRNLQCLSGWNP-LSCTSSIFRLLPNVKKLQIYGIQEGYIRSNK  752

Query  2185  TETWWDNLHYLTKLEKL--------IVEDIESEQFELQSINSFPQSLKELKIVGTELGWE  2340
              E  + +L YL +L++L        IV  +   +  L SI +F ++LK+L   GT L W+
Sbjct  753   DEV-FHSLCYLDQLKELDFKMKKTAIVRPMFPTRLILPSIGTFLKNLKKLAFRGTRLHWK  811

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              + I+  LP L++LKL     +G +W  G+ GFP LKFL +    L  W   SDHFP LE
Sbjct  812   DLEILGKLPKLKALKLGYDACLGTDWEVGEEGFPHLKFLRLKQLYLHKWIASSDHFPCLE  871

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             RL ++ C ++  IP+ F DITTLQLI + D   S+  SAK IQ+E + +YG+
Sbjct  872   RLVINRCWSMYSIPQDFVDITTLQLIHVSDSAKSVGNSAKMIQQEIEDNYGS  923



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score =   400 bits (1029),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 298/930 (32%), Positives = 464/930 (50%), Gaps = 94/930 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  + S+  T+ L     +  + +D K  ++ L Q L              +      
Sbjct  1     MAYAAVASVSETLSLILNHHQYAVFLDQKRRLRSLHQHL------KFLRAFLEDFPDKAI  54

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGAS----------------------HERLHQIL  372
              +  R++D +  AED IE  + E I + +S                        RL ++ 
Sbjct  55    HLEGRIRDAATEAEDIIEHLLSEEIRSWSSTGGGGGRPRTVHPSPHRTANSISRRLQKMC  114

Query  373   QRL---AEDIEGLIEQ----RNT------TQMLSSYNPGQSNQEHIIAGGASKLQDDAIM  513
             Q+L   AE +  ++E+    +N+       Q+L+  +P  ++   ++       + DA M
Sbjct  115   QQLPKAAEVVGSIVEEVMGIKNSLGAVQDPQVLTHSSPPTTSSTALVPTKKYDQKIDA-M  173

Query  514   VGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATV  693
             VG  ++L  TK  L   S++  + I I GMGGIGKTT+A+  Y D  I   F +  W TV
Sbjct  174   VGFEEDLLATKTRLYGGSSK-LEFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLTV  232

Query  694   SQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGW  873
             SQDY ++++L  L   +    +K   E  S  +++ +V +    +RYL+V+DD+W ++ W
Sbjct  233   SQDYSVQQMLFALVDSIKPFNEKFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWSTKAW  292

Query  874   DDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSIN  1050
             DD++R  PDDSNGSRI++TTRL++VA Y+  S   +  + F++ ++SW+L  QK+    +
Sbjct  293   DDVRRILPDDSNGSRIIITTRLQDVAAYADSSSP-LHEMRFMDVDQSWILLRQKVFNEQH  351

Query  1051  LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCS  1230
              P E+E  G  I   C+GLPLAI V AG+L    ++  +W+ IA  +NL +++   +Q  
Sbjct  352   CPAELESTGMMIARSCKGLPLAIVVIAGILKTVSQTQASWEDIAKKVNLAVSAK-DEQFG  410

Query  1231  TILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMK  1410
              IL+LSY +LP+HL+ CFLY G FP+   EI    L+ LW+ EGF+     +S EEGA +
Sbjct  411   RILSLSYTHLPHHLRPCFLYMGCFPE-DYEIHVSKLVQLWMAEGFMKPSVSKSFEEGAEE  469

Query  1411  YLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVI---E  1581
             YL+DL+ R+LVL+++    G IK+C +HDL+ DLC+R+ ++EKFV     R  + I    
Sbjct  470   YLEDLVKRSLVLVNRRKSNGKIKSCSVHDLVRDLCIRKAREEKFVLYALDRYVDRILPKP  529

Query  1582  LGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSF  1761
             + D   L    +  L F+  +  P       F   R  LF   + G             F
Sbjct  530   IKDQHRLSIPRSTMLLFQNIFT-PTIRTALYFQHCR--LFPSSLKG-------------F  573

Query  1762  KMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV-----LKHHHNLQTLIVKFP  1926
             +++RVLD  +++  + P  ++ +L  LRYLA  T  Y  +     +    NLQTL + +P
Sbjct  574   RLLRVLDAQKVTVMKFPA-EVLELFHLRYLAF-TRGYDDLCIPASISKLENLQTLFI-YP  630

Query  1927  NSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY--PFPIDTDEIPVQDTLHTLYWVPY  2100
                      +           +W+   LR + +    P P         + L TL  +  
Sbjct  631   YGGDNAFYSAICFQAE-----IWRMAQLRHLVFFMLDPLPSPCPRSFALENLQTLALLLN  685

Query  2101  LRCTKEFVLKIPNVKVLGIKCSEIRAFQTETW-WDNLHYLTKLEKLIVED----------  2247
              RC++      P++K LG+   + R    E +   NL +L +LEKL +            
Sbjct  686   FRCSERIGQIFPSLKKLGLIYGKDRVLNWEFYGLHNLVHLHQLEKLKISMPISSWESHSP  745

Query  2248  --IESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWV  2421
               I   +  L    +FP+ LK+L + G  L  + +  I  LPNL  LKL +    G +W 
Sbjct  746   TWIPESRVPLWEKLAFPRMLKKLTLGGFMLSQQDMATIGSLPNLHVLKLRRCSFRGGKWE  805

Query  2422  TGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIE  2601
             T +G F +LKFL I    LK+W T S HFP LERL L+HC  L +IP    +I TL+LIE
Sbjct  806   TTEGEFAQLKFLKIESTNLKHWVTDSSHFPTLERLLLYHCPELYEIPNVIGEIPTLELIE  865

Query  2602  LKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             +K     L  SAK I++EQ   GN+ L VR
Sbjct  866   VKSWDEFLGNSAKRIKQEQEDSGNECLRVR  895



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score =   399 bits (1025),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 306/900 (34%), Positives = 479/900 (53%), Gaps = 83/900 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAYV + SL+RT+E QF++ +P  +  + +  +  L   L + +  LE + K+       
Sbjct  1     MAYVAVISLLRTLE-QFVQLQPHWISAEIRIMVDSLLVSLEYFQNFLENTSKRSQDHGHI  59

Query  256   KDVIARVKDISFRAEDEIESEVMEI--ISNGASHERLHQILQRLAEDIE----GLIEQRN  417
             K++   ++ +   AED IE ++ EI  +    + + L +IL  L E I+     +I    
Sbjct  60    KELERDIRTVVNEAEDVIELKIYEINQLDRTIASKALCEILPPLVEKIDLVKREVIGSSF  119

Query  418   TTQMLSSYNPGQSNQEHIIAGGASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             +T  +  Y  G    E++  G +S+    L+ + I+VG   +L + K  L    +  R+V
Sbjct  120   STDKIHGY--GDPMNENLQLGHSSRQVANLKLETIVVGLEDDLIKIKRRLTGPPST-REV  176

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             + I+GMGGIGKTT+AKK YDD  IR RF    W TVSQ+Y +R +L  +  C +      
Sbjct  177   VPILGMGGIGKTTLAKKAYDDSEIRHRFDFHVWVTVSQEYRIRDLLLGVLSCTS------  230

Query  766   INEVKSTA-ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
              NE+K T  +L + + + L R+RYL+V+DDIW +  WD + R FPDD+NGSRI+LT+RLK
Sbjct  231   -NEIKETDDQLMDMIYKNLKRKRYLVVMDDIWSNDVWDLMTRNFPDDNNGSRIILTSRLK  289

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN---LPPEIEEIGKRIVNKCRGLPL  1113
             ++A+++         +  L+S+ESW L   K+  +     PPE+++IGK++  KC+GLPL
Sbjct  290   DLAIHADPDSP-PHEMKLLSSDESWKLLHDKVFGVKHEICPPELKDIGKQVAQKCQGLPL  348

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             A+ V AG LSK  R+ E+W+ +A ++++ + ++  D+C  +L +SYN LP HLK CFLY 
Sbjct  349   ALLVVAGHLSKIARTPESWRDVAKSVSI-VAANESDKCLGVLAMSYNYLPNHLKPCFLYM  407

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FP+   E+    L+NLW++EGF+ ++  +S+E+G   + +DL+ R+L+++ K  F G 
Sbjct  408   GVFPE-DSEVNIVMLINLWVSEGFLGKEKLKSMEQGRDCW-EDLVSRHLIMVRKRRFNGE  465

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQP  1653
              +TC +HDL+ DL LRE +KEKF           +++  T      + + L  R      
Sbjct  466   ARTCGVHDLVRDLILREAEKEKF-----------LQVTRTHEATNPSAKKLHVR------  508

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGL--PVSWR------QNVSFKMIRVLDLVEISFDEA  1809
                 +Y+FH     ++       S L   V  R          FK++RVL +    F + 
Sbjct  509   ----RYSFH---PYIYEADCCEESSLIRTVHLRGFGGFFHFEHFKLLRVLVIPYYEFQDF  561

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHH-HNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             P  +I+ L+ LRYL       + +L    +NLQT I +            +        +
Sbjct  562   P-LEITKLVHLRYLQFWCSDDIHLLVSKLYNLQTFIFRH-----------EALKPPTIPE  609

Query  1987  GLWKSQSLR---FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
              +W+ +  R    +K  +   I      +++ L  L  +    CT E    IPN+K L I
Sbjct  610   TIWEMKHFRHLQVVKRVFSLAIPKSGFKLEN-LEGLSCLNLSSCTYEMFSAIPNLKRLKI  668

Query  2158  KC--SEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTEL  2331
                 SE +  +     D+L  L +LE L  +     + +L    S P SLK L +  T  
Sbjct  669   HGNWSECKRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLTNTLF  728

Query  2332  GWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHF  2508
               E +T I MLPNLE LK+   +E  +EW   D   F +LKFL IS   L++WE  S +F
Sbjct  729   PLEDMTNIVMLPNLEVLKIKDVFE-NDEWRLNDEEIFSQLKFLLISVTFLRHWEAGSVNF  787

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             P L+RL L  C  LE+IP+ F +I +L+ IEL DC  S  +S +++QEEQ S GND L V
Sbjct  788   PKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQKSMGNDCLTV  847



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score =   399 bits (1025),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 306/900 (34%), Positives = 479/900 (53%), Gaps = 83/900 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAYV + SL+RT+E QF++ +P  +  + +  +  L   L + +  LE + K+       
Sbjct  1     MAYVAVISLLRTLE-QFVQLQPHWISAEIRIMVDSLLVSLEYFQNFLENTSKRSQDHGHI  59

Query  256   KDVIARVKDISFRAEDEIESEVMEI--ISNGASHERLHQILQRLAEDIE----GLIEQRN  417
             K++   ++ +   AED IE ++ EI  +    + + L +IL  L E I+     +I    
Sbjct  60    KELERDIRTVVNEAEDVIELKIYEINQLDRTIASKALCEILPPLVEKIDLVKREVIGSSF  119

Query  418   TTQMLSSYNPGQSNQEHIIAGGASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             +T  +  Y  G    E++  G +S+    L+ + I+VG   +L + K  L    +  R+V
Sbjct  120   STDKIHGY--GDPMNENLQLGHSSRQVANLKLETIVVGLEDDLIKIKRRLTGPPST-REV  176

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             + I+GMGGIGKTT+AKK YDD  IR RF    W TVSQ+Y +R +L  +  C +      
Sbjct  177   VPILGMGGIGKTTLAKKAYDDSEIRHRFDFHVWVTVSQEYRIRDLLLGVLSCTS------  230

Query  766   INEVKSTA-ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
              NE+K T  +L + + + L R+RYL+V+DDIW +  WD + R FPDD+NGSRI+LT+RLK
Sbjct  231   -NEIKETDDQLMDMIYKNLKRKRYLVVMDDIWSNDVWDLMTRNFPDDNNGSRIILTSRLK  289

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN---LPPEIEEIGKRIVNKCRGLPL  1113
             ++A+++         +  L+S+ESW L   K+  +     PPE+++IGK++  KC+GLPL
Sbjct  290   DLAIHADPDSP-PHEMKLLSSDESWKLLHDKVFGVKHEICPPELKDIGKQVAQKCQGLPL  348

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             A+ V AG LSK  R+ E+W+ +A ++++ + ++  D+C  +L +SYN LP HLK CFLY 
Sbjct  349   ALLVVAGHLSKIARTPESWRDVAKSVSI-VAANESDKCLGVLAMSYNYLPNHLKPCFLYM  407

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FP+   E+    L+NLW++EGF+ ++  +S+E+G   + +DL+ R+L+++ K  F G 
Sbjct  408   GVFPE-DSEVNIVMLINLWVSEGFLGKEKLKSMEQGRDCW-EDLVSRHLIMVRKRRFNGE  465

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQP  1653
              +TC +HDL+ DL LRE +KEKF           +++  T      + + L  R      
Sbjct  466   ARTCGVHDLVRDLILREAEKEKF-----------LQVTRTHEATNPSAKKLHVR------  508

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGL--PVSWR------QNVSFKMIRVLDLVEISFDEA  1809
                 +Y+FH     ++       S L   V  R          FK++RVL +    F + 
Sbjct  509   ----RYSFH---PYIYEADCCEESSLIRTVHLRGFGGFFHFEHFKLLRVLVIPYYEFQDF  561

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHH-HNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             P  +I+ L+ LRYL       + +L    +NLQT I +            +        +
Sbjct  562   P-LEITKLVHLRYLQFWCSDDIHLLVSKLYNLQTFIFRH-----------EALKPPTIPE  609

Query  1987  GLWKSQSLR---FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
              +W+ +  R    +K  +   I      +++ L  L  +    CT E    IPN+K L I
Sbjct  610   TIWEMKHFRHLQVVKRVFSLAIPKSGFKLEN-LEGLSCLNLSSCTYEMFSAIPNLKRLKI  668

Query  2158  KC--SEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTEL  2331
                 SE +  +     D+L  L +LE L  +     + +L    S P SLK L +  T  
Sbjct  669   HGNWSECKRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLTNTLF  728

Query  2332  GWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHF  2508
               E +T I MLPNLE LK+   +E  +EW   D   F +LKFL IS   L++WE  S +F
Sbjct  729   PLEDMTNIVMLPNLEVLKIKDVFE-NDEWRLNDEEIFSQLKFLLISVTFLRHWEAGSVNF  787

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             P L+RL L  C  LE+IP+ F +I +L+ IEL DC  S  +S +++QEEQ S GND L V
Sbjct  788   PKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQKSMGNDCLTV  847



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score =   400 bits (1028),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 309/961 (32%), Positives = 481/961 (50%), Gaps = 167/961 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E+  I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEELTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q   T+  +    P  S+     EH         Q + IMVG   E E T++ L++   
Sbjct  108   KQWMATSDSMKDQKPQTSSLVSLPEHAFE------QPENIMVGRENEFEMTRDQLVR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP+I SRF +   ATVSQ+Y +R +L  L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVRNVLLALLSSTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +N  +SW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPLHMRPMNFVKSWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVTAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +  R I    L++LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  L
Sbjct  389   CFLYFAIFAEDER-IYVNRLVDLWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNL  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I+ C +HD+  +LCLRE +   FV+    +S+        +  F+  +R     +
Sbjct  448   SFDGKIERCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRI----S  503

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF  1818
              Y + + +   N  ++ +++   G +  +         +SFK+++VLDL        P F
Sbjct  504   IYKEEELAWCRN-SEAHSIIMLRGFNYVT-------LELSFKLVKVLDL---GLTRCPIF  552

Query  1819  --DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSKW  1980
                +  LI LRYL+L    +   LK +      + + I+  P S                
Sbjct  553   PSGVLSLIHLRYLSLC---FCPCLKQYRGSKEAVPSSIIDIPLS----------------  593

Query  1981  LQGLWKSQSLR-FIKYP--YPF--PIDTDEIP----------------------VQDTLH  2079
             +  L   Q+ + ++ +P  YPF  P++   +P                      +  +L 
Sbjct  594   ISSLCYLQTFKLYLPFPNNYPFILPLEILTMPQLRKLCMNWNYLRSHEPTENRLILKSLQ  653

Query  2080  TLYWVPYLRCTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDI  2250
              L  +    CT  F    PN+K   V G+       F+      +  YL +LEKL     
Sbjct  654   CLNQLNPRYCTGSFFRLFPNLKKLHVFGVP----EDFRNHKDLYDFRYLYQLEKLTFSSC  709

Query  2251  ESE-------------------QFELQSI-------------------NSFPQSLKELKI  2316
              S                    +F+++++                   ++FPQ+LK L  
Sbjct  710   CSSVACFLKNTAPSGSTPQDPLRFQMETLYKATDFRGTALPTLLLPPPDAFPQNLKSLTF  769

Query  2317  VGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWET  2493
              G   L W+ ++I+  LP LE LKL      G+EW   + GFP LK L++    ++ W  
Sbjct  770   SGDFYLAWKDLSIVGKLPKLEVLKLSYNAFKGKEWEVVEEGFPHLKSLFLYKVYIRYWRA  829

Query  2494  MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYG  2670
              SDHFP LERL L  C++L+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +YG
Sbjct  830   RSDHFPYLERLFLGGCYSLDSIPRDFADITTLALIDISYCRQSVGNSAKQIQQDIQDNYG  889

Query  2671  N  2673
             +
Sbjct  890   S  890



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score =   395 bits (1016),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 282/760 (37%), Positives = 407/760 (54%), Gaps = 56/760 (7%)
 Frame = +1

Query  493   LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFH  672
             L ++  +VG   + +  ++ L    T E  V+SIVGMG IGK+T+AK +++ PS+  RF 
Sbjct  40    LDEENTLVGMEDDFKIIRDQLFG-QTPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFD  98

Query  673   LLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDD  852
             +  W TVSQ YD + +L D+         K +    S  EL ++V R+L R+RYL+V+DD
Sbjct  99    ISSWVTVSQAYDAKEMLLDVLS-FGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDD  157

Query  853   IWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVC--NLPFLNSNESWMLF  1026
             +W    WD ++R FPDD NGSRI++TTRL EVA    C+G      ++PFL+  + W L 
Sbjct  158   MWTIEAWDQVRRSFPDDENGSRIMITTRLLEVA---NCAGNDFPPHHMPFLSLEDGWKLL  214

Query  1027  SQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPM  1203
             S K+  + + PP++EE+GK+I  +C+GL L++ V +GLLSK  R+ ++WQ IA  +N  +
Sbjct  215   SLKVFANEDCPPQLEEVGKQIAKQCQGLALSVVVISGLLSKINRTYDDWQQIADNVNSHI  274

Query  1204  TSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSG  1383
              S    QC  IL LSYN LP  LKACFLY G+F +   +I    L+ +W+ EGF+  +S 
Sbjct  275   GST-SQQCLAILALSYNYLPCSLKACFLYMGVFLE-DADISADKLIRIWVAEGFLKRNSH  332

Query  1384  RSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQ  1560
             +  +E   + L++L+ R+L++++   ++ G IK  R+HDL+  +CLRE K EKF    ++
Sbjct  333   KKPKEVGEECLEELVSRSLIMVNNRGWVSGKIKCLRIHDLIRLICLREGKAEKFFHVINE  392

Query  1561  RSENVIELGDTEP-LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPV  1737
               E   E  ++E  LF Y +          Q    +K N    RT+        AS L  
Sbjct  393   CYEVSSEGVESEHRLFLYED------AVQNQNIGLEKGNLDSVRTISCTHK-PHASLLDY  445

Query  1738  SWRQNVS--FKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQT  1908
                + V   F+++RVLD++ I F   PT +I+ L+ LRYLAL T   V   + +  NLQT
Sbjct  446   ECYKIVDSRFQLLRVLDVLLIYFLHFPT-EITQLVHLRYLALVTSTSVPASISNLWNLQT  504

Query  1909  LIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP----YPFPIDTDEIPVQDTL  2076
             LIV                    W   +WK  SL    YP     P P         + L
Sbjct  505   LIVH------------SVANELSWPLEIWKISSLIHF-YPGKMYVPAPPKAPNFLGLENL  551

Query  2077  HTLYWVPYLRCT-KEFVLKIPNVKVLGIKCSEIRAFQTETW---WDNLHYLTKLEKLIVE  2244
               L          KE  + IP+VKVL +  ++      + W    DNL YL  L  L + 
Sbjct  552   EELSLSTASSSNLKEIFMAIPHVKVLDVDLNQ------DGWDNLIDNLIYLADLRNLRIL  605

Query  2245  D---IESEQFELQSI---NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
                  +++ F   S    + FP +LK L +  T L W  +T++S LPNLE LKL      
Sbjct  606   LRLPFDAQLFRRPSARPYDVFPANLKSLILAETHLVWTKMTMLSYLPNLEGLKLELFAFQ  665

Query  2407  GEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             G  W   +GGF KLK L I   +L +W   S+  PVLE L L HC+ L++IP    DI T
Sbjct  666   GSNWNLDEGGFKKLKLLDIVQPELVHWHATSESLPVLEYLVLRHCYKLKEIPTEIGDIPT  725

Query  2587  LQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
             L+LIEL  C  S V SA++I +EQ S GN+ L VR Y+TR
Sbjct  726   LKLIELHYCSQSAVTSAEEILDEQQSLGNEVLAVRAYNTR  765



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score =   400 bits (1028),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 305/957 (32%), Positives = 470/957 (49%), Gaps = 153/957 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+RT+  Q +E     +  + ++++ LR  L          E   N++   +
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLESLRTIL----------ENSCNITGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
             ++      + ++++  ED ++ E   +       ER      +  +L++  E I+  ++Q
Sbjct  50    ELTILEVEIVEVAYTTEDMVDLESRSVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                 +  +    P  S+     EH +       Q + IMVG   E E   + L++   +E
Sbjct  110   WMAASDSMKDLKPQTSSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLVR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +V+SIVGMGGIGKTT+A K+Y DP I SRF +    TVSQ+Y +R ++  L   ++   
Sbjct  163   LEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRTKVTVSQEYCVRNVILGLLSSISNEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D +         LA+++++ L  +RYL+V+DDIW +  WDD+++CFPD +NGSRILLTTR
Sbjct  223   DDQ---------LADRLQKNLKGRRYLVVIDDIWTTEAWDDIKQCFPDCNNGSRILLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRG  1104
               EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC G
Sbjct  274   NVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGG  330

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAITV AGLLSK  ++++ WQ++A  ++  +++DL  +C  +L LSY++LP HLK CF
Sbjct  331   LPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCF  390

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF IF +   +I   +L+ LW  EGF+ E++G+S+EE A   + +L+DR+L+ I  LSF
Sbjct  391   LYFAIFAE-DEQIYVSELVELWAVEGFLNEEAGKSIEEVAETCINELVDRSLISIHNLSF  449

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTY  1644
              G I+ C +HD+  +LCL+E +   FV+    +S+        +  F+  +R   ++   
Sbjct  450   DGEIERCGMHDVTRELCLKEARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIYKEEE  509

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF--  1818
             +   +      H    L  F  V+            +SFK++RVLDL        P F  
Sbjct  510   L--AWCHNSEAHSIIMLRLFKCVT----------LELSFKLVRVLDL---GLTICPIFPS  554

Query  1819  DISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLW  1995
              +  LI LRYL L     V + L+    + + I+  P S          ++ S +     
Sbjct  555   GVLSLIHLRYLCLCFYPCVLQYLRSKEAVPSSIIDIPLSISSLCYLQTFKLYSPFTCK--  612

Query  1996  KSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR-----------------------  2106
                    + YP+  P +   +P   TL  + W  YLR                       
Sbjct  613   -------VGYPFILPSEILTMPQLRTL-CMGW-NYLRSHEPTENRLVLKSLQCLNQLNPR  663

Query  2107  -CTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLI------------  2238
              CT+ F    PN+K   V G++      F+      +  YL +LEKL             
Sbjct  664   YCTESFFRLFPNLKKLEVFGVR----EDFRNHKDLYDFRYLYQLEKLAFGFYHPYDACFL  719

Query  2239  -----------------VEDIESE-------------QFELQSINSFPQSLKELKIVGT-  2325
                               E +  E                L   ++FPQ+LK L   G  
Sbjct  720   KNTAPSGYTPQDPLRFQTETLHKETDFGGTAPPTDVPTLLLPPPDAFPQNLKSLTFRGEF  779

Query  2326  ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDH  2505
              L W  ++I+  LP LE LKL      G+EW   + GFP LKFL +    ++ W   SDH
Sbjct  780   SLAWRDLSIVGKLPKLEVLKLSGNAFKGKEWEVVEEGFPHLKFLSLDDVYIQYWRASSDH  839

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             FP LERL L  C++L+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +YG+
Sbjct  840   FPYLERLFLKDCYSLDSIPRDFADITTLALIDISKCQQSVGNSAKQIQQDIQDNYGS  896



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score =   398 bits (1023),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 298/847 (35%), Positives = 440/847 (52%), Gaps = 61/847 (7%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQR-NTTQML  432
             KD+  R+KD++  AEDE+ES + ++I      E   Q+L+     ++ + +Q    T  +
Sbjct  62    KDLQRRIKDVALDAEDEVESLMKQLIIELDDDE---QVLECCRTKLDKVSQQAIQVTDSV  118

Query  433   SSYNPGQSNQEHIIAGGASKLQDDA-----IMVGHAQELERTKEMLLQCSTQERQ-VISI  594
                   Q       AG ++  + DA     +M G+ +E ER  + L + S   RQ V+S+
Sbjct  119   EELIIKQKINNCPEAGSSASPRLDASIRENVMEGYNEERERMVQRLTRGSGSNRQEVVSV  178

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGM GIGKTT AK I  + SI+  F + GW TVS +YDLR++L  L   V +M D   N 
Sbjct  179   VGMPGIGKTTFAKTILFENSIKRVFRIRGWITVSNNYDLRKLLLVLLRDVIRMGDGNDNT  238

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             +    +LA +V++ L  ++YL+VVDDIW    WD +   FPD  N SRILLT+R +EV  
Sbjct  239   M-DIGKLAERVQQGLKGEKYLIVVDDIWSKDAWDRISHWFPDCGNKSRILLTSRDREVGE  297

Query  955   YSGCSGK--YVCNLPFLNSNESWMLFSQKLGSINLP------PEIEEIGKRIVNKCRGLP  1110
             Y+  + K   V   P L  +ES  LF  K    N         E E++G++++  C+GLP
Sbjct  298   YAATNPKDGLVLMRP-LTQDESRCLFYHKAFGENYSIRGSDIDEFEKVGEKVITNCKGLP  356

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L IT  AG+L  +K  ++ W  +A +++  +  D + QC  ++ LSYN+LP  +KACFL+
Sbjct  357   LMITAIAGILC-SKSKLDEWMEVAQSVSSLVNDDDYKQCLKVVALSYNHLPSLMKACFLH  415

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
             FG+FPK    I  K L+ LWI EG V        E+ A + L D I ++LV++ K S  G
Sbjct  416   FGVFPKAHV-ISVKKLIRLWIAEGLVNLKGVEEFEQVAARVLHDFIGKSLVIVDKSSLNG  474

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
              IKTCR+HDL  D C +E + E  +      S  + ++      F    RW++  + Y  
Sbjct  475   QIKTCRIHDLFHDFCSKEAESENLLYVVRSDSTTISQVHTN---FRQGCRWMSVPSIY--  529

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD--I  1824
               +S +Y   K R+L  ++    + GL         FK++RVLDL     + A T     
Sbjct  530   --YSSQYTPIKIRSLYGYYKYF-SEGL-------FHFKLLRVLDL---EGETASTLGNIT  576

Query  1825  SDLILLRYLALGTIKYVRVLKHHH--NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWK  1998
              DL+ LRYL++ T     +L   +  NLQTLI+   +  RI            + + +W+
Sbjct  577   GDLVCLRYLSVMTHDTFAILAITNLWNLQTLILDKKSLSRIFHKIVT------FPKEIWQ  630

Query  1999  SQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRA  2178
                LR + Y     + +    V   L ++  +    CTKE    I  VK L I+      
Sbjct  631   MSQLRHL-YSIGISLSSPGDKVLGNLQSVSGLSPRCCTKEIFEGIKKVKKLAIRGWNGEY  689

Query  2179  FQTETWWDNLHYLTKLEKLIVE-----DIESEQ-FELQSINSFPQSLKELKIVGTELGWE  2340
                  W DNL +L  LE L +E      I   + F L S +SFPQ LK+LK+  T L WE
Sbjct  690   PTDLKWIDNLKHLQDLESLSIEIQYWSTINGTRFFSLTSSDSFPQKLKKLKLSRTCLPWE  749

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDG-GFPKLKFLYISGAKLKNWETMS---DHF  2508
              ++IIS LP LE LKL     +G+EW   D  G PKL+FL ++   L+ W T +   DHF
Sbjct  750   YMSIISKLPELEVLKLKYDALVGDEWKATDQIGLPKLRFLLLANLNLEKWRTTAGSHDHF  809

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             P LE + + +C  L++IP+GF D   L+LIEL  C PSLV  A+ IQE+    G ++L V
Sbjct  810   PGLECVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKIQEKHEDLGRNKLKV  869

Query  2689  RDYDTRS  2709
               +++ S
Sbjct  870   TAFNSES  876



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score =   397 bits (1020),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 277/738 (38%), Positives = 406/738 (55%), Gaps = 62/738 (8%)
 Frame = +1

Query  508   IMVGHAQELERTKEMLLQC-STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGW  684
             ++VG  +++ + ++ L     T  R+V+ IVGMGGIGK+T+A+ +YDD  I S F    W
Sbjct  136   VVVGITEDVNKLRDWLTNLQDTGARKVVPIVGMGGIGKSTLARHLYDDSFIISHFDTRAW  195

Query  685   ATVSQDYDLRRILQDLCGCV-AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWG  861
             +TVSQ+Y++ +IL DL GCV  + TD+ + E     +L  ++ + L R+RYL+V+DDIW 
Sbjct  196   STVSQNYNVHKILLDLLGCVTGKPTDEMLGE--EDDQLGLRLHQNLKRRRYLIVLDDIWN  253

Query  862   SRGWDDL-QRCFPDDSNGSRILLTTRLKEVAVYSGC-SGKYVCNLPFLNSNESWMLFSQK  1035
                W+ + +R FPDD NGSRI++TTR  +VA  +G  S  ++ NL  L  +ESW L  QK
Sbjct  254   IEPWEHIARRYFPDDGNGSRIIVTTRESKVADDTGSGSPHHLMNL--LKDDESWKLLHQK  311

Query  1036  LGSI--NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTS  1209
             + +      PE+E++G+RI N CRGLPLAI V  GLLS+ KRS E+W+ IA  ++  + +
Sbjct  312   VFATQETCTPELEDVGRRIANNCRGLPLAINVIGGLLSQAKRSPESWEQIAKDVS-SVVA  370

Query  1210  DLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRS  1389
             D  +Q S IL+LSYNNLPYHLK CFLY G FP+   EI    L+ LW++EGF+   S  S
Sbjct  371   D-KEQFSNILSLSYNNLPYHLKPCFLYMGAFPE-NYEIRASRLIKLWVSEGFLKPVSDTS  428

Query  1390  LEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSE  1569
              EE A  YL+ L+DRNL+ + +    GN K+  LHDLL DLC+R+  +EKF+        
Sbjct  429   PEEAAQIYLKALVDRNLIFVHRQEPKGNAKSYSLHDLLRDLCVRKAHEEKFL--------  480

Query  1570  NVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQ  1749
              +++  D  P      R ++ R   I  K         +R+ LF    +GA+   +    
Sbjct  481   -LVKAPDGLPSDTLQLRRMSTRDPNISAK-----QMQYARSFLF----TGAASREILSDV  530

Query  1750  NVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFP  1926
                F+++RVLD++ I  D+ P  +I  L+ LRYLAL + + +   +     LQTLIV+  
Sbjct  531   VSEFRLLRVLDILGIKSDQFPE-EILQLVNLRYLALSSAETLPSSISRLRILQTLIVQ--  587

Query  1927  NSCRieeidsdeeiGSKW----LQGLWKSQSLRFIKYPYPFPIDTDEIP----VQDTLHT  2082
                            S W       +     LR IK+   +    D+I     VQ  L +
Sbjct  588   -----------AIASSSWPCAITPAILDMTQLRHIKFKGTYVRYHDKIRTRSVVQKNLIS  636

Query  2083  LYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE--DIES  2256
             L  +   + + +F+  + N+K LGI C    + + +     L    KLEKL     D+  
Sbjct  637   LSTIAISQLSHKFLETVGNMKELGIICGCPSSPERD-----LTLPHKLEKLKCSSTDLSY  691

Query  2257  EQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG  2436
              Q  L  +  FP +LK+L + G  +    +  I  LPNLE LKL + +     W   +GG
Sbjct  692   TQVFLSCL-IFPSTLKKLTVSGCIIMDGHMNKIGELPNLEVLKLRKDHFDSSMWEPSEGG  750

Query  2437  FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCF  2616
             F +L+FL +    L NW     HFP LE L +  C +LE+IP G  +ITTL++IE++   
Sbjct  751   FSRLRFLLLEDLDLVNWIADYSHFPRLEHLVIRGCSDLEEIPPGIGEITTLEIIEVQRSS  810

Query  2617  PSLVESAKDIQEEQSSYG  2670
              S V SA  IQEEQ+ YG
Sbjct  811   ASAVASALKIQEEQADYG  828



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score =   399 bits (1024),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 287/881 (33%), Positives = 455/881 (52%), Gaps = 78/881 (9%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L+   KD+++ L + L  +KA L++S +K N  +  ++V+ ++ D+++ AED I++ V+ 
Sbjct  23    LIYGLKDQVESLHKDLSLMKAFLKDSREKRNEFEYVREVVRQITDVAYEAEDIIDTFVV-  81

Query  328   IISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSS--------YNPGQSNQEHIIAGG  483
                  A+ ++    + R+    +     RN  + + S        Y+        +  G 
Sbjct  82    ----NAAMQKSRSRMGRMIHVFDNASLLRNVGRQIESIRAKVKEIYDKKMFGIVSMSGGE  137

Query  484   ASK---------LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
              S+         + ++A +VG  +E +     L +   +  +V+S++GMGG+GKTT+A+K
Sbjct  138   PSRRSAREKRPPVVEEANVVGFDEEAKTIIHRLTE-GPEHLEVVSVIGMGGLGKTTLARK  196

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRR  816
             +Y DPSI   F+L  W  VSQ+Y  R + + +   +  M ++ +N   S   LA ++ R 
Sbjct  197   VYVDPSIEYHFYLRAWVYVSQEYSRREVFRGILESLGLMNNQMLN--MSDDWLAEELCRH  254

Query  817   LMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPF  996
             L   RYL+V+DD+W    WDD++  FP+    SRILLT+R +EVA+++        NL F
Sbjct  255   LRNNRYLIVIDDVWTREAWDDIRMAFPNTDLASRILLTSRNREVALHANADSA-PHNLRF  313

Query  997   LNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQ  1173
             L  +ESW L  +K       PPE+E++G++I  KC GLPLAI V +GLL K +++ + W+
Sbjct  314   LTVDESWELLCRKTFRKERCPPELEDLGRQIARKCYGLPLAIVVISGLLLKREKTHDWWK  373

Query  1174  SIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWI  1353
              +A +++  +  D   QC  +L LSY +LP HLK CF+YFGIFP+   EIP   LL LW+
Sbjct  374   KVADSVSTHVAKD-PKQCMDVLALSYKHLPEHLKVCFIYFGIFPE-DYEIPVWKLLRLWV  431

Query  1354  TEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
              EGFV E     LE+ A +YL+DL+DRNL+L++     G IKTCR+HD+L DLC++E  +
Sbjct  432   AEGFVQESGQECLEDLAEEYLEDLVDRNLILVATKRANGRIKTCRIHDMLRDLCVKESAE  491

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGV  1713
             +KF+      + N      T+      +R L   +  ++   S     H  R+ L F  V
Sbjct  492   QKFLQVIKGFAPNCPSSTSTQSY----HRRLCIHSNVLEFISSKPVGPH-VRSFLCF--V  544

Query  1714  SGASGLPVSWRQNVSF-----KMIRVLDLVEISFDEAPTFDISDLILLRYLAL-GTIKYV  1875
                  +P   RQ+ SF      ++RVLDL  ISF   P  +I  L+ LR++AL G  K +
Sbjct  545   LEEKHVP---RQHTSFILDAFGLVRVLDLRSISFSRFPN-EIVQLVHLRFIALFGNFKIL  600

Query  1876  -RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR--------FIKYP  2028
                + +  NLQT+IV+   +CR   I          L  +WK   LR        F+  P
Sbjct  601   PATISNLWNLQTIIVR--TTCRELNI----------LADIWKMLQLRHLHTSGISFLNGP  648

Query  2029  YPFPIDTDEIP-VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDN  2205
                     E P V+  + T+  +    CT+  + + PN++ LGI+   I   + +     
Sbjct  649   PSQTRKNYEDPFVRRNILTISTISPDSCTENILARTPNLRKLGIRGKLITLVEEKGGSTM  708

Query  2206  LHYLTKLEKLIVEDIESEQFELQSIN----------SFPQSLKELKIVGTELGWEAITII  2355
                L KL++L    + ++ F L               FP +LK++ +  T L W+ ++ +
Sbjct  709   FDILAKLDRLESLKLLNDAFPLDPSRCIIPGLPPSYKFPPNLKKITLSDTLLDWDHMSTL  768

Query  2356  SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALH  2535
              MLPNLE LKL      G  W   DGGF  L+ L I    L  W+    HFP L+ +   
Sbjct  769   GMLPNLEVLKLKDYAFKGSRWEPLDGGFRLLRVLKIGRTDLIWWDASGHHFPRLQCVVFR  828

Query  2536  HCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             HC +LE IP G  +++ LQ +EL    P+   SA+ IQ ++
Sbjct  829   HCSSLEAIPSGLAEVSALQNMELHWPKPTAAYSARLIQRQK  869



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score =   396 bits (1018),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 302/873 (35%), Positives = 461/873 (53%), Gaps = 71/873 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEP---RPILVVDY--KDEIQCLRQKLCHlkalleesekklNV  243
             MAY  L SL++ +E QFL P   +P+ V+D   K +++ L QK+   K L E S   ++ 
Sbjct  1     MAY-NLESLVQILE-QFLHPEHHQPLWVLDSDKKPQMKTLLQKVYFFKDLFENSSSAVS-  57

Query  244   SQAEKDVIARVKDISFRAEDEIESEVM-EIISNGASHERLHQILQRLAEDIEGLIEQRNT  420
                 + + +R++DI+++AED +ES ++ +++S G     +         D+E LIE  ++
Sbjct  58    GYRRRGLESRIRDIAYKAEDVLESHLVDQLLSCGEGESFIFS-----PPDLEKLIEDFDS  112

Query  421   TQ--MLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
                 M+SS    +   ++ + GG SKL+                            VI I
Sbjct  113   ANKDMMSSLEESEMQLKYRLTGGGSKLE----------------------------VIPI  144

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +    E+ +
Sbjct  145   VGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVIRRPTYEMLQ  204

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             +    EL   +R  LM +RYL+++DDIW +  W+D+ + FPD++NGSRI++TTR   +A 
Sbjct  205   M-GNEELGEHLRTTLMGRRYLIILDDIWNTHSWNDITKFFPDNNNGSRIIITTRNSSLAN  263

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             +      +  N+  L  +ESW L  QK+   G I   P +E IG++I + CRGLPLAI++
Sbjct  264   FIAFRSPH-HNMYLLKDDESWNLIHQKVFAPGEI-CSPGLESIGRKIAHNCRGLPLAISL  321

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
               GLLS  KR    W+ +A  ++  + +D+ ++   IL+LSYN LPYHLK C LY G FP
Sbjct  322   IGGLLSHAKRRQVFWEQVAEDLS-SIGADVGEEILDILSLSYNYLPYHLKPCLLYMGAFP  380

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +   EI    L+ LW+ EGF+   SGR LEE A  YL+ LIDRNL+ + + S  GN+K+C
Sbjct  381   E-DSEIHASRLIKLWVAEGFLKPISGRRLEEAAEIYLKALIDRNLIFVRQQSPQGNVKSC  439

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSD  1665
              +HDLL D+C++   KE F+S    +  N+  LG         +    F  T  Q   + 
Sbjct  440   GIHDLLRDMCVKIAYKENFLS---MKQWNI--LGAVSWRRVCFHSIQDFDKTLNQMPLAR  494

Query  1666  KYNFHKS-RTLLFFFGVSGASGLPVSWRQNVSF-KMIRVLDLVEISFDEAPTFDISDLIL  1839
              + F  + R  +    +S    L V   + + F +++RVLD++E+ F   P  +I  LI 
Sbjct  495   SFLFTSAGRREISSPRISATEVLRVLRIKLLGFPRLLRVLDILEVKFRRFPK-EILRLIN  553

Query  1840  LRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFI  2019
             LRYLAL T K    +    NLQ LIV+   S  +    + E +G   L+ + K +   ++
Sbjct  554   LRYLALSTSKLPSSISRLWNLQILIVEVIASSCVRLEVTPETLGMAQLRHI-KLKGF-YV  611

Query  2020  KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWW  2199
              Y   +    ++  VQD L +L  +   + T   +  IPN++ LGI C E    + +   
Sbjct  612   WYDDKY---REDFVVQDQLQSLSTIAISQLTDRILRTIPNLEKLGIFCDE----KVDHVR  664

Query  2200  DNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLES  2379
             D L  L KL  L    +   +    ++  FP SLK+L +    +    +  I  LPNLE 
Sbjct  665   D-LSRLHKLHSLKCTSVYDGRTHFSNL-IFPDSLKKLTLRDCGIRDPDMNRIGKLPNLEI  722

Query  2380  LKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKI  2559
             LKL     +  +W   +G F +L+FL +    L NW     HF  L+ L + HC +LE I
Sbjct  723   LKLQGCQFVSRKWEPDEGEFHRLRFLLMENLNLVNWVADESHFRRLQHLFIQHCSDLEAI  782

Query  2560  PEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             P    DI TLQ+IE+ +C PS++ SA+ IQEEQ
Sbjct  783   PLVIRDIPTLQVIEVHNCRPSVMNSARMIQEEQ  815



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score =   398 bits (1023),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 326/945 (34%), Positives = 475/945 (50%), Gaps = 100/945 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLE---PRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  L SL  T++   +    P   L+ D+K+E+  L +K+     L   + +K NVS 
Sbjct  1     MAYASLISLKTTIKSLLMTSNLPMQSLICDHKEELWALHEKVS-SLGLFVNNFEKNNVSG  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEI----ISNGASHE----RLHQILQRLAEDIEGLI  405
                D+  +VK+++   E  I+  + EI      N  S E      H  LQ++A DI+ + 
Sbjct  60    EMTDLEVQVKEVASAVEYTIQLRLTEIEMANTKNNVSGEIEGLHFHHSLQQVAVDIDRVR  119

Query  406   EQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             ++    +        +S+     +     L    IMVG   + ER  E L +  + E +V
Sbjct  120   KESTKIRDKGKQASEESSVRDFSSSANDILNVKNIMVGRGDQRERLLEDLTRGYSGEPKV  179

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC----GCVAQM  753
             I I+GMGGIGKTT+A ++Y+D  +RS F +  WAT+SQ ++++ IL +L     G    M
Sbjct  180   IPIIGMGGIGKTTLAIEVYNDAHVRSHFDVCAWATLSQQHNVKEILLNLLRSTKGGAFDM  239

Query  754   TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTT  933
              D+        AELA+ +R+ L  +RYL+V+DDIW  + WDD++R FP  + GSRILLTT
Sbjct  240   LDE--------AELADMLRKSLYGKRYLIVMDDIWSIKAWDDVRRFFPSQNKGSRILLTT  291

Query  934   RLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRG  1104
             R  EVA Y+      +  + F++ +ESW LF        ++ LP E E IGK+I  K  G
Sbjct  292   RNNEVACYANTENLSL-QMSFMDQDESWNLFKSVAFANEALPLPSEFENIGKKIAEKSHG  350

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPL I V AGLL K+K+++E+W+++A  +   + +D  +QCS +L LSYN+L   LK C 
Sbjct  351   LPLTIVVVAGLL-KSKKTIEDWETVAKDVKSFVNNDPDEQCSHVLGLSYNHLTSDLKTCL  409

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYFGIFP+   EIP   L  LW+ EGF+  +    LE  A K LQDLI+R LV +S  S 
Sbjct  410   LYFGIFPE-DSEIPVNHLKRLWMAEGFL--NFENDLEGEADKCLQDLINRCLVHVSNKSR  466

Query  1465  I-GNIKTCRLHDLLFDLCLREVKKEKFVSA----FHQRSENVIELGDTEP----------  1599
                 I +C++HDL++DLCLR++++          F +      ++ D +P          
Sbjct  467   DETKIISCKVHDLIYDLCLRQIQRGNLFIIKDILFEKSDVKKAQINDCDPNHVPSVCQPL  526

Query  1600  ---LFEYANRWLTFRTTYIQP---------------KFSDKYNFHKSRTLLFFFGVSGAS  1725
                  +   RW T    +  P               +  D  N  K    +F  G  G  
Sbjct  527   SRHNMQPFKRW-TGDEIHGSPYGLYRALLTPGHHEWRDDDDNNLLKRTCSIFSLG--GFF  583

Query  1726  GLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV---LKHHH  1896
                V   + + FK++++LDL  I     P   I  LI LRYLAL   +   V   +    
Sbjct  584   STFVLQSELIHFKLLKILDLTHIRIYSFP-LQILSLIWLRYLALFCSEIFDVTPEICRLW  642

Query  1897  NLQTLIVK-FPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDT  2073
             NLQT IV+ +P S               + + +W  + LR++K       +   + V   
Sbjct  643   NLQTFIVEGYPPSYLT------------FPEQIWGLRRLRYLKLHKLHLPNQPSVSVDKA  690

Query  2074  LH-------TLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK  2232
              H       ++ ++  L CTKE +  I NVK +GIK ++         ++NL  L +LE 
Sbjct  691   RHMSFSNIQSISYLSPLCCTKEVLSGIQNVKKIGIKGNQ--NISESGIFNNLVILQQLET  748

Query  2233  LIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGE  2412
             L V      +F   S  + P +LK+LK+  T L W  + II+ LPNLE LKL+     GE
Sbjct  749   LTV-----RKFYNWSAVTIPTTLKKLKLYKTFLRWSYLDIIAELPNLEVLKLVLNACHGE  803

Query  2413  EWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQ  2592
             EW      F +LK L I    L++W+  +D+FPVLERL L  C  L++IP  F DI T Q
Sbjct  804   EWNPNVRVFTQLKVLLIQANYLESWKATNDNFPVLERLVLGSCSYLKEIPIEFADINTSQ  863

Query  2593  LIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTRS*ILGAP  2727
             LIEL  C P L ESA  IQ+EQ   GND + V     R   LG P
Sbjct  864   LIELDSCPPILAESAARIQQEQEDLGNDPIDVHIIPIRH-TLGEP  907



>ref|XP_006350137.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score =   397 bits (1021),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 309/937 (33%), Positives = 479/937 (51%), Gaps = 124/937 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+RT+  Q +E     +  + ++++ LR  L          EK  N++   +
Sbjct  1     MAYAAVTSLMRTIH-QSMELNGCDLQPFYEKLESLRAIL----------EKSCNITGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQ  411
              +      + +++F+AED ++S+  ++      I+   +   L   L++  E I+  + Q
Sbjct  50    GLTTLEVEITEVAFKAEDMVDSKSRKVSSAETVITRSKAFWELCCSLEQEVECIDSFMMQ  109

Query  412   -------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                     N  +   + N   S    +        + + IMVG+  E    K ML Q + 
Sbjct  110   WLAIWDWYNNIKDFKAQNFCLSKIPELAVE-----RSEVIMVGYENEF---KMMLDQLAR  161

Query  571   QERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              ER+  V+SIVGMGGIGKTT+A K+Y+DP +  RF +   ATVSQ+Y +R +  DL  C+
Sbjct  162   GERELEVVSIVGMGGIGKTTLATKLYNDPCMMYRFDIRAKATVSQEYCVRNVFLDLLSCI  221

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                +DK  +++    +LA+++++ L  +RYL+V+DDIW ++ WDD+Q CFPD  NGSRIL
Sbjct  222   ---SDKPYDQLHD-GQLADRLQKLLKGKRYLVVIDDIWTTKAWDDIQICFPDFHNGSRIL  277

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  SGK   ++  +N +ESW L  +K+ + +   PE E++GK+I  KC 
Sbjct  278   LTTRNVEVAEYAS-SGKLPHHMRLMNFDESWNLLYEKVFTKDSFSPEYEQLGKQIALKCG  336

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPLAI V AGLL+K  +++  WQS+A  ++  +++D+  QC  +L +SY+ LP+HLK C
Sbjct  337   GLPLAIVVIAGLLTKIDKALSEWQSVAENVSSAVSTDVGVQCMRVLAMSYHYLPHHLKPC  396

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYF IFP+  + I    L+ LW TEGF+  +  +S+EE A KYLQDLIDR+L+ I   +
Sbjct  397   FLYFAIFPE-DKLIFVNKLMILWETEGFLKVEEMKSIEEVAEKYLQDLIDRSLISIKSTT  455

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             F G IK C +HD+  +LCL E +   FV+   ++++    +   + L +  +R     + 
Sbjct  456   FDGKIKCCGIHDMTRELCLMEARNMNFVNVLRRKNDQNSYVKSMQCLSKSRSRI----SI  511

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD  1821
             + + ++    N      +LF              R+ + FK++RVLDL +      P  +
Sbjct  512   HNKKEYVRCLNSEAHSVILF-------GRFRCCMREYLPFKLVRVLDLADNICLTFPR-E  563

Query  1822  ISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG--L  1992
             I  LI LR+LAL     V + L    ++ +  V  P S               +LQ   L
Sbjct  564   ILYLIHLRHLALRIYPNVEQYLGSEEDVLSSRVDIPTSISNLC----------YLQSLVL  613

Query  1993  WKSQSLRFIKYPYPFPIDTDEIP----------------------VQDTLHTLY-WVPYL  2103
             +    +   K+    P D   +P                      V   LH+L+ W P  
Sbjct  614   YLPLVINLRKHALILPSDILTMPQLRHLHLDRNYLRYHELTEKSLVMKNLHSLFGWNPSY  673

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK-----------------  2232
              CT  F    PN+K L ++    + F +     +  YL  LE+                 
Sbjct  674   -CTASFFRLFPNLKELQVR-GIPQDFHSHKDLYDFRYLDHLEELAFCLPPQNNAYFLERR  731

Query  2233  --------LIVEDIESEQFELQSINSFPQSLKELKIVGT-ELGWEAITI-ISMLPNLESL  2382
                     L+VE + S    L   ++FP++LK L   G   L W+ ++I +  LP LE L
Sbjct  732   MCFQTRNPLVVEVVPS--LILPPPDAFPRNLKNLTFTGNFFLSWKDLSIVVGKLPKLELL  789

Query  2383  KLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIP  2562
             +L Q    G EW   + GFP LKFL +  + ++ W    DHFP LERL L  C  L+ IP
Sbjct  790   ELTQGVCRGREWEVAEEGFPFLKFLLLKRSHIQYWRASCDHFPCLERLFLDSCRFLDSIP  849

Query  2563  EGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYG  2670
             + F DITTL LI +++C  S+  SAK IQ++ Q +YG
Sbjct  850   QDFADITTLALIYIRNCPESVGNSAKQIQQDIQDNYG  886



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   392 bits (1008),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 274/757 (36%), Positives = 391/757 (52%), Gaps = 89/757 (12%)
 Frame = +1

Query  508   IMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWA  687
             ++VG   +LE  +  L   S++ R ++SIVGMGGIGKTT+A++ YDD  I   F    W 
Sbjct  23    VVVGFESDLEEMRTRLTGASSK-RDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWV  81

Query  688   TVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSR  867
             TVSQ+Y LR++L  L      +T+K  +  K+  ELA+ + + L+ +RYL+V+DDIW ++
Sbjct  82    TVSQEYSLRQVLVGLLDSAKILTEKMYD--KTEEELADCLYKGLVGRRYLIVMDDIWDTQ  139

Query  868   GWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GS  1044
              WD ++R FP+D N SRILLTTRL +VA+Y+  S   +  + FL   ESW LF +K+ G 
Sbjct  140   IWDAVRRFFPNDCNRSRILLTTRLSDVALYAD-SFSPLHKMQFLKEGESWNLFCKKVFGE  198

Query  1045  INLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQ  1224
              + P E+E+IGK I   C GLPLAI V                               DQ
Sbjct  199   KDCPRELEDIGKAIARNCGGLPLAIVVIDD----------------------------DQ  230

Query  1225  CSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGA  1404
             C  IL LSYN LP  L+ACFLY  +FP+   EIP   L+ LW  EGF+  ++ +SLE+ A
Sbjct  231   CLEILGLSYNRLPQRLRACFLYMAVFPE-DYEIPVAKLIRLWAAEGFLKPNASKSLEDLA  289

Query  1405  MKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIEL  1584
              +YL DLI+RNL+L+S+ S  G I+TC +HDLL +LC R  +KEKF+   + + +NV++ 
Sbjct  290   EEYLDDLIERNLILVSRRSANGKIRTCNIHDLLRNLCSRNARKEKFLYMVNCK-DNVLKQ  348

Query  1585  GDTEPLFEYAN---------RWLTFRTTY--IQPKFSDKYNFHKSRTLLFFFGVSGASGL  1731
             G        +N         R L+       IQ +   K   H S         +GA  +
Sbjct  349   GVNITPHRLSNPPRRLSIPPRRLSIHPDLLSIQSQILYKSEIHNSSAHSLL--CTGARLI  406

Query  1732  PVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-RVLKHHHNLQT  1908
               S    + ++++RVLDL+ + F   P  +I+ L+ LRYLA    + +   +    NLQT
Sbjct  407   YPSCVY-LGYRLLRVLDLIIVRFFHFPA-EITKLVHLRYLAFTYNEALPPSIAELWNLQT  464

Query  1909  LIVKFPNSCRieeidsdeeiGSKWLQG--------LWKSQSLRFIKY-PYPFPIDTD-EI  2058
             L+                     W  G        +W    LR +   P   P+  +  +
Sbjct  465   LVYH------------------NWTFGKCPVFPVEIWMMPKLRHLCITPCRLPVPQNVRM  506

Query  2059  PVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWD-------NLHYL  2217
              V   L TL  V  LRC+ +   +IPN+K LGI         +E W         NLH L
Sbjct  507   LVLGNLQTLSEVRNLRCSVDIFKRIPNLKELGI---SYEVSPSENWSKYQLEALVNLHQL  563

Query  2218  TKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQA  2397
               L+ L      + +       +FP+ LK L + G  + W ++TI+  LPNLE LKL + 
Sbjct  564   ETLKLLFKYSSHASEIVNPPKLAFPEKLKRLILAGCGIPWSSMTIVGALPNLEVLKLRKN  623

Query  2398  YEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTD  2577
                G EW   +  F +LK L +    L  W     HFP L+RL +  C+ L++IP G  +
Sbjct  624   ACQGVEWEPVEEQFCQLKHLLLEEVDLVQWVANETHFPCLQRLVIRSCYKLKEIPSGIGE  683

Query  2578  ITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             I TL+LIEL DC  S V SA+ IQEEQ   GN++L V
Sbjct  684   IPTLELIELVDCHHSAVTSAEKIQEEQEGLGNEELKV  720



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score =   396 bits (1017),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 305/907 (34%), Positives = 449/907 (50%), Gaps = 87/907 (10%)
 Frame = +1

Query  85    YVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK-D  261
             Y  L SL   ++   L PRP +  D ++++  L + L  L+  LE      +    E  D
Sbjct  1     YAALLSLKYIIQQIQLHPRPPISFD-QNQVDSLTKSLNFLQDFLEGYSYGSSSISREAVD  59

Query  262   VI-ARVKDISFRAEDEIESEVMEIISNGAS-----------HERLHQILQRLAEDIEGLI  405
             V+ +R+K+ +   ED IE+ V++ I  G++           H+ L  ++Q +    + ++
Sbjct  60    VLESRIKNAALAGEDLIETRVVDQIHGGSTAHGKKISSSDFHQDLEMVIQDMGFIKKDVM  119

Query  406   EQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             E +     +  +   +S+        +S       MVG    L    + L    +  R +
Sbjct  120   EIKENHIGIEDHLLRKSSTLGGAGASSSPSTRQNAMVGFDHLLNVVMDKLTGGQSNLR-I  178

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             ISIVGMGGIGKTT+AK  Y        F +  W T+SQ+Y +R+IL ++  C+++    E
Sbjct  179   ISIVGMGGIGKTTLAKNAY--LKFMKHFDIQAWVTISQNYSVRQILIEILLCISKEESPE  236

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
                 KS  EL  +V + L ++RYL+V+DDIW    WD +Q  FPD+  GSR+++TTRL  
Sbjct  237   SLSAKSEGELGERVHKTLWKRRYLIVMDDIWSIDVWDKVQIFFPDNGQGSRVMITTRLSN  296

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
             VA      G Y   + FLN ++SW L  + +     + PPE+ EIGK+I   C GLPL+I
Sbjct  297   VASI----GSYGIVMGFLNEDKSWDLLCRSVFKEEKDCPPELVEIGKKIAKNCEGLPLSI  352

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V  G L+K++R+ E+W+ I+   N  + S+ +++C   L LSYN+LP HLK CFLY G+
Sbjct  353   VVIGGHLAKSERTKEHWEYISENTNTIVNSEDNERCLKALQLSYNHLPVHLKPCFLYMGV  412

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FP+    I    L+ LW++EGFV   + +SLE  + +YLQ+L DRNL+L+ K    GNIK
Sbjct  413   FPE-GNMIRVSWLVKLWVSEGFVKPINCKSLEVVSREYLQELCDRNLILVHKRGSNGNIK  471

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSEN--VIELGDTEPL-------FEYANRWLTF  1632
              C++HDLL DLCLRE ++EKF+      SE   ++      PL       FE     L F
Sbjct  472   YCKIHDLLRDLCLREAEREKFLYVRRPMSEKDPILHTLQDVPLVRSLICNFEERLPLLDF  531

Query  1633  RTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAP  1812
             R   +         F  +R              P  +   V F+++  L  + I  D   
Sbjct  532   RLLRVLKADDKNSYFDNNR--------------PYKYSVEVVFRLVN-LRFIAIRSDVPK  576

Query  1813  TFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
                   L+ L +                NLQTLIV                 G      +
Sbjct  577   NSGFPSLVNLLW----------------NLQTLIVN-------------GIFGVVAPCEI  607

Query  1993  WKSQSLRFI-----KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
             W    L+ +     K P P         V + L TL  +   +C +E V +IPN+  L I
Sbjct  608   WNMTQLKHVHFFQLKLPDPPIGGKGNEFVLENLQTLTHIRNFKCGEEVVKRIPNINKLQI  667

Query  2158  K-CSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELG  2334
                 E + F + +  DNL  L KLE L +  I SE   L      P SLK+L ++GT L 
Sbjct  668   SYFEEPQGFLSYS-LDNLGQLHKLESLRL-SIYSENKHLLQNFILPNSLKKLTLMGTCLK  725

Query  2335  WEAI-TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK-LKNWETMSDHF  2508
             WE + T I +LPNL+ LKL +   +G EW T +G F  L++L I   + L+ W T S HF
Sbjct  726   WEDMKTKICLLPNLQVLKLKEYSFVGTEWETVEGQFCNLRYLLIRSCRDLEWWTTDSSHF  785

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             P LE L L + H L++IP    +I+TLQ IEL  C    V SAK I +EQ  +GN+   V
Sbjct  786   PRLEHLHLRYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGNEDFRV  845

Query  2689  RDYDTRS  2709
             + +DT S
Sbjct  846   QVFDTMS  852



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score =   396 bits (1018),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 304/915 (33%), Positives = 465/915 (51%), Gaps = 106/915 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+RT+  Q +E     +  + ++++ LR  L          EK  N++   +
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFHEKLESLRAIL----------EKSCNITGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
             ++      + ++++  ED I+ E   +       ER      +  +L++  E I+  ++Q
Sbjct  50    ELTILEVEIVEVAYTTEDMIDLESRSVFLVQILEERSRAMWEVFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                T+  +    P  S+     EH +       Q + IMVG   E E   + L++   +E
Sbjct  110   WMATSDSMKDLKPQTSSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLVR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +V+SIVGMGGIGK T+A K+Y DP I SRF +   ATVSQ+Y +R +LQ L   ++   
Sbjct  163   LEVVSIVGMGGIGKATLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRI LTTR
Sbjct  223   DDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRIFLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRG  1104
               EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC G
Sbjct  274   NVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGG  330

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAITV AGLLSK  + ++ WQ IA  ++L +++D   QC  +L LSY++LP HLK CF
Sbjct  331   LPLAITVIAGLLSKMGQRLDEWQRIAENVSLVVSTDPEAQCIRVLALSYHHLPSHLKPCF  390

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF +F +  R I    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I    F
Sbjct  391   LYFAVFAEDER-IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFGF  449

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTY  1644
              G I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R     + +
Sbjct  450   HGRIESCGMHDMTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRI----SIH  505

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDI  1824
              + +     N  ++ +++ F+     +         +SFK++RVLDL        P F +
Sbjct  506   NEEELVWCRN-SEAHSIITFYDFKFVT-------LELSFKLVRVLDLGWTICPFFP-FGV  556

Query  1825  SDLILLRYLALGTIKYVRVLK-HHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKS  2001
               LI LRYL+L     ++  +     + + I+  P S           I S      +K 
Sbjct  557   LSLIHLRYLSLCFKPCLQQYRGSKEAVPSSIIDIPLS-----------ISSLCFLQTFKL  605

Query  2002  QSLRFIKYPYPFPIDTDEIP----------------------VQDTLHTLYWVPYLRCTK  2115
                 +  YP+  P +   +P                      V  +L  L  +    CT+
Sbjct  606   YLPSYSDYPFILPSEILTMPQLRMLCMGWNYLRSHEPTENRLVLKSLQCLNQLNPRYCTE  665

Query  2116  EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-------IVEDIESEQFELQ  2274
              F    PN+K LG+       F+      +  YL +LEKL            +     L 
Sbjct  666   SFFRLFPNLKKLGV-FGVPEDFRNHKDLYDFRYLYQLEKLEFQTERATAPPTDVPTLLLP  724

Query  2275  SINSFPQSLKELKIVGTE-LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLK  2451
               ++FPQ+L  L   G   L W+ ++I+  LP LE L+L      GEEW   + GFP LK
Sbjct  725   PPDAFPQNLTSLTFRGKFCLAWKDLSIVGKLPKLEVLQLSYNPFKGEEWEVVEEGFPHLK  784

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
             FL++    ++ W   SDHFP LERL L  C+ L+ IP  F DITTL LI++  C  S+V 
Sbjct  785   FLFLDEVYIRYWRASSDHFPYLERLFLRDCYFLDSIPRDFADITTLALIDISSCRQSVVN  844

Query  2632  SAKDIQEE-QSSYGN  2673
             SAK IQ++ Q +YG+
Sbjct  845   SAKQIQQDIQDNYGS  859



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score =   393 bits (1009),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 272/736 (37%), Positives = 408/736 (55%), Gaps = 33/736 (4%)
 Frame = +1

Query  502   DAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLG  681
             + ++VG   +L   K  L   S++  Q++ I GMGGIGKTT+A+  YDD  I   F +  
Sbjct  40    EPVVVGFEDDLTAIKHRLCGQSSK-LQLVPIFGMGGIGKTTLARNAYDDQLIMEHFQIRA  98

Query  682   WATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWG  861
             W  VSQDY ++ IL +L   +      + +E      LA  V + L   RYL+V+DD+W 
Sbjct  99    WVKVSQDYSIQEILSNLLVSIKPSNGNQCDEF-----LAENVYKGLKGMRYLIVIDDVWS  153

Query  862   SRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCN-LPFLNSNESWMLFSQKL  1038
             ++ WDD++  FPDD+NGSRI++TTRL ++A Y+  S     + + FL+ ++SW L  Q +
Sbjct  154   TKAWDDIKMIFPDDNNGSRIIVTTRLLDIATYAQFSSSSAPHEMHFLDEDQSWNLLRQMV  213

Query  1039  -GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDL  1215
                 + P E+E+IGK I   C GLPLAI V AGLLS   R+  +W+ IA  +N+ +T++ 
Sbjct  214   FKQEDCPVELEKIGKLIARSCGGLPLAIIVIAGLLSTVGRTQASWEDIAENVNVAVTTN-  272

Query  1216  HDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLE  1395
             ++Q + IL+LSY +LP HL+ CFLY G FP+   EI    L+ LW+ EGF+     +S E
Sbjct  273   YEQFAKILSLSYIHLPQHLRPCFLYMGGFPE-DYEIHVWKLIKLWVAEGFIKSSESKSFE  331

Query  1396  EGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENV  1575
             E A +YL+DL+ R+LVL++K    G IK C +HDL+ DLC+R+ ++EKF+  +  +    
Sbjct  332   EEAEEYLEDLVKRSLVLVTKRKTNGKIKVCGVHDLVRDLCIRKAQEEKFLHRYVGKM---  388

Query  1576  IELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQ  1749
                     LFE  N     R + +    +   N + S   T++ F     +   P     
Sbjct  389   --------LFE--NMKHQHRISIMHLNLNSLENIYSSTIHTIICFQASYRSPTHPEYCSF  438

Query  1750  NVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFP  1926
               +F+M+++LD+V  S     + ++ +L  LRYLA+  +I+    + +  NLQTLIV   
Sbjct  439   LGNFRMLKILDMVN-SARVPFSPEVFELFHLRYLAVDYSIEIPATISNLQNLQTLIVHRG  497

Query  1927  NSCRieeidsdeeiGSKWL-QGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYL  2103
                +  E          W+   L    S  F + P P       I   + L TL  V   
Sbjct  498   KIFKSYEPMMIFLPPKIWMIPQLRHLVSFVFGRLPDP----ERAISPLENLQTLSEVRDF  553

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSIN  2283
             RCT++F+  IPN+K L I     +  Q E   +NL +  +LEKL V+   +  F  +   
Sbjct  554   RCTEKFLKMIPNLKKLSISYFRGKNDQ-EYQLNNLLHFHQLEKLKVKIFPTFLFRRKLNL  612

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYI  2463
             +FP SLK+L + G +  WE + I+S+LPNLE LKL      G +W T +  F  LKFL +
Sbjct  613   AFPPSLKKLTLSGWQRPWEDMGIVSLLPNLEVLKLRDYAFRGYKWETSEEEFRCLKFLLL  672

Query  2464  SGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKD  2643
               + L++W T S HFP L+ L L+ C  L++IP+GF +I TL+LI++ D   SLV+SA+ 
Sbjct  673   DKSDLQHWITESSHFPNLKCLVLYRCWCLKEIPDGFGEIPTLELIKVDDGNISLVDSARQ  732

Query  2644  IQEEQSSYGNDQLVVR  2691
             IQE Q  +GND   VR
Sbjct  733   IQEVQQGWGNDAFQVR  748



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score =   397 bits (1020),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 306/951 (32%), Positives = 479/951 (50%), Gaps = 143/951 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+ +++ Q +E   +++  + ++++ LR   +K C++              +
Sbjct  1     MAYAAITSLMNSIQ-QSMESTGLVLQLFYEKLESLRTIMEKPCNITGD----------HE  49

Query  250   AEKDVIARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTT  423
             A   + A++ +++  AE +++ E   I+   N     R    L  L +++ G I+     
Sbjct  50    ALTSLEAQIAELADEAEYKVDLESRNIVLPENEKKQRRAFVNLYSLVKEVVGRIDSTMKK  109

Query  424   QM-----LSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
              M     L +    ++    +++     L+ +  MVG   E E  ++ L +   +E +V+
Sbjct  110   WMAIQNKLKNIQDLKAQNLSLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVV  168

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             SIVGMGGIGKTT+A KIY DP I S F +   ATVSQ+Y  R +L  L   ++  T+ E 
Sbjct  169   SIVGMGGIGKTTLANKIYSDPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTN-EF  227

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
              E +   +LA+++++ L   RYL+V+DD W    WDD++RCFPD +NGSRIL+TTR  EV
Sbjct  228   QEQQDDDQLADRLQKLLKCGRYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEV  287

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITV  1125
             A  +  SGK   ++  +N +ESW L  +K+   +   PE E++GK I   C GLPLA+ +
Sbjct  288   AECAS-SGKTPYHMRLMNFDESWSLLYEKVFVKDCFSPEFEQLGKTIALNCGGLPLALVL  346

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AGLLSK  +S++ W+SI   ++  + ++++ QC  ++ LSY+ LP+HLK CFLYF IF 
Sbjct  347   IAGLLSKIGKSLDEWKSIVKNVSSTVNTEVNVQCMRVVALSYHYLPHHLKPCFLYFAIFQ  406

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +    I    L+ LW  EGF+  +  +S+E+ A K L++LIDR+L+ I  LSF G I+ C
Sbjct  407   E-DELILVNKLVGLWAAEGFLKVEERKSIEKVAEKCLKELIDRSLISIRNLSFDGKIEIC  465

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL-------------  1626
              +HD+  +LCLRE            RS N++ +   E   EY N  +             
Sbjct  466   GMHDVTRELCLREA-----------RSMNIVNVTREE---EYQNPCVQSMHFSSKSRGRI  511

Query  1627  ---TFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEIS  1797
                  +   I  K  ++Y  ++ R+++ +        + +   + + FK++RVLDL  + 
Sbjct  512   SIQVIKYESITEKILERYPKNEVRSIICY-------RVNMFMPKLLHFKLVRVLDLALMG  564

Query  1798  FDEAPTFDISDLILLRYLALGTIKYVRVLKHHHN--------------------LQTLIV  1917
             F   P+  I DLI LRYLAL   +    L+H+                      LQT I+
Sbjct  565   FSAFPS-SILDLIHLRYLAL---RLSPGLQHYLGEEISSSFAVDIPPSIASLCYLQTFIL  620

Query  1918  KF--PNSCRieeidsdeeiGSKWLQGL---WKSQSLRFIKYPYPFPIDTDEIPVQDTLHT  2082
             +   PN+ +   +  +E +    L+ L   W      +++Y  P      +  V   L  
Sbjct  621   RLLQPNARQYPLVLPNEILTMPQLRHLHLDWN-----YLQYHEP-----KKSLVLKNLQC  670

Query  2083  LYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIV-------  2241
             L  +    CT+    + PN+K L I C     F +     + HYL KLE+L V       
Sbjct  671   LSGLNPWHCTRSVFRQFPNLKKLQI-CGIWEDFCSRKDLYDFHYLDKLEELDVVLTYSCY  729

Query  2242  ----EDIES--------------------------EQFE---LQSINSFPQSLKELKIVG  2322
                 E I S                          E F    L   ++FP +LK+L   G
Sbjct  730   ACFLESITSSGLLRFTRQKRRAIFLDRLSRALPPTETFPYSILPPPDAFPLNLKKLAFYG  789

Query  2323  TELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSD  2502
             T L W+ ++I+  LP LE+LKL  +  +G EW     GFP LKFL +   K++ W    D
Sbjct  790   TCLQWKDLSIVGKLPKLEALKLGISACIGMEWKVVKDGFPSLKFLLLERLKVRYWRASCD  849

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             HFP LERL L HC +L+ IP+ F DITTL LI+++ C  S+  SAK IQE+
Sbjct  850   HFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGNSAKQIQED  900



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score =   394 bits (1013),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 303/923 (33%), Positives = 481/923 (52%), Gaps = 108/923 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVV--DYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  ++SL+ T+E Q  +P    V     +  ++ L Q L  L+  L+++  K    + 
Sbjct  1     MAYAAISSLMYTLE-QLFKPNQSFVCPCSTQQHVENLNQNLSALQDFLDDTTTKD--IET  57

Query  253   EKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQR  414
              K V  R++D+ ++AED+++S +  II   ++  R        + L ++ +D++ L ++ 
Sbjct  58    LKVVEKRIRDVVYKAEDKVDSSLRSIILADSTESREGAAKFFEEELVKVEKDVDSLRKEV  117

Query  415   NTTQM-----------LSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQ  561
                +             + ++P Q +   I+      ++DD  ++     L+R     L 
Sbjct  118   TVVEFNKHGTKSAELATTPFSPDQKST--IVENTVVGMKDDFNII-----LDR-----LT  165

Query  562   CSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGC  741
               T E  VI I+GMGGIGKTT+A+K+YDD  IRSRF  L W T+SQ+Y+ R++L ++   
Sbjct  166   AQTDELIVIPILGMGGIGKTTLARKVYDDSCIRSRFDKLAWVTISQEYNERQMLLEVVSS  225

Query  742   VAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRI  921
             +     +E+    S  EL   V R L  +R+L+V+DDIW +  W+ +QR FP+D N SRI
Sbjct  226   ITTKGSQEM----SNDELMEIVYRGLKGRRFLIVIDDIWSTEAWNQMQRIFPNDDNKSRI  281

Query  922   LLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKC  1098
             LLTTRLK VA Y  C      +  FL+  +SW LF++KL   +  PP + EIGK IV +C
Sbjct  282   LLTTRLKYVADYVNCPDFPPHSKSFLSLEDSWNLFTEKLFKKDQCPPLLVEIGKHIVQQC  341

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
             +GLPL+I V AGLL K   + +NW+++   ++      + ++C +IL+LSYN LP +LKA
Sbjct  342   QGLPLSIVVVAGLLGKMDLTHDNWKNVEENLS-SFFGTVSERCQSILSLSYNYLPQYLKA  400

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLY G FP+  REI    L+ LWI E FV   + + LE  A +Y+Q+LIDR+L+L+  L
Sbjct  401   CFLYVGGFPE-DREINVSQLIRLWIAEQFVKARNNKRLEVVAEEYVQELIDRSLILMDSL  459

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFH-----------QRSENVIELGDTE---  1596
             +  G +KT ++HDLL  LCL E   E  V   +                VI L   E   
Sbjct  460   TTNGRMKTFKIHDLLRQLCLSETHTENVVHIMNGNVPMFLLEAIDDQRRVILLSKLEEKQ  519

Query  1597  ---PLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKM  1767
                P+  ++N   +   T+I  ++     FH        + +  A            FK+
Sbjct  520   VYPPM--HSNGITSIARTFISMQY-----FHYDDFPEGIYSIFSA------------FKL  560

Query  1768  IRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRiee  1947
             ++VLD++ + +D +    I +L+ LRY+A G I+    L    NLQT+I+        + 
Sbjct  561   LKVLDVLTVWYDFSSV--IPELVHLRYVAAG-IEEGLSLDKLRNLQTIILH-------KN  610

Query  1948  idsdeeiGSKWLQGLWKSQSLRFIKYPYP----FPIDTDEIPVQDTLHTLYWVPYLRCTK  2115
             I ++    S+    +W+   LR +    P     P++ +     + L  LY        +
Sbjct  611   IGANRPTKSEQPLDIWRMSELRHVDIDSPRYISNPLEAENPLFLNNLQNLYLYNS-HFFE  669

Query  2116  EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQ-------  2274
             E + + PN+K L      +   +   W   L  L  LE+L    I+ E+  +        
Sbjct  670   EIIKRTPNLKTLKF----LDESEHPDWSAILDSLILLEELEKLVIQLERMNVNIFCGDIL  725

Query  2275  --SINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPK  2445
                I     ++K+LK++GT + WE + +++ LPNLE ++   A+  G +W +  D  F K
Sbjct  726   YCKIKKLSPNIKKLKLLGTYIPWEVVNLLAYLPNLEVIEGEYAFS-GTDWKLDEDVVFSK  784

Query  2446  LKFLYISGAKLKNWE-TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS  2622
             LK+L I  A L+ WE   SD+FP+LE+L L+  + L++IPE   DI TL+LI++ DC  S
Sbjct  785   LKYLLIGEADLERWEAAASDNFPMLEKLILYGFNKLDEIPESIGDIMTLKLIKIDDCSSS  844

Query  2623  LVESAKDIQEEQSSYGNDQLVVR  2691
             +  SAK IQ+EQ S GN +L +R
Sbjct  845   VENSAKRIQQEQQSLGNYELQLR  867



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score =   394 bits (1013),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 309/958 (32%), Positives = 466/958 (49%), Gaps = 163/958 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLHPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q    +  +    P  S+     EH +       Q D IMVG   E E   + L +   
Sbjct  108   KQWMAASDSMKDLKPQTSSLVSLPEHDVE------QPDNIMVGRENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D          +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPD---------YQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKPCFPDCINGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +  +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPHHMRLMKFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKMGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +    I    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFAE-DEWIFVNKLVELWSVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R      
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSR------  501

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDE  1806
                        + H    L++       S +     + V    SFK++RVLDL    +  
Sbjct  502   ----------ISIHNEEELVWCRNSEAHSIITFCRFKFVTLELSFKLLRVLDLHLTRYPI  551

Query  1807  APTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL  1983
              P+  +S LI LRYL+L    Y+++ L     + + I+  P S                +
Sbjct  552   FPSGVLS-LIHLRYLSLCFYPYLQLYLGSEEAVPSSIIDIPLS----------------I  594

Query  1984  QGLWKSQSLRFIKYP-YPF------------------------PIDTDEIPVQDTLHTLY  2088
               L   Q+ +    P YPF                        P  T+   V  +L  L+
Sbjct  595   SSLCYLQTFKLYSRPDYPFILPSEILTMPQLRKLCMGRNYLRSPEPTENRLVLKSLQCLH  654

Query  2089  WVPYLRCTKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESE  2259
              +    CT  F    PN   +KV G+       F+      +  YL +LEKL      + 
Sbjct  655   HLNPRYCTGSFFRLFPNLKKLKVFGVP----DEFRNHKDLYDFRYLYQLEKLAFRIYYTP  710

Query  2260  -------------------QFELQSI-------------------NSFPQSLKELKIVGT  2325
                                +F+++++                   ++FPQ+LK L   G 
Sbjct  711   NACFLKITAPSGSTPQDPLRFQMETLYKATDFRGTALPTLLLPPPDAFPQNLKSLTFSGD  770

Query  2326  -ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSD  2502
               L W+ + I+  LP LE LKL      G+EW   + GFP LK L++    ++ W   SD
Sbjct  771   FSLAWKDLGIVGKLPKLEVLKLSYNAFKGKEWEVVEEGFPHLKSLFLYKVYIQYWRARSD  830

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             HFP LERL L  C++L+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +YG+
Sbjct  831   HFPYLERLFLGGCYSLDSIPRDFADITTLALIDISYCRQSVRNSAKQIQQDIQDNYGS  888



>ref|XP_004250409.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=843

 Score =   392 bits (1007),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 296/887 (33%), Positives = 471/887 (53%), Gaps = 78/887 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD--YKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  L+SL+ T+E Q  +P    V     +  ++ L++ L  L+  L+++ K +   + 
Sbjct  1     MAYAALSSLMYTLE-QLFKPNQSFVCRSCTQQHVESLQKNLSALQDFLDDTTKDI---ET  56

Query  253   EKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQR  414
              K +  R++D+ ++AED+++S +  II    +  R        + L  + +D++ L  ++
Sbjct  57    LKLIEKRIRDVIYKAEDKVDSTLRSIILADCTESREGACKLFEEELVLVEKDVDSL--RK  114

Query  415   NTTQMLSSYNPGQSNQEHIIAG-GASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVIS  591
                QM   +N   +  E   +    S + ++  ++G   E     + L    T E  VI 
Sbjct  115   EVMQM--EFNKHGTRYETTPSSPQKSSIDEENTIIGMDDEFNTILDRL-TTQTNELTVIP  171

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEIN  771
             I GMGGIGKTT+AKK+YDD  IRSRF    W T+S+D++ R++L ++   +        N
Sbjct  172   IFGMGGIGKTTLAKKVYDDSYIRSRFDKHAWVTISEDFNQRQMLLEVASSITGS-----N  226

Query  772   EVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVA  951
             + KS  +L   V + L  +R+L+V+DDIW +  WD +QR FP+D N SRILLTTRLK VA
Sbjct  227   QEKSDDQLMEIVYKGLKGRRFLIVIDDIWSTEAWDQMQRIFPNDKNKSRILLTTRLKYVA  286

Query  952   VYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVA  1128
                 C         FL+ ++SW LF++KL    + P ++ ++GK IV +C+GLPL+I V 
Sbjct  287   DNVSCPEFPPHCKSFLSLDDSWNLFTEKLFKKDSCPRQLVKLGKHIVQQCQGLPLSIIVV  346

Query  1129  AGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPK  1308
             AGLL K   + +NW+ +   +       + ++C +IL+LSYN LP +L ACFLY G FP+
Sbjct  347   AGLLVKMDLTRDNWKKVEENLK-SFFGTVSERCQSILSLSYNYLPQYLSACFLYVGGFPE  405

Query  1309  VRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCR  1488
                EI    L+ LWI E F+   S + LE  A +YLQ+LIDR+L+L  K    G +++C+
Sbjct  406   -DTEIGVSKLIRLWIAEQFIKARSNKRLEVVAEEYLQELIDRSLILAGKQRANGRMRSCK  464

Query  1489  LHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDK  1668
             +HDLL  LCL +   E  V   H  + NV+E  D +            R   +  +  +K
Sbjct  465   IHDLLRQLCLSKAHTENVV---HVMNGNVVEAIDDQ------------RRMILLSEVEEK  509

Query  1669  YNF-----HKSRTLLFFFGVSGASGLPVSWRQNVS-FKMIRVLDLVEISFDEAPTFDISD  1830
             +++     H S  +  F  +S     P    Q VS FK+++VLD++ I +D +    IS+
Sbjct  510   HDYYSMMQHSSDIVRTF--ISMQVDFPT---QIVSQFKLLKVLDVLSIDYDFSSV--ISE  562

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
             L+ LRY+A    + V V K   NLQT+I++           S E    K    +W+   L
Sbjct  563   LVQLRYVAARIREAVSVAK-LRNLQTIILQ-----------SLERNELKQAIDIWRMTEL  610

Query  2011  RFIKYPYPF----PIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRA  2178
             R +    P     P++ +     + L TL+ + Y     E + +IPN+K L I    +  
Sbjct  611   RHVDIRSPLYISNPLEAENPLFLNNLQTLF-LHYSPFVAEIIRRIPNLKKLKI----VDD  665

Query  2179  FQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIIS  2358
              +   W   L  L+ ++ L    I++ ++ + S  +FP +LK+LK+  T + WE + +++
Sbjct  666   SENLDWPAILDSLSLIQDLETLHIKTMKWMVFSGENFPPNLKQLKLTHTYIPWEVVELLA  725

Query  2359  MLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGA-KLKNWETMSDHFPVLERLAL  2532
              LPNLE LK   A++ G  W +  D  F  LK+L +SG   LK WE    +FP LE+L L
Sbjct  726   NLPNLEVLKGYHAFD-GTYWKLDEDIVFHNLKYLLLSGCYYLKRWEAEPANFPKLEQLIL  784

Query  2533  HHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
              +   +++IPE   +I TL+ I +  C   + +SA+ IQEEQ S+GN
Sbjct  785   DNFSAMKEIPESIGEIMTLKFIRVIWCSSGVEKSARKIQEEQESFGN  831



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score =   394 bits (1013),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 315/957 (33%), Positives = 476/957 (50%), Gaps = 149/957 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++I+ LR   +K C++    E       ++ 
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKIESLRAILEKSCNIMGDHE------GLTI  53

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
              E ++I    ++++  ED ++SE   +       ER      +  +L++  E I+  ++Q
Sbjct  54    LEVEII----EVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                T+  +    P  S+     EH +       Q + IMVG   E E   + L +   +E
Sbjct  110   WMATSDSMKDLKPQTSSLVSLPEHDVE------QPENIMVGRENEFEMMLDQLAR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +   
Sbjct  163   LEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRI LTTR
Sbjct  223   DDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRIHLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRG  1104
               EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC G
Sbjct  274   NVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGG  330

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAITV AGLLSK  ++++ WQ++A  ++  +++DL  +C  +L LSY++LP HLK CF
Sbjct  331   LPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCF  390

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF IF +   EI    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   SF
Sbjct  391   LYFAIFTE-DEEIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSF  449

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTY  1644
              G I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R        
Sbjct  450   RGTIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSR--------  501

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDEAP  1812
                      + H    L++       S + +   + V    SFK++RVLDL         
Sbjct  502   --------ISIHNEEELVWCRNSEAHSIIRLCRFKCVTLELSFKLVRVLDLALTRCPIVF  553

Query  1813  TFDISDLILLRYLAL---GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL  1983
                +  LI LRYL+L     ++  RV K    L + I+  P S               +L
Sbjct  554   PSGVLSLIHLRYLSLCFKPCLQMYRVPK--EALPSSIIDIPLSISSLC----------FL  601

Query  1984  QGLWKSQSLRFIKYPYPFPIDTDEIP----------------------VQDTLHTLYWVP  2097
             Q        +   +P+  P +   +P                      V  +L  L+ + 
Sbjct  602   QTFKLYLPFKSF-HPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCLHQLN  660

Query  2098  YLRCTKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-----------  2235
                CT  F    PN   +KV G+     + F+      +  YL +LEKL           
Sbjct  661   PWYCTGSFFRLFPNLKKLKVFGVP----QDFRNRKDLYDFRYLYQLEKLEFGLYYPPITC  716

Query  2236  IVEDIESEQFELQ---------------------SINSFPQSLKELKIVGT-ELGWEAIT  2349
              +E+I + Q  L+                       ++FPQ+LK     G   L W+ ++
Sbjct  717   FLENIATPQEPLRFQKEIRRQTHFGGTAPTLLLPPPDAFPQNLKSSTFRGDFLLAWKDLS  776

Query  2350  IISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLA  2529
             I+  LP LE LKL      GEEW   + GFP LKFL++    ++ W   SDHFP LERL 
Sbjct  777   IVGKLPKLEVLKLSGNAFKGEEWEVVEEGFPHLKFLFLDNVYIRYWRASSDHFPYLERLF  836

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGND-QLVVRD  2694
             L HC+ L+ IP  F DITTL LI++ DC  S+  SAK IQ++ Q +YG+  ++  RD
Sbjct  837   LRHCYYLDSIPRDFADITTLALIDISDCQQSVGNSAKQIQQDIQDNYGSSIEVYTRD  893



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   393 bits (1009),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 290/881 (33%), Positives = 465/881 (53%), Gaps = 79/881 (9%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L+   KD+++ L ++L  +KA L++S +K + S   ++++ ++ D+++ AED I++ V+ 
Sbjct  23    LLSGVKDQVESLHRELSLMKAFLKDSREKRDESAYVREIVRQITDVTYEAEDIIDTFVVH  82

Query  328   IISNGAS-------HERLH-QILQRLAEDIEGL---IEQRNTTQM--LSSYNPGQSNQEH  468
                  A        H   H  +L+ ++EDI+ +   +++    +M  + S   G+ + + 
Sbjct  83    AAMQKARSALKRVFHALDHSNMLRSVSEDIKSIKVKVKEIYDKKMFGIESLQSGEPSHKP  142

Query  469   IIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDD  648
                  A  ++++ + VG  +E     E L     ++ +VIS+VGMGG+GKTT+AKK+Y D
Sbjct  143   SARKRAPIVEEENV-VGFDEEARTVVERLTD-GPEQLEVISVVGMGGLGKTTLAKKVYSD  200

Query  649   PSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKVRRRLM  822
             PSI   F++  W  +SQ Y  R +   +   +  +TD+  ++N+ +    LA ++ R L 
Sbjct  201   PSIEYHFYIRAWVYMSQQYCRREVFLGILDSMGLITDQVYKMNDDR----LAEELFRHLR  256

Query  823   RQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCN---LP  993
               RYL+V+DD+W +  W+D++  FP+ + GSRILLT+R  EVA+++       CN   L 
Sbjct  257   SNRYLIVIDDVWTTEAWNDIKMAFPNTACGSRILLTSRNTEVAMHANP----YCNPHRLR  312

Query  994   FLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVE  1164
             FL + ESW L  +K+   GS   PPE++E+G+RI  +C GLPLAI V +GLLSK +++  
Sbjct  313   FLTNEESWELLCKKVFREGSC--PPELQELGQRISKRCDGLPLAIVVVSGLLSKREKTRT  370

Query  1165  NWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLN  1344
              W  +A +++  +  D   QC  +L LSY +LP HLK CF+YFG FP+   EIP   LL 
Sbjct  371   WWNKVAESVSTYVARD-PTQCMDVLALSYKHLPDHLKVCFIYFGAFPE-DFEIPVSKLLK  428

Query  1345  LWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLRE  1524
             LW+ EGF+ +    +LE+ A +YL DL+DRNLV+++K    G IK+CR+HD+L DLC+RE
Sbjct  429   LWVAEGFIQQIGQETLEDIAEEYLVDLVDRNLVIVAKKRANGRIKSCRIHDMLRDLCIRE  488

Query  1525  VKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFF  1704
               +E F+    Q    + +      +  Y  R      +++    S + +    R+  FF
Sbjct  489   GAEENFL----QVIRGIPDRASLTSIPNYCRRLCIH--SHVLEFVSSRPSGPHVRS--FF  540

Query  1705  FGVSGASGLPVSWRQNV--SFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-GTIKYV  1875
                     +P      V  +F ++R+LDL  I F   P  +I  L+ LR+L+L G  K +
Sbjct  541   CFSMDERDVPREHTSFVHEAFNLVRILDLKSIIFSRFPN-EIVQLVHLRFLSLSGHFKVL  599

Query  1876  -RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWK--------SQSLRFIKYP  2028
                + +  NLQTL+V                        LWK        +  L  +  P
Sbjct  600   PPAISNLWNLQTLVV------------VTTSRNLDIQADLWKMLQFRHLHTSGLSCLHGP  647

Query  2029  YPFPIDTDEIP-VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTE---TW  2196
                     E P V+  + T+  +    CT+  + + PN+K LGI+   +   Q     + 
Sbjct  648   RAETRKDSEDPFVRRNIQTICTIVPECCTENILSRTPNLKKLGIRGKLVMLVQERGGMSL  707

Query  2197  WDNLHYLTKLE--KLIVEDIESEQFE-----LQSINSFPQSLKELKIVGTELGWEAITII  2355
             +DNL  L  LE  KL+ +    + F+     L     FP +LK+L +  T L W  ++ +
Sbjct  708   FDNLAKLDHLETLKLLNDTFPLDPFKCHIPGLPQSYKFPPNLKKLTLSDTLLDWSEMSTL  767

Query  2356  SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALH  2535
              MLPNLE LKL      G  W   DGGF  L+ L +  + L +W   S HFP LER+ L 
Sbjct  768   GMLPNLEVLKLKDYAFKGSRWEPLDGGFRLLRVLQLGRSDLVHWHASSHHFPRLERVVLK  827

Query  2536  HCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             HC +LE+IP GF +++ LQ +EL    P+   SA+ IQ ++
Sbjct  828   HCTHLEEIPCGFGEVSALQNMELYWPTPAAAASARLIQHQK  868



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score =   394 bits (1012),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 310/956 (32%), Positives = 465/956 (49%), Gaps = 146/956 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+ T++ Q ++   + +  + ++++ LR  L       E+  K     +  K
Sbjct  1     MAYAAVTSLMSTIQ-QSMQLTGLNLQSFYEKLESLRSIL-------EKPLKTKGDLEVLK  52

Query  259   DVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQRNT  420
              + A + +++   ED +ESE  ++      ++       L  +L++    I+ ++ +   
Sbjct  53    SLEAEIIELACNTEDMVESESRKVFLAKDAVTRKIDSWELFSLLKQAVGHIDYVMNKWMA  112

Query  421   TQMLSSYNPGQSNQEHIIAG-GASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIV  597
              Q + + +     Q   +A      L+ +  MVGH  E E  ++ L +  + E +++SIV
Sbjct  113   VQNMYTNSKDLKAQNLSLADVSQPALELENTMVGHETEFEMLQDQLARGGS-ELEIVSIV  171

Query  598   GMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEV  777
             GMGGIGKTT+A KIY  P I S F +   ATVS +Y  R +L  L   ++  T  E    
Sbjct  172   GMGGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKT-YEFYGQ  230

Query  778   KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVY  957
             +   +LA+++++ L   RYL+V+DDIW +  WDD++ CF D +NGSRILLTTR  +VA Y
Sbjct  231   QDVGQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEY  290

Query  958   SGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAAG  1134
             +  SGK    +  LNSNESW L   K+        E + IGK I  KC GLPLAITV AG
Sbjct  291   AS-SGKPPYQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAG  349

Query  1135  LLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVR  1314
             LLSK  ++++ WQS+A  ++  +++D+  QC  +L LSY+ LP HLK CFLYF IFP+  
Sbjct  350   LLSKIGKALDEWQSVAENVSSVVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPE-D  408

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
               I    L+ LW  EGF+  +  +S+E+ A KYL+DLIDR+L+ I  LSF G I++C +H
Sbjct  409   ELIFVSKLMELWAAEGFLKVEEMKSIEQVAEKYLKDLIDRSLISIHSLSFDGKIESCGMH  468

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFS----  1662
             D+  +LCLRE +   FV        NVI   D +   E +  + +     I  + +    
Sbjct  469   DVTRELCLREAQNVNFV--------NVIGENDDQNPLEQSMHFSSNSQGRISIQLNQVFH  520

Query  1663  -------DKYNFHKSRTLLFFFGVSGASGLPVSW--RQNVSFKMIRVLDLVEISFDEAPT  1815
                    D Y  ++ R+++ F G         +W  ++++ FK++R+LDL  +  D  P+
Sbjct  521   GIIEKKLDMYPDNEVRSIICFKG---------TWFVQKSLRFKLVRILDLALVRCDTFPS  571

Query  1816  FDISDLILLRYLAL---------------GTIKYVRVLKHHHNLQTLIVKFPNSCRieei  1950
               I DLI LRYLAL                +I     +     LQT I+ FP+  R    
Sbjct  572   -RILDLIHLRYLALTLSPAVEKYIGKEIPSSIDIPPSISSLCYLQTFILNFPHLKR----  626

Query  1951  dsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR--------  2106
                           WK +       PYPF + ++ + +Q   H      YLR        
Sbjct  627   --------------WKWER------PYPFILPSEILAMQQLRHLCLDWNYLRYHEPTEKS  666

Query  2107  ----------------CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK--  2232
                             CT       PN+K L I       +     +D   YL +LE+  
Sbjct  667   LVLKNLQCLSGWNPWYCTSSVFRLFPNLKKLQIHGIAEDYYSCRNIYD-FRYLDQLEELE  725

Query  2233  --LIVEDIESEQFELQSINS--------------------------FPQSLKELKIVGTE  2328
               L    +    F L+S  S                          FPQ+LK+L    T 
Sbjct  726   FHLYYNYLPVRPFFLKSRPSDYLRFTGRKRPHSGTLRPLLLPPLDVFPQNLKKLAFSRTF  785

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHF  2508
             L W  ++I+  LP LE+LKL     +GE W   D GFP LK L +     + W    DHF
Sbjct  786   LRWNDLSIVGKLPKLEALKLTYRACVGEAWEVVDEGFPSLKLLLLEDLDFEYWRASCDHF  845

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             P LERL L  C  L+ IP+ F DI TL LI+++ C  S+  SAK IQ++ Q +Y +
Sbjct  846   PCLERLFLERCRFLDSIPQDFADIITLALIDIRRCKESVGNSAKQIQQDMQDNYAS  901



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score =   394 bits (1012),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 301/936 (32%), Positives = 471/936 (50%), Gaps = 112/936 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+ T++ Q +E   +++  + ++++ LR   +K C++   L           
Sbjct  1     MAYAAITSLMNTIQ-QSMESTGLVMQLFYEKLESLRAIMEKSCNVTGDL----------D  49

Query  250   AEKDVIARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTT  423
             A   + A++ +++  AE++++ E   I    N     R    L  L +++ G I+     
Sbjct  50    ALTSLEAQIVELADEAENKVDLESRNIFLPENEKKQRRAFVNLYSLVKEVVGRIDSTMKK  109

Query  424   QM-----LSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
              M     L +    ++    +++     ++ +  MVG   E E  ++ L +   +E +V+
Sbjct  110   WMAIQKKLKNIQDLKAQDLSLVSTSRHGIEPEDKMVGLENEFEMMQDQLAR-GAKELEVV  168

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             SIVGMGGIGKTT+A KIY DP I S F +   ATVSQ+Y  R +L  L   ++   + E 
Sbjct  169   SIVGMGGIGKTTLANKIYSDPFIMSHFGIRAKATVSQEYCARYVLLRLLSSISGKIE-EF  227

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
             +E +   +LA+++++ L   RYL+V+DDIW    WD ++RCFPD +NGSRIL+TTR  EV
Sbjct  228   HEHQDDDQLADRLQKLLKCGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEV  287

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITV  1125
             A     SGK   ++  +N +ESW L  +K+   +   PE E++GK+I   C GLPLA+ +
Sbjct  288   A-ECASSGKTPYHMRLMNFDESWSLLYEKVFVKDYFSPEFEQLGKKIALNCGGLPLALVL  346

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AGLL K   S++ W+S+   ++  +T++++ QC  ++ LSY+ LP+HLK+CFLYF IF 
Sbjct  347   IAGLLFKIGNSLDEWKSVVKNVSSMVTTEVNVQCMRVVALSYHYLPHHLKSCFLYFAIFQ  406

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +    I    L+ LW  EGF+  +  +S+EE A K L++LIDR+L+ I  LSF G I+ C
Sbjct  407   E-DELILVNKLVELWAAEGFLKVEERKSIEEVAEKCLKELIDRSLISIRNLSFDGKIEIC  465

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLT----FRTTYIQP  1653
              +HD+  ++CLRE +    V+    R E           F   +R         +     
Sbjct  466   GMHDVTREICLREARNMNIVNV--TREEKYQNSCVQSMHFSSKSRGRISIQLITSEQNTE  523

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDL  1833
             K   +Y  ++ R+++ F        L       + FK++RVLDL  + F   P+  I DL
Sbjct  524   KILARYPKNEVRSIICFRVKMFVPKL-------LHFKLVRVLDLALMRFSAFPSL-ILDL  575

Query  1834  ILLRYLALG-----------------TIKYVRVLKHHHNLQTLIVKF--PNSCRieeids  1956
             I LRYLAL                  ++     +     LQT I+K   PN+     +  
Sbjct  576   IHLRYLALSLSPSLQHYLGEEISSSFSVDIPPSISSLCYLQTFILKHLQPNAREYPLVLP  635

Query  1957  deeiGSKWLQGL---WKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVL  2127
              + +    L+ L   W      +++Y  P    T++  V   L  L  +    CT+    
Sbjct  636   YKILTMPQLRHLHLDWN-----YLQYHEP----TEKSLVLKNLQCLSGLNPWHCTRAVFR  686

Query  2128  KIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-----------IVEDIES------  2256
             + PN+K L I C     F++     + HYL +LE+L            +E I S      
Sbjct  687   QFPNLKKLQI-CGIWEDFRSRKDLYDFHYLDQLEELDFVLTYSCYACFLESITSSGLLRF  745

Query  2257  --------------------EQFE---LQSINSFPQSLKELKIVGTELGWEAITIISMLP  2367
                                 E F    L   ++FPQ+LK+L   GT   W+ ++I+  LP
Sbjct  746   TRQKRRAILLERPSLALPPTETFPYSILPPPDAFPQNLKKLAFYGTCFQWKDLSIVGKLP  805

Query  2368  NLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHN  2547
              LE+LKL  +  +G EW     GFP LKFL +   K++ W    DHFP LERL L HC +
Sbjct  806   KLEALKLGISACIGIEWKVVKDGFPSLKFLLLERLKVRYWRASCDHFPCLERLFLEHCWD  865

Query  2548  LEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L+ IP+ F DITTL LI+++ C  S+  SAK IQE+
Sbjct  866   LDSIPQDFADITTLALIDIRWCAESVGNSAKQIQED  901



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score =   392 bits (1006),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 297/892 (33%), Positives = 473/892 (53%), Gaps = 66/892 (7%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAYV + SL+RT+E Q ++ +P  +  + +     L   L + +  LE + K+       
Sbjct  1     MAYVAVISLLRTLE-QLVQLQPHWISAETRIMANSLLVSLEYFQNFLENTSKRSQDHGQI  59

Query  256   KDVIARVKDISFRAEDEIESEVMEI--ISNGASHERLHQILQRLAEDIEGL----IEQRN  417
             K++   ++ +   AED IE ++ EI  +    + + L++IL    E I+ L    +E   
Sbjct  60    KELERYIRTVVNEAEDVIELKIYEINQLDRMMASKALYEILPPFVEKIDLLKREVMESSF  119

Query  418   TTQMLSSYNPGQSNQEHIIAGGASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             +T  +  Y  G    E++  G +S+    L  + I+VG   +L   K  L    +  R++
Sbjct  120   STDKIHGY--GDPMNENLQLGHSSRQVANLNLETIVVGLEDDLMIIKRRLTGPPST-REI  176

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             + I+GMGGIGKTT+AKK YDD  IR RF +  W TVSQ+Y +R +L  +  C +      
Sbjct  177   VPILGMGGIGKTTLAKKAYDDSEIRHRFDVHVWVTVSQEYRIRDLLLGVLSCTS------  230

Query  766   INEVKSTA-ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
              NEVK T  +L + + + L R+RYL+V+DDIW +  WD + R FPDD+NGSRI+LT+RLK
Sbjct  231   -NEVKETDDQLMDMIYKNLNRKRYLVVMDDIWSNDVWDLMTRTFPDDNNGSRIILTSRLK  289

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN---LPPEIEEIGKRIVNKCRGLPL  1113
             ++A+++         +  L+S+ESW L   K+  +     PPE+++IGK++  KC+GLPL
Sbjct  290   DLAIHADPDSP-PHEMRLLSSDESWKLLHDKVFGVEHEICPPELKDIGKQVAQKCQGLPL  348

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             A+ V AG LSK  R+ E+W  +A +++  + +   D C  +L +SYN LP HLK CFLY 
Sbjct  349   ALLVVAGYLSKIARTPESWGDVAKSVS-KVVAHESDICLGVLAMSYNYLPNHLKPCFLYM  407

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FP+   E+    L+NLW++EGF+ ++  +S+E+      +DL+ R+L+++ K  F G 
Sbjct  408   GVFPE-DSEVNIVTLINLWVSEGFLGKERLKSMEQVGRDCWEDLVSRHLIMVRKRRFNGE  466

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYAN-RWLTFRTTYIQ  1650
              +TC +HDL+ DL LRE +KE F+               T PL +  + R  +F     +
Sbjct  467   ARTCGVHDLVRDLILREAEKEMFLQVTRTHEA-------TNPLAKKLHVRRYSFHPYIYE  519

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
                 ++ +F ++  L  F G                FK++RVL +    F + P  +I++
Sbjct  520   DDCWEESSFIRTVHLRGFGGFFHFE----------HFKLLRVLVIPYYEFRDFP-LEITE  568

Query  1831  LILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS  2007
             L+ LRYL       + +++   +NLQT I +            +        + +W+ + 
Sbjct  569   LVHLRYLQFWCNDDIYQLVSKLYNLQTFIFRH-----------EALKPPTIPETIWEMKH  617

Query  2008  LR---FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCS--EI  2172
             LR    +K  +   I      +++ L  L  +    CT E    IPN+K L I  +  E 
Sbjct  618   LRHLQVVKRVFSLAIPKSGFKLEN-LEGLSCLNLSSCTYEMFSAIPNLKRLKIHGNWREC  676

Query  2173  RAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITI  2352
             +  +     D+L  L +LE L      + + +L    S P SLK L +  T    E +T 
Sbjct  677   KREKISQHLDSLSCLKELEILKFRYQGAYRRQLPRKFSLPTSLKRLTLTNTLFPPEDMTN  736

Query  2353  ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLAL  2532
             I+MLPNLE LK+   ++  E  +  +  F +LKFL IS   L++WE  S +FP L+R+ L
Sbjct  737   ITMLPNLEVLKMKDVFDSDEWRLNDEEIFSQLKFLLISVTFLRHWEAGSVNFPKLQRVVL  796

Query  2533  HHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
               C  LE+IP+ F +I +L+ IEL DC  S  +S +++QEEQ S GND L V
Sbjct  797   RSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQEEQESMGNDCLSV  848



>ref|XP_010319214.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=882

 Score =   392 bits (1006),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 286/844 (34%), Positives = 442/844 (52%), Gaps = 68/844 (8%)
 Frame = +1

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLS  435
             KD++ R+KD++  AE E+ES + ++I  G + E     L  + + +   I+  ++   +S
Sbjct  55    KDLLRRIKDVAVYAEYEVESLMNQLIIVGLNDECCGAKLDYVCQHV---IQVTHSVNNIS  111

Query  436   SYNPGQSNQEHIIAGGASKLQDDAI----MVGHAQELERTKEMLLQCSTQERQVISIVGM  603
                P +S          S   DD+I    M G+ +E  +     L   +++ QV+S+VGM
Sbjct  112   C--PKKS---------VSPRLDDSIHENFMEGYNEE-RKNMVARLTYGSKKLQVVSVVGM  159

Query  604   GGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKS  783
              GIGKTT AK    D + +  F + GW TVS++YDLR +L  L   V +M DK+ + + +
Sbjct  160   AGIGKTTFAKTTLFDIN-KEDFPIRGWITVSENYDLRELLLRLLRDVIEMKDKDFDGMDN  218

Query  784   TAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSG  963
               +LA  +++ L  +RYL+VVDDIW +  WD+++  FPD  + SRILLT+R K+V  Y+ 
Sbjct  219   -GQLAAHLKQVLQGKRYLIVVDDIWSNSDWDNIRHWFPDCGDKSRILLTSRDKKVGAYAA  277

Query  964   CSGKYVCNLPFLNSNESWMLFSQKLGSINLP-----PEIEEIGKRIVNKCRGLPLAITVA  1128
               G  V   P        + + +  G  N        + +++G++++  C+GLPL IT  
Sbjct  278   KDG-LVLMRPLTQDESRNLFYHRAFGKNNTIRRSDIGKFKKVGEKVITNCKGLPLMITAV  336

Query  1129  AGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPK  1308
             AG+L ++K  +  W  +A +++  +  D + QC  ++ LSYNNLP  +KACFL+FG+FPK
Sbjct  337   AGIL-RSKSKLYEWMEVAESVSSLVNDDAYKQCLQVVALSYNNLPSLMKACFLHFGVFPK  395

Query  1309  VRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCR  1488
                 IP K L  LWI EG V  +     E+ A + L DLI +++V++ KLS+ G IKTCR
Sbjct  396   -SHGIPVKKLTRLWIAEGLVYPNGVEEFEQAADRVLHDLIGKSVVIVDKLSWDGKIKTCR  454

Query  1489  LHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDK  1668
             +HD+  D C +E + E  +      S  + ++      F    RW++ ++      FS+ 
Sbjct  455   IHDVFHDFCSKESESENLLCVCSSDSTTISQV---HTKFRQGCRWMSVQSMI---DFSNY  508

Query  1669  YNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE---ISFDEAPTFDISDLIL  1839
               +       F+         P    +   FK++RVLDL     I  +E       DL+ 
Sbjct  509   RRYTPIEIPSFYMLYDVVIFDP----KVFHFKLLRVLDLEVHNIIGLNEV----TRDLVC  560

Query  1840  LRYLALGT--IKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
             LRYLA+GT  + +V + + +  NL  LI+      +   ++  +     + + +W+   L
Sbjct  561   LRYLAVGTSYLDFVDLPITNLWNLHALILG-----KSFVMNPRKRKVFTFPEDIWQMTQL  615

Query  2011  RFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTE  2190
             R +           +  V   L ++  +    CTKE    I  VK L I+ +    F T+
Sbjct  616   RHLYAKGIHLCSPGDNKVLGNLQSVSGLSPCCCTKEIFEGIKKVKKLVIRGTR-EEFPTD  674

Query  2191  T-WWDNLHYLTKLEKLIVEDIE-------SEQFELQSINSFPQSLKELKIVGTELGWEAI  2346
               W DNL YL  LE + +E+I+       +  F L S +SFPQ LKELK+  T L WE I
Sbjct  675   VKWIDNLKYLQHLESVSIENIDFIFQKNTTSFFSLTSPDSFPQKLKELKLRCTYLPWECI  734

Query  2347  TIISMLPNLESLKLLQAYEMGEEWVTGDG-GFPKLKFLYISGAKLKNWETMS---DHFPV  2514
             +IIS LP LE LKL     +G EW   D  GFPKL+FL +    L  WE  +   DHFP 
Sbjct  735   SIISKLPELEVLKLKSKSLIGNEWKATDQVGFPKLRFLLLDNLPLTEWENTTGSHDHFPS  794

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQ-EEQSSYGNDQLVVR  2691
             LERL + +   LE+IP+GF D   L+LIEL  C PSLV+ AK++Q E +   G ++L V 
Sbjct  795   LERLIITNFKFLEEIPQGFADSKKLELIELHYCNPSLVDFAKNVQVEHEEVLGRNKLKVT  854

Query  2692  DYDT  2703
              ++T
Sbjct  855   AFNT  858



>gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Erythranthe guttata]
Length=895

 Score =   391 bits (1005),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 301/901 (33%), Positives = 460/901 (51%), Gaps = 58/901 (6%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L S++  +E   L P P + +D + +I+ L + +      LE   + ++       
Sbjct  3     AYAALISVMNIIEQIQLHPHPPISLD-QFQIEPLVKNVTFFLDFLECYSQLISSQDTYHL  61

Query  262   VIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSY  441
             + +R+ + ++  +D IES +++ I +GA+     +    L E I+ +   +     +   
Sbjct  62    LESRIANTTYAVQDIIESHIVDQI-HGANIGSDKEFYNGLTEVIQEMDFIKKEVMQMKEN  120

Query  442   NPG----QSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGG  609
             N G    + +    I    S+       VG    +E   +ML       RQ+I IVGMGG
Sbjct  121   NMGLFLHKDSSTVDIGPLRSRFTGQNATVGFDDVMEEMMDML-TGRQSTRQIIPIVGMGG  179

Query  610   IGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA  789
             IGKTT+A+ +Y    I   F +L WAT+SQ+Y +R IL ++  C+     KE        
Sbjct  180   IGKTTLARNLYGSRLIVRHFDMLAWATISQEYSMRGILLEILLCIKSQESKETYSAMRED  239

Query  790   ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCS  969
             EL   + + L+ +RYL+++DD+W    W+ ++  FPD++NGSRI++TTRL+ VA  S  +
Sbjct  240   ELGLVLHKTLIGRRYLIIMDDMWSIEAWELVKFFFPDNNNGSRIIVTTRLRIVA--SQLT  297

Query  970   GKYVCNLPFLNSNESWMLFSQKL-GSINLPP-EIEEIGKRIVNKCRGLPLAITVAAGLLS  1143
                   + FL+ ++SW L  + + G  + P  E+EEIGK I   C+GLPL+I V  GLL+
Sbjct  298   DSCGIEMSFLDDDQSWNLLCRNVFGEQDCPNLELEEIGKEIAKSCKGLPLSIVVIGGLLA  357

Query  1144  KTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG-IFPKVRRE  1320
             K++R+ E W+ +   ++  +  + +++C  IL +SY++L  HLK CFLY G +FP+  + 
Sbjct  358   KSERTREYWEYVLENISSIVNLEDNERCLRILNMSYDHLSVHLKPCFLYLGSVFPEDDK-  416

Query  1321  IPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDL  1500
             I    L+ LW+ EGF+   SG+S+E  A +YL+DLI+RNLVL+      G IK C +HDL
Sbjct  417   IRVSWLIKLWVAEGFLKPKSGKSMELVAEEYLKDLIERNLVLVHTRGSSGKIKFCIIHDL  476

Query  1501  LFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFH  1680
             L DLCLR+ +KEKFV  F + + + ++    E           +      P+ S      
Sbjct  477   LRDLCLRQAEKEKFVCVFTRNNHSSLDARQIETQHRICIHRGKWEEELDIPRMSHAV---  533

Query  1681  KSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILL---RYL  1851
             +S +L           LP     +++ +++RVL   + +      + I  +  L   RYL
Sbjct  534   QSASLTRSMICDFKEVLP-----SLNMRLLRVLKSNDRALHYGDIYSIEAIFQLVNSRYL  588

Query  1852  A-----LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR-  2013
             A     +   KY+  L H  NLQTLIV                  +     +WK   LR 
Sbjct  589   AFRVDWMQISKYLSSLHHIWNLQTLIV-------------YGAWNTIAPPEIWKMHQLRH  635

Query  2014  --FIKYPYPFP----IDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIR  2175
               FI    P P     D D+I V + L TL  +   +C++E V +IPNVK L +   ++ 
Sbjct  636   IEFIMLDLPDPEMDGRDQDKIIVLENLQTLLQIRNFKCSEEVVKRIPNVKKLRLYYQDVE  695

Query  2176  AFQTETWWDNLHYLTKLEKL---IVEDIES--EQFELQSINSFPQSLKELKIVGTELGWE  2340
                +    +NL  L KLE L      + E       LQ+++ FP SLK+L +  T L W 
Sbjct  696   ELSSFC-LNNLCRLEKLESLGCYFAPEKEPIIRNHMLQNLD-FPHSLKKLSLYRTRLHWG  753

Query  2341  AITI-ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG-AKLKNWETMSDHFPV  2514
              + I I  LP L+ LKL      G+EW T +G F  LKFL I G  +L+ W T S HFP 
Sbjct  754   DMAIKIGSLPFLQVLKLESNAFCGDEWETIEGQFSNLKFLLIEGCGELRYWRTESSHFPC  813

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRD  2694
             LE+L+L   + LE+IP    +I TL+ I LK C  S V SAK+I EEQ   GN+ L VR 
Sbjct  814   LEQLSLRDLYILEEIPWDIGEIPTLETIVLKYCSHSAVISAKEIVEEQLENGNEDLRVRV  873

Query  2695  Y  2697
             Y
Sbjct  874   Y  874



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score =   391 bits (1005),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 311/932 (33%), Positives = 485/932 (52%), Gaps = 116/932 (12%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L SL++T E     PRP + +D K ++Q L++ +  L+  LE+   +L     E  
Sbjct  4     AYAALVSLVQTTEPIQHHPRPPISLD-KQQLQSLQEHVAFLQDFLEQYSHRLT-QDYEDG  61

Query  262   VIARVKDISFRAEDEIESEVMEIISNGAS-----------HERLHQILQRLAEDIE----  396
             ++ R+ D +  AED IES +++ I +G S               +Q LQ++  D++    
Sbjct  62    LMVRIADAAHAAEDVIESHIVDQILDGQSTTTSRENISSIDHHFYQDLQKVIADMDLIKN  121

Query  397   GLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML---LQCS  567
              +IE + +  ++      Q ++  + AG  S     + + G  Q +    ++L   +   
Sbjct  122   EVIEIKESMGIVHD----QLHRNSVPAGSLSS----SPLTGQKQAMVGVDDILNDIMDKL  173

Query  568   TQER---QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCG  738
             T+++   Q++ I+GMGGIGKTT+A+ +Y++P I   F    W TVS++Y+ R IL +L  
Sbjct  174   TRQQSGCQIVPIIGMGGIGKTTLARHVYENPLIVEYFDFRAWVTVSREYNTREILLNL--  231

Query  739   CVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSR  918
              V+Q + KE  E+ S  EL   + + L  +RYL+++DD+W    WD+++  FP++++ S+
Sbjct  232   -VSQKS-KETMEIMSEEELGEMLYKSLAGKRYLIIMDDMWSIEAWDNVKLFFPNNNSESK  289

Query  919   ILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSI-NLPPEIEEIGKRIVN  1092
             I++TTRL  +A+    SG Y   + FL+ N+SW LF + + G + N P E+EE+ KR+  
Sbjct  290   IMITTRLSNLALQ--ISGSYGLWMYFLDENKSWELFCKIVFGEVDNCPLELEEVAKRVAR  347

Query  1093  KCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHL  1272
              C GLPL++ V  GLL+K++++   W+ IA  ++  +  + +++C  IL  SY  LP HL
Sbjct  348   NCNGLPLSVIVIGGLLAKSEKAQGYWKYIADNLSSIVNLEDNERCLRILYTSYQELPIHL  407

Query  1273  KACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLIS  1452
             K CFLY G+ P+      ++ L  LW+ EGF+   SG+SLEE A +YL+DLIDRNL++  
Sbjct  408   KPCFLYMGVLPEDSMTYVSR-LRKLWVAEGFLKPISGKSLEEVAEEYLKDLIDRNLIVPL  466

Query  1453  KLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTF  1632
              +   G IK C +HDLL DLCLRE +K+KF+S+        +E+G         NR    
Sbjct  467   MMGSTGKIKVCSMHDLLRDLCLREAEKQKFLSS--------LEIGQAIT----TNR----  510

Query  1633  RTTYIQPKFSDKYNFH---KSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL------DL  1785
             R    +    D+++ H   +S  L+          LP++     S +++RVL      D+
Sbjct  511   RIVVHKISSKDRHDLHRALRSAQLVRSLTCDLQEALPLA-----SCRLLRVLKNTYSEDI  565

Query  1786  VEISF-DEAPTFDISDLILLRYLALGTIKYV-----RVLKHHHNLQTLIVKFPNSCRiee  1947
              E+   D   T DI  L+  RYLALG   ++       +    NLQTLI++  N C+I +
Sbjct  566   FELRREDGGLTGDIFKLVNSRYLALGANLWLGHACPSSMHLLWNLQTLILRTTN-CKIID  624

Query  1948  idsdeeiGSKWLQGLWKSQSLRFIKYP-YPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFV  2124
                          G+WK   LR +       P  T +  V   L  +  +    C +  V
Sbjct  625   AP----------PGIWKMHQLRHVDVNLLRLPDLTADEFVLPNLQKMSEIVNFECCEAVV  674

Query  2125  LKIPNVKVLGIKCSEIRAF------QTETWWDNLHY----LTKLEKLIVEDIESEQFELQ  2274
              +IPN+K L I  ++  +          +   ++HY    L + +KL     ES  F L 
Sbjct  675   KRIPNIKKLRICYNDFYSLLYCLNNLGHSDISSMHYSVENLGRFQKL-----ESLCFSLS  729

Query  2275  SIN---------SFPQSLKELKIVGTELGWEAIT-IISMLPNLESLKLLQAYEMGEEWVT  2424
             S+           FP SLK+L + G  L WE IT  I  LP L+ LKL +   +G EW T
Sbjct  730   SMVRRSDMLERLCFPNSLKKLSLRGCRLQWEDITRKIGPLPLLQVLKLHKDSVIGSEWET  789

Query  2425  GDGGFPKLKFLYISGA-KLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIE  2601
              +G F +L  L I+    L+ W   + HFP L RL L H   L+KIP GF +I TL+LIE
Sbjct  790   VEGQFRRLSVLEITDIDDLEYWTVDNSHFPCLHRLCLRHLRKLKKIPWGFAEIQTLELIE  849

Query  2602  LKDCFPSLVESAKDIQEEQSSYGND--QLVVR  2691
             L  C  S V S K+I E+Q   GN+  Q+VVR
Sbjct  850   LAMCSDSAVISVKEIAEQQEELGNEDLQVVVR  881



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score =   390 bits (1002),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 313/896 (35%), Positives = 460/896 (51%), Gaps = 79/896 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL   +E LQ    R  L +D  +++Q L Q +     L         +SQ  +
Sbjct  5     AYASLLSLSHVLENLQHPARRTRLHLD-SNQVQTLHQTV--QFLLEFLEVDSGRISQEME  61

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGAS------------HERLHQILQRLAEDIEGL  402
             D+  ++  ++  AED I+  V+  +  G+             ++ +H+++Q++   +  L
Sbjct  62    DLARQIAILADEAEDVIDLHVVYQLGQGSRDKSQDMAALSSFYQDIHKVVQKIDSIMNEL  121

Query  403   IEQRNTTQMLSSYNPG----QSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                R  +  +S   P     +S+     + G S     + MVG  + L R  + L + + 
Sbjct  122   GMIRKESTDVSKQQPVVFVLESSSTAFTSSGKS-----STMVGFDEHLVRVMDELTR-NE  175

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
              + Q+I I+GMGGIGKTT+AK  +D+P I   F    W T+SQ+Y  R IL  L   +  
Sbjct  176   PDLQIIPIIGMGGIGKTTLAKNTFDNPYIVHHFDRRIWFTISQEYSAREILVRL---LND  232

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D+E N  K+ A+L  ++ + L  +RYL+V+DD+W    WD+L+  FP++ NGSRIL+T
Sbjct  233   GKDQESN--KTLAQLGQRLHQNLFGRRYLIVMDDMWSISAWDELRLFFPNNRNGSRILVT  290

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLP-PEIEEIGKRIVNKCRG  1104
             TR+  VA+  G    YV  + FL+ ++SW L  QK  G  N P P++EEIGK I  KC G
Sbjct  291   TRISNVAISLGTHSPYV--MDFLDEDKSWNLLCQKAFGEDNCPYPKLEEIGKTIAKKCNG  348

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAI V  GLL+ + R++E+W+S+A ++N     +  ++C  IL+LSY+NLP HLK CF
Sbjct  349   LPLAIVVIGGLLANSNRTLEHWESVAKSINSFSNLEYSERCLKILSLSYDNLPIHLKPCF  408

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LY  IFP+    I    L+ LW+ EGF+     ++LEE A +YL++LIDRNL+L+ K  +
Sbjct  409   LYMRIFPE-DDVIKASKLIKLWVAEGFLKTSRAKTLEEVAEEYLRNLIDRNLILVHKWHY  467

Query  1465  IG-NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
              G   KTCR+HDLL DLCLR+ +KE  +     +  +  E  ++   F  ++R L     
Sbjct  468   GGKKAKTCRIHDLLRDLCLRQSQKECLICVPKAQRISFFEPWESCLCFLCSSR-LNEDQR  526

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL----DLVEISFDEA  1809
                P+           +LL         G  + +   V  +++RV     D+  +   + 
Sbjct  527   MDLPEVQVASQSTSLESLLV------CDGCRIMYPNLVRLRLLRVKAYEDDIEFLHPTKL  580

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG  1989
                 ISD + L++ +  TI  +       NLQTL +K P    +                
Sbjct  581   RYLKISDDMQLKFESPSTISLL------WNLQTLTLKLPYRVNLPSE-------------  621

Query  1990  LWKSQSLRFI----KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
             LW    LR +        P P  T +  + + L TL      RCT + + ++PN+K LGI
Sbjct  622   LWDMPQLRHLISDGVVDLPHPAVTQDSMIMENLQTLAHFRNFRCTIDVLDRVPNLKKLGI  681

Query  2158  KCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGW  2337
                E  +   E    NL  L KLE L+V  IE +   L +I +FP SLK+L +    + W
Sbjct  682   VYLEKGSGGLE----NLARLQKLESLLV--IEKDVSLLANI-TFPTSLKKLTLTSCCIPW  734

Query  2338  EAITII-SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPV  2514
             E +T+  S+LPNLE LKL      G EW   +G FP+LK L I    L  W   S HFP 
Sbjct  735   EEMTVFGSVLPNLEKLKLYGNAFKGPEWSPVEGQFPRLKVLIIWENDLVWWRAESIHFPK  794

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
             LERL L+  H LE+IP G  DI TL  I L DC  S + SAK I EEQ S GN+ L
Sbjct  795   LERLDLYEMHCLEEIPSGIGDIPTLLSIHLWDCSDSSINSAKQILEEQQSSGNEIL  850



>ref|XP_006350138.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score =   391 bits (1004),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 307/937 (33%), Positives = 478/937 (51%), Gaps = 124/937 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++              +
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLESLRAIMEKSCNITGD----------HE  49

Query  250   AEKDVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQ  411
                 +   + +++++AED ++S+  ++      I+   +   L   L++  E I+  + Q
Sbjct  50    GLTTLEVEIAEVAYKAEDMVDSKSRKVSSAETVITRSKAFWELCCSLEQEVECIDSFMMQ  109

Query  412   -------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                     N  +   + N   S     I   A +  +D IMVG+  E    K ML Q + 
Sbjct  110   WLAIWDWYNNFKDFKAQNFCLSK----IPERAVERSED-IMVGYENEF---KMMLDQLAR  161

Query  571   QERQ--VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
              ER+  V+SIVGMGGIGKTT+A K+Y+DP +  RF +   ATVSQ+Y +R +  DL  C+
Sbjct  162   GERELAVVSIVGMGGIGKTTLATKLYNDPCMMYRFDIRAKATVSQEYCVRNVFLDLLSCI  221

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                +DK  +++    +LA+++++ L  +RYL+V+DDIW ++ WDD+Q CFPD  NGSRIL
Sbjct  222   ---SDKPYDQLHD-GQLADRLQKLLKGERYLVVIDDIWTTKAWDDIQICFPDFHNGSRIL  277

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTR  EVA Y+  SGK   ++  +N +ESW L  +K+ + +   PE E++GK+I  KC 
Sbjct  278   LTTRNVEVAEYAS-SGKPPYHMRLMNFDESWSLLYEKVFTKDSFSPEYEQLGKQIALKCG  336

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPLAI V AGLL+K  +++  WQS+A  ++  +++D+  QC  +L +SY+ LP+HLK C
Sbjct  337   GLPLAIVVIAGLLTKIDKALSEWQSVAENVSSAVSTDVGVQCMRVLAMSYHYLPHHLKPC  396

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYF IFP+  + I    L+ LW TEGF+  +  +S+EE A KYLQDLIDR+L+ I   +
Sbjct  397   FLYFAIFPE-DKLIFVNKLMILWETEGFLKVEEMKSIEEVAEKYLQDLIDRSLISIESTT  455

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             F G IK C +HD   +LC+ E +   FV+    +++    +   + L +   R     + 
Sbjct  456   FDGKIKCCGIHDTTRELCMMEARNMNFVNVLGSKNDQNPCVKSMQCLSKSRGRI----SI  511

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD  1821
             + + ++    N      +LF              R+ + FK++RVLDL +      P  +
Sbjct  512   HNKKEYVRCLNSEAHSVILF-------GRFRCCMREYLPFKLVRVLDLADNICLTFPR-E  563

Query  1822  ISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG--L  1992
             I  LI LR+LAL     V + L    ++ +  V  P S               +LQ   L
Sbjct  564   ILYLIHLRHLALRIYPNVEQYLGSEEDVLSSRVDIPTSISNLC----------YLQSLVL  613

Query  1993  WKSQSLRFIKYPYPFPIDTDEIP----------------------VQDTLHTLY-WVPYL  2103
             +    +   K+    P +   +P                      V   LH+L+ W P  
Sbjct  614   YLPLVINLRKHALILPSEILTMPQLRHLHLDRNYLRYHELTEKSLVMKNLHSLFGWNPSY  673

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK-----------------  2232
              CT  F    PN+K L ++    + F +     +  YL  LE+                 
Sbjct  674   -CTASFFRLFPNLKELQVR-GIPQDFHSHKDLYDFRYLDHLEELAFCLPPQNNAYFLERR  731

Query  2233  --------LIVEDIESEQFELQSINSFPQSLKELKIVGT-ELGWEAITI-ISMLPNLESL  2382
                     L+VE + S    L   ++FP++LK L   G   L W+ ++I +  LP LE L
Sbjct  732   MCFQTRNPLVVEVVPS--LILPPPDAFPRNLKNLTFTGNFFLSWKDLSIVVGKLPKLELL  789

Query  2383  KLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIP  2562
             +L Q    G EW   + GFP LKFL +  + ++ W    DHFP LERL L  C  L+ IP
Sbjct  790   ELTQGVCRGREWEVAEEGFPFLKFLLLKRSHIQYWRASCDHFPCLERLFLDSCRFLDSIP  849

Query  2563  EGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYG  2670
             + F DITTL LI++++C  S+  SAK IQ++ Q +YG
Sbjct  850   QDFADITTLALIDIRNCPESVGNSAKQIQQDIQDNYG  886



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score =   390 bits (1002),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 311/921 (34%), Positives = 476/921 (52%), Gaps = 88/921 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD--YKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  L+S + ++E Q L+P   LV     +  I+ L QKL  L+  L+ + K +   + 
Sbjct  1     MAYAALSSFMNSLE-QLLKPNQSLVCRSCTQQHIESLYQKLSALQVFLDNTTKDI---ET  56

Query  253   EKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQR  414
              K +  R+++I ++AED ++S + +II      +R       +Q L ++ E +  L ++ 
Sbjct  57    VKVLEKRIRNIVYKAEDRVDSCLRKIILADREDKRQKACTSFYQELLKVEEQVYFLNKE-  115

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQ---CSTQERQV  585
                  +   N G  + E  +A  +S L+   I       +E     +L      T E  V
Sbjct  116   --VMQIEFNNHGSKSAE--LARISSSLEKSTIEENTVVGMEDDFNTILDRVTAQTDELTV  171

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKE  765
             I I GMGGIGKTT+A+K YDD  I+SRF    W T+SQ Y+ R++L ++   +   ++K 
Sbjct  172   IPIFGMGGIGKTTLARKAYDDSYIQSRFDKHAWVTISQKYNERQMLLEVASSITTGSNKY  231

Query  766   INEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKE  945
             +    S  +L   V R L  +R+L+V+DDIW +  WD ++R FP+D+N SRILLTTRLK 
Sbjct  232   M----SDDQLMEFVYRGLKGRRFLIVIDDIWSTEAWDQMKRIFPNDNNKSRILLTTRLKC  287

Query  946   VAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             VA Y+        +  FL+ ++SW LF++KL    + PP +EE GK IV +CRGLPL++ 
Sbjct  288   VAGYASSPDFPPHSKSFLSVDDSWNLFNEKLFKQDHCPPLLEETGKHIVQQCRGLPLSVV  347

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V AGLL K   + +NW+++   +N      + +QC +IL+LSY+ LP +L+ACFLY G F
Sbjct  348   VVAGLLGKMDPTYDNWKNVEKNLN-SFFGTVSEQCQSILSLSYSYLPQYLRACFLYVGGF  406

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKT  1482
             P+  +EI    L+ LWI E FV   S +SLE  A +YL++LIDR+L+L  +       KT
Sbjct  407   PE-DKEIDVSKLIELWIAEQFVKARSNKSLEVVAEEYLEELIDRSLILTGRQRANEWNKT  465

Query  1483  CRLHDLLFDLCLREVKKEKFVSAFHQRSENVI----ELGDTEPLFEYANRWLTFRTTYIQ  1650
             C++HDLL  LCLRE   E  V   H  + NV      + D   +    ++    R  Y +
Sbjct  466   CKIHDLLRQLCLREAHTENVV---HIMNWNVTMSSEAINDQRRVIVSEHQE---RQVYSR  519

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
                S   +  ++   + +FG++   G+     Q    K+++VLD+  I +D +    I  
Sbjct  520   RHSSGITSITRTFISMQYFGLNFPKGICSFVSQ---LKLLKVLDVSSIQYDFSCV--IPQ  574

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
             L+ LRY+A   IK    L    NLQT+I+   N  R E          K    +W    +
Sbjct  575   LVHLRYVA-ARIKEAISLAKLRNLQTIIL--ANVERTEL---------KHPLDIWTMTEI  622

Query  2011  RFIKYPYPFPIDTDEIPVQDTLH------------TLYWVPYLRCTKEFVLKIPNVKVLG  2154
             R +    P  I    +   +++             TL++ P+     E + + PN+K L 
Sbjct  623   RHLDIESPLHISNPCVSENNSIGEQPLFLNNMQTLTLHFSPF---AAEIIRRTPNLKYLK  679

Query  2155  IKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSI--------NSFPQSLKEL  2310
             I          + W   L     L+ LI+ +         S         + FP +LK+L
Sbjct  680   I---------IDYWPSILDGPPVLDSLILLEELEMLDIELSTIGPVTFPRDIFPSNLKKL  730

Query  2311  KIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNW  2487
             ++  T + WEA+ +++ LPNLE LKL  A+  G +W V  D  F KLK+L I+   L+ W
Sbjct  731   RLSYTRIPWEAMNLLANLPNLEVLKLDYAF-AGTDWKVDEDVVFHKLKYLQIASDCLERW  789

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSY  2667
             E  SD+FP+LE+L L+  + LE+IPE   +I TL LI+L  C   +V SAK IQ+EQ S 
Sbjct  790   EIGSDNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQEQQSL  849

Query  2668  GNDQLVVRDYDTRS*ILGAPV  2730
             GN +L V+       + G PV
Sbjct  850   GNYELQVQIKSNYGVVKGIPV  870



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score =   391 bits (1004),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 316/953 (33%), Positives = 474/953 (50%), Gaps = 146/953 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I +V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILKVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q    +  +    P  S+     EH +       Q D IMVG   E E   + L +   
Sbjct  108   KQWMAASDSMKDLKPQTSSLVSLPEHDVE------QPDNIMVGRENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +   L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVFLGLLSLTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA  +  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVA-ENASSGKPPHHMRIMNFDESWNLLHKKIFETEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKMGQRLDKWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   EI    L++LW  EGF+ E+ G+S+EE     + +L+DR+L+ I  L
Sbjct  389   CFLYFAIFAE-DEEIYVNKLVDLWAVEGFLNEEEGKSIEEVPETCINELVDRSLISIHNL  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I+ C +HD+  +LCLRE +   FV        NVI  G+++      +   +F++
Sbjct  448   SFDGKIERCEMHDVTRELCLREARNMNFV--------NVIR-GNSDQNSCAQSMQCSFKS  498

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDE  1806
                      + + H    L++       S +     + V    SFK++RVLDL       
Sbjct  499   -------RSRISIHNDEELVWCRNSEAHSIITFCGFKFVTLELSFKLVRVLDLGSTICPI  551

Query  1807  APTFDISDLILLRYLAL----------GTIKYVR--------VLKHHHNLQTLIVKFPNS  1932
              P+  +S LI LRYL+L          G+++ V          +     LQT  + FP  
Sbjct  552   FPSGVLS-LIHLRYLSLCFNPCLKQYRGSLEAVPSSIIDIPLSISSLCYLQTFKLCFPFP  610

Query  1933  CRieeidsdeeiGSKWLQGLWK-SQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRC  2109
              R +            +  L K      +++   P    T+   V  +L  L+ +    C
Sbjct  611   YRDDVYPFILPSEILTMPQLRKLCMGWNYLRSHEP----TENRLVLKSLQCLHQLNPWYC  666

Query  2110  TKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL--------------I  2238
             T  F   IPN   +KV GI+    + F+      +  YL +LEKL              I
Sbjct  667   TGSFFRLIPNLKKLKVFGIQ----QDFRNRKDPYDFRYLYQLEKLEFSIWRPAGQVAACI  722

Query  2239  VED-------------IESEQFE-------------LQSINSFPQSLKELKIVGT-ELGW  2337
             +++              ++E F              L   ++FPQ+LK L   G   L W
Sbjct  723   LKNTAPSGSTPQEPLRFQTEIFHRYTFFWETAPTLLLPPPDAFPQNLKSLTFRGEFFLAW  782

Query  2338  EAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVL  2517
             + ++I+  LP LE LKL      GEEW     GFP LKFL++    ++ W   SDHFP L
Sbjct  783   KDLSIVGKLPKLEVLKLSYNPFKGEEWEVVAEGFPHLKFLFLDKVYIRYWRASSDHFPYL  842

Query  2518  ERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             ERL L  C+ L+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +YG+
Sbjct  843   ERLFLRACYFLDSIPRDFADITTLALIDITRCQQSVGNSAKQIQQDIQDNYGS  895



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score =   389 bits (998),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 301/907 (33%), Positives = 465/907 (51%), Gaps = 89/907 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEP---RPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  L SL R +E Q L P   R IL  + K +++ L +K       +  +    +   
Sbjct  1     MAY-NLESLTRILE-QILHPNQQRWILDHNKKPQMESLLKK-ASSLKQIPHNSSSASGPS  57

Query  250   AEKDVIARVKDISFRAEDEIESEVME--IISNGA-----SHERLHQILQRLAEDIEGL--  402
             +   ++++++D + +AED  ES +++  +   GA     S   +H I+Q L   ++ L  
Sbjct  58    STASLMSQIRDAAHKAEDITESHMVDRRLSKPGAQSCIISPPDVHDIVQELDSAMDKLLR  117

Query  403   IEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQ  582
             I +  +  M +S  P        +         + I+VG  ++L + K+ L    + E Q
Sbjct  118   IVKHGSDAMRNSSFPD-------VVSSTPDSTSNNIVVGLDEDLIQLKDRLTGLES-ELQ  169

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGC-VAQMTD  759
             +I IVGMGGIGKTT+A+ +Y+DP + S F    W  +SQDYD+R IL  L GC V ++TD
Sbjct  170   IIPIVGMGGIGKTTLARNLYNDPLVVSHFDTRAWIVISQDYDVRAILLGLLGCIVGKLTD  229

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             + +   K+ ++LA  + + L  +RYL+V+DDIW +  WD+++  FP ++N SRI+LTTR 
Sbjct  230   EVLQ--KNNSQLAVALYKNLTGRRYLVVLDDIWSTDAWDNIKMFFPGNNNRSRIVLTTRE  287

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLA  1116
               VA Y   S  Y   +  L ++ESW L  QK+ G  N PPE E+IG+ I + C GLPLA
Sbjct  288   SNVANYVDLSSSY-HQMHLLTNSESWNLLHQKVFGEDNCPPEFEKIGRSIASYCGGLPLA  346

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V  GLLS+ K   + W+ +A  +   +     +Q   +L LSYN+LPYHLK CFLY G
Sbjct  347   IHVIGGLLSEAKGRRDVWEHVADDVRAAIAGK-DEQFYNVLALSYNHLPYHLKPCFLYMG  405

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
              FP+   EI    L+ +W+ EGF+  +  +SLEE A + L+ L DRNL+++ +    G  
Sbjct  406   AFPE-DHEIRASKLIRIWVAEGFLKSNGDKSLEEIAEENLRVLADRNLLMVREWKSNGKA  464

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             KT  +HDLL DLC+++  ++KF+   +++  NV E G +     Y  R ++   +Y   +
Sbjct  465   KTYGIHDLLRDLCVKKAAEDKFLHVKNRQVHNVPE-GSS-----YFPRRVSVHQSY---R  515

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLI  1836
               D YN  +  +L   F   G +   +      + +++RVL++++I F + PT +I +L+
Sbjct  516   IRDVYNSTEFMSLARSFLCIGLASRVILSPVFFALRLLRVLEVLDIEFHQFPT-EILELV  574

Query  1837  LLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR  2013
              LRYLA      +   +    NLQTLIV                   +    +W+   LR
Sbjct  575   NLRYLAFYCNSEIPSAISRLWNLQTLIVG------------SILRSFELPSEIWEMPELR  622

Query  2014  FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR--------------CTKEFVLKIPNVKVL  2151
              IK+             + +++++Y +P++                    +  +PN+K L
Sbjct  623   HIKFRNS----------RISIYSVYQIPFVHEKLQTISAMSANVLIDSNILGSVPNIKNL  672

Query  2152  GIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTEL  2331
             G     I ++       +L  L KLE L   D         S   FP S+ +L +    +
Sbjct  673   G-----IYSWIPPRTVVDLSLLPKLETLKFSDFCLIDHGHLSEVIFPPSVIKLALRSCTI  727

Query  2332  GWEAITIISMLPNLESLKL----LQAYEM---GEEWVTGDGGFPKLKFLYISGAKLKNWE  2490
              WE I  I  LPNL+ LK+     +  EM    EEW   +G F  L+FL +   KL  W+
Sbjct  728   TWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSDEEWEPTEGEFSSLQFLLLEKLKLVRWK  787

Query  2491  TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYG  2670
                 HFP L  L +  C  LE+IP    DI TL++IEL +C PS+V SA+ IQE+QS  G
Sbjct  788   ADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVASARQIQEDQSENG  847

Query  2671  NDQLVVR  2691
             ND L VR
Sbjct  848   NDGLEVR  854



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score =   392 bits (1006),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 308/945 (33%), Positives = 479/945 (51%), Gaps = 103/945 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  LTS + ++EL      P+L  +  K++I  L +++   +  L + EK ++     
Sbjct  38    MAYAALTSAVCSLELFLQCNHPLLNNLQRKEQILSLCKRILSFQEFLTDYEKIMHKHGGL  97

Query  256   KDVIARVKDISFRAEDEIESEVME--IISNGASHERLHQILQR----LAEDIEGLIEQRN  417
             K +  ++K+ +++ ED ++S++ +  +  N    ++ + +L R      E++E + ++  
Sbjct  98    KLLEEKIKEKTYQVEDIVDSKLRKYFLAKNAKDRKKAYSVLCRRLQVAIEEMELVKKEAM  157

Query  418   TTQ----MLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             T +       +++   S     ++  +  LQ     VG   +L++  + L +  + E  +
Sbjct  158   TIKGDKIRTRNFHTRVSPARRDVSTSSPNLQQQT-PVGFQDDLKKIIDRL-RGDSSELDI  215

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA------  747
             I+IVGM GIGKTT+AK+ ++DPS+  RF +  W T+SQ+Y  R  L DL   V       
Sbjct  216   ITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAWTTISQEYRERDTLHDLFYSVVPPASGS  275

Query  748   -QMTDKEINE----------VKST-----AELANKVRRRLMRQRYLLVVDDIWGSRGWDD  879
              Q +DKE  +           K T      E+A+++ + L  +R+L+VVDD+W +  WD+
Sbjct  276   NQESDKEAADRLYGRLTTQPSKETYEGRNQEMADRLYKSLKGKRFLIVVDDMWSTDAWDN  335

Query  880   LQRCFPDDSNGSRILLTTRLKEVAVYS-GCSGKYVCNLPFLNSNESWMLFSQKL-GSINL  1053
             ++   PDD N SR++LT+RL +VA Y+     +    L FLN +E W L  +KL G    
Sbjct  336   VKMLLPDDDNKSRVILTSRLIDVATYAIANPDRQPHRLNFLNKDEGWELLREKLFGKRGC  395

Query  1054  PPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCST  1233
             P E+E IGK I  KC+GLPLAI V AG LSK  ++ ++W ++A +++  +  +   QC  
Sbjct  396   PFELEVIGKSIAEKCQGLPLAIVVVAGHLSKMSKTPDSWNTVAESVDSVVNRE-PGQCLD  454

Query  1234  ILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKY  1413
             IL LSYN LP HLKACFLY G FP+   EIP   L+ LW+ EGF+      ++EE A   
Sbjct  455   ILALSYNYLPQHLKACFLYMGAFPE-DFEIPVWKLIRLWVAEGFLNATEHTTMEEIAEDC  513

Query  1414  LQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDT  1593
             L+DLIDR LVL  K S  G +KTC++HD++ + CL E +++ F+    + S +V+    T
Sbjct  514   LEDLIDRCLVLAGKRSN-GKLKTCKVHDIMREFCLEEARRKNFLHVL-KSSLDVLSESIT  571

Query  1594  EPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIR  1773
                    N    F +  IQP  S       SR++L  F +S +S         + FK++R
Sbjct  572   TLRRVSINCSTIFSSYSIQPTDS---TVSVSRSIL-GFNISESSIFSY-----IDFKLLR  622

Query  1774  VLDLVEISFDEAPTFDISDLILLRYLALGT-IKYVRVLKHHHNLQTLIVKFPNSCRieei  1950
             VLD+    F + P+ +I  L+ LRYLA+ T  ++  ++    +LQTLI+           
Sbjct  623   VLDITFQHFPQFPS-EIMQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHL---------  672

Query  1951  dsdeeiGSKWLQGLWKSQSLRF--------IKYPYPFPIDTDEIPVQDTLHTLYWVPYLR  2106
                    S     +W   +LR         ++ P     +     V + L TL  +    
Sbjct  673   ---YSRSSTLPWEIWTMPNLRHLHVKPSICLQSPTKVECNRYSSWVLNNLQTLVNITLAD  729

Query  2107  CTKEFVLKIPNVKVLGIKCSEIR------------AFQTETWWD---------------N  2205
             CTK+     P +K LGI C  I              + +E  W                N
Sbjct  730   CTKDVFSSTPKLKKLGI-CESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCFRN  788

Query  2206  LHYLTKLEKLIVEDIESEQFE---LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLE  2376
             L  L +LE L +  ++    E    + +++ P++LK+L +  T L WE++T +  LPNLE
Sbjct  789   LALLPQLEALKIFGLKPPVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLE  848

Query  2377  SLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEK  2556
              LKL      G +W   + GF  LK L I  + L+ W   +DHFP LE L L  C +L+ 
Sbjct  849   VLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDS  908

Query  2557  IPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             IP     I TLQ+IEL +   S V SAK+IQEEQ S GND L VR
Sbjct  909   IPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVR  953



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score =   388 bits (996),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 270/720 (38%), Positives = 391/720 (54%), Gaps = 56/720 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             ++++IVGMGGIGKTT+A++++DD S    FH+  WATVSQ +  R +L  L      +TD
Sbjct  119   EIVAIVGMGGIGKTTLARRVFDDLSTVYNFHVRAWATVSQVFRQRDVLLALLRSTTHVTD  178

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              EI   K+  ELA  + R L  +RYL+V+DDIW +  WDD++ CFPDD N SR+L+TTRL
Sbjct  179   -EIYR-KNNEELAQDLYRSLKGKRYLIVLDDIWNTLAWDDVKLCFPDDENASRLLVTTRL  236

Query  940   KEVAVY-SGCSGKYVCNLPFLNSNESW-MLFSQKLGSINLPPEIEEIGKRIVNKCRGLPL  1113
              +VA Y +  S  ++ NL  LN + SW +L     G  + P ++  IGK I  KC+GLPL
Sbjct  237   SKVAHYVNPNSTPHLMNL--LNLDNSWKLLHGMVFGKESCPLDLVGIGKTIARKCQGLPL  294

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             AI V AGLLS+ +R+ ++W+SIA  ++  + +D  +QC  IL LSYN+LP+HLKACFLY 
Sbjct  295   AIIVIAGLLSRIRRTSDSWKSIADNVSSTVNTD-SEQCIGILALSYNHLPHHLKACFLYM  353

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMK----------YLQDLIDRNLV  1443
             G FP+   EI  K L+ LW+ EGF+ +   R  E  A            +L+DLI RNLV
Sbjct  354   GAFPE-DGEIEVKKLVRLWVAEGFLDKQLPRLAERVAAVSSDREAIAEIFLEDLIGRNLV  412

Query  1444  LISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRW  1623
              ++K SF G  KTC +HDLL +LCLRE ++E F+    +R  + +  G          R 
Sbjct  413   FVAKRSFSGRNKTCHIHDLLRELCLREAQRENFMCLI-KRDIHCLPAGINR------KRR  465

Query  1624  LTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVS-WRQNVSFKMIRVLDLVEISF  1800
             ++F + +     S     H    L+F  G+    G P   +   + FK++RVLD++ +  
Sbjct  466   ISFHSEFCGDLRSVPAIPHVRSFLMFSLGL----GFPADIFLLQLGFKLLRVLDIIFLRS  521

Query  1801  DEAPTFDISDLILLRYLAL-GTIKYVRVLKHHHNLQTLIVKFP---NSCRieeidsdeei  1968
             +  PT  I  L+ LRYLAL  T +    +    NLQTLI+  P   +          E  
Sbjct  522   EHFPT-QILKLVHLRYLALTATYELPASISKLCNLQTLIIHGPWILSENGESPTIFFEYW  580

Query  1969  GSKWLQGLWKSQSLRF-------IKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVL  2127
                WL+ L  + +          I YPYP        P+  TL T+       CT+E   
Sbjct  581   NMPWLRHLGFTVTCSLCIPPIPEINYPYPLA------PILQTLSTIRLT---SCTREVFR  631

Query  2128  KIPNVKVLGIKCS---EIRAFQTETWWDNLHYLTKLEKLIVEDI-ESEQFELQSINSFPQ  2295
              +P ++ L I C    +    +T  +  NL +L  LE L      +++ +     ++FP 
Sbjct  632   SMPYLRRLAI-CETKEDHNTNETSKYLSNLVHLPLLEALKCSFYRDAKPWRTLPWDAFPS  690

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
             +L++L +  + L WE +T IS LP LE LKL     +G EW   +  F  LK L I  + 
Sbjct  691   NLRKLTLSWSYLPWEDMTNISRLPKLEVLKLRNCAFLGPEWEPPEDEFLHLKQLLIENSD  750

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L  W+  + HFP L+RL L +C  LE+IP    +I TL+L+EL +C  S   SAK+I E+
Sbjct  751   LVQWKASTIHFPSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIGEQ  810



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score =   392 bits (1006),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 308/945 (33%), Positives = 479/945 (51%), Gaps = 103/945 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV-VDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  LTS + ++EL      P+L  +  K++I  L +++   +  L + EK ++     
Sbjct  53    MAYAALTSAVCSLELFLQCNHPLLNNLQRKEQILSLCKRILSFQEFLTDYEKIMHKHGGL  112

Query  256   KDVIARVKDISFRAEDEIESEVME--IISNGASHERLHQILQR----LAEDIEGLIEQRN  417
             K +  ++K+ +++ ED ++S++ +  +  N    ++ + +L R      E++E + ++  
Sbjct  113   KLLEEKIKEKTYQVEDIVDSKLRKYFLAKNAKDRKKAYSVLCRRLQVAIEEMELVKKEAM  172

Query  418   TTQ----MLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQV  585
             T +       +++   S     ++  +  LQ     VG   +L++  + L +  + E  +
Sbjct  173   TIKGDKIRTRNFHTRVSPARRDVSTSSPNLQQQT-PVGFQDDLKKIIDRL-RGDSSELDI  230

Query  586   ISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA------  747
             I+IVGM GIGKTT+AK+ ++DPS+  RF +  W T+SQ+Y  R  L DL   V       
Sbjct  231   ITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAWTTISQEYRERDTLHDLFYSVVPPASGS  290

Query  748   -QMTDKEINE----------VKST-----AELANKVRRRLMRQRYLLVVDDIWGSRGWDD  879
              Q +DKE  +           K T      E+A+++ + L  +R+L+VVDD+W +  WD+
Sbjct  291   NQESDKEAADRLYGRLTTQPSKETYEGRNQEMADRLYKSLKGKRFLIVVDDMWSTDAWDN  350

Query  880   LQRCFPDDSNGSRILLTTRLKEVAVYS-GCSGKYVCNLPFLNSNESWMLFSQKL-GSINL  1053
             ++   PDD N SR++LT+RL +VA Y+     +    L FLN +E W L  +KL G    
Sbjct  351   VKMLLPDDDNKSRVILTSRLIDVATYAIANPDRQPHRLNFLNKDEGWELLREKLFGKRGC  410

Query  1054  PPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCST  1233
             P E+E IGK I  KC+GLPLAI V AG LSK  ++ ++W ++A +++  +  +   QC  
Sbjct  411   PFELEVIGKSIAEKCQGLPLAIVVVAGHLSKMSKTPDSWNTVAESVDSVVNRE-PGQCLD  469

Query  1234  ILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKY  1413
             IL LSYN LP HLKACFLY G FP+   EIP   L+ LW+ EGF+      ++EE A   
Sbjct  470   ILALSYNYLPQHLKACFLYMGAFPE-DFEIPVWKLIRLWVAEGFLNATEHTTMEEIAEDC  528

Query  1414  LQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDT  1593
             L+DLIDR LVL  K S  G +KTC++HD++ + CL E +++ F+    + S +V+    T
Sbjct  529   LEDLIDRCLVLAGKRSN-GKLKTCKVHDIMREFCLEEARRKNFLHVL-KSSLDVLSESIT  586

Query  1594  EPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIR  1773
                    N    F +  IQP  S       SR++L  F +S +S         + FK++R
Sbjct  587   TLRRVSINCSTIFSSYSIQPTDS---TVSVSRSIL-GFNISESSIFSY-----IDFKLLR  637

Query  1774  VLDLVEISFDEAPTFDISDLILLRYLALGT-IKYVRVLKHHHNLQTLIVKFPNSCRieei  1950
             VLD+    F + P+ +I  L+ LRYLA+ T  ++  ++    +LQTLI+           
Sbjct  638   VLDITFQHFPQFPS-EIMQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHL---------  687

Query  1951  dsdeeiGSKWLQGLWKSQSLRF--------IKYPYPFPIDTDEIPVQDTLHTLYWVPYLR  2106
                    S     +W   +LR         ++ P     +     V + L TL  +    
Sbjct  688   ---YSRSSTLPWEIWTMPNLRHLHVKPSICLQSPTKVECNRYSSWVLNNLQTLVNITLAD  744

Query  2107  CTKEFVLKIPNVKVLGIKCSEIR------------AFQTETWWD---------------N  2205
             CTK+     P +K LGI C  I              + +E  W                N
Sbjct  745   CTKDVFSSTPKLKKLGI-CESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCFRN  803

Query  2206  LHYLTKLEKLIVEDIESEQFE---LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLE  2376
             L  L +LE L +  ++    E    + +++ P++LK+L +  T L WE++T +  LPNLE
Sbjct  804   LALLPQLEALKIFGLKPPVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLE  863

Query  2377  SLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEK  2556
              LKL      G +W   + GF  LK L I  + L+ W   +DHFP LE L L  C +L+ 
Sbjct  864   VLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDS  923

Query  2557  IPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             IP     I TLQ+IEL +   S V SAK+IQEEQ S GND L VR
Sbjct  924   IPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVR  968



>ref|XP_009589795.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=903

 Score =   389 bits (999),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 324/940 (34%), Positives = 456/940 (49%), Gaps = 107/940 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPIL----VVDYKDEIQCLRQKLCHlkalleesekklNVS  246
             MAY  + SLI+T+EL F    P +    V +  D +    +                 V 
Sbjct  1     MAYAAVNSLIQTLEL-FQRTYPAMINGQVAEMVDSLHANAEYF-----QRILENTSQQVY  54

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEII----------SNGAS---HERLHQILQRLAE  387
             +  KD+   ++     AED +ES ++ I+          +NGA     +    +LQ L +
Sbjct  55    EKIKDLEGGMRAAVQHAEDLLESNIVGILRERYNQQKEKNNGAKWTIQDEARVLLQDLPQ  114

Query  388   ----------DIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIM------VG  519
                       D+  +IE   +    ++Y    S   ++  G +S  + D+ +      VG
Sbjct  115   AIDKIDAMRKDLAKVIESSTSNVNANAYGTSTSQDHYVKPGDSSSPKRDSTVLLQEATVG  174

Query  520   HAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQ  699
                 L      LL  S  ER+VI I+GMGG GKTT+AKK  DD SI SRF +  W T+SQ
Sbjct  175   LDNALTDITNRLLG-SAFEREVIPILGMGGCGKTTLAKKAQDDLSIMSRFDIQVWVTISQ  233

Query  700   DYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDD  879
             +Y LR +L  L   VA    +++    S  +L  K  R L  ++YL+V+DD+W ++ WD 
Sbjct  234   EYHLREVLLSLVCSVAGNKFQDM----SDDQLMEKAYRALKGRKYLIVIDDVWSTKIWDV  289

Query  880   LQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--L  1053
             + R  P+D+NGSRI+LTTRLK+VA Y          +P L+ ++SW L   KL S +   
Sbjct  290   MARILPNDNNGSRIILTTRLKDVAEYVNSDIPPHEMMP-LSLDDSWKLLCDKLLSEDHTC  348

Query  1054  PPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCST  1233
             P E+EEIGK+IV KC+GLPLAI V AG LSK   + E+W ++A  +N  +TS   D+C  
Sbjct  349   PSELEEIGKKIVGKCQGLPLAILVVAGHLSKVGMTKESWATVAKNVNKVVTS-YPDKCLA  407

Query  1234  ILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKY  1413
             +L +SY +LP HLK CFL+ G FP+   EI    L+ LW+ EG +  +  RSLEE A   
Sbjct  408   VLAMSYYHLPIHLKPCFLHLGTFPE-DHEIDAWRLIQLWVAEGILKSNKLRSLEEVAQDC  466

Query  1414  LQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDT  1593
             L+DL  RNLV++++    G IK C +HDLL DL + E  KEKF+        N+I   + 
Sbjct  467   LEDLASRNLVMVTRRKLNGQIKRCGMHDLLRDLSVSEAGKEKFL--------NLIRNINR  518

Query  1594  EPLFEYAN---RWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFK  1764
              P F   N      +    +   KFSD  +    R+L  F  + G +G      +   FK
Sbjct  519   APNFPTHNCKVPRFSLHAHFSLEKFSD--SSQDVRSLYIFKQLLGPTG------RTAEFK  570

Query  1765  MIRVLDLVEISFDEAPTFDISDLILLRYLALGTIK-YVRVLKHHHNLQTLIVKFPN-SCR  1938
              +RVL  +     +      SD   LRYL +         L + +NLQT I K     C 
Sbjct  571   ALRVLVSIPRPIFKYRHCLTSDSAFLRYLEIRRGNDLTESLPYLYNLQTFIFKHDKLKCD  630

Query  1939  ieeidsdeeiGSKWLQGLWKSQSLRFIKYPY----PFPIDTDEIPVQDT--------LHT  2082
                   D          +W  + LR+I   +    P P       V+D+        L  
Sbjct  631   AVLTLPDY---------IWNMKQLRYIHIQHCIHLPNPQSISSTNVEDSRSDLGLQHLQE  681

Query  2083  LYWVPYLRCTKEFVLKIPNVKVLGIKC--SEIRAFQ-TETWWDNLHYLTKLEKLIVEDIE  2253
                + +  CTKE +  + N+K L I     +I   + T     NL YL KLE L    + 
Sbjct  682   FSRLCFASCTKEVLSCLTNLKKLRIANIQEDINGLEGTPGSLINLVYLKKLESLY---LS  738

Query  2254  SEQFELQS----INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWV  2421
              E +EL S      SFP SLK L I    L  E +T+++ LPNLE LKL         W 
Sbjct  739   CEMWELSSPLADSCSFPISLKRLTIFSGRLSCEDMTVLAKLPNLEVLKLRWVEFRPSVWK  798

Query  2422  TGD-GGFPKLKF-LYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQL  2595
               D   F +LKF L +    +K WE  S +FP L RL LH   NL++IP  F +I TL+ 
Sbjct  799   LNDEDQFKQLKFLLLVDNTYIKQWEASSVYFPNLRRLVLHQIRNLKRIPLAFAEICTLES  858

Query  2596  IELKDCFPSLVESAKDIQEEQSSY-GNDQL---VVRDYDT  2703
             IEL  C  +L +SA++IQEE SS  GND L   +  DY T
Sbjct  859   IELYMCSRNLEKSAREIQEEVSSVAGNDCLHIGIYNDYHT  898



>ref|XP_010320708.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=866

 Score =   388 bits (996),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 299/901 (33%), Positives = 474/901 (53%), Gaps = 76/901 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD---YKDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  ++SL++T++ Q L  +  L+ +    K  ++   Q LC L+  LE++  + N  +
Sbjct  1     MAYACISSLMQTLK-QLLRAKSPLICESCIQKQHVESSYQSLCTLQVFLEDTTNEANDIE  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTT  423
               K +  +++D+ ++AED ++S +  +I   N    E+  +      + +E  ++     
Sbjct  60    NLKILENKIRDVVYKAEDRVDSCLTNMILAHNEDDREKACKSFDEELQQVETELDSLRKE  119

Query  424   QMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC---STQERQVISI  594
              ++  ++   S    I     S  ++    VG    +++  + +L C    T+E  VIS+
Sbjct  120   VIVIEFHKRGSKLTEITTTSFSSTEE-TTYVG----MKKDYKAILNCLNAQTKELIVISL  174

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             +GMGGIGKTT+A+K++D+  IR RF    W T+S+ Y+ R++L ++   ++ + ++E+  
Sbjct  175   IGMGGIGKTTLARKVFDNSIIRDRFEKHAWVTISEQYNKRQMLLEVASSISGVNNQEM--  232

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
               S  EL   V R L  +R+L+V+DD+W +  WD ++R F +D+N SRI+LTTRLK VA 
Sbjct  233   --SNDELMVIVYRSLKGRRFLIVIDDLWSTEAWDQMRRIFQNDNNKSRIILTTRLKHVAD  290

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAA  1131
             Y+         + FL+  +SW LF++KL   +  PP++ +IGK I+ +C+GLPL+I V A
Sbjct  291   YASSPDFPPREVSFLSFKDSWKLFTKKLFRKDRCPPQLRKIGKHIIQQCQGLPLSIIVIA  350

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLLSK   + +NW+ I   +N    S L +QC  IL LSYN LP +LKACFLY G FP+ 
Sbjct  351   GLLSKIDVTYDNWKKIEQDLNSFHGSVL-EQCQAILCLSYNYLPPYLKACFLYIGGFPE-  408

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRL  1491
               EI    +++ WI E F+   S   LE  A KY+Q+L+DR+L+L       G  KTC++
Sbjct  409   DMEIRVSKMMSSWIAEQFIKATSDTRLEVVAEKYVQELMDRSLILGKTRKPNGRFKTCKI  468

Query  1492  HDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKY  1671
             HDLL  LC+RE +            ENV+    ++ +  Y+      R   I     D +
Sbjct  469   HDLLRQLCIREAQ-----------IENVVHFPYSDLVSTYSQDINDRRRVMIPFLIDDYF  517

Query  1672  NFH--------KSRTLLFFFGVSGASGLPVS---WRQNVS-FKMIRVLDLVEISFDEAPT  1815
               H        ++R+L+F  G  G S L      W  ++S FK+++VLD  EI +D +P 
Sbjct  518   IDHPSQRSGKIRTRSLIFMGG--GRSYLVPEMNHWPDSISEFKLLKVLDAREIGYDFSPI  575

Query  1816  FDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLW  1995
               I  L+ LRY+    I+    L    NLQT+IV    + +             W     
Sbjct  576   --IRQLVHLRYVD-ARIQDPSSLAKLFNLQTMIVYSRRNVQ--------LPAEIWTMSQI  624

Query  1996  KSQSLRFIKYPYPFPI-DTDEIPV-QDTLHTLYW--VPYLRCTKEFVLKIPNVKVLGIKC  2163
             K   +  +  P PF I D    P+  + L TL     P+L    E + K PNV+ L    
Sbjct  625   KHVDIEQMDMPNPFSIGDQQTQPLFLNNLQTLALDSSPFL---AEILKKTPNVEKL----  677

Query  2164  SEIRAFQTETWW----DNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTEL  2331
              +IR   T   W    D L  L +LEKL +   +       S   + ++LK L++  T L
Sbjct  678   -KIRGANTYNEWFDFVDCLVDLQRLEKLSITASDDNSPCFLSSAFYARNLKHLRLGYTSL  736

Query  2332  GWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYI-SGAKLKNWETMSDH  2505
              WE + +++ LPNLE LK   A+  G  W +  D  F KLK+L I S   L+ WE  +D+
Sbjct  737   PWEEMDVLANLPNLEVLKADSAFN-GTNWTLNEDIVFQKLKYLRIWSADDLERWEATTDN  795

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLV  2685
             FP+LE L L     LE+IP+ F +I TL+ + +++C P++  SA++I EEQ  +GN +L 
Sbjct  796   FPMLEHLVLLDLDELEEIPQSFGEIMTLKFVRVENCNPAVDSSARNILEEQQGWGNCELQ  855

Query  2686  V  2688
             +
Sbjct  856   I  856



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   388 bits (996),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 294/894 (33%), Positives = 464/894 (52%), Gaps = 86/894 (10%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L+ D KD+++ L   L   KA L++S +K +  +  K+++ +++++ + AED I+S V +
Sbjct  23    LITDIKDQVEFLYNDLTLFKAFLKDSTEKRSKHETLKELVKQIRNVVYEAEDAIDSFVAQ  82

Query  328   IISNGASH---ERLHQI-----LQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGG  483
               ++ A     + LH       L+ +  +IE +      T++   Y   +   E +  G 
Sbjct  83    AAAHKARKPLSKALHMFDYPAKLRNVGREIESI-----RTKVKDIYEHKKFGFEIVNVGD  137

Query  484   ASK----------LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAK  633
              S           +++D + VG   E E+    LL   + E QVISIVGM G+GKTT+AK
Sbjct  138   GSNGGTKEKKPPVVEEDNV-VGFEDEAEKVIN-LLTGGSDELQVISIVGMPGLGKTTLAK  195

Query  634   KIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKV  807
              IY +  I   F+   W  VSQDY  + +  ++     Q+TD   ++N+      L+ ++
Sbjct  196   MIYRNSKIEYEFYSRAWVYVSQDYSRKELFLNILSNFTQLTDSMYKMND----ENLSKEL  251

Query  808   RRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCN  987
              + L + +YL+V+DD+W    W+DL+  FP ++  SRIL+T+R+K VA+++  + +   N
Sbjct  252   YKFLEKGKYLIVLDDVWTEEAWNDLKIAFPKNNKRSRILITSRIKRVAIHANPNLE-PHN  310

Query  988   LPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVE  1164
             L FL   ESW L  +K LG+ N P E    G  I N+C+GLPLAI V  G+L   ++  +
Sbjct  311   LRFLTPEESWKLLQRKALGAENCPEEFMRDGMHISNECQGLPLAIVVIGGIL--LEKGTD  368

Query  1165  NWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLN  1344
              W+ +A +++  +  D   +    + LSYN+LPYHLKACF+YFG+FP+   EIP   L+ 
Sbjct  369   WWERVARSVDAYIAMDQDKRVDNFIALSYNHLPYHLKACFIYFGMFPE-DFEIPVWKLVR  427

Query  1345  LWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLRE  1524
             LWI EGF+ ++   S E+ A +YL+DL+ RNLV++ +L   G IKTCR+HD+L + C +E
Sbjct  428   LWIAEGFIQQNQEMSWEDIAEEYLEDLVSRNLVMVGRLRSNGKIKTCRIHDMLHEFCKKE  487

Query  1525  VKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFF  1704
               +E F     +R +    +     L +Y  R L   T  +    S K    + R+ L F
Sbjct  488   AAEENFFQEI-KRFDRGSYVSSNPALEKY--RRLCIHTRVLN-YISSKPEGPRVRSFLSF  543

Query  1705  FGVSGASGLPVSWRQNV--SFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT-IKYV  1875
                S  + LP      +  +FK++RVLD   + F   PT D++ L+ LRY+ L +  K +
Sbjct  544   --SSDETILPTEHNSTIPGAFKLLRVLDARSVIFTRFPT-DLTKLVHLRYIVLSSNFKML  600

Query  1876  -RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP----YPFP  2040
                +    N+QTL+V+   S R+ +I +           +WK   LR +K       P P
Sbjct  601   PEAISSLWNMQTLVVE--TSSRVLDIKA----------DIWKMIQLRHVKTNASTVLPGP  648

Query  2041  I-----DTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET---W  2196
             +       DE+ +  TL TL  V    CT+E   + PN+KVLGI+    +  + +     
Sbjct  649   LSRSRKSKDEVLMSGTLQTLSTVSPESCTEEVFARAPNLKVLGIRGQLGKLLEIKNGSML  708

Query  2197  WDNLHYLTKLEKL-IVEDI------ESEQFELQSINSFPQSLKELKIVGTELGWEAITII  2355
             +D+L  L+ LE L ++ D+      E     L     FP +L++L +  T L W+ ++ +
Sbjct  709   FDSLGRLSHLENLKLINDVFPRPPSEGSLSRLPHPYKFPPNLRKLTLSDTLLEWKDMSTL  768

Query  2356  SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMS-DHFPVLERLAL  2532
              ML NLE LKL      GE W T DGGF  L+ L+I    L  W   S +HFP L  L L
Sbjct  769   GMLENLEVLKLKDNAFKGEWWKTEDGGFRGLRVLHIGRTNLVTWNVASGNHFPRLRHLFL  828

Query  2533  HHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI-------QEEQSSYGN  2673
              HC  L  +P  F D+  LQ++++     S+  SA+ I       Q +QS  GN
Sbjct  829   KHCGYLASLPLVFGDVVCLQVVDIYCTNESVAASARKIEGRKMELQGKQSGRGN  882



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score =   387 bits (995),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 304/939 (32%), Positives = 482/939 (51%), Gaps = 133/939 (14%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD---------------YKDEIQCL---RQKLCHl  204
             MA   + SL+R++E + ++ +P L+ D               ++D ++     RQK C  
Sbjct  1     MANAAVISLVRSLE-ELVQRKPHLISDETRRMVDSVLDSLEYFQDFLESTSKRRQKYCR-  58

Query  205   kalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLA  384
                         V + E+++   V+    +AED IE ++M  I       +    L+ L 
Sbjct  59    -----------KVEELEREIRMEVE----KAEDVIELKIMYGIMKKEGLSK--TFLRTLV  101

Query  385   EDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAG---GASKLQ------DDAIMVGHAQELE  537
               I+   E++   + L  +       +  + G   GA+++Q      ++ ++ GH+    
Sbjct  102   GKIDAPRERKAIRKTLLPFVKKIDAVKRNVMGSSFGANRVQGYDDFTNEDLLPGHSS---  158

Query  538   RTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR  717
             R K      ++++         GGIGKTT+A+K +DD   R RF +  W TVSQ+Y +R 
Sbjct  159   RNKTKGPNVNSRDYPHFR---NGGIGKTTLARKAFDDFETRHRFDIHIWVTVSQEYWIRG  215

Query  718   ILQDLCGCVAQMT--DKEINEVKSTAELANKVR---------------------------  810
             +L ++  C++++T  +K  +E++ T  +  +++                           
Sbjct  216   MLMEILRCISEVTTDEKSNDELRDTISIEYRIKSMLLDNLRHTSDETKKVSNDKLMDLIY  275

Query  811   RRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGC-SGKYVCN  987
             ++L  +RYL+V+DDIW S  WD + R FPDD+NGSRI+LT+R +EVA ++   S  +  N
Sbjct  276   KKLKGRRYLVVMDDIWSSEVWDLMTRIFPDDNNGSRIILTSRQEEVANHADPDSNPHEVN  335

Query  988   LPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSV  1161
             L  LNS+ SW L  +K+  +    PPE++ IG  I  +CRGLPLA+ V AG LSK  R+ 
Sbjct  336   L--LNSDNSWKLLREKVFGVEQACPPELQYIGVEIAQRCRGLPLALLVVAGYLSKISRTR  393

Query  1162  ENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLL  1341
              +W+  A +++  +T++  D C  +L +SYN LP HLK CFLY G+FP+    +    L+
Sbjct  394   VSWEHFAISVSNVVTNE-SDICLGMLAMSYNYLPDHLKPCFLYMGVFPE-DSNVNIVRLI  451

Query  1342  NLWITEGFVMED-SGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCL  1518
             +LWI+EGF+ ++  GR        Y +DL+ RNLV++   SF G  KTC +HDL+ DL L
Sbjct  452   SLWISEGFLSDELEGRD-------YFEDLVSRNLVMVRSRSFSGEAKTCGVHDLIRDLIL  504

Query  1519  REVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLL  1698
             +E +KEKF+       E +           +A+R+ +F +   Q  F    N    RTL 
Sbjct  505   KEAEKEKFLQVTKPSEEKL----------RHAHRY-SFHSRD-QAAFWKLSNI--IRTLN  550

Query  1699  FFFGVSGASG-LPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV  1875
             FF G    S  +P+     VSFK++RVL +++++F   P  +I+ L+ LRYL      ++
Sbjct  551   FFEGFKKLSKQIPLL----VSFKLLRVLAILKVTFQRFP-LEITKLVQLRYLQFTCYDHI  605

Query  1876  R-VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP--YPFPID  2046
                +   +NLQT I+ +  +  +      E         +W+ ++LR +     + FPI 
Sbjct  606   HWSVSELYNLQTFILGYEVAGLLPPTIPVE---------IWQMRNLRHLHIGDFFSFPIP  656

Query  2047  TDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKL  2226
             ++++     L  L  +    CT E    IPN+K L I  + +   + E   ++L  L +L
Sbjct  657   SNKL---QNLQELSCLALTSCTSELFSAIPNLKKLQIVGNYLMEMKREHL-NSLSCLKEL  712

Query  2227  EKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
             E L   D   +   + S+ + P SLK L +  T L WE +  I  LPNLE LK+     +
Sbjct  713   EILKYRDDGIQPSRIPSMYALPTSLKRLTLCFTSLPWEDMANIVKLPNLEVLKIKDNGFL  772

Query  2407  GEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDIT  2583
             G+ W   D   F +LKFL IS   LK+WE  S +FP L+RL L  C NLE+IP+ F +I 
Sbjct  773   GDVWKLNDEEIFNQLKFLLISWTGLKHWEASSVNFPKLQRLFLKRCMNLEEIPQDFGEIC  832

Query  2584  TLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYD  2700
             TL+ IEL DC  S  +S KDI+EEQ S GN+ L V  Y+
Sbjct  833   TLESIELHDCSISAAKSGKDIKEEQESMGNECLCVLIYN  871



>gb|EYU24183.1| hypothetical protein MIMGU_mgv1a021378mg, partial [Erythranthe 
guttata]
Length=828

 Score =   386 bits (991),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 298/885 (34%), Positives = 457/885 (52%), Gaps = 90/885 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             AY  L SL  T++ Q L+P P    ++D ++ I+ LR+++     L   + +    S+  
Sbjct  3     AYGALVSLTHTID-QVLQPPPAHHFIID-RERIESLRERVV--LLLDFLANQSFRRSKEV  58

Query  256   KDVIARVKDISFRAEDEIESEVM-EIISNGASHERLHQILQRLAE-----DIEGLIEQ--  411
             +D+  R+ D S  AED IES    +I +      ++   L+ +       DI  ++E+  
Sbjct  59    EDLEMRITDASNAAEDIIESNARNQIRAKYEFFRKMRSTLKNMVHINVKRDIPMIVEEFV  118

Query  412   ------RN------TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML  555
                   RN      T    S  +P  S+   +  G  +       MVG  + L +   ML
Sbjct  119   FIEKELRNIKDDKVTEDEQSEKSPTVSSPRPLSGGKNT-------MVGFDEHLIQIMSML  171

Query  556   LQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC  735
                   +R++I IVGMGGIGKTT+A  +Y++P I  +F +  W  VSQ+   + IL  L 
Sbjct  172   -ATDESDRRIIPIVGMGGIGKTTLATNVYNNPFIVEKFEVRAWFVVSQECTGKEILLGLL  230

Query  736   GCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGS  915
               V      E+ E+    EL  K+ + L  +RYL+V+DDIW  + W+ + R  PD+ NGS
Sbjct  231   RQVVTTGRNEL-EMNDDDELGEKLHKTLFGRRYLIVMDDIWDIKAWEMVNRFLPDNDNGS  289

Query  916   RILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVN  1092
             RIL+TTRL ++A   G    Y  NL  L  ++SW L  +K+      P E+E IG++I  
Sbjct  290   RILVTTRLMKLASDVGSCTPYQLNL--LEKSQSWDLLREKIFAEGRCPVELEVIGRKIAK  347

Query  1093  KCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHL  1272
             KCRGLPLA+ V  GLL+K++R  ++W+ +   +   + +   + C  IL LSY +LP +L
Sbjct  348   KCRGLPLALVVVGGLLAKSER--DHWKYVEEDLTSSVNNQDDEFCMKILLLSYIHLPIYL  405

Query  1273  KACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLIS  1452
             K CFLYF +FP+   +I    L+ LWI EGF+ +   +SLEE   +YL+DLIDRNL+L+ 
Sbjct  406   KPCFLYFAVFPQ-DIDIKVSWLVRLWIAEGFIRQCKHKSLEEIGEEYLEDLIDRNLILVG  464

Query  1453  KLSFIGNIKTCRLHDLLFDLCLREVKKEKF-VSAFHQRSENVIELGDTEPLFEYANRWLT  1629
             K    G +KT  +HDLL DLC  E +K  F V A   +++   ++     L     RW  
Sbjct  465   KRKISGEVKTYHIHDLLSDLCKSEARKHNFLVFAKLDKTKASSDMLSVRRLIINGGRWKK  524

Query  1630  FRTTYIQPKFSDKYNFHKSRTLL-FFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
                     K     +   +R+ + FF+G S +     S R+   F ++RVLD+V    D 
Sbjct  525   I-------KLRASGSAATTRSFISFFYGNSSS----YSARR---FILLRVLDVV----DR  566

Query  1807  APTFDISDLILLRYLA-LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL  1983
              P  +I  LI  RY+A +G++     +    +LQTL+V    +  IE             
Sbjct  567   YPQHEILKLINSRYVACMGSLSMSSSISRLWSLQTLVVDEELTLPIE-------------  613

Query  1984  QGLWKSQSLRFIK-----YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKV  2148
               +W+   LR +K      P P   +  +I V + L TL  V   +C++E + +IPNVK 
Sbjct  614   --IWQMPQLRHVKAKTISLPDPPSDNAQKITVLENLQTLSTVGEFKCSEEVIKRIPNVKK  671

Query  2149  LGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTE  2328
             LGI CS + +        NL +L KLE L    +  +    +    FP S+K+L +   +
Sbjct  672   LGIVCSTVGSH----CLSNLGFLHKLESL---SLAFDGTIGRGNMVFPSSVKKLCLSECK  724

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHF  2508
             + WE ++I+  LPNL+ LKL     +G++W++ +  F +LKFL I   +L+ WE  S HF
Sbjct  725   IPWEDMSIVGSLPNLQVLKLRSNAAVGQKWISNEEEFVRLKFLLIELRELEIWEADSTHF  784

Query  2509  PVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKD  2643
             P LE L L    NL++IP  F++I  LQ+I+L  C  SL+ SAK+
Sbjct  785   PCLEELHLRTL-NLKEIPSDFSEILPLQVIDLNLCSSSLLTSAKE  828



>ref|XP_009764269.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=903

 Score =   388 bits (996),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 322/934 (34%), Positives = 456/934 (49%), Gaps = 95/934 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDE-IQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  + SLI+T+EL F    P ++     E +  LR    + + +LE +  + +  +  
Sbjct  1     MAYAAVNSLIQTLEL-FQRTYPAIINGQVAEMVDSLRANAEYFQRILENTSHQKHEYEKI  59

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLS  435
             KD+   ++     AED +ES ++  +    + ++      +     E  +  R+  Q++ 
Sbjct  60    KDLEGGMRAAVQHAEDLLESNIVGFLRERYNQQKEKNNGAKWTIQDEARVLLRDLPQVMD  119

Query  436   SYNP--------GQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST-------  570
               +          +S+   I A G S  QD  +  G +   +R   +LLQ +T       
Sbjct  120   KIDAIRKDLAQVMESSTSTINANGPSIRQDHFVKPGDSSSPKRDSTVLLQEATVGLDDAL  179

Query  571   -----------QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRR  717
                         ER+VI+I+GMGG GKTT+AKK  DD SI SRF +  W T+SQ+Y LR 
Sbjct  180   TEITNRLLGSASEREVITILGMGGCGKTTLAKKAQDDLSIMSRFDIQVWVTISQEYHLRE  239

Query  718   ILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
             +L  L   VA    +++    S  +L  K  R L  ++YL+V+DD+W ++ WD + R  P
Sbjct  240   VLLSLVCSVAGNKFQDM----SDDQLMEKAYRALKGRKYLIVIDDVWSTKIWDVMARTLP  295

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEE  1071
             +D+NGSRI+LTTRLK+VA Y          +P L+ N+SW L   KL       P E++E
Sbjct  296   NDNNGSRIILTTRLKDVAEYVNSDIPPHEMMP-LSLNDSWKLLCDKLLVEDHTCPSELQE  354

Query  1072  IGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSY  1251
             IGK+IV KC+GLPLAI V AG LSK   + E+W ++A  +N  +TS   D+C  +L +SY
Sbjct  355   IGKKIVGKCQGLPLAILVVAGHLSKVGMTKESWATVAKNVNKVVTS-YPDKCLAVLAMSY  413

Query  1252  NNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLID  1431
              +LP HLK CFL+ G FP+   EI    L+ LW+ EG +     RSLEE A   L+DL  
Sbjct  414   YHLPIHLKPCFLHLGTFPE-DHEIDAWRLIQLWVAEGILKSSKLRSLEEVAQDCLEDLAS  472

Query  1432  RNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEY  1611
             RNLV++++    G IK C +HDLL DL + E  KEKF+        NVI   +  P F  
Sbjct  473   RNLVMVTRRKLNGQIKRCGMHDLLRDLSVSEAGKEKFL--------NVIRNINRAPNFPT  524

Query  1612  AN---RWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLD  1782
              N      +    +   KFSD       R+L  F  + G +G      +   FK +RVL 
Sbjct  525   QNCKVPRFSLHAHFSLEKFSDLS--QGVRSLYIFKQLLGPTG------RTAGFKALRVLV  576

Query  1783  LVEISFDEAPTFDISDLILLRYLALGTIK-YVRVLKHHHNLQTLIVKFPN-SCRieeids  1956
              +     +      SD   LRYL +     +   L + +NLQT I K     C       
Sbjct  577   SIPRPIFKYRHRLTSDSAFLRYLEIHRGNDFTESLPYLYNLQTFIFKHDKLKCDAVITLP  636

Query  1957  deeiGSKWLQGLWKSQSLRFIKYPY----PFPIDTDEIPVQDT--------LHTLYWVPY  2100
             D          +W  + LR+I   +    P P       V D+        L     + +
Sbjct  637   DY---------IWNMKQLRYIHIQHCIHLPNPQSISSANVVDSKSDLGLQHLQEFSRLCF  687

Query  2101  LRCTKEFVLKIPNVKVLGIKC--SEIRAFQ-TETWWDNLHYLTKLEKLIVEDIESEQFEL  2271
               CTKE +  + N+K L I     +I   + T     NL YL KLE L    +  E +EL
Sbjct  688   ASCTKEVLSCLTNLKKLRIANIQEDINGLEGTPGSLFNLVYLKKLESLY---LSCEMWEL  744

Query  2272  QS----INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGD-GG  2436
              S      SFP SLK L I    L  E +T+++ LPNLE LKL         W   D   
Sbjct  745   SSPLADSCSFPISLKRLTIFSARLSCEDMTVLAKLPNLEVLKLRWVEFRPSVWKLNDEDQ  804

Query  2437  FPKLKF-LYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDC  2613
             F +LKF L +    +K WE  S +FP L RL LH   NL++IP  F +I TL+ IEL  C
Sbjct  805   FKQLKFLLLVDNTYIKQWEASSVNFPNLRRLVLHQIRNLKRIPLAFAEICTLESIELYMC  864

Query  2614  FPSLVESAKDIQEEQSSY-GNDQL---VVRDYDT  2703
               +L +SAK+IQEE SS  GND L   +  DY T
Sbjct  865   PWNLEKSAKEIQEEVSSIAGNDCLHIGIYNDYHT  898



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score =   388 bits (996),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 309/918 (34%), Positives = 468/918 (51%), Gaps = 92/918 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L SL   +E     PRP + +D ++++Q L   L  L+  LE     +  S+   D
Sbjct  3     AYAALLSLRHIIEQIQHHPRPPISLD-QNQVQSLTDNLNFLQKFLEHGYPCVGSSREAID  61

Query  262   VI-ARVKDISFRAEDEIESEVMEIISNGASHER------------------LHQILQRLA  384
             V  +R+ D +  AED IE+ V++ I   ++ +                   L++ L ++ 
Sbjct  62    VFESRIADAAHAAEDIIETWVVDQILAESTAQASKTETWNFVHFLWCCSVDLYRDLDKVI  121

Query  385   EDIEGLIEQRNTTQMLSSYNPGQSNQEHI----IAGGASK----LQDDAIMVGHAQELER  540
             +D+ GLI++      +   N G  +  H+    +AG AS           MVG  + L  
Sbjct  122   QDM-GLIKK--DVMEIKESNIGIEDHLHMNPSSLAGAASSRSPLTTKQETMVGFDELLIE  178

Query  541   TKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRI  720
               + L    +  R +I IVGMGGIGKTT+A+  Y  P I   F +  W T+SQ Y+++ I
Sbjct  179   VMDKLTGQQSNLR-IIPIVGMGGIGKTTLARNSYAKPLIVHHFDVRAWVTISQHYNVQDI  237

Query  721   LQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPD  900
             L ++  CV++   +EI   KS  EL+ +V + L  +RYL+V+DDIW    WD +Q  FPD
Sbjct  238   LIEILLCVSKYESREILSGKSEGELSERVHKSLWGRRYLIVMDDIWSIEVWDRVQIFFPD  297

Query  901   DSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEI  1074
             +  GSR+++TTRL  V       G +   + FLN  +SW L  + +     + P E+EEI
Sbjct  298   NGQGSRVMITTRLSNVVF--QLIGSHGLVMDFLNEYKSWELLRKSIFEKKEDCPFELEEI  355

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK+I   C+GLPL+I V  GLL+K+K + E W+ I+  +N  +  + +++C  +L LSYN
Sbjct  356   GKKIAKNCKGLPLSIVVIGGLLAKSKPTREYWEYISENLNSIVHLEENERCLKVLHLSYN  415

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
             +LP HLK CFLY G+FP+  + I    L+ +W+ EGF+   SG+SLE  A +YL+DL DR
Sbjct  416   HLPVHLKPCFLYMGVFPE-DKNIRVSWLVKVWVCEGFLKSISGKSLEAAAREYLEDLCDR  474

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA  1614
             NL+L+ +    G IK C++HDL+ +LCLRE +KEKF+        N+ + G         
Sbjct  475   NLILVHQRGLNGGIKFCKIHDLVRELCLREAEKEKFIYVRRPHDLNIPQ-GIIN------  527

Query  1615  NRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV-----SFKMIRVL  1779
                 T R   I    S+K    ++R  L    +  A  L V  RQ V      F+++RVL
Sbjct  528   ----TRRRISIHQSASEKEYLPQARHALECMPL--ARSLIVG-RQGVLPSLNYFRLLRVL  580

Query  1780  DLVEISFDEAPTFDISDLILL---RYLALGTIK-----YVRVLKHHHNLQTLIVKFPNSC  1935
             + V+   ++   F +  +  L   R++A+ + +     +   +    NLQTLIVK  ++ 
Sbjct  581   NAVDKYLNDH-VFSLEAVFQLVNSRFIAITSDRDQNADFPSSINLLWNLQTLIVKERDAF  639

Query  1936  RieeidsdeeiGSKWLQGLWKSQSLRFIKY-----PYPFPIDTDEIPVQDTLHTLYWVPY  2100
                E              +WK   LR +++     P P P+D  +  V   L TL  +  
Sbjct  640   APSE--------------IWKMTQLRHVQFNQLEMPDP-PLDGKDEYVLGNLRTLSRIRN  684

Query  2101  LRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK----LIVEDIESEQFE  2268
              +C +E V +IPN+  L I   E     +    DNL  L KLE         +  +    
Sbjct  685   FKCGEEVVKRIPNINKLQISYHEQFDGCSSYCLDNLVRLHKLESFGCFFFTWNRPNRDDV  744

Query  2269  LQSINSFPQSLKELKIVGTELGWEAI-TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPK  2445
             L++    P SLK+L +  T L WE + T I +LPNL+ LKL     +G EW T +G F  
Sbjct  745   LRNF-ILPNSLKKLTLHRTNLYWEDMKTKIGLLPNLQVLKLKANSFVGTEWETVEGQFCN  803

Query  2446  LKFLYISG-AKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS  2622
             LKFL I   + L+ W T S HFP LE+L L H   LE+IP    +I TLQ I ++ C  +
Sbjct  804   LKFLQICDCSDLERWTTESAHFPRLEQLDLRHLDRLEEIPSDIGEIPTLQSIRVQYCSKT  863

Query  2623  LVESAKDIQEEQSSYGND  2676
              V SA+ I +EQ  + N+
Sbjct  864   AVISARRILDEQEEFDNN  881



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   388 bits (996),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 280/790 (35%), Positives = 406/790 (51%), Gaps = 89/790 (11%)
 Frame = +1

Query  493   LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFH  672
             L+ +  MVGH  E E  ++ L + ++ E +V+SIVGMGGIGKTT+A KIY DP I S F 
Sbjct  139   LELENTMVGHETEFEMLQDQLTRGAS-ELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  197

Query  673   LLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDD  852
             +   ATVS +Y  R +L  L   ++  T  E  + +   +LA+++++ L   RYL+V+DD
Sbjct  198   IRAKATVSLEYRARNVLLGLLFSISGKT-YEFYDQQDVGQLADRLQKLLKGGRYLVVIDD  256

Query  853   IWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQ  1032
             IW +  WDD++ CF D +NGSRILLTTR  +VA Y+  SGK    +  LNSNESW L   
Sbjct  257   IWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYAS-SGKPPFQMRLLNSNESWNLLCG  315

Query  1033  KLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTS  1209
             K+        E + IGK I  KC GLPLAITV AGLLSK  +++  WQS+A  ++  +++
Sbjct  316   KVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAGLLSKIGKALHEWQSVADNVSSVVST  375

Query  1210  DLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRS  1389
             D+  QC  +L LSY+ LP HLK CFLYF IFP+    I    L+ LW  EGF+  +  +S
Sbjct  376   DVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPE-DELIFVDKLVELWAAEGFLKVEEMKS  434

Query  1390  LEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSE  1569
             +EE A KY++DLIDR+L+ I  L+F G I++C +HD+  +LCLRE +   FV        
Sbjct  435   IEEVAEKYIKDLIDRSLIFIHNLNFDGKIESCGMHDVTRELCLREARNVNFV--------  486

Query  1570  NVIELGDTEPLFEYANRWLTFRTTYIQPKFS-----------DKYNFHKSRTLLFFFGVS  1716
             NVI   D +   E +  + +     I  + +           D Y  ++ R+++ F G  
Sbjct  487   NVIGENDDQNPLEQSMHFSSNGQGRISIQLNQVFHGIIEKSLDMYPNNEVRSIICFKG--  544

Query  1717  GASGLPVSW--RQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-----------  1857
                    +W  ++++ FK++R+LDL  +     P+  I DLI LRYLAL           
Sbjct  545   -------TWFVQKSLRFKLVRILDLALVRCGTFPS-GILDLIHLRYLALTLSPAVEKYIG  596

Query  1858  ----GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLR----  2013
                  +I     +     LQT I+ FP+  R +       I    +  + + + LR    
Sbjct  597   KEIPSSIDIPPSISSLCYLQTFILNFPHLKRWQWERPYPFILPSEILAMQQLRHLRLDWN  656

Query  2014  FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI--------KCSE  2169
             +++Y  P       + + +  H   W P+  CT       PN+K L I         C  
Sbjct  657   YLRYHEP---TEKSLILTNLQHLSGWNPWY-CTSSVFRLFPNLKKLQIHGIAEDFYSCRN  712

Query  2170  IRAF----QTETWWDNLHY-LTKLEKLIVEDIESEQFE----------------LQSINS  2286
             I  F    Q E    +L+Y    +    ++   S+                   L   + 
Sbjct  713   IYDFRCLDQLEELEFHLYYNYLPVRPFFLKSRPSDYLRFTGRKRPHSGTLRPLLLPPADV  772

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYIS  2466
             FPQ+LK+L    T L W  ++I+  LP LE LKL     +GE W   D GFP LK L + 
Sbjct  773   FPQNLKKLAFSRTFLRWNDLSIVGKLPKLEVLKLTYRACIGEAWEVVDEGFPSLKLLLLE  832

Query  2467  GAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
                 + W    DHFP LERL L  C  L+ IP+ F DI TL LI+++ C  S+  SAK I
Sbjct  833   DLDFEYWRASCDHFPCLERLFLERCRFLDSIPQDFADIITLSLIDIRRCKESVGNSAKQI  892

Query  2647  QEE-QSSYGN  2673
             Q++ Q +Y +
Sbjct  893   QQDMQDNYAS  902



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score =   386 bits (992),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 293/902 (32%), Positives = 465/902 (52%), Gaps = 79/902 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQ---CLRQKLCHlkalleesekklNVSQ  249
             MAY  L+SL+ T++ Q L+ +  L+      IQ    L Q LC L+  LE +  ++   +
Sbjct  1     MAYAALSSLMHTLQ-QLLQSKSPLICTGNTSIQHVESLYQDLCDLQVFLENTTIEVKDIE  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEII--SNGASHERL-----HQILQRLAEDIEGLIE  408
               K +  ++KD+ ++AED I+S +  II   NG     +     ++ LQ++ +++  L +
Sbjct  60    DVKALEEKIKDVVYKAEDRIDSSLRSIILLDNGDDDREMACNVFNEELQQVEKEVCFLKQ  119

Query  409   QRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC---STQER  579
             +    +        +  +            ++  +VG   +L      +L C    T+E 
Sbjct  120   EVMVIKFDKHIGFSKLPESTTFPSSRKSTIEEKTVVGMKDDLNS----ILNCINAHTKEL  175

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
              VIS+VGMGGIGKTT+A K++DD  IRS+F    W T+SQDY+ R++L ++   +  +  
Sbjct  176   IVISVVGMGGIGKTTLASKVFDDSMIRSQFDKHAWVTISQDYNKRQMLLEIVSSITGIYQ  235

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             + +    S  +L + V + L  +R+L+V+DD+W +   D ++R FP+D N SRI+LTTRL
Sbjct  236   ENM----SNDKLLDTVYKGLKGRRFLIVIDDLWSTEALDLMRRIFPNDHNKSRIILTTRL  291

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLA  1116
             K VA Y+        ++ FL+ ++SW LF+++L   +  PP++E IGK I+ +C+GLPL+
Sbjct  292   KTVADYASSPDFPPHDMSFLSLDDSWNLFTERLFKKDPCPPQLEVIGKHIIQQCQGLPLS  351

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             I V AGLL    R+ +NW+ I   +N        ++C  IL+LSYN LP +LKACFLY G
Sbjct  352   IVVIAGLLGNIGRTPDNWKKIEENLN-SFFGKASEKCQAILSLSYNCLPQYLKACFLYIG  410

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
              FP+   EI    L++ WI E F+   S   LE  A +YLQ+L DR+L+L+      G I
Sbjct  411   SFPE-DMEIHVSKLISSWIAEHFIKARSNTRLEVVAEEYLQELTDRSLILVRGRRANGRI  469

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             K C++HDLL  +C+RE +            ENV+   + +      +         IQ  
Sbjct  470   KICKIHDLLRQMCIREAQ-----------IENVVHFTNNDISDGINDHRRVIIPYLIQDY  518

Query  1657  FSDKYNFHK----SRTLLFF----FGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAP  1812
             F D  N       +R+L+F     + V+G    P S      FK+++VLD  EI FD + 
Sbjct  519   FRDHPNHRNGKITTRSLIFLGRQSYEVTGIYYWPYSIS---DFKLLKVLDAHEIGFDFSR  575

Query  1813  TFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
                I  L+ LRY+    +     L    NLQ++I+         +  + +     W    
Sbjct  576   I--IPQLVHLRYVD-ARVNDPSSLAKLFNLQSIII-------YSQKKNVQLPTEIWTMSE  625

Query  1993  WKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEI  2172
              +   +  +  P P PI    +   + LHTL  V       + + +IPN+  L  K +++
Sbjct  626   IERVDITAVDMPNP-PIGEQPL-FMNNLHTLA-VKSSAVVLKILRRIPNLNKL--KINDV  680

Query  2173  RAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS--------FPQSLKELKIVGTE  2328
             R  +TE W+  L  L  L+ L+  +I++      S+NS        F  +L +L +  T 
Sbjct  681   R--RTE-WYAFLDCLIVLQGLVTLNIQAAA----SLNSPFFLSRDIFLPNLTKLSLNSTF  733

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWETMSDH  2505
               WE + +++ LPNLE LK   A+  G +W +  D  FPKL  L +    L+ WE  SD+
Sbjct  734   FPWEDMAVLAKLPNLEVLKADNAF-WGTDWKLDEDVVFPKLNCLAVRHGNLERWEATSDN  792

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLV  2685
             FP+LE L L   H LE+IPE   +I TL+ IE++ C  +++ SAK I+E Q  YGN +  
Sbjct  793   FPMLEELYLSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITSAKQIRENQEIYGNYEFQ  852

Query  2686  VR  2691
             +R
Sbjct  853   LR  854



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score =   385 bits (990),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 287/843 (34%), Positives = 443/843 (53%), Gaps = 112/843 (13%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEII---SNGASHE----RLHQILQRLAEDIEGLIEQRNTTQ  426
              R+   + ++ED IE  + + I    N  S +    +L+  L+   E+I+ ++++ N  +
Sbjct  56    VRITTAANQSEDTIERHISDQILSLQNSESSDLYWLKLYGSLRESMEEIDSILKEVNQVK  115

Query  427   ML---------SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST-QE  576
                         S++P            A K ++D ++VG  ++  + K  L  C   + 
Sbjct  116   SSSSASKEHSSGSFSPRL----------APKRKNDTVVVGLDEDAMKLKGRL--CGEFKN  163

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              Q I IVGMGG+GKTT+A+ +YDDP I   F +  W T+S +Y +R+IL DL   +  ++
Sbjct  164   LQTIPIVGMGGVGKTTLARYVYDDPLIVHHFDVRVWVTISLNYSIRQILLDLVSFIG-VS  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             +KE+++  + A L   V + L R+RYL+V+DD+W +  +DD++  FPDDSNGSRI++TTR
Sbjct  223   NKELHKFDTDALLVAYVYKYLKRRRYLIVMDDLWNTNVFDDVRMIFPDDSNGSRIVVTTR  282

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLP  1110
               +VA Y+  SG++   +  +N ++SW L  +K+     + PPE+E+IGK IV  CRGLP
Sbjct  283   QLDVASYADPSGRF-HRVELMNMDQSWNLLREKVFANREHCPPELEQIGKLIVENCRGLP  341

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHD-QCSTILTLSYNNLPYHLKACFL  1287
             LAI V AG+L +  ++ + W++IA   N+    D  D Q   IL+LSY  LP+ L+ CFL
Sbjct  342   LAIVVIAGVLREANQTQDTWRNIAR--NVKGAFDGSDEQFMEILSLSYTYLPHCLRPCFL  399

Query  1288  YFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI  1467
             Y G FP+   EI    ++ LW  EGFV  +  ++ EE A +YL+DL  R+LVL+ K  F 
Sbjct  400   YMGGFPE-DHEISASKVIKLWAAEGFVKPNGSKNQEEVAEEYLEDLAKRSLVLVVKKRFN  458

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYI  1647
             G IK  ++HDLL DLCLR+ ++E F+   ++ S       D+  + E + R   F  +YI
Sbjct  459   GRIKAVKIHDLLRDLCLRKAREENFLHVINEFS------VDSLKVIEKSRRLSIF--SYI  510

Query  1648  QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDIS  1827
                F +  +  +  +LL F           SWR   SF ++RV+D + +  D  P  DI 
Sbjct  511   LGGFPE-VDCSRIHSLLLF-----QHEALHSWR---SFSLLRVVDALSVILDFYPD-DIF  560

Query  1828  DLILLRYLALGTIKYVRVLKHHH-----------NLQTLIVK-------FPNSCRieeid  1953
             +L  LRYLA  T  Y    K HH           NL+TLI++       F  +C +    
Sbjct  561   ELFHLRYLAF-TFDYTD--KRHHYEIPKSFSKLENLRTLIIRQFNGFYGFRTTCCMPFE-  616

Query  1954  sdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKI  2133
                         +W+   LR +     F  D    P  +T           C +   L +
Sbjct  617   ------------IWRMTQLRHLILLDGFLPD----PCSET-----------CLE--TLAL  647

Query  2134  PNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDI--ESEQFELQSINSFPQSLKE  2307
              N++ L    S I+   ++   +NL +L KLE+L    +  +  + +L     FP ++K+
Sbjct  648   ENLQTL----SNIQEEWSKYCLNNLVHLHKLEELKFHAMPHDYHRSDLSRNLVFPLTMKK  703

Query  2308  LKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNW  2487
             L + G  L WE++TI+  LPNLE LKL +    G +W T +G F +LK L +     + W
Sbjct  704   LTLSGCNLPWESMTIVGSLPNLEVLKLKKGAFRGLKWETTEGEFCRLKVLVMDRTDPRIW  763

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSY  2667
              T S HFP LE L L  C+ L +IP    +I TL+ I++  C  S+ ESAK IQEE  S+
Sbjct  764   ITESSHFPTLEVLVLRKCYTLSEIPYSICEIQTLEQIKVDCCNSSIGESAKRIQEEVQSF  823

Query  2668  GND  2676
             GN+
Sbjct  824   GNE  826



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   386 bits (992),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 297/914 (32%), Positives = 471/914 (52%), Gaps = 74/914 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVV-DYKDEIQCLRQKLCHlka---lleesekklNVS  246
             M Y  + SLI+T++ Q ++ +P  V+ D +  ++ L   + + +          ++ +  
Sbjct  1     MGYAAVISLIQTLK-QVMQQKPRWVIGDTRKMVESLLDSVGYFQNFLESSCNIRRQDSCK  59

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQ  426
             Q  +++   ++     AE+ IE  + E         RL    Q + +D+  L+E+ +  +
Sbjct  60    QQFEELEREIRIAVNEAENVIELNIYEFNQLERCRSRLGLSRQPICDDLPPLLEKIDAVK  119

Query  427   ----MLSSYNPGQSNQEHIIAGGAS-----KLQDDAIMVGHAQELERTKEMLL--QCSTQ  573
                 M +S     +  + ++   +S      +  + ++VG   +L +    L+   C   
Sbjct  120   RKILMQNSSIISSTKVDSLLGLDSSSRHIVNMSLENVVVGLEDDLMKIMRRLIGPPCG--  177

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
              R+V+SI+GM GIGKTT+AKK Y  P IR+RF +  W T+SQ+Y +R +   +  C+  +
Sbjct  178   -REVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWVTISQEYRIRDLWLSILSCIPHI  236

Query  754   TDK-------EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
             ++        EINE  +  +L + + ++L  +RYL+V+DDIW    WD + R FPDD+NG
Sbjct  237   SETYPMDVRDEINE-STDDQLMDMIYKKLKCRRYLVVMDDIWSKEIWDLMTRIFPDDNNG  295

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRI  1086
             SRI+LT+R ++VA ++    K    +  LNS+ SW L   K+  +    PPE+E+IGK++
Sbjct  296   SRIILTSRHEQVAKHADPDSK-PHKMSLLNSDNSWKLLKGKVFGVEHVCPPELEDIGKQV  354

Query  1087  VNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPY  1266
               KC+GLPLA+ V AG LSK   + + W  +A  ++  + S+  D+C  ++ +SY+ LP 
Sbjct  355   AQKCQGLPLALLVVAGHLSKISTTRKCWNDVAKTISKIVASE-PDKCLGVVAMSYSYLPD  413

Query  1267  HLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVL  1446
             HLK+ FL    FP+   E+    L+ LWI +GF+  +  +SLEE   ++L+DLI RNL++
Sbjct  414   HLKSSFLSMAAFPE-GFEVEIHRLIQLWIADGFLRNERVKSLEEIGKEWLEDLISRNLIM  472

Query  1447  ISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL  1626
             + K  F G +KTC +HDL+ DL LR+ +KEKF+     R   VI   +      Y  R+ 
Sbjct  473   VIKRRFNGEMKTCGVHDLVRDLILRQAEKEKFMQV--TRIHKVIRRFNDSACKPYVRRY-  529

Query  1627  TFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISF  1800
             +F +T I P  +D +N   S  RTL  F G+   S L         FK++RVL +++ +F
Sbjct  530   SFHST-ISP--TDCWNSSSSFTRTLYLFNGLKLVSPLSKQVPFLARFKLLRVLAILQYTF  586

Query  1801  DEAPTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
              E P  +++ L+ LRYL       + R +   +NLQ L+                   S 
Sbjct  587   REFP-LELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLVFG---------------GHSN  630

Query  1978  WLQGLWKSQSLRFI------KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPN  2139
                 +WK + LR +       +  P   +     +Q+ L  L  +    CTK      PN
Sbjct  631   LPVDIWKMKLLRHLHVRKISSFRVPSSKEGSGFKLQN-LEGLSDISISCCTKGLFTGFPN  689

Query  2140  VKVLGI-----KCSEIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSL  2301
             +K L I     +C     FQT    +NL  L KLE L I+   +     L S  + P SL
Sbjct  690   LKRLKIHGAWAECRRDMIFQT---LNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSL  746

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKL  2478
             K L +  T L WE +  I  LPNL+ LK+      G+ W +     F +LKFL I    L
Sbjct  747   KRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNL  806

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             K+W+  S +FP L+RL L  C  LE+IP+   +I TL+ IEL +C  S+ +S K+IQEEQ
Sbjct  807   KHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQ  866

Query  2659  SSYGNDQLVVRDYD  2700
              S  ND L VR ++
Sbjct  867   ESMANDILSVRIHE  880



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score =   387 bits (993),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 301/920 (33%), Positives = 477/920 (52%), Gaps = 83/920 (9%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVV-DYKDEIQCLRQKLCH----lkalleesekklNV  243
             MAY  + SLI+T++ Q ++ +P  ++ D +  I+ L     +    L+      +   N 
Sbjct  1     MAYADVVSLIQTLK-QLMQQKPRWIIGDTRKMIESLLDSAGYFQDFLEKTYMRRQVFGNS  59

Query  244   SQAEKDVIARVKDISFRAEDEIESEVMEIISNGASH-ERLHQILQRLAEDIEGLIEQ---  411
              + E+ +   V D+    E+ IE ++ E   N   H  R+    Q L +D+  L+E+   
Sbjct  60    EELERVIRIAVNDV----ENVIELKMHEY--NLLKHCSRVGLPRQPLCDDLLPLVEKIDF  113

Query  412   -RNTTQMLSSYNPGQSNQEHIIAGGASK----LQDDAIMVGHAQELERTKEMLLQCSTQE  576
              +       + N    ++++++   +S+    L  + ++VG   +L +    L       
Sbjct  114   VKRKMMRFVTLNEDLPSRDYLLGHSSSRRVASLNLENVVVGLEDDLLKVMRRLTG-PPSS  172

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
             R+++SI+GMGGIGKTT+AKK+Y  P +R+RF +  W T+SQ+Y  R +L  +  C+ Q+ 
Sbjct  173   REIVSILGMGGIGKTTLAKKVYHHPEVRNRFDVHIWITISQEYQTRDLLLGILACIFQLK  232

Query  757   DKEINEV-----------KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD  903
             ++  NE             S  +L + + ++L  +RYL+++DDIW    WD + R FPDD
Sbjct  233   NEVQNETYRLAVGDEIKESSDDQLMDMIHKKLKYRRYLVIMDDIWSKGIWDLMTRIFPDD  292

Query  904   SNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSIN--LPPEIEEI  1074
             +NGSRI+LT+R KEVA ++         +  LNS+ SW L   K+ GS +   P E+E+I
Sbjct  293   NNGSRIILTSRHKEVAEHADPDSN-PHEMSLLNSDNSWKLLHDKVFGSQHDVCPCELEKI  351

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK++  KC+GLPLA+ V AG LSK  R+ E W  +A  ++  ++S+  D+C  +L +SY+
Sbjct  352   GKQVAQKCQGLPLALLVVAGHLSKISRTRECWDDVAKTISKIVSSE-PDKCLGVLAMSYS  410

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
              LP+HLKACFL  G+FP+    I T+ L+ LW+ EGF+  +  +S+E+   + L+DLI R
Sbjct  411   YLPHHLKACFLSIGVFPE-DFVIATERLIQLWVAEGFLRHERLKSMEQVGKECLEDLISR  469

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA  1614
             NL+L+ K  F G + TC +HDL+ DL LR+ +KEKF+     R+ +VI          + 
Sbjct  470   NLILVRKRRFNGELITCGVHDLVRDLILRQGEKEKFLKV--TRTHDVITRFIDTASKPHV  527

Query  1615  NRWLTFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGA----SGLPVSWRQNVSFKMIRV  1776
             +R+    +++ +    D +N   S  RTL  F G+  A      +P   R    FK++RV
Sbjct  528   HRY----SSHSRISQGDCWNSTSSLTRTLYLFNGLKHALRPSKQIPFLAR----FKLLRV  579

Query  1777  LDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeid  1953
             L ++  +F + P  +I+ L+ LRYL       ++  +   +NLQ LI +           
Sbjct  580   LAILHYTFQDFP-LEITKLVHLRYLEFNCHDDLQCSVSELYNLQNLIFR-----------  627

Query  1954  sdeeiGSKWLQGLWKSQSLRFIKY----PYPFPIDTDEIPVQDTLHTLYWVPYLR---CT  2112
                   S     +WK + LR ++      +P P  T        L  L  +  L    C+
Sbjct  628   ----RHSDLPVEIWKMKLLRHLEVKKISSFPVPSSTYTTGSSSKLQNLEVLSDLSISCCS  683

Query  2113  KEFVLKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLEKLIVE-DIESEQFELQSIN  2283
              E   + PN+K L +  +  E R        ++L+ LT+LE L ++   +     L S  
Sbjct  684   NEMFTRTPNLKRLKLHGAWEECRRDTISQTLNSLYCLTELEILKIKCSRKLYPHPLPSKY  743

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG-FPKLKFLY  2460
               P SL  L +  T L WE +  I  LPNL+ LK+      G+ W   D   F +LKFL 
Sbjct  744   VLPNSLMRLTLRCTYLPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLL  803

Query  2461  ISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAK  2640
             I    LK W+  S +FP L+ L L  C  LE+IP+   +I TL+ IEL +C  S  +S K
Sbjct  804   IDRTNLKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVK  863

Query  2641  DIQEEQSSYGNDQLVVRDYD  2700
             +IQEEQ S GND L VR +D
Sbjct  864   EIQEEQESMGNDCLSVRIHD  883



>gb|AEW48196.1| disease resistance protein RGH7 [Solanum chacoense]
Length=914

 Score =   387 bits (994),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 312/963 (32%), Positives = 481/963 (50%), Gaps = 167/963 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E+  I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEELTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q   T+  +    P  S+     EH         Q + IMVG   E E T++ L++   
Sbjct  108   KQWMATSDSMKDQKPQTSSLVSLPEHAFE------QPENIMVGRENEFEMTRDQLVR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP+I SRF +   ATVSQ+Y +R +L  L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVRNVLLALLSSTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRIL+T
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILMT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +N  +SW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPLHMRPMNFVKSWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVTAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +  R I    L++LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  L
Sbjct  389   CFLYFAIFAEDER-IYVNRLVDLWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNL  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I  C +HD+  +LCLRE +   FV+    +S+        +  F+  +R     +
Sbjct  448   SFDGKIGRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRI----S  503

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF  1818
              Y + + +   N  ++ +++   G +  +         +SFK+++VLDL        P F
Sbjct  504   IYKEEELAWCRN-SEAHSIIMLRGFNYVT-------LELSFKLVKVLDL---GLTRCPIF  552

Query  1819  --DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSKW  1980
                +  LI LRYL+L    +   LK +      + + I+  P S                
Sbjct  553   PSGVLSLIHLRYLSLC---FCPCLKQYRGSKEAVPSSIIDIPLS----------------  593

Query  1981  LQGLWKSQSLR-FIKYP--YPF--PIDTDEIP----------------------VQDTLH  2079
             +  L   Q+ + ++ +P  YPF  P++   +P                      +  +L 
Sbjct  594   ISSLCYLQTFKLYLPFPNNYPFILPLEILTMPQLRKLCMNWNYLRSHEPTENRLILKSLQ  653

Query  2080  TLYWVPYLRCTKEFVLKIPNVK---VLGIK--------------------------CSEI  2172
              L  +    CT  F    PN+K   V G+                           CS +
Sbjct  654   CLNQLNPRYCTGSFFRLFPNLKKLHVFGVPEDFRNHKDLYDFRYLYQLEKLTFSSCCSSV  713

Query  2173  RAF------QTETWWDNLHYLTKL--------EKLIVEDIESEQFELQSINSFPQSLKEL  2310
               F         T  D L + TKL        +     D+ +    L   ++FPQ+LK L
Sbjct  714   ACFLKNTAPSGSTPQDPLRFQTKLLYKKTPFGKAAPPADVPT--LLLPPPDAFPQNLKSL  771

Query  2311  KIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNW  2487
                G   L  + ++I+  LP LE LKL     +GEEW   + GFP LKFL++    ++ W
Sbjct  772   TFSGEFFLASKDLSIVGKLPKLEVLKLSANAVIGEEWEVVEEGFPHLKFLFLDNVYIRYW  831

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSS  2664
                SDHFP LERL L +C++L+ IP  F DITTL LI++  C  S+V SAK IQ++ Q +
Sbjct  832   RASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVVNSAKQIQQDIQDN  891

Query  2665  YGN  2673
             YG+
Sbjct  892   YGS  894



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score =   385 bits (990),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 295/910 (32%), Positives = 467/910 (51%), Gaps = 93/910 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILV----VDYKDEIQCLRQKLCHlkalleesekklNVS  246
             MAY  L+SL+ T++ Q L+ +  L+       +  ++ L Q LC L+  LE +  ++   
Sbjct  1     MAYAALSSLMHTLQ-QLLQSKSPLICTGDTSIQQHVESLYQDLCDLQVFLENTTMEVKDI  59

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEII--SNGASHE-RLHQILQRLAEDIEGLIEQRN  417
             +  K +  R+KD+ ++AED I+S +  II   NG     R  +      + +E  +    
Sbjct  60    EDVKVLEKRIKDVVYKAEDRIDSSLGSIILLDNGDDDRVRACKAFNEELQQVEKEVCFLK  119

Query  418   TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQE----------LERTKEMLLQC-  564
                M+  +N      +HI   G SKL + A     +++          ++     +L C 
Sbjct  120   KEVMVIKFN------KHI---GFSKLPESATSFPSSRQSTTEEKTVVGMKDDLNTILNCI  170

Query  565   --STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCG  738
                T+E   IS+VGMGGIGKTT+A+K++DD  IRS+F    W T+S+DY+ R++L D+  
Sbjct  171   NAQTKELIAISVVGMGGIGKTTLARKVFDDSMIRSQFDKHAWVTISEDYNKRQMLLDVVS  230

Query  739   CVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSR  918
              +  +      E+ S  +L   V + L  +R+L+V+DD+W +  W+ ++R FP+D N SR
Sbjct  231   SITGIN----QEIMSNDKLMETVYKGLKGRRFLIVIDDLWSTEAWNLMRRIFPNDYNKSR  286

Query  919   ILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNK  1095
             I+LTTRLK VA ++  S     ++ FL+ ++SW LF+++L   +  PP++E  GK I+ +
Sbjct  287   IILTTRLKNVANHASSSDFPPHDMSFLSLDDSWNLFTERLFKKDPCPPQLEVTGKHIILQ  346

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             C+GLPL+I V +GL+   +R+ +NW+ I   +N        +QC  IL+LSYN LP +LK
Sbjct  347   CQGLPLSIVVISGLIGNIERTHDNWKKIEENLN-SFFGTASEQCQAILSLSYNYLPQYLK  405

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
             ACFLY G FP+   EI    L++ WI E F+   S   LE  A +YLQ+L DR+L+L+  
Sbjct  406   ACFLYIGSFPE-DMEIRVSKLISSWIAEQFIKARSNTRLEVVAEEYLQELTDRSLILVGG  464

Query  1456  LSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR  1635
                 G IKTC++HDLL  +C+RE + E  V      + N +  G  +            R
Sbjct  465   RRANGRIKTCKIHDLLRQMCIREAQIENVV----HFTNNYVSDGIND-----------HR  509

Query  1636  TTYIQPKFSDKYNFH--------KSRTLLFFFGVSGASGLPVSWRQNVS-FKMIRVLDLV  1788
                I     D +  H         +R+L+F    S        W  ++S FK+++VLD  
Sbjct  510   RVIIPYLIQDYFRDHPEHRNGKITTRSLIFLGRQSYVVTGIYYWPYSISDFKLLKVLDAH  569

Query  1789  EISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
              I FD +    I  L+ LRY+    +     L    NLQT+I+         +  + +  
Sbjct  570   AIGFDFSRI--IPQLVHLRYVD-ARVNDPSSLAKLFNLQTIII-------YSQKKNVQLP  619

Query  1969  GSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKV  2148
                W     K   +  +  P P P+    + + + LHTL  V       + +   PN+  
Sbjct  620   TEIWTMSEIKHVDITDVDMPNP-PLGEQPLFLNN-LHTLA-VKSSAVVLKILRSFPNLNK  676

Query  2149  LGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS--------FPQSLK  2304
             L  K +++R+ +   W   L  L  LE L+  +I++      S+NS        F  +L 
Sbjct  677   L--KINDVRSTE---WNAFLDCLLVLEGLVTLNIQAAA----SLNSPFFLSKDIFLPNLA  727

Query  2305  ELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLK  2481
             +L +  T   WE + +++ LPNLE LK   A+  G +W +  D  FP+LK+L +    L+
Sbjct  728   KLSLNSTFFPWEDMAVLAKLPNLEVLKADNAF-WGTDWKLDEDVVFPELKYLGVHHGNLE  786

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
              WE  SD+FP+LE L L   H LE+IPE   +I TL+ IE+KDC  +++ SA+ I+E Q 
Sbjct  787   IWEATSDNFPMLEELNLSWLHFLEEIPESIGEIMTLRSIEIKDCNSAVITSAEQIRENQE  846

Query  2662  SYGNDQLVVR  2691
              YGN +  VR
Sbjct  847   IYGNYEFQVR  856



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score =   386 bits (992),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 297/914 (32%), Positives = 471/914 (52%), Gaps = 74/914 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVV-DYKDEIQCLRQKLCHlka---lleesekklNVS  246
             M Y  + SLI+T++ Q ++ +P  V+ D +  ++ L   + + +          ++ +  
Sbjct  1     MGYAAVISLIQTLK-QVMQQKPRWVIGDTRKMVESLLDSVGYFQNFLESSCNIRRQDSCK  59

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQ  426
             Q  +++   ++     AE+ IE  + E         RL    Q + +D+  L+E+ +  +
Sbjct  60    QQFEELEREIRIAVNEAENVIELNIYEFNQLERCRSRLGLSRQPICDDLPPLLEKIDAVK  119

Query  427   ----MLSSYNPGQSNQEHIIAGGAS-----KLQDDAIMVGHAQELERTKEMLL--QCSTQ  573
                 M +S     +  + ++   +S      +  + ++VG   +L +    L+   C   
Sbjct  120   RKILMQNSSIISSTKVDSLLGLDSSSRHIVNMSLENVVVGLEDDLMKIMRRLIGPPCG--  177

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
              R+V+SI+GM GIGKTT+AKK Y  P IR+RF +  W T+SQ+Y +R +   +  C+  +
Sbjct  178   -REVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWVTISQEYRIRDLWLSILSCIPHI  236

Query  754   TDK-------EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
             ++        EINE  +  +L + + ++L  +RYL+V+DDIW    WD + R FPDD+NG
Sbjct  237   SETYPMDVRDEINE-STDDQLMDMIYKKLKCRRYLVVMDDIWSKEIWDLMTRIFPDDNNG  295

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRI  1086
             SRI+LT+R ++VA ++    K    +  LNS+ SW L   K+  +    PPE+E+IGK++
Sbjct  296   SRIILTSRHEQVAKHADPDSK-PHKMSLLNSDNSWKLLKGKVFGVEHVCPPELEDIGKQV  354

Query  1087  VNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPY  1266
               KC+GLPLA+ V AG LSK   + + W  +A  ++  + S+  D+C  ++ +SY+ LP 
Sbjct  355   AQKCQGLPLALLVVAGHLSKISTTRKCWNDVAKTISKIVASE-PDKCLGVVAMSYSYLPD  413

Query  1267  HLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVL  1446
             HLK+ FL    FP+   E+    L+ LWI +GF+  +  +SLEE   ++L+DLI RNL++
Sbjct  414   HLKSSFLSMAAFPE-GFEVEIHRLIQLWIADGFLRNERVKSLEEIGKEWLEDLISRNLIM  472

Query  1447  ISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL  1626
             + K  F G +KTC +HDL+ DL LR+ +KEKF+     R   VI   +      Y  R+ 
Sbjct  473   VIKRRFNGEMKTCGVHDLVRDLILRQAEKEKFMQV--TRIHKVIRRFNDSACKPYVRRY-  529

Query  1627  TFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISF  1800
             +F +T I P  +D +N   S  RTL  F G+   S L         FK++RVL +++ +F
Sbjct  530   SFHST-ISP--TDCWNSSSSFTRTLYLFNGLKLVSPLSKQVPFLARFKLLRVLAILQYTF  586

Query  1801  DEAPTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
              E P  +++ L+ LRYL       + R +   +NLQ L+                   S 
Sbjct  587   REFP-LELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLVFG---------------GHSN  630

Query  1978  WLQGLWKSQSLRFI------KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPN  2139
                 +WK + LR +       +  P   +     +Q+ L  L  +    CTK      PN
Sbjct  631   LPVDIWKMKLLRHLHVRKISSFRVPSSKEGSGFKLQN-LEGLSDISISCCTKGLFTGFPN  689

Query  2140  VKVLGI-----KCSEIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSL  2301
             +K L I     +C     FQT    +NL  L KLE L I+   +     L S  + P SL
Sbjct  690   LKRLKIHGAWAECRRDMIFQT---LNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSL  746

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKL  2478
             K L +  T L WE +  I  LPNL+ LK+      G+ W +     F +LKFL I    L
Sbjct  747   KRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNL  806

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             K+W+  S +FP L+RL L  C  LE+IP+   +I TL+ IEL +C  S+ +S K+IQEEQ
Sbjct  807   KHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQ  866

Query  2659  SSYGNDQLVVRDYD  2700
              S  ND L VR ++
Sbjct  867   ESMANDILSVRIHE  880



>ref|XP_006365693.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=1113

 Score =   391 bits (1005),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 304/906 (34%), Positives = 473/906 (52%), Gaps = 70/906 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD--YKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  L+SL+ T+E Q L+P    +     +  ++ L Q L  L+  L+++ K +   + 
Sbjct  1     MAYAALSSLMYTLE-QLLKPNQSFLCPCCTQQHLESLNQNLSALQDFLDDTTKDI---ET  56

Query  253   EKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAE--DIEGLIEQRNTTQ  426
              K V  R++++ ++ ED ++S +  I+      +R         E   +E  +   N   
Sbjct  57    LKVVEKRIRNVVYKVEDRVDSSLRNILRADREDKRQKACTSFYEELLKVEQQVYFLNKEV  116

Query  427   MLSSYNPGQSNQEHIIAGGASKLQ---DDAIMVGHAQELERTKEMLLQCSTQERQVISIV  597
             ML  +N   S    +    +S  +   ++  +VG   +     + L    T E  VI I 
Sbjct  117   MLVEFNNHGSKSAELARTSSSPEKSTIEENTVVGMEDDFNTILDRL-TAQTDELIVIPIF  175

Query  598   GMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEV  777
             GMGG+GKTT+A+K YDD SIRSRF    W T+S++Y+ R +L ++   +        N+ 
Sbjct  176   GMGGLGKTTLARKAYDDSSIRSRFDKHAWVTISEEYNAREMLLEVVSSITGS-----NQE  230

Query  778   KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVY  957
             +S  +L   V R L  +R+L+V+DDIW +  W+ +QR FP+D N SRILLTTRLK VA Y
Sbjct  231   RSNDQLMEIVYRGLKGRRFLIVIDDIWSTEAWEQMQRIFPNDDNKSRILLTTRLKYVADY  290

Query  958   SGCSGKYVCNLPFLNSNESWMLFSQKLGSINL-PPEIEEIGKRIVNKCRGLPLAITVAAG  1134
               C         FL+ ++SW LF++KL   +L PP + EIGK IV +C+GLPL++ V AG
Sbjct  291   FSCPDFLPHCKSFLSLDDSWNLFTEKLFKKDLCPPLLVEIGKHIVQQCQGLPLSVIVVAG  350

Query  1135  LLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVR  1314
             LL K   + +NW+ +   +N      + ++C +ILTLSY+ LP +L+ACFLY G FP+  
Sbjct  351   LLGKMDPTYDNWKKVEENLN-SFFGTVSERCQSILTLSYSYLPQYLRACFLYVGGFPE-D  408

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
             +EI    L+ LWI E FV   S   LE  A +YL++LIDR+++L  K    G +++C++H
Sbjct  409   KEINVSKLIRLWIAEHFVRARSNIRLEVVAEEYLEELIDRSIILTCKQRANGRMRSCKIH  468

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYN  1674
             DLL  LCL E   E  V   +      +E  D +            R   +  K  +K+ 
Sbjct  469   DLLRQLCLSEAHTENVVDVMNGNVLVSLEAIDDQ------------RRVIVLSKLEEKHV  516

Query  1675  FHKSRTLLFFFGVSGASGLPVSWRQNVS-FKMIRVLDLVEISFDEAPTFDISDLILLRYL  1851
             +  S T  F    S     P     +VS FK+++VLD++ +  D   T  I +L+ LRY+
Sbjct  517   YRTSITRTFISMQSFGLDFPKEICSSVSQFKLLKVLDVLSVWNDF--TCVIPELVHLRYV  574

Query  1852  ALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPY  2031
             A   ++   + K   NLQT+I++  +   +E+              +W    +R++    
Sbjct  575   AARIMQGFSLAK-LRNLQTIILQITHVKELEDPL-----------DIWTMSEIRYLDIRL  622

Query  2032  PF----PIDTDEIPVQDTLHT--LYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET  2193
             P     P++ ++    + LHT  LY+ P++    E + + PN+K L I        +   
Sbjct  623   PLYISNPLEAEQPLFLNNLHTLFLYYSPFV---AEIIRRTPNLKKLKISDRS----EHPD  675

Query  2194  WWDNLHYLTKLEKLIVEDIESEQF----ELQSINSFPQSLKELKIVGTELGWEAITIISM  2361
             W   ++ L+ LE L    I +EQ      + S  + P +LK+LK+ GT + WE + +++ 
Sbjct  676   WPPIMNSLSLLEGLETLHIATEQTITGRMIFSGCNLPPNLKQLKLSGTSIPWEDMNLLAN  735

Query  2362  LPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYI-SGAKLKNWETMSDHFPVLERLALH  2535
             LPNLE LK   A+  G  W +  D  F KLK+L + +   L+ WE  SD+FP+LE+L L 
Sbjct  736   LPNLEVLKGSHAF-TGTVWKLNEDVVFSKLKYLRLYACGDLQRWEAGSDNFPMLEQLLLR  794

Query  2536  HCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTRS*I  2715
                 LEKIPE   +I TL+LI++ DC   +  SA +IQEEQ   GN +L VR   T+   
Sbjct  795   ELDELEKIPESIGEIMTLKLIQIDDCSSFVETSATEIQEEQERVGNYELQVRIKRTK---  851

Query  2716  LGAPVQ  2733
             L  P+Q
Sbjct  852   LERPLQ  857


 Score =   116 bits (290),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 122/221 (55%), Gaps = 13/221 (6%)
 Frame = +1

Query  2053  EIPVQDTLHTL--YWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKL  2226
             E P+Q   H L    +P+     E + +  N+K L I    +   +   W D L  L  L
Sbjct  853   ERPLQVDTHYLTKLSLPHYPFVAEMMRRTSNLKELKI----LHKSKHPDWPDILDSLRLL  908

Query  2227  EKLIVEDIESEQ-----FELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLL  2391
             EKL   D+ +EQ       + S + FP SLKELK+  T + WEA+ +++ LPNLE+   +
Sbjct  909   EKLETLDLGAEQTINDQIMIFSGDIFPPSLKELKLARTFIPWEAMNLLTNLPNLEAFMGV  968

Query  2392  QAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEG  2568
              A++ G +W +  D  FPKLK+L I    L  WE  S++F +LE+L L   + LE+IPE 
Sbjct  969   DAFD-GTDWTLNEDIVFPKLKYLRILFGCLARWEAGSNNFLMLEQLLLDGLYELEQIPES  1027

Query  2569  FTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
               DI TL+LI++  C   +  SAK IQ+EQ S GN +L V+
Sbjct  1028  IGDIMTLELIKIDRCGSGVETSAKKIQQEQQSQGNYELQVQ  1068



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score =   387 bits (993),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 320/950 (34%), Positives = 483/950 (51%), Gaps = 134/950 (14%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPI--LVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  + SL+R +EL      P+  L+ D+K+E   L++K+     +  ++ +K N ++ 
Sbjct  1     MAYASIASLMRMIELLLTSKSPMQSLICDHKEEFLTLQRKVS-SLEVFLKNFEKSNDTEK  59

Query  253   EKDVIARVKDISFRAEDEIESEVME-IISNG-----ASHERLHQILQRLAEDIEGLIEQR  414
                + A++KD++   E  I+  + E +++N        H+RL   L+++AEDI+ +   +
Sbjct  60    MAYLEAQIKDVTNAVEHTIQLRLTEAVMANDEMHKEKEHKRLFNSLKQVAEDIDHV---Q  116

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
             N +  +  YN     Q   +    ++                         + + +VISI
Sbjct  117   NESPNIQDYNTVSLYQRKWLLEKLTQYD----------------------GSSDLKVISI  154

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             +GMGGIGKTT+AK++YD  SIR  + +  W TVSQ Y+++ IL+ L    + M  +   +
Sbjct  155   IGMGGIGKTTLAKEVYDYESIRFHYDVRAWTTVSQQYNVKDILESLLH--STMGSQFYTD  212

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
              K   ELA+++R+ LM +RYL+V+DD+W S  WDD++ CFP  +N SRILLTTR KEVA 
Sbjct  213   DK--LELADRLRKSLMGKRYLIVMDDMWNSNAWDDVRHCFPCCNNRSRILLTTRNKEVAY  270

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVA  1128
             Y+G     +  +  ++ +ESW L ++ +  +N  LP E E IGK+I+  C GLPLAI V 
Sbjct  271   YAGTENLSL-QMDLMDPDESWNL-AKSMVFVNEALPYEFETIGKQIIEYCTGLPLAILVI  328

Query  1129  AGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPK  1308
             +GLLS++KR++E+W++IA  +   +T D +++   +L L YN+L   LKAC LYFGIFP+
Sbjct  329   SGLLSRSKRTIEDWENIAEDVVSFVTKDPYERYRHVLGLCYNHLTSDLKACLLYFGIFPE  388

Query  1309  VRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN-IKTC  1485
                EI  K L+  W+ EGF+   S + +E  A K LQDL+DR+LVL+ K    G  I++C
Sbjct  389   -DTEISVKSLVRFWMAEGFL--KSEKDVEREAEKCLQDLLDRHLVLVWKKRLDGTKIRSC  445

Query  1486  RLHDLLFDLCLREV------------------------------------KKEKFVSAFH  1557
             ++HDL+ +LCLRE+                                     KE    AF 
Sbjct  446   KVHDLIHELCLRELAQSQDIFVMKDIVFDKSYEDDDLDEGDDSGGDGDSDAKEAQSHAFS  505

Query  1558  QRSENVIELGDTEPLFEYANRWLTFRT--TYIQPKF---------SDKYNFHKSRTLLFF  1704
                 N+     T  +  +  RW   R     + P+           D Y   K    +F 
Sbjct  506   PECHNL----STHKMHPF-KRWTDDRMCLALLTPEHDHMISRQTDDDDYTLLKRTRSIFS  560

Query  1705  FGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL---GTIKYV  1875
             F ++    L     + + F ++R+LDL        P   +  LI LR+LAL   G   YV
Sbjct  561   FCLNSTFTLN---SELIHFSLLRILDLGTTKLRSFPPHVLC-LIWLRFLALSGFGEDFYV  616

Query  1876  RV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL------RFIKYPYP  2034
                +    NLQTLIVK+   C              + + +W+   L      +F     P
Sbjct  617   PPEIYRLWNLQTLIVKW--RCPRY---------ETFTEKIWELMQLSQLRLHKFYLSNPP  665

Query  2035  FPIDTDEIPVQ-DTLHTLYWVPYLRCTKEFVLKIPNVKVLGI--KCSEIRAFQTETWWDN  2205
                D +E  +    +H++  +    CTKE +  I NVK L I    ++   FQ    +DN
Sbjct  666   RESDNEESYLAFSNIHSISGLSPSSCTKEVISGIRNVKKLVIHGHANDYEIFQESRLFDN  725

Query  2206  LHYLTKLEKLIVEDIE---SEQFELQ-----SINSFPQSLKELKIVGTELGWEAITIISM  2361
             L +L +LE L  E      SE + +      S  +FP +L++LK+  T + WE + I+  
Sbjct  726   LVHLHQLETLSFEFRRWGSSENWRISPATIPSAKAFPVTLRKLKLKSTYVRWEDLNIVGE  785

Query  2362  LPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHC  2541
             LPNLE LKL+    +GEEW   +GGF +LK L I    LK W+   D+FPVLERL   HC
Sbjct  786   LPNLEVLKLMWKACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATDDNFPVLERLLFRHC  845

Query  2542  HNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              +LE+IP  F  I +LQLIEL +C   L  SA  IQEEQ   G   + VR
Sbjct  846   RSLEEIPIVFAYIDSLQLIELTNCTTELEASAVRIQEEQEELGIKPVDVR  895



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score =   391 bits (1005),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 278/775 (36%), Positives = 402/775 (52%), Gaps = 47/775 (6%)
 Frame = +1

Query  391   IEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQD-DAIMVGHAQELERTKEMLLQCS  567
             ++  ++ +   +M++  N   SN    I     +  + D I+VG   EL    E L +  
Sbjct  362   VQASMQIQPIKEMITKINDESSNAHTSIGSMPLRHSNKDDIVVGLDDELVSLLEGLTRVP  421

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA  747
             +   ++++I+GMGGIGKTT+A+K +        F+   W TVSQ Y +R +L  L GC+ 
Sbjct  422   SA-LEIVTILGMGGIGKTTLARKAFRHSYTEYHFYCRAWITVSQVYQVRDLLLGLLGCLG  480

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
               TDK +   K+ A+LA  V R L  QRYL+V+DDIW    W+D++RCFPDD  GSRILL
Sbjct  481   HSTDKLVE--KNDAQLAEVVYRSLKGQRYLIVMDDIWSIDAWNDVKRCFPDDKTGSRILL  538

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQ-KLGSINLPPEIEEIGKRIVNKCRG  1104
             T+R+ E+A Y        C +  L++ +SW L  +   G  + PPE+E+ GK I  +C+G
Sbjct  539   TSRITELASYINAKKPPHC-MSLLDTEQSWELLEKLVFGIASCPPELEKCGKLIAKRCQG  597

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAI V AG+LS+  ++ + W + A  +   ++++  ++C  IL LSYN LP+HLKACF
Sbjct  598   LPLAIVVMAGVLSRVVKTYDCWNNFAEKVCAIISTN-PEECLDILALSYNYLPHHLKACF  656

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             L+   FP+   EI  + L+NLW  EGF+   S  +LE+ A +YL+DLI RNLV I K  F
Sbjct  657   LHMAAFPE-DCEIEVQKLINLWAAEGFLDPQSSENLEQVAEEYLEDLIGRNLVFIEKECF  715

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTY  1644
              G +KTCRLH+ L +LCLRE +KE F+    +R      +G         +R L+F    
Sbjct  716   GGKVKTCRLHNFLRELCLREAQKEDFMHVMQKRGTKRSRVG-----LRNQHR-LSFHLDP  769

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDI  1824
                  +     H S  + F     G + +P      + FK++RVLD+  + FD  P   I
Sbjct  770   YSDVAAAPGIPHVSSFMCFTL---GTNIVPNILFFQLGFKVLRVLDIFFLHFDYFPA-RI  825

Query  1825  SDLILLRYLAL-GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKS  2001
               LI LRYLAL  T +    +    NLQTL++  P  CR      +       L   W  
Sbjct  826   LKLIHLRYLALSATYELPASVSQLRNLQTLVIHGPWHCR------ESGSSPTLLLEYWSM  879

Query  2002  QSLR--------FIKYPYPFPIDTDEIP---VQDTLHTLYWVPYLRCTKEFVLKIPNVKV  2148
              SLR        ++K P   P    E+P   V   + TL  +    CTKE    +P++K 
Sbjct  880   PSLRHLQCSVTIYLKNP---PGANSELPQLFVPKNVQTLSTIKISCCTKEVFSVMPHLKK  936

Query  2149  LGIKCSE--IRAFQTETWWDNLHYLTKLEKL----IVEDIESEQFELQSINSFPQSLKEL  2310
             L I  +E      +      NL YL +LE L      + +E+ Q      ++ P SL++L
Sbjct  937   LEICETEEDCGICEPSVLLGNLQYLKELETLECCFYKQRVEARQISF--FSALPCSLRQL  994

Query  2311  KIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE  2490
              +  + L WE  ++I MLP LE LKL      G +W     GF +L  L I    L +WE
Sbjct  995   SLSWSYLPWEDTSLIGMLPRLEVLKLKHFAFHGPKWEPKTKGFCRLTHLLIENTDLVHWE  1054

Query  2491  TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
                 HFP L+ L L  C  LE+IP    +I TLQ IEL  C  +    A++IQE+
Sbjct  1055  ATVHHFPRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILAREIQEQ  1109



>gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythranthe guttata]
Length=887

 Score =   385 bits (990),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 301/900 (33%), Positives = 462/900 (51%), Gaps = 76/900 (8%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L S++  +E   L P P + +D + +I+ L + +      LE   + ++       
Sbjct  3     AYAALISVMNIIEQIKLHPHPPISLD-QIQIEPLVKNVTFFLDFLECYSQLISSKDTYHL  61

Query  262   VIARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTTQMLS  435
             + +R+ + ++  +D IES +++ I  +N AS +  +  L+ + ++++ +  ++   QM  
Sbjct  62    LESRIANATYAVQDIIESHIVDQIHGANIASDKEFYNCLKEVIQEMDFI--KKEVMQMKE  119

Query  436   SYNPG----QSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGM  603
             + N G    + +    I    S+L      VG    +E   +ML       RQ+I IVGM
Sbjct  120   N-NMGLFLHKDSSTVDIGPLRSRLTGQNATVGFDDVMEEMMDMLTG-RQSTRQIIPIVGM  177

Query  604   GGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKS  783
             GGIGKTT+A+ +Y    I   F +L WAT+SQ+Y ++ IL ++  C+     KE      
Sbjct  178   GGIGKTTLARNLYVSRLIVRHFDMLAWATISQEYSMKGILLEILLCIKSQESKETYSAMR  237

Query  784   TAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSG  963
               EL   + + L+ +RYL+++DD+W    W+ ++  FPD++NGSRI++TTRL+ VA  S 
Sbjct  238   EDELGLVLHKTLIGRRYLIIMDDMWSIEAWELVKFFFPDNNNGSRIIVTTRLRIVA--SQ  295

Query  964   CSGKYVCNLPFLNSNESWMLFSQKL-GSINLPP-EIEEIGKRIVNKCRGLPLAITVAAGL  1137
              +      + FL+ + SW L  + + G  + P  E+EEIGK I   C+GLPL+I V  GL
Sbjct  296   LTDSRGIEMSFLDDHHSWNLLCRNVFGEQDCPNLELEEIGKEIAKSCKGLPLSIVVIGGL  355

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG-IFPKVR  1314
             L+K+ R+ E W+ +   ++  +  + +++C  IL +SY++L  HLK CFLY G +FP+  
Sbjct  356   LAKSARTREYWEYVLENISSIVNLEDNERCLRILNMSYDHLSVHLKPCFLYLGSVFPEDD  415

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
             + I    L+ LW+ EGF+   SG+S+E  A +YL DLI+RNL+L+      GNIK C +H
Sbjct  416   K-IHVSWLIKLWVAEGFLKPKSGKSMELVAEEYLNDLIERNLILVHTRGSTGNIKLCNIH  474

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYN  1674
             DLL DLCLR+ +KE FV          I+      +    N   T       P+      
Sbjct  475   DLLRDLCLRQAQKENFVCVTRLHGIPQIDTHRRVCIHRMDNEEYT-------PQLMSNSA  527

Query  1675  FHK---SRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE--ISFDEAPTFD-ISDLI  1836
             F     +R+L+  F       LP      ++ KM+RVL   +  + + E  + + I  L+
Sbjct  528   FQSPSLTRSLIIDF----KEVLPY-----LNTKMLRVLKSNDRALYYGETSSVEAIFRLV  578

Query  1837  LLRYLALGTIKYVRVLKHHH------NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWK  1998
              LRYLA   + ++ +  H        NLQTLIV                  +K    +WK
Sbjct  579   NLRYLAF-RVDWMSISNHLSSLHLLWNLQTLIV-------------YGAWKTKAPPEIWK  624

Query  1999  SQSLR---FIKYPYPFP----IDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI  2157
                LR   FI    P P     D + I V + L TL  +   +C +E V +IPN+K L +
Sbjct  625   MHQLRHIEFIMLDLPDPEMDGRDRNGITVLENLQTLLQLRNFKCGEEVVKRIPNIKKLQV  684

Query  2158  KCSEIRAFQTETWWDNLHYLTKLEKLIV------EDIESEQFELQSINSFPQSLKELKIV  2319
                 +         +NL  L KLE L        + I+   + LQ++N FP SLK+L + 
Sbjct  685   YYENLDDLSCYC-LNNLCRLEKLESLGCIFAPEEKPIKIRSYLLQNLN-FPNSLKKLSLD  742

Query  2320  GTELGWEAITI-ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG-AKLKNWET  2493
              T L WE +++ I  LP L+ LKL      G+EW T +G F  LKFL I G  +L+ W T
Sbjct  743   RTCLSWEDMSVKIGSLPLLQVLKLYTDAFKGDEWETVEGQFCNLKFLLIEGCGELRCWRT  802

Query  2494  MSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
              S HFP LE+L L     LE+IP G  +I TL+ I LK C  S V SAK+I +EQ  YGN
Sbjct  803   ESSHFPCLEQLFLRDLDELEEIPWGIGEIPTLETIVLKYCSDSAVFSAKEILDEQEEYGN  862



>gb|EYU24163.1| hypothetical protein MIMGU_mgv1a019941mg, partial [Erythranthe 
guttata]
Length=843

 Score =   384 bits (987),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 299/896 (33%), Positives = 460/896 (51%), Gaps = 86/896 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDY-KDEIQCLRQKLCHlkalleesekklNVSQAE-  255
              Y  L SL  T++ Q L P P    ++ +D+I CLRQK+  L   LE+++        E 
Sbjct  4     TYAALVSLTHTID-QILNPPPHHHFNFDRDQINCLRQKVDFLIDFLEKNQSSTGGDHKEI  62

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQM-L  432
             +D+  R++ ++  AE  IE  VM  I  G+  +R  +    L+E ++  I+  ++ +  L
Sbjct  63    EDLETRIRVVAEGAEYIIEDNVMNHILAGSEVDRSVET-STLSEGVQTSIQDFDSIEEEL  121

Query  433   SSYNPGQSNQEHIIAGGASKLQ---------DDAIMVGHAQELERTKEMLLQCSTQE--R  579
                       ++ I   AS               IMVG    +    E++   ST E  R
Sbjct  122   VRIEKDHVQHKNSITTEASLSSSSSRPLLPIGKNIMVGFDGHV---NEIMGALSTDESNR  178

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             Q+I IVGMGGIGKTT+A  +Y +P I   FH+  W TVSQ+Y  + IL  L   +     
Sbjct  179   QIIPIVGMGGIGKTTLATHVYTNPFIVQHFHVRAWFTVSQEYTKKEILLGLLHKINNKNS  238

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              + +++    EL +K+ + L  ++YL+V+DD+W    W+ +    PD++NGSRIL+TTRL
Sbjct  239   NDAHDMNDEDELGDKLHKTLFGRKYLIVMDDMWDINAWEMINMFLPDNNNGSRILVTTRL  298

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLA  1116
               +A+  G    Y  N  FL+  +SW L SQK+      P E+E IG+ I  KCRGLPLA
Sbjct  299   LRLAMDIGSCRPYQLN--FLDEEQSWDLLSQKIYADKCCPVELEVIGRSIAKKCRGLPLA  356

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             + V  G+L+K+K   ENW+ I   +   + +   +    IL LSYNN+P +LK CFLYF 
Sbjct  357   LVVIGGVLAKSK--TENWKYIEEDVTSAVRNQDDEFYMKILLLSYNNMPIYLKPCFLYFA  414

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             +FP+    I    L++LW+ EGF+ +   +SLEE   +YL+DLIDRNLVL+   S  G +
Sbjct  415   VFPE-DYTIKVSKLVSLWVAEGFIRQCGHKSLEENGNEYLEDLIDRNLVLVDWRSISGEV  473

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIE-LGDTEPLFEYANRWLTFRTTYIQP  1653
             ++CR+HDLL +LC  E +K+ F+      + N +  L  T+ L     +W   + T   P
Sbjct  474   RSCRIHDLLSNLCRTEAQKDNFILTRKLYNPNTLSYLKITQRLNINGGKWKGMKLT---P  530

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDL  1833
               S        R+LL  F    ++   V         ++RVL+ V    D  P  +I  L
Sbjct  531   DTSPV----PIRSLL-CFSPEDSNDYTVD-----QVGLLRVLNGV----DRYPIHEILQL  576

Query  1834  ILLRYLA-LGTIKYV-RVLKHHHNLQTLIV----KFPNSCRieeidsdeeiGSKWLQGLW  1995
             I LRY++ +G +  +   +    +LQTLIV      P+                    +W
Sbjct  577   INLRYVSCMGPMTAMSSSISRLWSLQTLIVDGELNLPSE-------------------IW  617

Query  1996  KSQSLRFIKYPY-----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIK  2160
             +   LR ++        P P D   I +   L TL  V  L+CT+  + +I N+K  GI 
Sbjct  618   QMPQLRHVEATRIHLADPPPDDVKNIILLQNLQTLSTVIDLKCTEAVIKRILNIKKFGII  677

Query  2161  CSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWE  2340
             C    +     +  NL +L KLE+L ++        +     FP SLK L + G ++ WE
Sbjct  678   CPTFGSI----FLRNLGHLHKLEELYLQCTPCGGDVV-----FPNSLKRLILRGCKIPWE  728

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++++  LPNLE+L L     +G++W++ +G F +LKFLYI   +L+ WE  + HFP LE
Sbjct  729   DMSVVGSLPNLEALTLWTNAVVGQKWISKEGEFTRLKFLYIYECELEIWEADNTHFPCLE  788

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS--LVESAKDIQEEQSSYGNDQL  2682
              L+L +  NL++IP  F +I +LQ I   DC  +  L+ SA +I E++ + G + L
Sbjct  789   ILSLGYL-NLKEIPSEFAEILSLQAINF-DCNSNNDLLLSANEISEQRENLGYNAL  842



>gb|EYU21830.1| hypothetical protein MIMGU_mgv1a001060mg [Erythranthe guttata]
Length=899

 Score =   385 bits (989),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 302/912 (33%), Positives = 463/912 (51%), Gaps = 80/912 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlk----alleesekklNVSQ  249
             AY  L SL   +E   L PRP + + +++++  L   L  L+              + ++
Sbjct  3     AYAALLSLKHIIEQIQLHPRPPISL-HQNQVDSLTDNLNFLQDFLEVYSCGGGSSSSSTE  61

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISNGA--SHERLHQILQRLAEDIEGLIEQR---  414
             A   +  R+ D +  AED IE+ +++ I  G   S + L+Q L++L +D+ G I++    
Sbjct  62    AADVLENRIADAAHAAEDIIETRIVDQILGGERISSDELYQGLEKLIQDM-GFIKKELME  120

Query  415   NTTQMLSSYNPGQSNQEHIIAGGASK--LQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
             N  + +             + G +S    + +A++      +E   ++  Q S    ++I
Sbjct  121   NKEKNIGIIEDHLHLNSPTLGGSSSSPSTRQNAVVGLDDLLIEVMDKLTGQPSN--LRII  178

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
              IVGMGGIGKTT+A+  Y  P I   F +  W T+SQ+Y+++ IL ++  C+ +   +EI
Sbjct  179   PIVGMGGIGKTTLARNSYAKPLIMHHFDIRAWVTISQNYNVQEILIEILLCIRKDESREI  238

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
                K+  EL   V + L  +RYL+V+DDIW    WD +   FPD+  GSRI++TTRL  V
Sbjct  239   LSSKNEGELGETVHKNLWGRRYLIVLDDIWSVEVWDRVNFFFPDNGQGSRIVITTRLSNV  298

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAIT  1122
             A      G     + FL+ ++SW L  + +     + P E+EEIGK+I   C+GLPL+I 
Sbjct  299   ASI----GSRGLEMNFLDDDKSWDLLCKNIFEKEEDCPHELEEIGKKIAKNCKGLPLSIV  354

Query  1123  VAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIF  1302
             V  GLL+ +K + E+W+ I+  +N  +  + +++C  +L LSYN+LP HLK CFLY G+F
Sbjct  355   VIGGLLANSKHTTEHWKYISENLNSIVHLEDNERCLKVLLLSYNHLPVHLKPCFLYMGVF  414

Query  1303  PKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKT  1482
             P+ R+ I    L+ LW++EGF+   SG+SLE  + +YL+DL DRNL+ + +    G IK 
Sbjct  415   PEDRK-IHVSWLVKLWVSEGFLKPISGKSLEVVSREYLEDLCDRNLIRVHQRGSNGKIKF  473

Query  1483  CRLHDLLFDLCLREVKKEKFVSAFHQRSENV---------IELGDTEPLFEYANRWLTFR  1635
             C +HDLL ++CLRE ++EKF+    + S N+         I +  +E    Y    L   
Sbjct  474   CNIHDLLREVCLREAEREKFLYVPRKHSLNIAQGINTQRRIIIHQSESETGYLLDVLQVN  533

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEI-SFDEAP  1812
              T I            +R+L+  F +     LP     N  ++++RVL +V+  S+    
Sbjct  534   NTLISVPL--------ARSLMCKFML-----LPSHPGSN--YRLLRVLKVVDKHSYSGYH  578

Query  1813  TFD----ISDLILLRYLALGT----IKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
               D    +  L+  R+LA+G      ++   +    NLQTLIVK                
Sbjct  579   ASDSIEAVLQLVNSRFLAIGADWQNFRFPSSVYLLWNLQTLIVK---------DMFYAVA  629

Query  1969  GSKWLQGLWKSQSLRFIKY-----PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKI  2133
              S+    +WK   LR I++     P P P+  D+  V   L TL  +   +C +E V +I
Sbjct  630   PSE----IWKMTQLRHIEFGLLDLPDP-PLGGDDDSVLGNLQTLLKIRNFKCGEEVVKRI  684

Query  2134  PNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEK---LIVEDIESEQFELQSINSFPQSLK  2304
             PNVK L I   E     +    +NL  L KLE          +  + +L      P S+K
Sbjct  685   PNVKKLQICYLEEFEGCSSYSLNNLVRLHKLESFSCFFYSQKKPHRNDLLRNLILPNSIK  744

Query  2305  ELKIVGTELGWEAI-TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             +L + GT L W+ + T I +LPNL+ LKL     +G EW T DG F  L+FL I      
Sbjct  745   KLALRGTNLYWDDMKTKIGLLPNLQVLKLQYNSFVGPEWETVDGQFCNLRFLQIYTCSDL  804

Query  2482  NWETMSD--HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
              W TM+D  HFP LE L L +   L ++P    +I TLQ IELK+C  S + S + I EE
Sbjct  805   EWWTMTDSSHFPRLEHLVLCNMDKLNEMPSCIGEIPTLQSIELKNCSDSTIISTRRILEE  864

Query  2656  QSSYGNDQLVVR  2691
             Q   GN  L VR
Sbjct  865   QEELGNVGLRVR  876



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   385 bits (988),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 293/874 (34%), Positives = 473/874 (54%), Gaps = 65/874 (7%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L+   KDE++ L ++L  +KA L++S +K +  +  +++++++  +++ AED I++    
Sbjct  23    LLSGVKDEVESLHRELSLMKAFLKDSREKRSEYEYVRELVSQITIVAYEAEDIIDT----  78

Query  328   IISNGASHERLHQI------------LQRLAEDIEGL---IEQRNTTQM--LSSYNPGQS  456
              ++N A  +    +            L+ +A++IE +   +++    +M  + S + G+S
Sbjct  79    FVTNAAMQKARSTVRRAFHVFDHSSKLRNVAKEIESIKVKVKEIYDKKMFGIQSLHGGES  138

Query  457   NQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
             +           ++++ + VG   E  +    L   S +E ++ISIVGMGG+GKTT+AKK
Sbjct  139   SHRSPPQKRVPMVEEENV-VGFDDEARKISSRLTNGS-EELEIISIVGMGGLGKTTLAKK  196

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKVR  810
             +Y D SI   F+   W  VSQ Y  + +   +   ++ +TD+  ++N+ K   EL + +R
Sbjct  197   VYTDSSIEFHFYNRAWIYVSQLYSRKEVFLGILDSLSLITDEMYKMNDEKLAGELFSHLR  256

Query  811   RRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNL  990
              +    RYL+V+DD+W    WDDLQ  FP  + GSRILLTTR  EVA+++   G    +L
Sbjct  257   SK----RYLVVIDDVWTMEAWDDLQMAFPKTATGSRILLTTRNTEVALHANPEG-LPHHL  311

Query  991   PFLNSNESWMLFSQKLGSINLPP-EIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVEN  1167
              FL   ESW L S+K+    + P E+E+IG +I  KC GLPLAI V +GLL K +++ + 
Sbjct  312   RFLTHEESWELLSKKVFRKGICPLELEDIGLQIAKKCYGLPLAIVVVSGLLLKKEKTRDW  371

Query  1168  WQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNL  1347
             W+ IA+ ++  +  D   QC  +L LSY +LP HLK CF+YFG+FP+   EIP   LL L
Sbjct  372   WKKIANDVSSYVARD-PKQCMDVLALSYKHLPDHLKVCFIYFGVFPE-DFEIPVWKLLRL  429

Query  1348  WITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREV  1527
             W +EGFV +     LE+ A +YL+DL+DRNLVL++K    G IKTCR+HD+L DL ++  
Sbjct  430   WTSEGFVQKMGQECLEDTAEEYLEDLVDRNLVLVAKKRASGRIKTCRIHDMLRDLSVKMG  489

Query  1528  KKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFF  1707
              +EKF+  F + ++N        P+ +Y  R L   + ++    S  +     R+ L F 
Sbjct  490   SEEKFLEVFKESAQN----HSLSPISKYHRR-LCVHSHFLDFITSRPFG-PNVRSFLCF-  542

Query  1708  GVSGASGLPVSWRQNVS-----FKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-GTIK  1869
                 AS      R++ S     F+++RVLDL  I+F   PT +I  L+ LRY+AL G  +
Sbjct  543   ----ASEEMELLREHTSFLHEAFRLVRVLDLKYINFPRFPT-EIVQLVHLRYIALSGNFR  597

Query  1870  YVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPID  2046
              +   +    NL+TLIV      R  +I  D    S++ + L+ S        P     D
Sbjct  598   VLPASISKLWNLETLIVG--TKSRELDIQVDIWKMSQF-KHLYTSGLSCLRGPPAKTRKD  654

Query  2047  TDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIK---CSEIRAFQTETWWDNLHYL  2217
               +  V+  + T+  V    C +  + + P ++ LGI+    + +      + +DNL  L
Sbjct  655   NADPFVRRNIQTISTVLPDCCKENILARTPGLRKLGIRGKLATLVATNGDSSLFDNLAKL  714

Query  2218  TKLEKL-IVED---IESEQFELQSIN---SFPQSLKELKIVGTELGWEAITIISMLPNLE  2376
               LE L ++ D   +   Q ++  +     FP +LK+L +  T L W  I+ + MLPNLE
Sbjct  715   DNLETLKLLNDTFPLPPSQCQIPGLPQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLE  774

Query  2377  SLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEK  2556
              LKL      G +W   DGGF  L+ L+I    L++W     HFP L+++ L HC +L +
Sbjct  775   VLKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNE  834

Query  2557  IPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             IP G  ++++LQ IEL    P+   SA+ IQ+E+
Sbjct  835   IPFGLVEVSSLQNIELFWPTPAAAASARIIQQEK  868



>gb|AEW48215.1| disease resistance protein RGH7 [Solanum leptophyes x Solanum 
sparsipilum]
Length=921

 Score =   385 bits (990),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 313/969 (32%), Positives = 488/969 (50%), Gaps = 174/969 (18%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLI  405
              E+  I  V+  +++++AED ++S+  ++      I+   +   L   L++  E I+  +
Sbjct  48    HEELTILEVEIAEVAYKAEDMVDSKARKVSSAETVITRSKAFWELCCSLEQEVECIDSFM  107

Query  406   EQ-------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
              Q        N  +   + N   S     I   A +  +D IMVG+  E E   + L++ 
Sbjct  108   MQWLAIWDWYNNIKDFKAQNFCLSK----IPELAVERSED-IMVGYENEFEMMLDQLVR-  161

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
               +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +LQ   G +
Sbjct  162   GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQ---GLL  218

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                +D+      S  +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD   GSRIL
Sbjct  219   PSRSDE------SDDQLADRLQKHLKARRYLVVIDDIWTTEAWDDIKLCFPDCYKGSRIL  272

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVN  1092
             LTTR  EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  
Sbjct  273   LTTRNVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIAL  329

Query  1093  KCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHL  1272
             KC GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HL
Sbjct  330   KCGGLPLAITVTAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHL  389

Query  1273  KACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLIS  1452
             K CFLYF IF +  R I  K L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I 
Sbjct  390   KPCFLYFAIFSEDER-IYVKKLVELWAVEGFLNEEEGKSMEEVAETCINELVDRSLISIH  448

Query  1453  KLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTF  1632
              LSF G  + C +HD+  +LCLRE +   FV+    +S+        +  F+  +R   +
Sbjct  449   NLSFDGETQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRIRIY  508

Query  1633  RTTYIQPKFSDKYNFHKSRTL--LFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDE  1806
             +         +++ + +S     +   GV     + +     +SFK++RVLDL    F  
Sbjct  509   K--------EEEFAWCRSSEAHSIIMLGVGEFKCVTL----ELSFKLVRVLDLGLNKFPM  556

Query  1807  APTFDISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGS  1974
              P+  +S LI LRYL+L    +   LK +      + + I+  P S              
Sbjct  557   FPSGVLS-LIHLRYLSLC---FNPCLKQYRGSLEAVPSSIIDIPLS--------------  598

Query  1975  KWLQGLWKSQSLRFI-----KYPYPFPIDTDEIPVQDTLHTLYWVPYLR-----------  2106
               +  L   Q+ +       +YP+  P++   +P   TLH + W  YLR           
Sbjct  599   --ISSLCYLQTFKLYLPFTNEYPFILPLEILTMPQLRTLH-MGW-NYLRNHEPTENQLVV  654

Query  2107  -------------CTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLI  2238
                          CT  +    PN+K   V G++      F+      +  YL +LE+L+
Sbjct  655   KSLQCLNQLNPRYCTGSYFRLFPNLKKLEVFGVR----EDFRNHKDLYHFRYLYQLEELV  710

Query  2239  VEDIESE-------------------QFELQSI-----------------------NSFP  2292
                  S                    +F+ +++                       ++FP
Sbjct  711   FSIYYSPTACFLKNTAPSDSTPQDPLRFQTKTLHKEIDFRGTAPPTDVPTLLSPPPDAFP  770

Query  2293  QSLKELKIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG  2469
             Q+LK L   G   L W+ ++I+  LP LE L+L     +GEEW   + GFP LKFL++  
Sbjct  771   QNLKSLTFSGDFSLAWKDLSIVGKLPKLEVLQLSSNPFIGEEWEVVEEGFPHLKFLFLDQ  830

Query  2470  AKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQ  2649
               ++ W   SDHFP LERL L +C +L+ IP  F +ITTL LI++  C  S+  SAK IQ
Sbjct  831   VHIRYWRASSDHFPYLERLFLRYCCHLDSIPRDFANITTLALIDITGCQQSVGNSAKQIQ  890

Query  2650  EE-QSSYGN  2673
             ++ Q +YG+
Sbjct  891   QDIQDNYGS  899



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score =   384 bits (987),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 285/838 (34%), Positives = 437/838 (52%), Gaps = 69/838 (8%)
 Frame = +1

Query  295   AEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQ----MLSSYNPGQSNQ  462
             AE+ IE  + E         RL    Q + +D+  L+E+ +  +    M +S     +  
Sbjct  60    AENVIELNIYEFNQLERCRSRLGLSRQPICDDLPPLLEKIDAVKRKILMQNSSIISSTKV  119

Query  463   EHIIAGGAS-----KLQDDAIMVGHAQELERTKEMLL--QCSTQERQVISIVGMGGIGKT  621
             + ++   +S      +  + ++VG   +L +    L+   C    R+V+SI+GM GIGKT
Sbjct  120   DSLLGLDSSSRHIVNMSLENVVVGLEDDLMKIMRRLIGPPCG---REVVSILGMAGIGKT  176

Query  622   TMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK-------EINEVK  780
             T+AKK Y  P IR+RF +  W T+SQ+Y +R +   +  C+  +++        EINE  
Sbjct  177   TLAKKAYHHPEIRNRFDIHVWVTISQEYRIRDLWLSILSCIPHISETYPMDVRDEINE-S  235

Query  781   STAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYS  960
             +  +L + + ++L  +RYL+V+DDIW    WD + R FPDD+NGSRI+LT+R ++VA ++
Sbjct  236   TDDQLMDMIYKKLKCRRYLVVMDDIWSKEIWDLMTRIFPDDNNGSRIILTSRHEQVAKHA  295

Query  961   GCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAG  1134
                 K    +  LNS+ SW L   K+  +    PPE+E+IGK++  KC+GLPLA+ V AG
Sbjct  296   DPDSK-PHKMSLLNSDNSWKLLKGKVFGVEHVCPPELEDIGKQVAQKCQGLPLALLVVAG  354

Query  1135  LLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVR  1314
              LSK   + + W  +A  ++  + S+  D+C  ++ +SY+ LP HLK+ FL    FP+  
Sbjct  355   HLSKISTTRKCWNDVAKTISKIVASE-PDKCLGVVAMSYSYLPDHLKSSFLSMAAFPE-G  412

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
              E+    L+ LWI +GF+  +  +SLEE   ++L+DLI RNL+++ K  F G +KTC +H
Sbjct  413   FEVEIHRLIQLWIADGFLRNERVKSLEEIGKEWLEDLISRNLIMVIKRRFNGEMKTCGVH  472

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYN  1674
             DL+ DL LR+ +KEKF+     R   VI   +      Y  R+ +F +T I P  +D +N
Sbjct  473   DLVRDLILRQAEKEKFMQV--TRIHKVIRRFNDSACKPYVRRY-SFHST-ISP--TDCWN  526

Query  1675  FHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRY  1848
                S  RTL  F G+   S L         FK++RVL +++ +F E P  +++ L+ LRY
Sbjct  527   SSSSFTRTLYLFNGLKLVSPLSKQVPFLARFKLLRVLAILQYTFREFP-LELTKLVHLRY  585

Query  1849  LALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFI--  2019
             L       + R +   +NLQ L+                   S     +WK + LR +  
Sbjct  586   LEFNCYDDLHRSVSELYNLQNLVFG---------------GHSNLPVDIWKMKLLRHLHV  630

Query  2020  ----KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGI-----KCSEI  2172
                  +  P   +     +Q+ L  L  +    CTK      PN+K L I     +C   
Sbjct  631   RKISSFRVPSSKEGSGFKLQN-LEGLSDISISCCTKGLFTGFPNLKRLKIHGAWAECRRD  689

Query  2173  RAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAIT  2349
               FQT    +NL  L KLE L I+   +     L S  + P SLK L +  T L WE + 
Sbjct  690   MIFQT---LNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTSLKRLTLRCTYLPWEDMA  746

Query  2350  IISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERL  2526
              I  LPNL+ LK+      G+ W +     F +LKFL I    LK+W+  S +FP L+RL
Sbjct  747   NIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNLKHWDAGSVNFPKLKRL  806

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYD  2700
              L  C  LE+IP+   +I TL+ IEL +C  S+ +S K+IQEEQ S  ND L VR ++
Sbjct  807   VLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQEEQESMANDILSVRIHE  864



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score =   384 bits (987),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 309/945 (33%), Positives = 468/945 (50%), Gaps = 142/945 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++    E       ++ 
Sbjct  1     MAYAAVTSLMRTIH-QSVELTGCDLQPFYEKLKSLRAILEKSCNIMGDHE------GLTI  53

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
              E ++I    ++++  ED ++SE   +       ER      +  +L++  E I+  ++Q
Sbjct  54    LEVEII----EVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                T+  +    P  S+     EH +       Q + IMVG   E E   + L++   +E
Sbjct  110   WMATSDSMKDLKPQTSSLVSSPEHAVE------QPENIMVGRENEFEVMLDQLVR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +LQ L   ++   
Sbjct  163   LEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLTTR
Sbjct  223   DDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLP  1110
               EVA Y+  SGK   ++  +N +ESW L  + +        PE E IGK+I  KC GLP
Sbjct  274   NVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKMIFEKEGFYSPEFENIGKQIALKCGGLP  332

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             LAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK CFLY
Sbjct  333   LAITVIAGLLSKIGQRLDKWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLY  392

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
             F IF +   EI    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   SF G
Sbjct  393   FAIFAE-DEEIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRG  451

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
              I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R          
Sbjct  452   TIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSR----------  501

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQN-----VSFKMIRVLDLVEISFDEAPT  1815
                    + H    L++    S A  + +S   N     +SFK++RVLDL    +   P+
Sbjct  502   ------SSIHNEEELVWCRN-SEAHSIIMSRIFNCVTLELSFKLVRVLDLGWTYYPIFPS  554

Query  1816  FDISDLILLRYLALGTIK-YVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
               +S LI LRYL+L  +   ++       + +LI+  P S               +LQ  
Sbjct  555   GVLS-LIHLRYLSLCLVPCLLQDRGSTEAVPSLIIDIPLSISSLC----------FLQTF  603

Query  1993  WKSQSLRFIKYPYPFPIDTDEIP----------------------VQDTLHTLYWVPYLR  2106
               +       +P+  P +   +P                      V  +L  L  +    
Sbjct  604   KLNHPFDTF-HPFILPSEILTMPQLRKLCMSWNYLRSHEPTENRLVLKSLQCLNQLNPRY  662

Query  2107  CTKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLI-------------  2238
             CT  F    PN   +KV G+       F+      +  YL +LEKL              
Sbjct  663   CTGSFFRLFPNLKKLKVFGVP----EDFRNHKDLYDFRYLYQLEKLAFSTYYSSAAFFLE  718

Query  2239  ------------------VEDIESEQFELQSINSFPQSLKELKIVGT-ELGWEAITIISM  2361
                               V + ++    L   ++FPQ+LK L   G   L  + ++I+  
Sbjct  719   NTAPSGSTPQDPLRFQIRVGETDAPTLLLPPPDAFPQNLKSLTFSGQFFLASKDLSIVGK  778

Query  2362  LPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHC  2541
             LP LE LKL     +GEEW   + GFP LK L+++   ++ W   SDHFP LERL L  C
Sbjct  779   LPKLEVLKLSDNTVIGEEWEVVEEGFPHLKLLFLNNVYIRYWRASSDHFPYLERLFLRKC  838

Query  2542  HNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
               L+ IP  F DITTL LI++  C  S+V SAK IQ++ Q +YG+
Sbjct  839   CYLDSIPRDFADITTLALIDISYCRQSVVNSAKQIQQDIQDNYGS  883



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score =   384 bits (985),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 299/916 (33%), Positives = 471/916 (51%), Gaps = 75/916 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVV-DYKDEIQCLRQKLCH----lkalleesekklNV  243
             MAY  + SLI+T++ Q ++ +P  ++ D +  I+ L     +    L+      +   N 
Sbjct  1     MAYADVVSLIQTLK-QLMQQKPSWIIGDTRKMIESLLNSAEYFQNFLEKTYMRRQVFGNF  59

Query  244   SQAEKDVIARVKDISFRAEDEIESEVMEIISNGASH-ERLHQILQRLAEDIEGLIEQ---  411
              + E+ +   V D+    E+ IE  + E   N   H  RL    Q L +D+  L+E+   
Sbjct  60    EELERVIRIAVNDV----ENVIELTMHEY--NLLEHCSRLGLPRQPLCDDLPPLVEKIDF  113

Query  412   -RNTTQMLSSYNPGQSNQEHIIAGGASK----LQDDAIMVGHAQELERTKEMLLQCSTQE  576
              +       + +   S+  +++   +S+    L  + ++VG   +L +    +       
Sbjct  114   VKRRMMRFVTNDQDLSSGVYLLGHSSSRRVASLNLENVVVGLEDDLMKVMRRVTG-PPSS  172

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
             R+++SIVGMGGIGKTT+AKK+Y  P +R+RF +  W T+SQ+Y  R +L  +  C+ Q+ 
Sbjct  173   REIVSIVGMGGIGKTTLAKKVYHHPEVRNRFDVHIWVTISQEYQTRDLLLCILSCIFQLK  232

Query  757   DKEINEV-----------KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD  903
             ++  NE             S  +L + + ++L  +RYL++VDDIW    WD + R FPDD
Sbjct  233   NEIQNETYRLVVGDEINGSSDDQLMDMIYKKLKYRRYLVIVDDIWSIGIWDLMTRFFPDD  292

Query  904   SNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSIN--LPPEIEEI  1074
             +NGSRI+LT+R KEVA ++         +  LNS+ SW L   K+ GS +   P E+E+I
Sbjct  293   NNGSRIILTSRHKEVAEHADPDSN-PHEMSLLNSDNSWKLLHDKVFGSQHDVCPRELEKI  351

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK++  KC+GLPLA+ V AG LSK  R+ E W  +A  ++  + S+  D+C  +L +SY+
Sbjct  352   GKQVAQKCQGLPLALLVVAGHLSKMPRTRECWDDVAKTISKIVASE-PDKCIGVLAMSYS  410

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
              LP+HLKACFL  G+FP+    I T+ L+ LW+ EGF+ ++  +S+E+   + L+DLI R
Sbjct  411   YLPHHLKACFLSIGVFPE-DFVIATERLIQLWVAEGFLRQERLKSMEQVGKECLEDLISR  469

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA  1614
             NL+L+ K  F G + TC +HDL+ DL LR+ +KEKF+     R+ +VI          + 
Sbjct  470   NLILVRKRRFSGELITCGVHDLVRDLILRQGEKEKFLKV--TRTHDVITRFIDTTSKPHV  527

Query  1615  NRWLTFRTTYIQPKFSDKYNFHKS--RTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLV  1788
             +R+    +++ +    D +N   S  RTL  F G+  A            FK++RVL ++
Sbjct  528   HRY----SSHSRISQGDCWNSTSSLIRTLYLFNGLKHAPRPSKQIPFLARFKLLRVLAIL  583

Query  1789  EISFDEAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQTLIVKFPNSCRieeidsdee  1965
               +F + P  +I+ L+ LRYL       +   +   +NLQ LI                 
Sbjct  584   HYTFQDFP-LEITKLVHLRYLEFNCRDDLHCSVSELYNLQNLIFG---------------  627

Query  1966  iGSKWLQGLWKSQSLRFIKY----PYPFPIDTDEIPVQDTLHTLYWVPYLR---CTKEFV  2124
               S     +WK + LR ++      +P P           L  L  +  L    C+ E  
Sbjct  628   RYSDLPVEIWKMKLLRHLEVKKISSFPVPSSMYTTGSSSKLQNLEVLSDLSISCCSNEMF  687

Query  2125  LKIPNVKVLGIKCS--EIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQ  2295
              + PN+K L +  +  E R        ++L+ L +LE L I+   +     L S    P 
Sbjct  688   TRTPNLKRLKLHGAWEECRRDTISQMLNSLYCLPQLEILKIICSRKLYPHPLPSTYVLPT  747

Query  2296  SLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGG-FPKLKFLYISGA  2472
             SL  L +  T L WE +  I MLPNL+ LK+      G+ W   D   F +LK+L I   
Sbjct  748   SLVRLTLRCTYLPWEDMANIVMLPNLQVLKIKDNGFDGDAWRLSDEQIFNQLKYLLIDRT  807

Query  2473  KLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQE  2652
              +K+W+  S +FP L+RL L  C  LE+IP+   ++ TL+ IEL +C  S  +S K+IQE
Sbjct  808   NVKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAKSVKEIQE  867

Query  2653  EQSSYGNDQLVVRDYD  2700
             EQ S GND L VR +D
Sbjct  868   EQESMGNDCLSVRIHD  883



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score =   384 bits (985),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 281/818 (34%), Positives = 435/818 (53%), Gaps = 79/818 (10%)
 Frame = +1

Query  325   EIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQ-------SNQEHIIAGG  483
             +++      E LH+ L  L E I+ L  +RN   M SS+   +       +N +  +   
Sbjct  119   KVLRKTMEEEALHKTLSPLVEKIDVL--ERNV--MGSSFGKNEVQGYVDPTNDQLQVEAS  174

Query  484   ASK----LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDP  651
             +S+    L  + I+VG   +L   K  L++ S+  R+++ I+GMGGIGKTT+A+K +DD 
Sbjct  175   SSRRVAILNPENIVVGLEDDLMEIKRRLIETSSN-REIVPILGMGGIGKTTLARKAFDDL  233

Query  652   SIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQR  831
              +R  F +  W TVSQ Y +R +L D+    ++++   I +  ++ +L +K+ + L  +R
Sbjct  234   EVRHHFDIHVWVTVSQQYRIRDLLLDIH---SRISADPIKQGTNSDQLMDKIYKVLKCRR  290

Query  832   YLLVVDDIWGSRG-WDDLQRCFPDDSNGSRILLTTRLKEVAVYS--GCSGKYVCNLPFLN  1002
             YLLV+DDIW     WD + R FP+D N SRI+LT+R+ EVA+++   C+      +  LN
Sbjct  291   YLLVMDDIWSCDNIWDIVSRTFPEDENSSRIILTSRINEVAMHADPNCTPY---KMHLLN  347

Query  1003  SNESWMLFSQKLGSIN---LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQ  1173
              +ESW L   K+  ++    PPE+E+IGK++   C+GLPLA+ V AG LSK  R+ ++W+
Sbjct  348   FHESWKLIHDKVFGVHQHVCPPELEKIGKQVAQNCQGLPLALLVVAGHLSKIDRTRKSWE  407

Query  1174  SIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWI  1353
              ++ +++  + ++  D C  +L +SYN LPYHL+ CFLY G+FP+  REI   +L+NLWI
Sbjct  408   DVSKSVSNILVNE-SDICLGVLAMSYNYLPYHLRPCFLYIGVFPE-DREINIMNLINLWI  465

Query  1354  TEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
             +EGF++    +SLE      L DL+ RNLV++    + G  KT  +HDL+ DL +R    
Sbjct  466   SEGFLVNKGHKSLEAVGRDCLNDLVSRNLVMVRSRKWDGECKTFGVHDLVRDLIIRVAND  525

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSD----KYNFHKSRTLLF  1701
             EKF+        + I++  T P    AN++   R +Y    + D    + +   +RTL F
Sbjct  526   EKFLQV------SRIQVA-TNP---SANKFHVRRYSYSSRIYDDDDLRESSSSNTRTLHF  575

Query  1702  FFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIK--YV  1875
             F+G++  S L         FK++RVL +++ +F   P   I  L+ LRYL +        
Sbjct  576   FYGLNNDSLLG-------RFKLLRVLAILDCTFHYFPLV-IKKLVHLRYLHIFNCHEDIH  627

Query  1876  RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRF--IKYPYPFPIDT  2049
               +   +NLQTLI                   S     +WK + LR   IK    F + +
Sbjct  628   SSVSELYNLQTLIFG---------------QYSGLSVEIWKMKLLRHVEIKGISDFCVPS  672

Query  2050  DEIPVQDTLHTLYWVPYLR---CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLT  2220
              +      L  L  + YL+   CT++    IPN+K L I  ++       +  ++L  L 
Sbjct  673   SKEGSSFKLQNLEHLSYLKISCCTEKLFSDIPNLKTLKIYGAK---GDITSELNSLSCLN  729

Query  2221  KLEKL-IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQA  2397
             KLE L I  +    +   QS  + P SLK L +  T L WE +  I MLPNL+ LK+   
Sbjct  730   KLETLKIACNRRYYERPPQSKFALPTSLKRLTLESTYLPWEDMANIVMLPNLQVLKIKDN  789

Query  2398  YEMGEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFT  2574
                G+ W   D   F +LKFL I    LK W+  S +FP L+ L L  C +L+ IP+   
Sbjct  790   GFDGDVWRLNDEMIFNQLKFLLIYETNLKQWKAGSVNFPELQCLVLKECRSLKTIPQDIG  849

Query  2575  DITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             +I TL+ IEL +C  S  +S K+IQ+EQ S GND L V
Sbjct  850   EIYTLESIELHNCSTSAEKSVKNIQKEQKSMGNDCLTV  887



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score =   383 bits (984),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 285/824 (35%), Positives = 433/824 (53%), Gaps = 84/824 (10%)
 Frame = +1

Query  325   EIISNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQ-------SNQE------  465
             +++      E LH+ L  L E I+ L  +RN   M SS+   +       +N E      
Sbjct  119   KVLRKTMEEEALHKTLSPLVEKIDVL--ERNV--MGSSFGTNEVQGYVDPTNDELQVEAS  174

Query  466   ---HIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKK  636
                H  +   +KL  + I+VG   +L   K  L+  S+  R+++ I+GMGGIGKTT+A+K
Sbjct  175   LLGHSSSRRVAKLNPENIVVGLEDDLMEIKRRLIGTSSN-REIVPILGMGGIGKTTLARK  233

Query  637   IYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRR  816
              YDD  +R RF +  W TVSQ Y +R +L D+   +++++   I +  ++ +L +K+ + 
Sbjct  234   AYDDFEVRHRFDIHVWVTVSQQYRIRDLLLDI---LSRISADPIKQGTNSDQLMDKIYKV  290

Query  817   LMRQRYLLVVDDIWGSRG-WDDLQRCFPDDSNGSRILLTTRLKEVAVYS--GCSGKYVCN  987
             L  +RYLLV+DDIW     WD + R FP+D N SRI+LT+R+ EVA+++   C+      
Sbjct  291   LKCRRYLLVMDDIWSCDNIWDIVSRTFPEDENSSRIILTSRINEVAMHADPNCTPY---E  347

Query  988   LPFLNSNESWMLFSQKLGSIN---LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRS  1158
             +  LN +ESW L   K+  ++    PPE+EEIGK++   C+GLPLA+ V AG LSK  R+
Sbjct  348   MHLLNLDESWKLIHDKVFGVDQQFCPPELEEIGKQVAQNCQGLPLALLVVAGHLSKIDRT  407

Query  1159  VENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDL  1338
              ++W+ ++ +++  + ++  D C  +L +SYN LPYHL+ CFLY G+FP+  REI   +L
Sbjct  408   RKSWEDVSKSVSNILVNE-SDICLGVLAMSYNYLPYHLRPCFLYIGVFPE-DREINITNL  465

Query  1339  LNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCL  1518
             +NLWI+EGF++    +SLE      L DL+ RNL+++    + G  KT  +HDL+ DL L
Sbjct  466   INLWISEGFLVNKGLKSLEAVGRDCLNDLVSRNLLMVRSRRWDGECKTFGVHDLVRDLIL  525

Query  1519  REVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDK-----YNFHK  1683
             R    EKF+        + I++  T P    AN++   R +Y    + D       +   
Sbjct  526   RVANDEKFLQV------SRIQVA-TNP---SANKFHVRRYSYSSRIYDDDDLCESSSSSS  575

Query  1684  SRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT  1863
             +RTL FF+G++  S L         FK++RVL +++ +F   P   I  L+ LRYL +  
Sbjct  576   TRTLHFFYGLNNDSLLG-------QFKLLRVLAILDCTFHYFPLV-IKKLVHLRYLHIFN  627

Query  1864  I-KYVRV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRF--IKYPY  2031
               +Y+   +   +NLQTLI                   S     +WK + LR   +K   
Sbjct  628   CHEYIHSSVSELYNLQTLIFG---------------QYSGLPVEIWKMKILRHLEVKRIS  672

Query  2032  PFPIDTDEIPVQDTLHTLYWVPYLR---CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWD  2202
              F + + +      L  L  + YL    CT++    IPN+K L I     +   T    +
Sbjct  673   YFCVPSSKEGSSFKLQNLEQLSYLNISCCTEKLFSGIPNLKRLKIYGD--KGNMTSEKLN  730

Query  2203  NLHYLTKLEKLIVEDIESE-QFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLES  2379
             +L  L KLE L +       +   QS  + P SLK L +  T L WE +  I MLPNL+ 
Sbjct  731   SLSCLNKLETLKITCYRGYYERPPQSKFALPTSLKRLTLESTYLPWEDMANIVMLPNLQV  790

Query  2380  LKLLQAYEMGEEWVTGDGG-FPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEK  2556
             LK+     +   W   D   F +LKFL I    L+ W+  S +FP L+ L L  C +L+K
Sbjct  791   LKIKDNGFVDGRWRLNDEMIFNQLKFLLIHKTDLEQWKAGSVNFPELQCLVLKECISLKK  850

Query  2557  IPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             IP+   +I TL+ IEL +C  S   S K IQ+EQ S GND L V
Sbjct  851   IPQDIGEIYTLESIELHNCSTSAENSVKKIQKEQKSMGNDCLTV  894



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score =   391 bits (1005),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 275/832 (33%), Positives = 438/832 (53%), Gaps = 67/832 (8%)
 Frame = +1

Query  271   RVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYN  444
             ++KD+ ++AED ++S +  I+   N    E+  +      + +E   +      M+   N
Sbjct  502   KIKDVVYKAEDRVDSCLTSILLADNEDDREKACKFFNEELQQVETEFDSLRKEVMVIECN  561

Query  445   PGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC---STQERQVISIVGMGGIG  615
                S    + A  +    ++   VG    +++  + +L C     +E  VIS+VGMGGIG
Sbjct  562   KRGSKSTELAATTSFSSIEETTYVG----MKKDYKAILNCLNAQAKELIVISLVGMGGIG  617

Query  616   KTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAEL  795
             KTT+A+K++ + +IR RF    W T+S+ Y+ R++L ++   ++ + ++E+    S  EL
Sbjct  618   KTTLARKVFGNSTIRDRFEKHAWVTISEQYNKRQMLLEVASSISGVNNQEM----SNDEL  673

Query  796   ANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGK  975
                V R L  +R+L+V+DD+W +  WD ++R F +++N SRI+LTTRLK VA Y+     
Sbjct  674   MVIVYRSLKGRRFLIVIDDLWSTDAWDQMRRIFQNNNNKSRIILTTRLKHVADYASSPDF  733

Query  976   YVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTK  1152
                ++ FL+  +SW LF+++L   +  PP++ +IGK I+ +C+GLPL+I V AGLL K  
Sbjct  734   PPHDVSFLSFKDSWKLFTKRLFKKDRCPPQLRKIGKHIIQQCQGLPLSIIVIAGLLGKIG  793

Query  1153  RSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTK  1332
              + +NW+ I   +N    S L +QC  IL+LSY+ LP +LKACFLY G FP+   EI   
Sbjct  794   VTYDNWKKIEENLNSFHGSVL-EQCQAILSLSYDYLPPYLKACFLYIGGFPE-DMEIRVS  851

Query  1333  DLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDL  1512
              +++ WI E F+   S + LE  A +Y+Q+L+DR+L+L       G  KTC++HDLL  L
Sbjct  852   KMMSSWIAEQFIKATSDKRLEVVAEEYVQELMDRSLILGKTRKPNGRFKTCKIHDLLRQL  911

Query  1513  CLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRT  1692
             C+RE +           SENV+    ++ +  Y++     R   I     D +  H S+ 
Sbjct  912   CIREAQ-----------SENVVHFPYSDLVPAYSDDINDRRRVMIPFLIEDYFCNHPSQM  960

Query  1693  -------LLFFFGVSGASGLPV--SWRQNVS-FKMIRVLDLVEISFDEAPTFDISDLILL  1842
                     L F G   +  +P    W  ++S FK+++VLD  EI +D +    I  L+ L
Sbjct  961   SGKITTRSLIFMGAGKSYLVPEINHWPDSISDFKLLKVLDAREIGYDFSHI--IPQLVHL  1018

Query  1843  RYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIK  2022
             RY+    I+    L    NLQT+IV    + +             W     K   +  + 
Sbjct  1019  RYID-ARIENPSSLAKLFNLQTIIVYSRRNVQ--------LPAEIWTMSQIKHLDIEQMD  1069

Query  2023  YPYPFPI--DTDEIPVQDTLHTLYW--VPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTE  2190
              P P  I     E    + L TL     P+L    E + + PNV+ L     +IRA  T 
Sbjct  1070  MPNPLSIGDQQPEFLYLNNLQTLALDSSPFL---AEILERTPNVEKL-----KIRAANTH  1121

Query  2191  TWW----DNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIIS  2358
               W    D L  L +LEKL +   E     + S      +LK L++  T L WE + +++
Sbjct  1122  NEWSDFVDCLINLQRLEKLSITATEDNSPRILSSAFCAPNLKHLRLAYTSLPWEEMDVLA  1181

Query  2359  MLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYI-SGAKLKNWETMSDHFPVLERLAL  2532
              LPNLE LK   A+  G +W +  D  F KLK+L I S   L+ WE  SD+FP+LE+L L
Sbjct  1182  NLPNLEVLKADSAFN-GTDWTLNEDVVFQKLKYLRIWSADDLERWEATSDNFPMLEKLVL  1240

Query  2533  HHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
              H   LE+IP+   +I TL+L+++++C P++  SA++I +EQ  +GN +L +
Sbjct  1241  QHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSARNILQEQQGWGNCELQI  1292


 Score =   179 bits (453),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 151/475 (32%), Positives = 232/475 (49%), Gaps = 48/475 (10%)
 Frame = +1

Query  1318  EIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHD  1497
             EI    +++ WI E F+   S + LE  A +Y+Q+L+DR+L+L       G  KTC++HD
Sbjct  2     EIRVSKMMSSWIAEQFIKATSDKRLEVVAEEYVQELMDRSLILGKTRKPNGRFKTCKIHD  61

Query  1498  LLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNF  1677
             LL  LC+RE +            +NV+    ++ +  Y++     R   I     D +  
Sbjct  62    LLRQLCIREAQ-----------IQNVVHFPYSDHVSTYSDDINDRRRVMIPFLIEDYFCD  110

Query  1678  HKSRTL-------LFFFGVSGASGLPV--SWRQNVS-FKMIRVLDLVEISFDEAPTFDIS  1827
             H S+         L F G   +  +P    W  ++S FK+++VLD  EI +D +    I 
Sbjct  111   HPSQMSGKITTRSLIFMGAGRSYLVPEINHWPDSISDFKLLKVLDAREIGYDFSHI--IP  168

Query  1828  DLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS  2007
              L+ LRY+    I+    L    NLQT+I+          I+  +     W     K   
Sbjct  169   QLVHLRYVD-ARIQDPSSLAKLCNLQTIII-------YSRINIVQLPVEIWTMSEIKHVI  220

Query  2008  LRFIKYPYPFPIDTDEIPVQDTLHTLYW--VPYLRCTKEFVLKIPNVKVLGIKCSEIRAF  2181
             +  +  P P  I+  +    + L TL     P+L    E + + PNV  L     +IRA 
Sbjct  221   IEQMDMPNPLSIEEQQPLFLNNLQTLALDSSPFL---AEILKRTPNVDKL-----KIRAA  272

Query  2182  QTETWW----DNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAIT  2349
              T   W    D L  L +LEKL +   E     + S      +LK L++  T L WE + 
Sbjct  273   NTHNEWSDFVDCLINLQRLEKLSITATEDNSPRILSSAFCAPNLKHLRLAETSLPWEDMA  332

Query  2350  IISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAK-LKNWETMSDHFPVLER  2523
             +++ LPNLE LK   A+  G +W +  D  F KLK+L I  A  L+ WE  SD FP+LE+
Sbjct  333   VLANLPNLEVLKADHAF-TGTDWDLNEDVVFQKLKYLRIKRADDLEMWEAASDSFPMLEQ  391

Query  2524  LALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             L L H   LE IP+ F +I TL+L+++K C P++ +SA++I E+Q S+GN +L +
Sbjct  392   LVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNILEDQQSWGNYELQI  446



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score =   384 bits (985),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 311/954 (33%), Positives = 473/954 (50%), Gaps = 148/954 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+RT+  Q +E     +  + ++++ LR  L          EK  N++   +
Sbjct  1     MAYAVVTSLMRTI-YQSMELTGCDLQPFYEKLESLRAIL----------EKSCNITGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEIISNGASHERLHQI------LQRLAEDIEGLIEQ  411
             ++      + ++++  ED ++SE   +       ER   +      L++  E I+  ++Q
Sbjct  50    ELTILEVEILEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFFLEQALECIDSTMKQ  109

Query  412   --RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ  573
                 T+  +    P   +     EH +       Q + IMVG   E E   + L++   +
Sbjct  110   YWMATSDSMKDLKPQTGSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLVR-GGR  162

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
             E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +  
Sbjct  163   ELEVVSIVGMGGIGKTTLATKLYTDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE  222

Query  754   TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTT  933
              D          +LA+++++ L  +RYL+V+DDIW +  WD+++ CFPD  NGSRILLTT
Sbjct  223   PD---------YQLADRLQKHLKGRRYLVVIDDIWTTEAWDNIKPCFPDCYNGSRILLTT  273

Query  934   RLKEVAVYSGCSGKYVCNLPFLNSNESWMLFS----QKLGSINLPPEIEEIGKRIVNKCR  1101
             R  EVA Y+  SGK   N+  +N +ESW L      +K GS +  PE E IGK+I  KC 
Sbjct  274   RNVEVAEYAS-SGKPPHNMRLMNFDESWNLLHKMIFEKEGSYS--PEFENIGKQIALKCG  330

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPLAITV AGLLSK  ++++ W+++A  ++  +++DL  +C  +L LSY++LP HLK C
Sbjct  331   GLPLAITVIAGLLSKISKTLDEWKNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPC  390

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYF IF +  R I    L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  LS
Sbjct  391   FLYFAIFAEDER-IYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLS  449

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             F G I+ C +HD+  +LCLRE +   FV+    +S+        +  F+  +R   F+  
Sbjct  450   FDGKIERCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIFKEE  509

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF-  1818
              +   +      H    L  F  ++            +SFK++RVLDL        P F 
Sbjct  510   EL--AWCRNSEAHSIIMLGRFNRIT----------LELSFKLVRVLDL---GLTICPIFP  554

Query  1819  -DISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL  1992
               +  LI LRYL+L  +   ++       + + I+  P S               +LQ  
Sbjct  555   SGVLSLIHLRYLSLSFSPCLIQYRGSKEAVPSSIIDIPLSISSLC----------YLQT-  603

Query  1993  WKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR----------------------  2106
             +K     F  YP+  P +   +P   TL  + W  YLR                      
Sbjct  604   FKLNVPFFYGYPFILPSEILTMPQLRTL-CMGW-NYLRSHEPTENRLVLKSLQCLDQLNP  661

Query  2107  --CTKEFVLKIPNVKVLGIK--CSEIRAFQTETWWDNLHYLTKLEKLIV-----------  2241
               CT  F    PN+K L +     + R  Q    + NL+ L +LE  I            
Sbjct  662   RYCTGPFFRLFPNLKKLKVSGIGEDFRNSQDLYDFRNLYQLEELEFSIFFSSVACFLKNT  721

Query  2242  -----EDIESEQFELQSI-----------------------NSFPQSLKELKIVGT-ELG  2334
                     +  +F+++++                       + FPQ+LK L   G   L 
Sbjct  722   APSGSTPQDPLRFQMETLHLETHFRATAPPTDVPTLLLPPPDCFPQNLKSLTFSGDFFLA  781

Query  2335  WEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPV  2514
             W+ ++I+  LP LE LKL     +GEEW   + GFP LKFL++    ++ W   SDHFP 
Sbjct  782   WKDLSIVGKLPKLEVLKLSYNAFIGEEWEVVEEGFPHLKFLFLDNLYIRYWRASSDHFPY  841

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             LERL L +C+NL+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +YG+
Sbjct  842   LERLFLRNCYNLDSIPRDFADITTLALIDIDYCQQSVGNSAKQIQQDIQDNYGS  895



>gb|EYU21839.1| hypothetical protein MIMGU_mgv1a022812mg [Erythranthe guttata]
Length=872

 Score =   380 bits (977),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 296/905 (33%), Positives = 457/905 (50%), Gaps = 79/905 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK-  258
             AY  L SL   ++   L PRP + + +++++  L   L  L+  LE      + S  E  
Sbjct  3     AYAALLSLKHIIQQIQLHPRPPISL-HQNQVLSLTDTLNFLQEFLEVYSCGGSSSSREAA  61

Query  259   DVI-ARVKDISFRAEDEIESEVMEIISNG--ASHERLHQILQRLAEDI----EGLIEQRN  417
             DV+ +R+ D +  AED IE+ +++ I  G   S + L+Q L++L +D+    + ++E + 
Sbjct  62    DVLESRIADATHAAEDIIETRIVDQILGGERVSSDELYQGLEKLIQDMGFIKKDVMEIKE  121

Query  418   TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIV  597
                 +   +   +N   +    +S       +VG    L    + L    +  R +I IV
Sbjct  122   KNIGIIEDHSLHTNSPTLGGLSSSPSTRQNAVVGLDDLLIEVMDKLTGQPSNLR-IIPIV  180

Query  598   GMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEV  777
             GMGGIGKTT+A+  Y  P I   F +  W  +SQ+Y+++ IL ++  C+ +   +EI   
Sbjct  181   GMGGIGKTTLARNAYGKPLIMHHFDIRAWVAISQNYNVQEILIEILLCIRKDESREILSS  240

Query  778   KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVY  957
             K+  EL   V + L  +RYL+V+DDIW    WD +   FPD+  GSRI++TTRL  VA  
Sbjct  241   KNEGELGETVHKSLWGRRYLIVLDDIWSVEVWDKVNFFFPDNGQGSRIVITTRLSNVASI  300

Query  958   SGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAITVAA  1131
                 G     + FL+ + SW L  + +     + P E+EEIGK+I   C+GLPL+I V  
Sbjct  301   ----GSRGLEMNFLDDDTSWDLLCKNIFEKEEDCPHELEEIGKKIAKNCKGLPLSIVVIG  356

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLL+ +K + E+W+ I+  +N  +  + +++C  +L LSYN+LP HLK CFLY G+FP+ 
Sbjct  357   GLLANSKHTTEHWEYISENLNSIVHLEDNERCLKVLLLSYNHLPVHLKPCFLYMGVFPE-  415

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRL  1491
              R+I    L+ LW++EGF+   SG+SLE  + +YL+DL DRNL+ + +    G IK C +
Sbjct  416   DRKIHVSWLVKLWVSEGFLKPISGKSLEVVSREYLEDLCDRNLIRVHQRGSNGKIKFCNI  475

Query  1492  HDLLFDLCLREVKKEKFVSAFHQRSENV---------IELGDTEPLFEYANRWLTFRTTY  1644
             HDLL ++CLRE ++EKF+    + S N+         I +  +E    Y    L    T 
Sbjct  476   HDLLREVCLREAEREKFLYVPRKHSLNIAQGINTQRRIIIHQSESETGYLRDVLQVNNTL  535

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEI-SFDEAPTFD  1821
             +            +R+L+  F +     LP     N  ++++RVL +V+  S+      D
Sbjct  536   LSVPL--------ARSLMCKFML-----LPSHPGSN--YRLLRVLKVVDKHSYSGYHASD  580

Query  1822  ----ISDLILLRYLALGT----IKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
                 +  L+  R+LA+G      ++   +    NLQTLIVK             +   + 
Sbjct  581   SIEAVLQLVNSRFLAIGADWQNFRFPSSVYLLWNLQTLIVK-------------DMFYAV  627

Query  1978  WLQGLWKSQSLRFIKY-----PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNV  2142
                 +WK   LR I++     P P PI  D+  V   L TL  +   +C +E V +IPNV
Sbjct  628   APSVIWKMTQLRHIEFGLLDLPDP-PIGGDDDFVLGNLQTLLKIRNFKCGEEVVKRIPNV  686

Query  2143  KVLGIKCSEIRAFQTETWWD-----NLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKE  2307
             K L I    +  F+  + +       LH L           +  + +L      P S+K+
Sbjct  687   KKLQI--CYLEEFEGCSSYSLNKLVRLHKLESFSCFFYSQKKPHRNDLLRNLILPNSIKK  744

Query  2308  LKIVGTELGWEAI-TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKN  2484
             L + GT L W+ + T I +LPNL+ LKL     +G EW T DG F  L+FL I       
Sbjct  745   LALRGTNLYWDDMKTKIGLLPNLQVLKLQYNSFVGPEWETVDGQFCNLRFLQIYTCSDLE  804

Query  2485  WETMSD--HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             W T +D  HFP LE L L +   L ++P    +I TLQ IELK+C  S + S + I EEQ
Sbjct  805   WWTTTDSSHFPRLEHLVLCNMDKLNEMPSCIGEIPTLQSIELKNCSDSTIISTRRILEEQ  864

Query  2659  SSYGN  2673
                GN
Sbjct  865   EELGN  869



>ref|XP_010312507.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=874

 Score =   380 bits (977),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 307/923 (33%), Positives = 478/923 (52%), Gaps = 114/923 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  ++SL+ T+E  F   +P +   Y   +Q L Q L  L+ LL+++ K +   +  +
Sbjct  1     MAYAAISSLMYTLEQLFKPNQPFVCRSYTQHVQSLCQNLSALQDLLDDTTKDIETLKVTE  60

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIE---Q  411
                 R++++ ++AE  ++S +  II      +R       ++ L ++   I  LI+   Q
Sbjct  61    ---KRMRNVIYKAEYRVDSSLRRIILADREDKRQKAYTSFYEELLKVKGQIYFLIKEVMQ  117

Query  412   RNTTQMLS-SYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
              N  +  S S    Q  +  I+      ++DD   +     L+R     +   T E  VI
Sbjct  118   INIKKHGSKSAAFSQDQKSTIVENTVVGMKDDFNTI-----LDR-----VTAQTNELTVI  167

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
              I GMGGIGKTT+AKK+YDD  I SRF  L W T+S++Y+ R++L ++   V    ++E 
Sbjct  168   PIFGMGGIGKTTLAKKVYDDSFICSRFDKLAWVTISEEYNERQMLLEVVSSVTTGGNQE-  226

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
                KS  EL   V R L  +R+L+V+DDIW +  WD +QR FP+D N SRILLTTRLK V
Sbjct  227   ---KSDDELMEIVYRGLKGRRFLIVIDDIWSTEAWDQMQRIFPNDDNKSRILLTTRLKYV  283

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITV  1125
             A Y  C      +  FL+  +SW LF++K+   +  PP +EEIGK IV +C+GLPL+I V
Sbjct  284   ADYVNCPDFPPHSKSFLSLEDSWNLFTEKIFKKDPCPPLLEEIGKHIVQQCQGLPLSIVV  343

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AGLL K   + +NW+++   ++      + ++C +IL+LSYN LP +LKACFLY G FP
Sbjct  344   VAGLLGKMDLTHDNWKNVEENLS-SFFGTVSERCQSILSLSYNYLPQYLKACFLYVGGFP  402

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +  REI    L+ LWI E FV     + LE    +YLQ+L+DR+L+L  K S  G +++C
Sbjct  403   E-DREINVSQLIRLWIAEQFVKARKDKRLEVVGEEYLQELVDRSLILTGKQSANGRMRSC  461

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENV----IELGDTE----PLFEYANRWLTFRTT  1641
             ++HDLL  LCL E   E  V   H  + NV    +E+ D +     L ++  + + +R  
Sbjct  462   KIHDLLRQLCLSETHTENVV---HVINGNVVVSSVEVIDDQRRVIGLHKHKEKQV-YRPA  517

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD  1821
             +     S    F  ++ L  +  VS              FK+++VLD+  + +D +    
Sbjct  518   HSNDITSITRTFISTQYLKTYSTVS-------------EFKLLKVLDVSSVYYDFSCV--  562

Query  1822  ISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ---GL  1992
             I +L+ LRY+A    K V + K   NLQT+I+                +G K L+    +
Sbjct  563   IPELVHLRYVAAKIGKGVSLAK-LRNLQTIIL--------------GGLGRKELEQPLDI  607

Query  1993  WKSQSLRFIKY-PYPF----PIDTDEIPVQDTLHTLYWV--PYLRCTKEFVLKIPNVKVL  2151
             W+   LR +     P     P++ +     + L  LY    P++    E + K PN+K L
Sbjct  608   WRMSELRHLDIRSAPLYICNPLEAENRLFLNNLQNLYVYNSPFI---AEIIRKTPNLKKL  664

Query  2152  GIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSIN---------SFPQSLK  2304
              +     R        D+L  L +LE L+++ +ES    + S +         +F  ++K
Sbjct  665   KVLDDSERP-DWSAILDSLILLKELETLLIK-LESIDINIFSGDILPCKIKKMTFSSNIK  722

Query  2305  ELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFL---YISGA  2472
             +L ++ T + WE + +++ L NLE LK  +++  G+ W +  D  F KLK+L   YI+  
Sbjct  723   KLILLDTCIPWEVVNLLANLSNLEVLKGYRSFN-GKYWRLNEDVVFRKLKYLQIVYIATE  781

Query  2473  KLKNWE-------------TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDC  2613
             + K W                S++FP+LE+L L+  H LE+IPE   DI TL+ IE+K C
Sbjct  782   RWKVWRDKQFVGLEMWELAAGSNNFPMLEQLKLYGLHKLEEIPESIGDIMTLKFIEIKRC  841

Query  2614  FPSLVESAKDIQEEQSSYGNDQL  2682
                +  SAK IQ+EQ S GN +L
Sbjct  842   SSGVENSAKRIQQEQESLGNYEL  864



>gb|AEW48208.1| disease resistance protein RGH4 [Solanum huancabambense]
Length=877

 Score =   380 bits (977),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 308/926 (33%), Positives = 464/926 (50%), Gaps = 120/926 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q    +  +    P  S+     EH +       Q D IMVG   ELE   + L +   
Sbjct  108   KQWMAASDSMKDLKPQTSSLVSLPEHDVE------QPDNIMVGRENELEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +LQ L   ++ 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSISD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D          +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPD---------YQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +  +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPHHMRLMKFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ IA  ++  ++ D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKMGQRLDEWQRIAENVSSVVSRDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   EI    L+ LW  E F+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFAE-DEEIYVNKLVELWAVERFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R      
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSR------  501

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQN-----VSFKMIRVLDLVEISFD  1803
                        + H    L++    S A  + +S   N     +SFK++RVLDL    + 
Sbjct  502   ----------SSIHNEEELVWCRN-SEAHSIIMSRIFNCITLELSFKLVRVLDLGLTYYP  550

Query  1804  EAPTFDISDLILLRYLALGTIK-YVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKW  1980
               P+  +S LI LRYL+L  +   ++       + +LI+  P S          ++   +
Sbjct  551   IFPSGVLS-LIHLRYLSLCLVPCLLQDRGSTEGVPSLIIDIPLSISSLCFLQTFKLNHPF  609

Query  1981  --------------LQGLWK-SQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTK  2115
                           +  L K   S  +++   P    T+   V  +L  L  +    CT 
Sbjct  610   DTFHPFILPSKILTMPQLRKLCMSWNYLRSHEP----TENRLVLKSLQCLNQLNPRYCTG  665

Query  2116  EFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL---------------IV  2241
              F    PN   +KV G+       F+      +  YL +LEKL                 
Sbjct  666   SFFRLFPNLKKLKVFGVP----EDFRNHKDLYDFRYLYQLEKLAFGTYYPSSACFLKNTA  721

Query  2242  EDIESEQFELQSINSFPQSLKELKIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEW  2418
                +     L   ++FPQ+LK L   G   L W+ ++I+  LP LE LKL     +GEEW
Sbjct  722   PPTDVPTLLLPPPDAFPQNLKSLTFSGEFFLAWKNLSIVGKLPKLEVLKLSWISFIGEEW  781

Query  2419  VTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLI  2598
                + GFP LK L++    ++ W   S+HFP LERL L  C+ L+ IP    DITTL LI
Sbjct  782   EVVEEGFPHLKLLFLHHVDIRYWRASSEHFPYLERLFLSDCYYLDSIPRDSADITTLALI  841

Query  2599  ELKDCFPSLVESAKDIQEE-QSSYGN  2673
             ++  C  S+  SAK IQ++ Q +YG+
Sbjct  842   DITHCQQSVGNSAKQIQQDIQDNYGS  867



>ref|XP_009781183.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=711

 Score =   376 bits (965),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 258/743 (35%), Positives = 373/743 (50%), Gaps = 80/743 (11%)
 Frame = +1

Query  553   LLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDL  732
             L+  + +E  V+S+VGMGGIGK+T+A  I+ +PS+   F +  W TVSQ YD+R +L D+
Sbjct  12    LIGGNARELNVVSVVGMGGIGKSTLAGSIFRNPSVFYHFDVSSWVTVSQKYDVREMLLDV  71

Query  733   CGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNG  912
                    + K +    S  +L  +V R+L  +RYL+V+DDIW    W+ + R F DD NG
Sbjct  72    LS-FGTPSLKAMYSNLSNDQLLEQVYRKLKGKRYLIVLDDIWSIEAWNLVIRSFSDDENG  130

Query  913   SRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIV  1089
             SRI+LT RL EVA+ +G    Y  N+PFLN   SW L + K+ G +  P  +E +GK+I 
Sbjct  131   SRIMLT-RLSEVAMSAG--NGYTFNMPFLNLENSWKLLADKVFGIVVCPLRLESMGKQIA  187

Query  1090  NKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYH  1269
              +C+GLPL++ V AGLL K  R+ ++WQ +  +M         +QC  IL LSYN LP  
Sbjct  188   QQCQGLPLSLVVIAGLLPKISRTYKDWQKVLESMK-SHEGSTSEQCLAILALSYNYLPCS  246

Query  1270  LKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLI  1449
             LKACFLY G FP+  +EI    L+ +W+ EGF+   S + LEE A + L+DL  R+L+++
Sbjct  247   LKACFLYMGAFPE-DKEIHVDKLIKIWVAEGFLKPSSHKKLEEVAEECLEDLFSRSLIIV  305

Query  1450  SKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLT  1629
             S+    G I++CR+HDLL  LCLRE K EKF     +  E   E  + E         L 
Sbjct  306   SRRRANGKIRSCRIHDLLRQLCLREGKSEKFFHVMTKSFEMSAECMEIEHRLCLHTDGLE  365

Query  1630  FRTTYIQPKFSDKYNFHKSRTLLFF-----FGVSGASGLPVSWRQNVSFKMIRVLDLVEI  1794
              ++  ++     K NF   RT+L       F  SG   +      +  F+++RVLD+  I
Sbjct  366   NQSLALE-----KGNFDSVRTILCLGELHSFLNSGCYKI-----VDPRFELLRVLDVQNI  415

Query  1795  SFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGS  1974
              F   P  +I+ L+ LRY++  T   V                P S              
Sbjct  416   HFPSFPN-EITQLVQLRYVSFTTGSEV----------------PAS--------------  444

Query  1975  KWLQGLWKSQSLRFIKYP----YPF-----PIDTDEIPVQDTLHTL-YWVPYLRCTKEFV  2124
               +  LW  Q++  I       +P       + ++    ++ +H          C KE  
Sbjct  445   --ISNLWNLQTMSVISVAENELHPAIGNLEDVKSETFQSREIVHACSSQGTKFSCWKEIF  502

Query  2125  LKIPNVKVLGI----KCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFEL------Q  2274
             + + NVK LG+      +E   F      D+L  L+ L KL +        +        
Sbjct  503   MAVTNVKALGVLINPDLNEWSNFN-----DSLICLSDLRKLRIHLALPPYVQFFPRLPAP  557

Query  2275  SINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKF  2454
               NSFP+ L  L +  T L W+ I+ +  LPNLE LKL      G  W   +GGF KLK 
Sbjct  558   QWNSFPEKLMHLTLEATHLLWKDISFLGKLPNLEVLKLKYFAFQGSNWNLNEGGFKKLKL  617

Query  2455  LYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVES  2634
             L+I    L  W+  SD  P LE L L HC+ L+++     DI TL+LIEL  C  +    
Sbjct  618   LHIFMTNLVQWKATSDSLPSLECLVLRHCYKLKEMASEIGDIPTLELIELHHCSHAAATC  677

Query  2635  AKDIQEEQSSYGNDQLVVRDYDT  2703
              ++I EEQ S GN+ LV   Y+T
Sbjct  678   VEEILEEQKSMGNEILVAHAYNT  700



>gb|AGX27496.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   375 bits (963),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 258/717 (36%), Positives = 386/717 (54%), Gaps = 56/717 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLY  259

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  260   MGAFPE-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  318

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD        +R +   +    
Sbjct  319   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDI  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              +  D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   DRPLDQMQLTRS-----FLSIGDASQEVLSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  420

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIV---KFPNSCRieeidsdeeiGSKWLQGLWKS  2001
             L+ LRYLAL T +    +    NLQ LIV   +F ++  +   +            +   
Sbjct  421   LVNLRYLALSTSELPSSISRLWNLQILIVQAIRFSSNPHVVTPE------------ILDM  468

Query  2002  QSLRFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E
Sbjct  469   PQLRHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE  528

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWE  2340
                       D++  L++L  L   +  S ++    L S  +FP SLK+L +    + + 
Sbjct  529   K--------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYR  580

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE
Sbjct  581   DMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLE  640

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  641   HLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>ref|XP_011072557.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=891

 Score =   380 bits (976),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 300/908 (33%), Positives = 459/908 (51%), Gaps = 94/908 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L SL+ T+E     PRP + +D ++++Q L++K+          +    +SQ   D
Sbjct  4     AYAALVSLVHTIEQIQHHPRPPVSLD-ENQVQSLQEKVA--FLQDFLEDYSHRLSQEHGD  60

Query  262   -VIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDI-------EG  399
              ++ R+ D +  AED IES +++ I      ++G     +    Q L  +I       + 
Sbjct  61    GLMVRIADAAHAAEDVIESRIVDQIHDQSTSTHGEKMSSIDHFYQDLQNEIAEMDLIKKE  120

Query  400   LIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQER  579
             +IE +   +++       S     ++   S +Q  A MVG    L    + L    +  R
Sbjct  121   VIEIKGKMRLIQDQLHRDSLAAGSLSSSTSMVQKQA-MVGIDDVLIEIMDKLTGQHSSSR  179

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ-MT  756
              +I IVGMGGIGKTT+A+ +  +P I   F +  W TVSQ+Y+ R+IL +L   + +   
Sbjct  180   -IIPIVGMGGIGKTTLARNVCQNPLIVQYFDIRAWVTVSQEYNTRQILLELNLDIEKDEG  238

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             +K+    KS  EL   + + L  +RYL+++DD+W +  WD+++  FP++++ SRI++TTR
Sbjct  239   NKKKLRQKSEEELGEIIYKSLFGRRYLIIMDDMWTAEVWDNVKFFFPNNNSESRIMITTR  298

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLP  1110
             L  +A     +G +   + FL+  ESW L  + +     N P E+EEIG++I   C+GLP
Sbjct  299   LSNLAFQ--ITGSHGLRMNFLDEEESWDLLCKTVFGEESNCPHELEEIGRKIAKHCKGLP  356

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L+I V  GLL+K+K++ + W+ I   ++  ++ + +++C  IL  SY+ LP HLK CFLY
Sbjct  357   LSIVVIGGLLAKSKQTCDYWEYIVENLSSIVSLEDNERCLRILYTSYHQLPVHLKPCFLY  416

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
               +FP+  REI    ++ LW+ EGF+   SG+S+EE A KY +DLIDRNL+L+    F G
Sbjct  417   MRVFPE-DREIRVSQIIKLWVAEGFLKPISGKSMEEVAEKYFKDLIDRNLILVRGFGFNG  475

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
              I+ C +HDLL DLCL+E +KEKF+  +H   + +            A R    R    Q
Sbjct  476   RIRFCNIHDLLRDLCLKEAQKEKFL-CYHDIRKGI-----------NAQR----RIVVHQ  519

Query  1651  PKFSDKYNFH-------KSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISF---  1800
                 +K++         ++R+L+  F   GA           S +++RVL+L +      
Sbjct  520   NASKNKHDISQVLQSAARARSLICDF--QGALLFD-------SLRLLRVLNLADWDGVYS  570

Query  1801  ------DEAPTFDISDLILLRYLALG-----TIKYVRVLKHHHNLQTLIVKFPNSCRiee  1947
                   DE  +  I  L+  RYLA       +  +   L    NLQT+IVK  +      
Sbjct  571   RYQGLQDEYFSEAIFKLVNSRYLAFRADLNLSSGFRSSLHLLWNLQTVIVKEMHVIDAP-  629

Query  1948  idsdeeiGSKWLQGLWKSQSLRFIKYPY---PFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
                          G+WK   LR +++ +   P P   DE  V + L T+  +   +C ++
Sbjct  630   ------------PGIWKLPQLRHVQFYWFHLPDPPAGDEF-VLENLQTMSSILNFKCGED  676

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSIN-SFPQ  2295
              V +IPN+K L I   +     +     NL  L KLE L        +  L   N SFP 
Sbjct  677   VVKRIPNIKKLRIGYDDFSF--SHYCLQNLDRLHKLESLACTFQSRPRRSLLLNNLSFPY  734

Query  2296  SLKELKIVGTELGWEAI-TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGA  2472
             SL++L +    L WE I T I  LP LE LKL  A  MG +W T +G F  LK L + G 
Sbjct  735   SLRKLNLYRNGLHWEDIATKIGSLPFLEVLKLFDAV-MGPKWETVEGQFCSLKVLLVDGC  793

Query  2473  -KLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQ  2649
               LK+W T S HFP LE L L    NL++ P G  +I TLQ I+L  C  S + + K I 
Sbjct  794   YDLKSWTTESSHFPCLEHLILIEAGNLKEFPPGIGEIPTLQTIQLIFCSSSAIVTTKRIV  853

Query  2650  EEQSSYGN  2673
             EEQ   GN
Sbjct  854   EEQEELGN  861



>gb|AGW28124.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   375 bits (962),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 258/717 (36%), Positives = 386/717 (54%), Gaps = 56/717 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLY  259

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  260   MGAFPE-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  318

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD        +R +   +    
Sbjct  319   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDI  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              +  D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   DRPLDQMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  420

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIV---KFPNSCRieeidsdeeiGSKWLQGLWKS  2001
             L+ LRYLAL T +    +    NLQ LIV   +F ++  +   +            +   
Sbjct  421   LVNLRYLALSTSELPSSISRLWNLQILIVQAIRFSSNPHVVTPE------------ILDM  468

Query  2002  QSLRFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E
Sbjct  469   PQLRHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE  528

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWE  2340
                       D++  L++L  L   +  S ++    L S  +FP SLK+L +    + + 
Sbjct  529   K--------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYR  580

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE
Sbjct  581   DMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLE  640

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  641   HLVIRHCAHLNEIPSGIGDIPTLQVIEVHECRRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AGX27495.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27497.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27498.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   375 bits (962),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 258/717 (36%), Positives = 386/717 (54%), Gaps = 56/717 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLY  259

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  260   MGAFPE-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  318

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD        +R +   +    
Sbjct  319   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDI  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              +  D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   DRPLDQMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  420

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIV---KFPNSCRieeidsdeeiGSKWLQGLWKS  2001
             L+ LRYLAL T +    +    NLQ LIV   +F ++  +   +            +   
Sbjct  421   LVNLRYLALSTSELPSSISRLWNLQILIVQAIRFSSNPHVVTPE------------ILDM  468

Query  2002  QSLRFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E
Sbjct  469   PQLRHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE  528

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWE  2340
                       D++  L++L  L   +  S ++    L S  +FP SLK+L +    + + 
Sbjct  529   K--------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYR  580

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE
Sbjct  581   DMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLE  640

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  641   HLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AGX27494.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   375 bits (962),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 258/714 (36%), Positives = 384/714 (54%), Gaps = 50/714 (7%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLY  259

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  260   MGAFPE-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  318

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD        +R +   +    
Sbjct  319   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDI  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              +  D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   DRPLDQMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  420

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
             L+ LRYLAL T +    +    NLQ LIV+         + + E         +     L
Sbjct  421   LVNLRYLALSTSELPSSISRLWNLQILIVQATRFSSNPHVVTPE---------ILDMPQL  471

Query  2011  RFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRA  2178
             R IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E   
Sbjct  472   RHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILAPGLNDRVLQTIPNLGKLGIFCDEK--  529

Query  2179  FQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWEAIT  2349
                    D++  L++L  L   +  S ++    L S  +FP SLK+L +    + +  ++
Sbjct  530   ------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMS  583

Query  2350  IISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLA  2529
             II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE L 
Sbjct  584   IIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLV  643

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  644   IRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   380 bits (975),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 293/873 (34%), Positives = 475/873 (54%), Gaps = 63/873 (7%)
 Frame = +1

Query  148   LVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVME  327
             L+   KD+++ L ++L  +KA L++S +K +  +  +++++++  +++ AED I++ V  
Sbjct  23    LLSGVKDQVESLHRELSLMKAFLKDSREKRSEYEYVRELVSQITIVAYEAEDIIDTFVTN  82

Query  328   IISNGASH---ERLHQI-----LQRLAEDIEGL---IEQRNTTQM--LSSYNPGQSNQEH  468
                  A       LH       L+ +A++IE +   +++    +M  + S + G+S++  
Sbjct  83    AAMQKARSPVGRALHVFDHSSKLRNVAKEIESIKVKVKEIYDKKMFGIQSLHGGESSRRS  142

Query  469   IIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDD  648
                     ++++ + VG   E  +    L   S +E ++ISIVGMGG+GKTT+AKK+Y D
Sbjct  143   PPQKRVPMVEEENV-VGFDDEAMKISSRLTNGS-EELEIISIVGMGGLGKTTLAKKVYTD  200

Query  649   PSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK--EINEVKSTAELANKVRRRLM  822
             PS+   F+   W  VSQ Y  + +   +   +  +TD+  ++N+ K   EL + +R +  
Sbjct  201   PSVEFHFYNRAWIYVSQLYSRKEVFLGILDSLGLITDEMYKMNDEKLAGELFSHLRSK--  258

Query  823   RQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLN  1002
               RYL+V+DD+W    WDDLQ  FP  ++GSRILLTTR  EVA+++   G    +L FL 
Sbjct  259   --RYLVVIDDVWTMEAWDDLQMAFPKTASGSRILLTTRNTEVALHANPEG-LPHHLRFLT  315

Query  1003  SNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQ  1173
               ESW L S+K+   GS   P E+E+IG +I  KC GLPLAI V +GLL K +++ + W+
Sbjct  316   HEESWELLSKKVFRKGSC--PLELEDIGLQIAKKCYGLPLAIVVVSGLLLKKEKTRDWWK  373

Query  1174  SIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWI  1353
              +A+ ++  +  D   QC  +L LSY +LP HLK CF+YFG+FP+   EIP   LL LW 
Sbjct  374   KVANDVSSYVARD-PKQCMDVLALSYKHLPDHLKVCFIYFGVFPE-DFEIPVWKLLRLWT  431

Query  1354  TEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKK  1533
             +EGF+ +     LE+ A +YL+DL+DRNLVL++K    G IK+CR+HD+L DL ++   +
Sbjct  432   SEGFIQQMGQECLEDTAEEYLEDLVDRNLVLVAKKRANGRIKSCRVHDMLRDLSVKMGSE  491

Query  1534  EKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGV  1713
             EKF+  F + ++N         + +Y  R L   + ++    S  +     R+ L F   
Sbjct  492   EKFLEVFKESAQN----HSLSSISKYHRR-LCVHSHFLDFITSRPFG-PNVRSFLCF---  542

Query  1714  SGASGLPVSWRQNVS-----FKMIRVLDLVEISFDEAPTFDISDLILLRYLAL-GTIKYV  1875
               AS      R++ S     F+++RVLDL  I+F   P  +I  L+ LRY+AL G  + +
Sbjct  543   --ASEEMELLREHTSFLHEAFRLVRVLDLKYINFPRFPN-EIVQLVHLRYIALSGNFRVL  599

Query  1876  RV-LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTD  2052
                +    NL+TLIV+     R  +I  D    S++ + L+ S  L  ++ P       +
Sbjct  600   PASISKLWNLETLIVR--TKSRELDIQVDIWKMSQF-KHLYTS-GLSCLRGPPAKTRKDN  655

Query  2053  EIP-VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQT---ETWWDNLHYLT  2220
             E P V+  + T+  V    C +  + + P ++ LGI+        T    + +DNL  L 
Sbjct  656   EDPFVRRNIQTISTVLPDCCKENILARTPGLRKLGIRGKVATLVATNGDSSLFDNLAKLD  715

Query  2221  KLEKL-IVED---IESEQFELQSIN---SFPQSLKELKIVGTELGWEAITIISMLPNLES  2379
              LE L ++ D   +   Q ++  +     FP +LK+L +  T L W  I+ + MLPNLE 
Sbjct  716   NLETLKLLNDTFPLPPSQCQISGLPQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEV  775

Query  2380  LKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKI  2559
             LKL      G +W   DGGF  L+ L+I    L++W     HFP L+++ L HC +L +I
Sbjct  776   LKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEI  835

Query  2560  PEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             P G  ++ +LQ +EL    P+   SA+ IQ+E+
Sbjct  836   PFGLVEVPSLQNMELFWPTPAAAASARFIQQEK  868



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score =   379 bits (973),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 308/954 (32%), Positives = 471/954 (49%), Gaps = 156/954 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             MAY  +TSL++T++ L  L P+         +I+ L QK+             ++  +  
Sbjct  1     MAYTEVTSLMQTLQRLMQLHPKS------GKKIESLLQKV------SLLQGFFVDTGKDH  48

Query  256   KDVIAR---VKDISFRAEDEIESEVMEIISNGASHER-------LHQILQRLAEDIEGLI  405
             +D+      ++D+S +AED +E E+M   S+ +S ++       ++++L R  + IE  I
Sbjct  49    EDIKCLEGIIRDVSCKAEDLVE-EIMFEYSSSSSLKKNAIKFLGVNRVLFRKIKSIEAAI  107

Query  406   EQ----------------------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVG  519
                                     R+ TQ LSS       Q+ ++ G    L DD +++ 
Sbjct  108   TSVYNDISAIKGRSTPSSSVNGCSRDVTQTLSS-------QKDVVVG----LDDDFLLI-  155

Query  520   HAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQ  699
              A +L    + L         V+ I GMGGIGKTT+AK+I+ D  I   F++  W TVS+
Sbjct  156   -ADKLTGYPDKL--------DVVVIFGMGGIGKTTLAKRIFHDKLIEEHFYVRAWITVSE  206

Query  700   DYDLRRILQDLCGCVAQ---MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRG  870
              Y +R +L DL GC ++   + D+  NE     ELA ++ + L  QRYL+V+DD+W ++ 
Sbjct  207   RYKVRNMLLDLLGCTSKVPFIMDEMENE-----ELAERLYKSLKGQRYLIVMDDVWNTKA  261

Query  871   WDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLP----FLNSNESWMLFSQKL  1038
             WDD++R FP+D  GSR+++T+R+ +VA +         N P    FL  +ESW L  +K+
Sbjct  262   WDDVRRYFPNDKIGSRVMVTSRIMKVARFIN-----PLNPPHQMRFLTVDESWKLLQKKI  316

Query  1039  GSINLPP-----EIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPM  1203
               ++ P      E+E IG +I  KC+GLPLAI + AG+LSK   +   W  +A  ++   
Sbjct  317   LGLDDPSFCCDYEMERIGMQISKKCKGLPLAIVMVAGILSKESATASKWSDVAENIHSSF  376

Query  1204  TSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSG  1383
              ++   +   IL LSYN+LP+HLKACFLY G FP+   EIP   L+ LW  EGF+  DS 
Sbjct  377   VTEESREFLDILALSYNHLPHHLKACFLYMGAFPE-DVEIPVWRLIRLWTAEGFIKLDSP  435

Query  1384  RSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQR  1563
             ++LE  A +YLQ+LIDR+L+++SK S+   +KTC +HD+L + C  E K+EK +    + 
Sbjct  436   KTLEFVAQEYLQELIDRSLIIVSKRSYDNRVKTCSIHDILRNFCQEEAKQEKLLHVVRR-  494

Query  1564  SENVIELGDTEPLF-EYANRWLTFRT---TYIQPKFSDKYNFHKSRTLLFFFGVSGASGL  1731
                       EP F +  +R L F +    Y    +S+ Y       +  F      S L
Sbjct  495   ---------LEPHFPQGVHRRLHFHSDIFAYSSYTYSNPY-------VRSFLSSKACSVL  538

Query  1732  PVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQT  1908
               S+   + FK++RVLD+V  SF   P   I  L+ LRYLAL    +  R +    NLQT
Sbjct  539   EDSYFGCMGFKLLRVLDVVNYSFYGFPIHVIK-LVHLRYLALSINSELPRSISKLKNLQT  597

Query  1909  LIVKFPNSCRieeidsdeeiGSKWLQGL----WKSQSLRFIKYP-----YPFPI---DTD  2052
             LI+ +               G+K ++ L    WK   LR I        +  PI      
Sbjct  598   LIIYW---------------GTKEMRILPLEIWKMPILRHIHVKGDVLLFGSPIADHSKR  642

Query  2053  EIPVQDTLHTL--YWVPYLRCTKEFVLKIPNVKVLG---IKCSEIRAFQTE---TWWDNL  2208
                V   L TL    +  +  +   V  +PN+K L    +      AF  +   +  +NL
Sbjct  643   NFQVLGNLQTLCTITISTISFSHGLVATLPNLKTLASNLVTGGNHDAFDVDWLGSCLNNL  702

Query  2209  HYLTKLEKL-----IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNL  2373
               +  LE L     +  +    +  +Q  N+FP +LK L +  + L WE   ++  LPNL
Sbjct  703   EQMYSLETLKLLFNLPMNNPRPRNSIQRWNAFPPNLKNLTLSCSFLLWEDARVLGNLPNL  762

Query  2374  ESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE---TMSDHFPVLERLALHHCH  2544
             E LKL      G EW T + GF +LK+L +    L  W+   T S  FPVL+ L L  C+
Sbjct  763   EVLKLKDFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQASTDSYPFPVLQHLVLRFCY  822

Query  2545  NLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
              L++IP    DI +LQ+I+L  C P     A+ I++EQ   GN  L V  +  R
Sbjct  823   KLKEIPYEIGDIPSLQVIKLHSCSPYATRLARMIEKEQIDSGNSCLEVFIHPAR  876



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score =   379 bits (973),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 312/959 (33%), Positives = 474/959 (49%), Gaps = 137/959 (14%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  L SL +T++      +  +    K +I      L H      ++     V +AE+
Sbjct  1     MAYAALVSLAQTIDQILNHDQYTISPQEKQQI-----TLIHENITSLQAFLDDVVEKAER  55

Query  259   DVIARVKDISFRAEDEIESEVMEII-------------------------SNGASHERLH  363
              +  R+ D++  AED IE  + E I                         +N   +    
Sbjct  56    -LEGRIADVANEAEDIIEHFMSEQIRARHGLVIESNIQPSKCKFMPCIRGTNRTMYNNQL  114

Query  364   QILQRLAEDIEGL----IEQRNTTQMLSS-----YNPGQSNQEHIIAGGASKLQDDAIMV  516
               L+++ ++IE +    +E +NT+ M  S     + PG S++    AG          MV
Sbjct  115   LDLKKVIDEIESIAQATMEIKNTSNMEDSPLDDSWYPGSSSRTVTTAGD---------MV  165

Query  517   GHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVS  696
             G   +L   K  L   S++  QVI I+GMGGIGKTT+A+  YDD  +  RF +  W +VS
Sbjct  166   GFDDDLMEIKTRLCGESSK-LQVIPIIGMGGIGKTTLARNAYDDQLMVQRFDIRVWVSVS  224

Query  697   QDYDLRRILQDLCGCVAQMTDKEINEVKSTAE----------------------------  792
              DY   RIL  L   +    ++E +E  + ++                            
Sbjct  225   HDYSPTRILSALLVSMKTFINQERSEDSNESKQQRFEEDNIESEEQISEDDNESQKRRQL  284

Query  793   ----LANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYS  960
                 +A KV + L  +RYL+V+DD+W ++ WDD++  FPDD NGSRI+LTTRL +VA Y 
Sbjct  285   DMSLMAEKVYKSLKGRRYLIVMDDVWSTKAWDDIRNMFPDDDNGSRIVLTTRLSDVASYP  344

Query  961   GCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGL  1137
                   +  + F++++ SW L  +K+    + P E+E IGK I   CRGLPLAI V  G+
Sbjct  345   DPFTP-LHEMHFMDTDRSWSLLQKKVFAGQDCPHELERIGKEIARNCRGLPLAIVVIGGI  403

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRR  1317
             LS   R+  +W  I   ++    ++ + Q   IL+LSY +LP+HL+ CFLY G FP+   
Sbjct  404   LSTISRTRASWSEIMRNVSSAFATNNNGQFEKILSLSYTHLPHHLRPCFLYMGGFPE-DY  462

Query  1318  EIPTKDLLNLWITEGFVM--EDSGR-SLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCR  1488
             EI    L+ LW+ EGF+    D GR SLEE A +YL DLI R+LVL++     G IK+C 
Sbjct  463   EIHVSKLVKLWVAEGFLKPPPDIGRKSLEEIAEEYLLDLIKRSLVLVTGTKSNGRIKSCS  522

Query  1489  LHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDK  1668
             +HDL+ DLC+R+ ++E F           +++ D     E         T+Y       +
Sbjct  523   VHDLVRDLCIRKAQQESF----------FVQVVDKHVFLESVKYLRRVSTSYSNL----R  568

Query  1669  YNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDL----VEISFDEAPTFDISDLI  1836
             Y     RT+++F   SG+     S   ++ F+++RVLD+    +   F   P   + +L 
Sbjct  569   YRSSIVRTIMYFDQRSGS-----SIDSSLKFRLLRVLDVDNSYIYSEFVPLPN-QLFELF  622

Query  1837  LLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGL----WKS  2001
              LRYLAL    K    + +  NL+TL+++                 S ++  L    W+ 
Sbjct  623   HLRYLALDYPTKIPTTITNLKNLETLVIR---------PRKTLSRRSYYITNLPLDIWRM  673

Query  2002  QSLRFIKYPY----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIK-CS  2166
               LR I   Y    P P  +    +++ L TL  +    C +  +  IPN+K LG+  C+
Sbjct  674   PKLRHIFCFYIGQLPDPEGSATCGLEN-LQTLSSLTNFVCVERIIKMIPNLKKLGLAFCT  732

Query  2167  EIRAFQTETWW--DNLHYLTKLEKL--IVEDIESEQFELQSINSFPQSLKELKIVGTELG  2334
               + ++    +  +NL YL +LEKL  +VE       +L     FP  L++L + G  L 
Sbjct  733   SDKPYEDIEHYCLENLVYLHQLEKLKFVVESDFPSPVKLH-FPVFPMKLRKLTLSGWRLP  791

Query  2335  WEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPV  2514
             W+ +TI+  LPNL+ LKL ++  +G+ W T +G F +L FL I  + L+NW T S HFP 
Sbjct  792   WKDMTIVGSLPNLQVLKLRESACVGDTWETIEGEFLELNFLMIEESDLRNWITESSHFPN  851

Query  2515  LERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             L+ L +  C  L +IP+G  +I TL+LIE++     LVESAK IQEEQ S GND L VR
Sbjct  852   LKWLVIRRCRYLREIPDGIGEIATLELIEVEMRNKYLVESAKRIQEEQESLGNDALQVR  910



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score =   379 bits (972),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 308/960 (32%), Positives = 464/960 (48%), Gaps = 167/960 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIVEVAYTTEDMVDSESRSVFLAQNLEERSRAMWEIFFVLEQALEYIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q    +  +    P  S+     EH +       Q + IMVG   E E   + L +   
Sbjct  108   KQWMAASDSMKDLKPQTSSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R ++  L   ++ 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSISD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA  +  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAECAR-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  +++  WQ +A  ++  +++DL  +C  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKISKTLGVWQYVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   +I    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFAE-DEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRS-ENVIELGDTEPLFEYANRWLTFR  1635
             SF G I++C +HD+  +LCLRE +   FV+    +S +N  E                 +
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSYQNSCE-----------------Q  490

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFD  1803
             +     K  ++   H  + L++       S + +   + V    SFK++RVLDL      
Sbjct  491   SMQCSFKSRNRIRIHNEKKLVWCCSSEAHSIIMLGGFKCVTLALSFKLVRVLDL---GLT  547

Query  1804  EAPTF--DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdee  1965
               P F   +  L  LRYL+L    +   LK +      + + I+  P S           
Sbjct  548   ICPFFPSGVLSLFHLRYLSLC---FKPCLKQYRGSKEAVPSSIIDIPLSISSLC------  598

Query  1966  iGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR-------------  2106
                 +LQ            YP+  P +   +P    LH + W  YL+             
Sbjct  599   ----YLQTFKLYLPFPNSSYPFILPSEILTMPQLRKLH-MGW-NYLQSHEPTENRLVLKS  652

Query  2107  -----------CTKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL---  2235
                        CT  F    PN   +KV G+       F+      +  YL +LEKL   
Sbjct  653   LQCLNQLNPRYCTGSFFRLFPNLKKLKVFGVP----EDFRNHKDLYDFRYLYQLEKLTFG  708

Query  2236  --------------------------------IVEDIESEQFELQSINSFPQSLKELKIV  2319
                                                  +     L   ++FPQ+LK L   
Sbjct  709   IYYSPIACFLKNAAPSGSTPQDPLRFQTRFGGTAPPTDVPTLLLPPPDAFPQNLKSLTFR  768

Query  2320  GT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETM  2496
             G   L W+ ++I+  L  LE LKL     +GEEW   + GFP LKFL++    ++ W   
Sbjct  769   GKFSLAWKDLSIVGKLSKLEVLKLSDNAFIGEEWEVVEEGFPHLKFLFLDRVYIRYWRAS  828

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             SDHFP LERL L  C++L+ IP  F DITTL LI++ DC  S+  SAK IQ++ Q +YG+
Sbjct  829   SDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISDCKQSVGNSAKQIQQDIQDNYGS  888



>gb|AGX27493.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   373 bits (957),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 258/717 (36%), Positives = 385/717 (54%), Gaps = 56/717 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLY  259

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW  EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  260   MGAFPE-DSEIDASRLIKLWGAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  318

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD        +R +   +    
Sbjct  319   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDI  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
              +  D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   DRPLDQMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  420

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIV---KFPNSCRieeidsdeeiGSKWLQGLWKS  2001
             L+ LRYLAL T +    +    NLQ LIV   +F ++  +   +            +   
Sbjct  421   LVNLRYLALSTSELPSSISRLWNLQILIVQAIRFSSNPHVVTPE------------ILDM  468

Query  2002  QSLRFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E
Sbjct  469   PQLRHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE  528

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWE  2340
                       D++  L++L  L   +  S ++    L S  +FP SLK+L +    + + 
Sbjct  529   K--------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYR  580

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE
Sbjct  581   DMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLE  640

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  641   HLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AAF04603.1|AF195939_1 disease resistance protein Gpa2 [Solanum tuberosum]
 emb|CAB55838.1| NBS-LRR protein [Solanum tuberosum subsp. andigenum]
Length=912

 Score =   378 bits (971),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 308/963 (32%), Positives = 470/963 (49%), Gaps = 167/963 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++    E       ++ 
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHE------GLTI  53

Query  250   AEKDVIARVKDISFRAEDEIESEVMEII--SNGASHER----LHQILQRLAEDIEGLIEQ  411
              E ++I    ++++  ED ++SE   +    N     R    +  +L++  E I+  ++Q
Sbjct  54    LEVEII----EVAYTTEDMVDSESRNVFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                T+  +    P  S+     EH +       Q + IMVG   E E   + L +   +E
Sbjct  110   WMATSDSMKDLKPQTSSLVSLPEHDVE------QPENIMVGRENEFEMMLDQLAR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +   
Sbjct  163   LEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D          +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLTTR
Sbjct  223   D---------YQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRG  1104
               EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC G
Sbjct  274   NVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGG  330

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLAIT+ AGLLSK  ++++ WQ++A  +   +++DL  +C  +L LSY++LP HLK CF
Sbjct  331   LPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKPCF  390

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF IF +  R I    L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  +SF
Sbjct  391   LYFAIFAEDER-IYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNVSF  449

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTY  1644
              G  + C +HD+  +LCLRE +   FV+    +S+        +  F+  +R        
Sbjct  450   DGETQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIHNEEE  509

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF--  1818
             +   +      H   TL  F  V+            +SFK++RVLDL        P F  
Sbjct  510   L--VWCRNSEAHSIITLCIFKCVT----------LELSFKLVRVLDL---GLTTCPIFPS  554

Query  1819  DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
              +  LI LRYL+L   ++   L+ +      + + I+  P S                + 
Sbjct  555   GVLSLIHLRYLSL---RFNPRLQQYRGSKEAVPSSIIDIPLS----------------IS  595

Query  1987  GLWKSQSLRFIK-----YPYPFPIDTDEIP----------------------VQDTLHTL  2085
              L   Q+ +        YP+  P +   +P                      V  +L  L
Sbjct  596   SLCYLQTFKLYHPFPNCYPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCL  655

Query  2086  YWVPYLRCTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIES  2256
               +    CT  F+   PN+K   V G+K      F+      +  YL +LEKL      S
Sbjct  656   NELNPRYCTGSFLRLFPNLKKLEVFGVK----EDFRNHKDLYDFRYLYQLEKLAFSTYYS  711

Query  2257  E-------------------QFELQSI-----------------------NSFPQSLKEL  2310
                                 +F+++++                       + FPQ+LK L
Sbjct  712   SSACFLKNTAPLGSTPQDPLRFQMETLHLETHSRATAPPTDVPTFLLPPPDCFPQNLKSL  771

Query  2311  KIVGT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNW  2487
                G   L W+ ++I+  LP LE L+L      GEEW   + GFP LKFL++    ++ W
Sbjct  772   TFSGDFFLAWKDLSIVGKLPKLEVLQLSHNAFKGEEWEVVEEGFPHLKFLFLDSIYIRYW  831

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSS  2664
                SDHFP LERL L  C  L+ IP  F DITTL LI++  C  S+  SAK IQ++ Q +
Sbjct  832   RASSDHFPYLERLFLSDCFYLDSIPRDFADITTLALIDIFRCQQSVGNSAKQIQQDIQDN  891

Query  2665  YGN  2673
             YG+
Sbjct  892   YGS  894



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score =   378 bits (970),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 308/960 (32%), Positives = 463/960 (48%), Gaps = 167/960 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I   +
Sbjct  48    HEGLTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIASTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q    +  +    P  S+     EH +       Q + IMVG   E E   + L +   
Sbjct  108   KQWMAASDSMKDLKPQTSSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R ++  L   ++ 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSISD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA  +  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAECAR-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  +++  WQ +A  ++  +++DL  +C  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKISKTLGVWQYVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   +I    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFAE-DEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRS-ENVIELGDTEPLFEYANRWLTFR  1635
             SF G I++C +HD+  +LCLRE +   FV+    +S +N  E                 +
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSYQNSCE-----------------Q  490

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFD  1803
             +     K  ++   H  + L++       S + +   + V    SFK++RVLDL      
Sbjct  491   SMQCSFKSRNRIRIHNEKKLVWCCSSEAHSIIMLGGFKCVTLALSFKLVRVLDL---GLT  547

Query  1804  EAPTF--DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdee  1965
               P F   +  L  LRYL+L    +   LK +      + + I+  P S           
Sbjct  548   ICPFFPSGVLSLFHLRYLSLC---FKPCLKQYRGSKEAVPSSIIDIPLSISSLC------  598

Query  1966  iGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLR-------------  2106
                 +LQ            YP+  P +   +P    LH + W  YL+             
Sbjct  599   ----YLQTFKLYLPFPNSSYPFILPSEILTMPQLRKLH-MGW-NYLQSHEPTENRLVLKS  652

Query  2107  -----------CTKEFVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL---  2235
                        CT  F    PN   +KV G+       F+      +  YL +LEKL   
Sbjct  653   LQCLNQLNPRYCTGSFFRLFPNLKKLKVFGVP----EDFRNHKDLYDFRYLYQLEKLTFG  708

Query  2236  --------------------------------IVEDIESEQFELQSINSFPQSLKELKIV  2319
                                                  +     L   ++FPQ+LK L   
Sbjct  709   IYYSPIACFLKNTAPSGSTPQDPLRFQTRFGGTAPPTDVPTLLLPPPDAFPQNLKSLTFR  768

Query  2320  GT-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETM  2496
             G   L W+ ++I+  L  LE LKL     +GEEW   + GFP LKFL++    ++ W   
Sbjct  769   GKFSLAWKDLSIVGKLSKLEVLKLSDNAFIGEEWEVVEEGFPHLKFLFLDRVYIRYWRAS  828

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             SDHFP LERL L  C++L+ IP  F DITTL LI++ DC  S+  SAK IQ++ Q +YG+
Sbjct  829   SDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISDCKQSVGNSAKQIQQDIQDNYGS  888



>gb|EYU38161.1| hypothetical protein MIMGU_mgv1a020688mg [Erythranthe guttata]
Length=861

 Score =   375 bits (964),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 283/839 (34%), Positives = 426/839 (51%), Gaps = 89/839 (11%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGL-IEQRNTTQMLSSYN  444
             +++   ++ AED IES +++ ++ G++       LQ++  D++ + + +     +  +  
Sbjct  63    SQIARAAYAAEDIIESHIVDQLAAGSTS---FLDLQKIIADMDSVNVNKEEIKDLKPTSY  119

Query  445   PGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQER-QVISIVGMGGIGKT  621
             P  S+Q+ + +       +   MVG  +E  + K+ L     Q R Q+I IVGMGG GKT
Sbjct  120   PTTSSQQPLTSN-----TEKCTMVGFDKESFQLKDAL--TGQQSRLQIIPIVGMGGSGKT  172

Query  622   TMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA-ELA  798
             T+ K +Y+   I   F ++ WAT+SQ+Y +R I   L  C ++ T   +N  ++   +L 
Sbjct  173   TLVKNVYESSLIFHHFDIIAWATISQNYTVREIFSQLFSCQSKSTGDHLNIPEADEHQLT  232

Query  799   NKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKY  978
             +K  + L+ +RYL+V+DD+W +  WD +   FPD++N SRI++TTRL  VA Y G S   
Sbjct  233   HKFYQNLIGRRYLIVLDDMWSTDAWDRINFFFPDNTNKSRIVVTTRLSSVATYFGSSS--  290

Query  979   VCNLPFLNSNESWMLFSQKLGSI--NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTK  1152
               ++ FLN + SW LF +K  +     PPE+EEI K+IV KCRGLPL+I V  GLL K+ 
Sbjct  291   YLSMKFLNEDISWNLFCKKTFAQLEGCPPELEEIAKKIVRKCRGLPLSIVVIGGLLRKSY  350

Query  1153  RSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTK  1332
             ++ E W+ +A   N  +      Q   IL+LSY++LP HLK CFLY G+FP+  R I   
Sbjct  351   KTKEYWEDVAREKNSILNLGDDQQSFDILSLSYSHLPAHLKPCFLYTGVFPEDHR-IHVT  409

Query  1333  DLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDL  1512
              L+ LW+ EGF+  ++ +SLEE    YL+DL DRNL+L+ +      IK C +HDLL DL
Sbjct  410   QLIKLWVAEGFIRPNNSQSLEEIGEDYLKDLTDRNLILVHRYRSTRKIKICLVHDLLRDL  469

Query  1513  CLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRT  1692
             CL++ ++EKF+         V+ + D  P      R + F     + K+ D         
Sbjct  470   CLKKAQEEKFL--------RVMGVSDI-PQGIDEERRIVFHEKIPEDKYDDPR-------  513

Query  1693  LLFFFGVSGA----SGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRY----  1848
              +F  G+  A    S +    R +  F+++RVL  V    D     DI +L  LRY    
Sbjct  514   -VFSHGLESASLARSLVSNGGRMSFKFRLLRVLLNV---VDSKSRDDIFELFNLRYACKS  569

Query  1849  -------LALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS  2007
                     ++G    + +L    N+QTLI++   + R                 +W  Q 
Sbjct  570   YSSESHTTSVGLPSSISLL---WNVQTLIIR--GNVRFVAPSE-----------IWSMQQ  613

Query  2008  LRFIKY--------PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKC  2163
             LR + +        P     D     V   L TL     LR ++E   +IPNVK L I  
Sbjct  614   LRHLDFAKISFRDPPLSDQQDNHHDSVLRNLQTLKGAVNLRLSEEVCERIPNVKKLKIMY  673

Query  2164  SEIRAFQTETWWDNLHYLTKLEKL---IVEDIES--EQFEL------QSINSFPQSLKEL  2310
               I     +    NL  L KLE L   + E  +S  EQ  L      ++  +FP+SL +L
Sbjct  674   FGISRSSRDYCLYNLCRLQKLESLNFCVYEPQKSSDEQTALLRSDLVRNTIAFPRSLVKL  733

Query  2311  KIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYI-SGAKLKNW  2487
              + G  L WE +T I +LP+L+ LKL+    +G EW   +G F KLKFL I + + L +W
Sbjct  734   TLEGCFLNWEDLTRIGLLPHLQVLKLINDSVVGSEWNPVEGEFLKLKFLKIVNCSDLVHW  793

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSS  2664
                S HFPVLE L +     L++IP    DI TL+ I L  C  S V S  +I   Q S
Sbjct  794   NADSSHFPVLENLFVIGLKKLDEIPLAIGDIPTLRNILLNGCSESAVFSVINIVYPQDS  852



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   375 bits (962),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 297/900 (33%), Positives = 459/900 (51%), Gaps = 75/900 (8%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQ-AE  255
             MAY  + SL++ +E Q L    + +   K +I+ L +K+   + +LE +    +  Q A 
Sbjct  1     MAYAAVVSLLQILE-QVLISDQLPIRYPKSQIEFLIRKIHFFQDILERNFPAQSSDQSAV  59

Query  256   KDVIARVKDISFRAEDEIESEVMEII---SNGASHERLHQILQRLAEDIEGLIEQR-NTT  423
              D+ A+++D   +AED IES + + +   S  +S E   + L+ L ++++ L+E   NTT
Sbjct  60    NDLEAQIRDAIHKAEDIIESHMSKFLTSESGSSSCEIFSRDLENLLQELDSLVEMAANTT  119

Query  424   QML---SSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
               L   S   P        IA   S        VG   +  + K+ L+  S++ + V+++
Sbjct  120   GHLTEISGLTP--------IASSRSAPSLGRKFVGLKDDFLQLKDQLIGESSRIK-VVAV  170

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGM GIGKTT+ K++YDDPSI   FH   WA ++ +Y  R IL  L   V +   K   E
Sbjct  171   VGMAGIGKTTLVKQVYDDPSIGQIFHYRAWAIMAPNYSKRDILLALLRSVDRDDSKFYGE  230

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
               +  +L   + + L  +RYL+V+DD+   R WDDL+  FPDD NGSR++LTTRL+ VA+
Sbjct  231   A-TDGQLTETIYKNLKGRRYLIVLDDLCVFRAWDDLKTLFPDDGNGSRVMLTTRLRNVAL  289

Query  955   YSGCSGKYVCNLPFLNSNESW-----MLFSQKLGSINLPPEIEEIGKRIVNKCRGLPLAI  1119
             Y+  S + +  + FL+ +ESW     ++F+ K  S     E+E+IGK I   C+GLPL I
Sbjct  290   YAAGSTRNIHYIRFLSKDESWELLRDIVFAGKSCSY----ELEKIGKEIAENCQGLPLTI  345

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILT-LSYNNLPYHLKACFLYFG  1296
                  +LS+  +SVE W+ +A +     T       S+++  L+  +LP HLKACFLY G
Sbjct  346   VFIGDILSRAAKSVEYWRKVADSQTSYATDGDDIGLSSVMQFLNDEHLPQHLKACFLYMG  405

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
              FP +  EIP   L+ LW++EGF+     ++LE+ A + L++L+DR+LVL+        I
Sbjct  406   AFP-LSYEIPVSKLIKLWVSEGFLKPMRSKTLEKVAEECLEELVDRSLVLVHDSRSTSGI  464

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQ-RSENVIELGDTEPLFEYANRWLTFRTTY---  1644
             KTC +H  ++ LC+   +K+KF  A ++ R+ N        P      R L  R      
Sbjct  465   KTCSVHSAVWHLCVSAAEKDKFFLAINRYRNGN--------PPQSNGRRRLCIRKNILFA  516

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDI  1824
             I+  ++   +   +R+LL   G   +  L    R  + F  +RVLD++ I F + P   I
Sbjct  517   IKDVYNSVVSASTARSLLCI-GPDHSHPL----RVCIGFTFLRVLDVLTIRFYKFPD-GI  570

Query  1825  SDLILLRYLALGTIKYVRV---LKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLW  1995
              +L+LLRYLAL T K   +   +    NLQ LIV      R           S     +W
Sbjct  571   LELVLLRYLAL-TCKAGDLPAKVSKLCNLQFLIV------RRHMSIKSSGDPSYLPFEIW  623

Query  1996  KSQSLRFIKY---PYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCS  2166
               + LR I++     P P     +P    L +L  V    C+K+     PN+  LGI+  
Sbjct  624   NMKQLRHIQFMGGDLPDPCGA-SLPY---LLSLSNVSGHSCSKQVFKATPNLMKLGIRIE  679

Query  2167  EIRAFQTETWWDNLHY----LTKLEKLIVEDIESEQFEL----QSINSFPQSLKELKIVG  2322
                   T     +       L   + +IV    + +F++     S++ FP +LK++ + G
Sbjct  680   LAEDTATPLCLLDHLTLLSQLESFKCVIVN--PTREFQVVARPDSVSIFPSTLKKITLSG  737

Query  2323  TELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSD  2502
                 WE + I++ LPNLE+LKL      G EW   +  F +LKFL +    + NW     
Sbjct  738   CGFPWEDMKILAQLPNLEALKLGCYAFQGPEWELDEEDFIRLKFLLLEDMDIANWRANGQ  797

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
                 LERL + HC+NL++IP G   ITTLQL+E+ DC PS+V+SA  I+E Q    ND  
Sbjct  798   ILHRLERLVVRHCYNLQEIPYGIDYITTLQLVEVVDCSPSVVDSAMRIKEMQEDLSNDDF  857



>ref|XP_006352021.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=890

 Score =   375 bits (963),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 289/817 (35%), Positives = 421/817 (52%), Gaps = 88/817 (11%)
 Frame = +1

Query  457   NQEHIIAGGASKLQ------DDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGK  618
             N+++IIA  +S         ++  MVG   E E  +  L +   +E +V+SIVGMGGIGK
Sbjct  45    NKDNIIANTSSSQHALLEPDENMNMVGDENEFEMMQGRLTR-GGRELKVVSIVGMGGIGK  103

Query  619   TTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELA  798
             TT+A KIY DP I S F + G  TVSQ+Y    +L  L   V+ M+  E  E +   ELA
Sbjct  104   TTLANKIYSDPFIMSHFDIRGNVTVSQEYCREYVLLGLLSSVSGMSSHEFYEQQDDGELA  163

Query  799   NKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKY  978
              ++++ L  +RYL+V+DDIW    WDD+Q CFPD +NGSRIL+TTR  +VA Y+      
Sbjct  164   EQLQKLLKGRRYLVVIDDIWTRETWDDIQLCFPDCNNGSRILMTTRNMDVAKYASSGNTT  223

Query  979   VCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTK  1152
                +  L+   SW L   K+      +  E +EIGK+I  KC GLPLAITV AG+LSK  
Sbjct  224   PYQMSLLDFKRSWNLLHTKVFDKESCVSHEFKEIGKQIALKCGGLPLAITVIAGVLSKIG  283

Query  1153  RSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTK  1332
             +S+  WQS+A  ++  +++D+  QC  +L LSY++LP HLK CFLYF IFP+    I   
Sbjct  284   KSLGEWQSVAENVSSVVSTDVDVQCMQVLALSYHHLPQHLKPCFLYFAIFPE-DEVIFVD  342

Query  1333  DLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDL  1512
              L+ LW+ EGF+  +  +S+E+ A K L DLIDR+L+ I  LSF   +++C++HD+  +L
Sbjct  343   KLMELWVVEGFLKAEETKSVEQVAEKCLNDLIDRSLISIHNLSFDEKLESCQMHDVTREL  402

Query  1513  CLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRT  1692
             CLRE +   FV+    R EN          F   +R    R +       D     +  +
Sbjct  403   CLREARNVNFVNVI--REENDQNPYSQSMCFSSKSRG---RISIQLINMPDDRVIEEKLS  457

Query  1693  LLFFFGVSGASGLPVSWRQN--VSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL---  1857
                   +S      + W     + FK++RVLDL  +     P   I DLI LRYLAL   
Sbjct  458   RYPNTVISSIICFRMLWSMPKLLCFKLLRVLDLALVKCGAFPN-GIIDLIHLRYLALSLS  516

Query  1858  -GTIKYVR-----------VLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKS  2001
              G  +Y+             +     LQTLI+  P+S          +   K    +  S
Sbjct  517   PGVERYLGEEIPSSIDIPLSISSLCYLQTLILNLPHS-------KGYQQREKKYPLILPS  569

Query  2002  QSLRFIKYPY--------PFPIDTDEIPVQDTLHTLY-WVPYLRCTKEFVLKI-PNVK--  2145
             + L  ++  Y         F   T++  V   L  L  W P+  CTK FV ++ PN++  
Sbjct  570   EILTMMQLRYLLLDWNYFRFHEPTEKRLVLRNLQCLSGWNPWY-CTK-FVFRLFPNLRKL  627

Query  2146  -VLGIK-----CSEIRAF----QTETWWDNLHY-------------------LTKLEKLI  2238
              + G+K     C++   F    Q E    +L+Y                    T+ E+  
Sbjct  628   QICGVKEDYCSCTDPYDFRDLDQLEELEFHLYYSFLPVCPFFLKSTPSDYLRFTERERPS  687

Query  2239  VEDIESEQFE---LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMG  2409
             +       F+   L  +++FPQ+LK+L    T L W+ ++I+  LP LE+LKL     +G
Sbjct  688   LTLPTVYYFQPLVLPPVDAFPQNLKKLSFSMTFLRWKDMSIVGQLPKLEALKLEYRACIG  747

Query  2410  EEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTL  2589
             EEW   + GFP LKFL +    L+ W+   DHFP LERL L  C  L+ IP  F DITTL
Sbjct  748   EEWEVVEEGFPCLKFLCLEDLNLEYWKASGDHFPCLERLFLEECRFLDSIPRDFADITTL  807

Query  2590  QLIELKDCFPSLVESAKDIQE--EQSSYGNDQLVVRD  2694
              LI+++ C  S+  SAK IQ+  E++  G+ ++ +RD
Sbjct  808   ALIDIRRCAESVGSSAKHIQQDIEENYAGSIEVHIRD  844



>gb|EYU31460.1| hypothetical protein MIMGU_mgv1a020657mg [Erythranthe guttata]
Length=720

 Score =   370 bits (949),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 266/749 (36%), Positives = 389/749 (52%), Gaps = 60/749 (8%)
 Frame = +1

Query  511   MVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWAT  690
             MVG    L   K+ L   S++  QVI IVGMGGIGKTT+A K Y DPSI   F++  W T
Sbjct  1     MVGFDDNLMAIKDKLCGNSSK-LQVIPIVGMGGIGKTTLATKAYHDPSINENFNVRAWVT  59

Query  691   VSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRG  870
             +SQD    ++   L   V  M +  +     + E+  KV + L  ++YLLV+DDIW ++ 
Sbjct  60    LSQDSSKEKVSSSL---VCAMENFVVGRSNESNEV--KVFQALKGRKYLLVLDDIWSTKA  114

Query  871   WDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GS  1044
             WDD+   FPDD+N SRI+LTTRL +VA Y   S  ++  +  L+ ++SW L  Q +  G 
Sbjct  115   WDDIMMMFPDDNNKSRIILTTRLSDVAAYPD-SCSHLHEMDLLDDDQSWNLLRQNIFNGK  173

Query  1045  INLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQ  1224
              + P E+E IGK I   C GLPLAI V AG+LSK   +  +W+ IA  +   +  + + +
Sbjct  174   EDYPLELEIIGKEIARSCGGLPLAIVVIAGVLSKVDNNRASWEKIARNVKSTIAKEENGK  233

Query  1225  CSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVME----DSGRSL  1392
                IL+LSYN+LP HL+ CFLY G FP+   +I    L+ LW+ E F+ +       RSL
Sbjct  234   FEEILSLSYNHLPRHLRPCFLYMGGFPE-DYDINIPRLVKLWVAEEFIHDIRPSSVSRSL  292

Query  1393  EEGA-MKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSE  1569
             EE A  +YL DL+ RNLV++++    G IKTCR+HDL+ +LC+R  +KE F+     +  
Sbjct  293   EEVAEEEYLADLVKRNLVMVTERKSDGRIKTCRVHDLMRELCIRISRKENFLVHVTDKG-  351

Query  1570  NVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQ  1749
               I + +   +F   N        Y             +RT++ F  ++       S++ 
Sbjct  352   --IPVENLRRIFINRNDLNCLANIYRS----------TTRTVICFMELNKD-----SYKD  394

Query  1750  NVSFKMIRVLDLVEISFDEA---PTFDISDLIL--LRYLALG-TIKYVRVLKHHHNLQTL  1911
                F+ +R++ ++    D +    +  + D  L  +RYLA     K    + +  NLQ L
Sbjct  395   LTYFRFMRIICILSARCDMSDCIASLCVEDFNLFNIRYLAFPYPTKIPPTISNLLNLQAL  454

Query  1912  IV-KFPNSCRieeidsdeeiGSKWLQGLWKSQSL------RFIKYPYPFPIDTDEIPVQD  2070
             I+ +  N C+                 +W  + L      RF + P P           +
Sbjct  455   IIHESLNECKQSLPTK-----------IWTMKELRHLICYRFGELPNPPDEGASSGYGLE  503

Query  2071  TLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-IVED  2247
              L TL+ V  L CT+  +  IPNVK LGI C  I   + E   DNL  L +LE+  +   
Sbjct  504   NLQTLWEVTNLICTENILEMIPNVKELGI-CYTIDNREKEYELDNLVRLKQLERFKLTLS  562

Query  2248  IESEQFELQSIN-SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVT  2424
                + ++ ++I  +FP++LK L   G    W  +TI+  LPNL+ LK+ +    GE W T
Sbjct  563   YPLDVWKGKNITLAFPKTLKWLSFGGWSRPWSEMTIVGSLPNLQVLKIKENILRGETWET  622

Query  2425  GDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
              +G F +LK L I G+KL+ W T S+HFP LERL +H C  L  I     +I+TL+LIE+
Sbjct  623   VEGEFLELKHLMIKGSKLERWVTESNHFPKLERLLIHQCLELRNISNDIGEISTLELIEV  682

Query  2605  KDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             K    S  E A+ IQ EQ  Y  D   VR
Sbjct  683   KSGLKSTAEWAERIQREQRDYRYDVTEVR  711



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score =   374 bits (959),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 258/730 (35%), Positives = 387/730 (53%), Gaps = 57/730 (8%)
 Frame = +1

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK  762
             V+SIVGMGGIGKTT+A+K+YDD  +   F++  W TVSQ +  R +L  +  C + + D 
Sbjct  161   VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
                  K+  +LA +V R L  +RYL+ +DD+W +  WD ++R FPD+ NGSR++LT+RL 
Sbjct  221   TYQ--KNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLA  278

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
              V +Y+  SG     +  L+ ++S  LF+ K+ G    P E+E+  K+IV KC+GLPLAI
Sbjct  279   NVGIYAS-SGSPPHYMRCLSVDQSLKLFNLKVFGRETCPLELEKATKQIVEKCQGLPLAI  337

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V AG  SK  ++ + W+ +A  + L ++ +  ++C  +L LSY +LP HLK CFLY G 
Sbjct  338   VVVAGFCSKISKTEDCWEDVAHKIGLVVSRET-EECMDLLALSYKHLPLHLKTCFLYMGA  396

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FPK   EI    L+ LWI   FV     +  EE A  YL+DLIDR+L+++ KL+  G +K
Sbjct  397   FPK-DFEITVSKLMKLWIAAEFVKRTPEKDFEEVAHGYLRDLIDRSLIMVKKLTSSGEVK  455

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL-TFR---TTYI  1647
             TC++HDLL DL +RE  KE+ +  +  +S  ++    + P+  + +R +  F    +T++
Sbjct  456   TCKVHDLLHDLIIREAWKERLI--YFTKSNVIL----SPPVASFEHRIIFNFHRAPSTHL  509

Query  1648  QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS------FKMIRVLDLVEISFDEA  1809
             +  + DK     + + L F    G  G P    Q  S      FK + VLD+    FD  
Sbjct  510   KHVY-DKPLLPCASSFLCF----GRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHL  564

Query  1810  PTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             P  +I  L  L+YLAL +   +   + +   LQTLI                   S  L 
Sbjct  565   PC-EIWKLSTLKYLALASFSVLPPSVCNLRYLQTLI-------------RYSHQASICLP  610

Query  1987  G-LWKSQSLRFI------KYPYPFPIDTDEIPVQ-------DTLHTLYWVPYLRCTKEFV  2124
               +W+ ++LR +       +P    I  D +            L T+ ++ +    +  +
Sbjct  611   AEIWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVL  670

Query  2125  LKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSL  2301
              ++  +K LGI+ SE      E    NL  L  LE L   +    + +  +  + FP +L
Sbjct  671   KRMHKLKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFKGFFIKPWLPKQCDVFPPTL  730

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             K+L + G +L W+ +TI+  LP LE LKL      G EW + D  F +LKFL + G  L 
Sbjct  731   KKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLI  790

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
             +W+  S  FP LE L L +C  L +IP+   +I TL  IEL  C  S  +SA  I+EEQ 
Sbjct  791   HWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQI  850

Query  2662  SYGNDQLVVR  2691
             S GND LVVR
Sbjct  851   SMGNDDLVVR  860



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score =   370 bits (949),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 270/751 (36%), Positives = 400/751 (53%), Gaps = 68/751 (9%)
 Frame = +1

Query  511   MVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWAT  690
             +VG  ++L + K+ L     +  +VI ++GMGGIGKTT+A+ +Y+D  I S F    W  
Sbjct  22    VVGLDEDLIKLKDRLTSLENK-LEVIPMIGMGGIGKTTLARNLYNDRLIISHFDTCAWIV  80

Query  691   VSQDYDLRRILQDLCGC-VAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSR  867
             +SQDYD+R IL  L  C V ++TD  + +  S  +LA  + + L   RYL+V+DD+W +R
Sbjct  81    ISQDYDVRAILLGLLACIVGKLTDDMLQQKNS--QLAVTLYKSLTGIRYLVVLDDMWSTR  138

Query  868   GWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GS  1044
              WDD++  FPD++N SRILLTTR K VA Y G S +Y   +  LN  ESW L  QK+ G 
Sbjct  139   AWDDVRMFFPDNNNRSRILLTTREKNVANYVGSSSQY-HQMRLLNKFESWNLLHQKVFGE  197

Query  1045  INLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQ  1224
                PPE E+I + I + C GLPLAI V  GLLS+ K   + W+ +A  ++  M ++  +Q
Sbjct  198   DKCPPEFEKIERNIASDCGGLPLAIHVIGGLLSEAKGRRDFWERVADDISSAM-AEKDEQ  256

Query  1225  CSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGA  1404
                IL LSYN L YHLK+CFL+ G FP+   EI    L+ +W+ EGF+  +  +SLEE A
Sbjct  257   FYNILALSYNYLSYHLKSCFLFMGAFPE-DHEIRASKLVRIWVAEGFLESNGDKSLEEIA  315

Query  1405  MKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIEL  1584
              + L+ L+DRNLV++ +    G  K+  +HDLL DLC+++  K+KF+   + +  NV E 
Sbjct  316   EENLKVLVDRNLVMVRERKSNGKAKSYSIHDLLRDLCVKKAAKDKFLHVKNWQVHNVPE-  374

Query  1585  GDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFK  1764
                     Y  R ++   +Y   +  D Y   +  +LL  F   G +   +      + +
Sbjct  375   -----GLSYFPRRVSVHQSY---RIRDVYGSTEFMSLLRSFLCIGLASRVILSPVFFALR  426

Query  1765  MIRVLDLVEISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRi  1941
             ++RVLD+++I F + PT ++  L+ L YLA      +   +    NLQTLIV+       
Sbjct  427   LLRVLDVLDIEFHQFPT-ELLGLVNLHYLAFSCNSDFPSAISRLWNLQTLIVQ-------  478

Query  1942  eeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEI---PVQDTLHTLYWVPYLRCT  2112
                     + S+    +W+   LR IK+        D      VQ  L T      + CT
Sbjct  479   -SSLFYMYLPSE----IWEMPELRHIKFKKTRICIDDAYRKKNVQRKLQT------ISCT  527

Query  2113  K-------EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFEL  2271
                       +  IPN+K LGI  +    F  +        L+ L +L +    + ++  
Sbjct  528   TLDQLIDCNLLGNIPNIKNLGIHSAS--PFHVD--------LSHLHRLEILKCSARKWSR  577

Query  2272  QSIN--SFPQSLKELKIVGTELGWEAITIISMLPNLESLKL----LQAYEM----GEEWV  2421
              SI+   FP S+++L +    + W  +T I +LPNLE LK+     +  EM     EEWV
Sbjct  578   TSISKLDFPPSIRKLTLSKLTIHWGFMTTIGLLPNLEVLKIRKCTFKGQEMQPRDDEEWV  637

Query  2422  TGDGGFPKLKFLYISGAK-LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLI  2598
               +G F  L+FL +   K L +W+    H P L  L +  C  LE+IP G  +I TL++I
Sbjct  638   LTEGEFCSLQFLLLEKLKNLVHWQADETHLPRLRHLLIRGCSALEEIPSGIGEIPTLEII  697

Query  2599  ELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             EL +C PS+V SAK IQE+Q  YGND L VR
Sbjct  698   ELDECSPSVVASAKQIQEDQREYGNDGLEVR  728



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score =   374 bits (959),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 258/730 (35%), Positives = 387/730 (53%), Gaps = 57/730 (8%)
 Frame = +1

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK  762
             V+SIVGMGGIGKTT+A+K+YDD  +   F++  W TVSQ +  R +L  +  C + + D 
Sbjct  161   VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
                  K+  +LA +V R L  +RYL+ +DD+W +  WD ++R FPD+ NGSR++LT+RL 
Sbjct  221   TYQ--KNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLA  278

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
              V +Y+  SG     +  L+ ++S  LF+ K+ G    P E+E+  K+IV KC+GLPLAI
Sbjct  279   NVGIYAS-SGSPPHYMRCLSVDQSLKLFNLKVFGRETCPLELEKATKQIVEKCQGLPLAI  337

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V AG  SK  ++ + W+ +A  + L ++ +  ++C  +L LSY +LP HLK CFLY G 
Sbjct  338   VVVAGFCSKISKTEDCWEDVAHKIGLVVSRET-EECMDLLALSYKHLPLHLKTCFLYMGA  396

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FPK   EI    L+ LWI   FV     +  EE A  YL+DLIDR+L+++ KL+  G +K
Sbjct  397   FPK-DFEITVSKLMKLWIAAEFVKRTPEKDFEEVAHGYLRDLIDRSLIMVKKLTSSGEVK  455

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL-TFR---TTYI  1647
             TC++HDLL DL +RE  KE+ +  +  +S  ++    + P+  + +R +  F    +T++
Sbjct  456   TCKVHDLLHDLIIREAWKERLI--YFTKSNVIL----SPPVASFEHRIIFNFHRAPSTHL  509

Query  1648  QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS------FKMIRVLDLVEISFDEA  1809
             +  + DK     + + L F    G  G P    Q  S      FK + VLD+    FD  
Sbjct  510   KHVY-DKPLLPCASSFLCF----GRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHL  564

Query  1810  PTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             P  +I  L  L+YLAL +   +   + +   LQTLI                   S  L 
Sbjct  565   PC-EIWKLSTLKYLALASFSVLPPSVCNLRYLQTLI-------------RYSHQASICLP  610

Query  1987  G-LWKSQSLRFI------KYPYPFPIDTDEIPVQ-------DTLHTLYWVPYLRCTKEFV  2124
               +W+ ++LR +       +P    I  D +            L T+ ++ +    +  +
Sbjct  611   AEIWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVL  670

Query  2125  LKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSL  2301
              ++  +K LGI+ SE      E    NL  L  LE L   +    + +  +  + FP +L
Sbjct  671   KRMHKLKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFKGFFIKPWLPKQCDVFPPTL  730

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             K+L + G +L W+ +TI+  LP LE LKL      G EW + D  F +LKFL + G  L 
Sbjct  731   KKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLI  790

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
             +W+  S  FP LE L L +C  L +IP+   +I TL  IEL  C  S  +SA  I+EEQ 
Sbjct  791   HWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQI  850

Query  2662  SYGNDQLVVR  2691
             S GND LVVR
Sbjct  851   SMGNDDLVVR  860



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score =   374 bits (959),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 258/730 (35%), Positives = 387/730 (53%), Gaps = 57/730 (8%)
 Frame = +1

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK  762
             V+SIVGMGGIGKTT+A+K+YDD  +   F++  W TVSQ +  R +L  +  C + + D 
Sbjct  161   VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
                  K+  +LA +V R L  +RYL+ +DD+W +  WD ++R FPD+ NGSR++LT+RL 
Sbjct  221   TYQ--KNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLA  278

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
              V +Y+  SG     +  L+ ++S  LF+ K+ G    P E+E+  K+IV KC+GLPLAI
Sbjct  279   NVGIYAS-SGSPPHYMRCLSVDQSLKLFNLKVFGRETCPLELEKATKQIVEKCQGLPLAI  337

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V AG  SK  ++ + W+ +A  + L ++ +  ++C  +L LSY +LP HLK CFLY G 
Sbjct  338   VVVAGFCSKISKTEDCWEDVAHKIGLVVSRET-EECMDLLALSYKHLPLHLKTCFLYMGA  396

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FPK   EI    L+ LWI   FV     +  EE A  YL+DLIDR+L+++ KL+  G +K
Sbjct  397   FPK-DFEITVSKLMKLWIAAEFVKRTPEKDFEEVAHGYLRDLIDRSLIMVKKLTSSGEVK  455

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL-TFR---TTYI  1647
             TC++HDLL DL +RE  KE+ +  +  +S  ++    + P+  + +R +  F    +T++
Sbjct  456   TCKVHDLLHDLIIREAWKERLI--YFTKSNVIL----SPPVASFEHRIIFNFHRAPSTHL  509

Query  1648  QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS------FKMIRVLDLVEISFDEA  1809
             +  + DK     + + L F    G  G P    Q  S      FK + VLD+    FD  
Sbjct  510   KHVY-DKPLLPCASSFLCF----GRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHL  564

Query  1810  PTFDISDLILLRYLALGTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             P  +I  L  L+YLAL +   +   + +   LQTLI                   S  L 
Sbjct  565   PC-EIWKLSTLKYLALASFSVLPPSVCNLRYLQTLI-------------RYSHQASICLP  610

Query  1987  G-LWKSQSLRFI------KYPYPFPIDTDEIPVQ-------DTLHTLYWVPYLRCTKEFV  2124
               +W+ ++LR +       +P    I  D +            L T+ ++ +    +  +
Sbjct  611   AEIWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVL  670

Query  2125  LKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-IVEDIESEQFELQSINSFPQSL  2301
              ++  +K LGI+ SE      E    NL  L  LE L   +    + +  +  + FP +L
Sbjct  671   KRMHKLKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFKGFFIKPWLPKQCDVFPPTL  730

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             K+L + G +L W+ +TI+  LP LE LKL      G EW + D  F +LKFL + G  L 
Sbjct  731   KKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLI  790

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQS  2661
             +W+  S  FP LE L L +C  L +IP+   +I TL  IEL  C  S  +SA  I+EEQ 
Sbjct  791   HWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQI  850

Query  2662  SYGNDQLVVR  2691
             S GND LVVR
Sbjct  851   SMGNDDLVVR  860



>gb|EYU28611.1| hypothetical protein MIMGU_mgv1a025283mg, partial [Erythranthe 
guttata]
Length=872

 Score =   373 bits (958),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 303/912 (33%), Positives = 463/912 (51%), Gaps = 98/912 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYK-DEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL  T+  Q L P P L + +  D+I  LRQK       LE         + E 
Sbjct  4     AYAALVSLTHTLN-QILHPPPALHIIFDTDQIVSLRQKADFFVDFLENHSSTEGDKRIE-  61

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHER----------LHQILQR-------LAE  387
             D+  R+ D ++ AE  IE  V   I  G++ +R          +H  +Q        L E
Sbjct  62    DLQKRIGDAAYAAEYIIEFNVRNQILAGSAFDREETSNLLFEGVHTSIQEFLFIEKELVE  121

Query  388   DIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQ----DDAIMVGHAQELERTKEML  555
               +  ++ +N+T    + +   S+     +  +S        +  MVG    ++   E++
Sbjct  122   FKKDHVQHKNSTSTTEASSSSSSSSSSSSSSSSSSRPLLPIGENTMVGFDDHMD---EIM  178

Query  556   LQCSTQER--QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQD  729
                ST E   ++ISIVGMGGIGKTT+A  +Y++P I   F +  W TVSQ+Y    +L  
Sbjct  179   GALSTNESNLRIISIVGMGGIGKTTLATNVYNNPFIVEMFGIRAWFTVSQEYTEEILL--  236

Query  730   LCGCVAQM--TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD  903
               G + Q+  TD+  +++    EL +K+ + L  ++YLLV+DD+W  + WD ++R  PD+
Sbjct  237   --GLLHQINNTDRNAHDMIDDDELGDKLYKTLFGRKYLLVMDDMWDIKAWDMVKRFLPDN  294

Query  904   SNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGK  1080
             +NGSRIL+TTRL ++A   G    Y   L FL+  +SW L  Q +      P E+E IGK
Sbjct  295   NNGSRILVTTRLLKLAADLGSCCPY--QLSFLDEAQSWDLLRQNIFAEGRCPIELEGIGK  352

Query  1081  RIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNL  1260
              I  KCRGLPLA+ V  GLL+K+K   E+W+ +   +   + +   + C  IL+LSYN L
Sbjct  353   SIAKKCRGLPLALVVIGGLLAKSK--AEHWKYVEEDVTSAVYNQDEEFCMKILSLSYNRL  410

Query  1261  PYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNL  1440
             P +LK CFLYF +FP+    I    LL LW+ EGF+ +   +SLE+   +YL+DLIDRNL
Sbjct  411   PIYLKPCFLYFAVFPE-DYTIEVPRLLKLWVAEGFIRQCGHKSLEDIGREYLEDLIDRNL  469

Query  1441  VLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFV-SAFHQRSENVIELGDTEP--LFEY  1611
             +L++    IG +  C +HDLL DL  RE +KE FV S       +++   +  P  L   
Sbjct  470   ILVNSRLIIGELIYCCIHDLLSDLSRREAQKENFVLSGKLYNHLDILSNTEIRPTRLSIN  529

Query  1612  ANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE  1791
               RW   + T + P  S       +R+ L F   S       S  Q   F ++RVL++V 
Sbjct  530   GGRW---KGTKLMPYRS----LVPTRSFLSF---SKGDLTDYSAHQ---FPLLRVLNVV-  575

Query  1792  ISFDEAPTFDISDLILLRYLA-LGTIKYV--RVLKHHHNLQTLIVKFPNSCRieeidsde  1962
                D  P  D+  LI  RY++ +G +  +    L     LQT++V+              
Sbjct  576   ---DRYPKHDVLQLINSRYVSCMGPMMLMSSSTLSRLWGLQTIVVE--------------  618

Query  1963  eiGSKWLQ-GLWKSQSLRFIKYPY------PFPIDTDEIPVQDTLHTLYWVPYLRCTKEF  2121
               G   L   +W+   LR I+         P P D  +I + + L TL  +   +C ++ 
Sbjct  619   --GKLILPIEIWQMPQLRHIEGNRINMPDPPSPDDVQKIILLENLQTLSIIRDFKCCEKL  676

Query  2122  VLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSL  2301
             + +IPNVK L   C  I    +     N+  L KLE+L +E           I  FP SL
Sbjct  677   IKRIPNVKTLRNVCQTI---GSNNCLRNIGLLHKLEELYLECPPC-----GGIIVFPCSL  728

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             K L + G ++ WE ++++  LPNLESL+L +   +G++W+  +G F +LK+L I   +L+
Sbjct  729   KNLSLSGCKIPWEDMSVVGSLPNLESLQLWKNAAVGQKWIPKEGEFARLKYLLIHKCELE  788

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS--LVESAKDIQEE  2655
              WE  + HFP LE L L +  NL++IP  F +I  ++ I+L +   +  LV SA +I E+
Sbjct  789   IWEAENTHFPCLEILRLGYL-NLKEIPSDFAEILPIRRIDLDNNSTNDLLVSSANEISEQ  847

Query  2656  QSSYGNDQLVVR  2691
             + + G D L V+
Sbjct  848   RENIGYDSLQVQ  859



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score =   372 bits (954),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 299/905 (33%), Positives = 444/905 (49%), Gaps = 90/905 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRP-ILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             M  V LTSL+ T+ELQFL   P + ++D +  I+   +       L          S A 
Sbjct  1     MGCVALTSLMATIELQFLRSIPRVSILDDELPIKFFEK-------LSSLQAFLQQKSGAI  53

Query  256   KDVIARVKDISFRAEDEIESEVMEII------SNGASHERLHQILQRLAEDIEGLIEQRN  417
             +D+  +++D +  AED IE ++   +          + ++LHQ L   AE+   L++   
Sbjct  54    RDLEIQIRDFALDAEDRIEIQLSNFLLAKNREDQQKAAQKLHQTLIEAAENAAHLLK---  110

Query  418   TTQMLSSYNPGQSNQEHIIA----GGASKLQDDAI---MVGHAQELERTKEMLLQCSTQE  576
                 +S+ +  +SN+ H +       + +LQ   +   MVG   +    K  LL   + +
Sbjct  111   ----ISNESDDESNECHSLIPWSLDTSLRLQPPKLEGRMVGRRNDYLLVKNQLLY--SDQ  164

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
             R+VI IVGM GIGKTT+A  +Y+D S+ S F +  W T+S +Y +R+ L DL   +A+  
Sbjct  165   RRVILIVGMNGIGKTTLAASVYEDSSVASHFDVRAWITMSGEYTMRQTLHDLLLTLAEPN  224

Query  757   DKEINEVKSTAEL-----ANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRI  921
              +         +      A +V + L  + YL+V+D++W +R WDD+Q  FP+DSNGSRI
Sbjct  225   HETRKRTTLDLDDDDDLLAKQVSKCLKGKIYLIVLDNLWNNRVWDDIQGYFPNDSNGSRI  284

Query  922   LLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLF-SQKLGSINLPPEIEEIGKRIVNKC  1098
             +LTT   +   Y+  S   + N+  L++ ESW LF S      ++ P+ E+I   ++ KC
Sbjct  285   VLTTTHFDQGSYT--SLDCIHNMALLDAKESWDLFCSNPFLEKHMEPKFEKIRSHVLEKC  342

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPL+I   A  LSK     + W+ +   + L    D     S+ LTL YN LP +LK 
Sbjct  343   EGLPLSIVTVAQRLSKCNNIRKEWEKVEKELELLGFLD-----SSALTLMYNQLPQYLKV  397

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYFG+F K R  I  K L  LWI EG +       LE  A +YLQ+LIDR+LVLI K 
Sbjct  398   CFLYFGVFSK-RNVIRVKQLFKLWIAEGILNLLGNEELESQAYEYLQELIDRSLVLIDKQ  456

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSA-----FHQRSENVIELGDTEPLFEYANRW  1623
             S  G IKTC++H  L   C+RE +K     A     + Q S N         +F  + RW
Sbjct  457   SSDGKIKTCKMHSALHSFCVREAQKNSIFCAVNTQQYPQGSFN---------MFANSCRW  507

Query  1624  LT-FRTTYIQPKFSDKYNFHKSRT--LLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEI  1794
             L+ ++ ++      D Y   ++ T   +FFF               VSFK++RVL     
Sbjct  508   LSLYKHSF------DYYVLFRTNTPRSIFFFQKDDEIS--------VSFKLLRVLAYAPS  553

Query  1795  SFDEAPTFDISDLILLRYLAL-GTIKYV-RVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
             SF +     + DLI LRYL++ G  K +  ++  + NLQTL+V   N  +          
Sbjct  554   SFFQRVPTQLQDLIFLRYLSVKGWFKGLDYIVSANRNLQTLVVSSSNESQPRGHTLHLP-  612

Query  1969  GSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKV  2148
                    +W+   L+ ++    + ID   + V+D + TL WV    C  E   K PN+K 
Sbjct  613   -----STIWELPQLQHLELDSSYVIDPPSV-VKDNMQTLSWVCPTHCRTEVYRKFPNIKK  666

Query  2149  LGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTE  2328
             L I         +    D+L+YL +LE+L +         L   + FP  LK+L +  T 
Sbjct  667   LKI----FGFCDSPIILDDLNYLVRLERLTISVSFGCIVTLPKPSMFPSRLKKLSLNDTS  722

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDG-GFPKLKFLYISGAKLKNWETMSDH  2505
             L  + + II MLP LE LKL   +   E W   +G  F +L+FL +   KLK W      
Sbjct  723   LSKKDLMIIGMLPRLEVLKLKNTFH-EEVWEVAEGRRFNQLRFLLLEDKKLKKWMINKYS  781

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLV  2685
             F  LERL L  C  LEKIP     I TL+ IEL++C P +  SA  IQE + S+ +    
Sbjct  782   FQCLERLVLRFCCCLEKIPRNMNYIITLKSIELEECGPFVAVSALLIQELRHSFSDINFE  841

Query  2686  VRDYD  2700
             V  Y+
Sbjct  842   VISYN  846



>ref|XP_011087329.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=789

 Score =   370 bits (949),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 294/889 (33%), Positives = 454/889 (51%), Gaps = 122/889 (14%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEP---RPILVVDY--KDEIQCLRQKLCHlkalleesekklNV  243
             MAY  L SL++ +E QFL P   +P+ V+D   K +++ L QK+   K L E S   ++ 
Sbjct  1     MAY-NLESLVQILE-QFLYPDHHQPLWVLDSDKKPQMKTLLQKVYFFKDLFENSSSAVS-  57

Query  244   SQAEKDVIARVKDISFRAEDEIESEVM-EIISNGASHERLHQILQRLAEDIEGLIEQRNT  420
                 + + +R++DI+++AED +ES ++ +++S G     +         D+E LIE  ++
Sbjct  58    GYRRRGLESRIRDIAYKAEDVVESHLVDQLLSCGEGESFIFS-----PPDLEKLIEDFDS  112

Query  421   TQ--MLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
                 M+SS    +   ++ + GG SKL+                            VI I
Sbjct  113   ANKDMMSSMEESEMQLKYRLTGGGSKLE----------------------------VIPI  144

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +    E+ +
Sbjct  145   VGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPTYEMLQ  204

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
             +    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR   +A 
Sbjct  205   M-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRNSSLAN  263

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLPL I++
Sbjct  264   FIAFRSPHH-NMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLPLTISL  321

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
               GLLS  KR  + W+ +A  ++    +D+ ++   IL+L YN LPY+LK C LY G FP
Sbjct  322   IGGLLSYAKRRQDFWEQVAEDLS-SNRADVDEEILDILSLPYNYLPYYLKPCLLYMGAFP  380

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  GN+K+C
Sbjct  381   E-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQGNVKSC  439

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSD  1665
              +HDLL DLC+++  +E F+S   +       LGD        +R +   +     +  D
Sbjct  440   GIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL------CSRRVCVHSIRDIDRPLD  488

Query  1666  KYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLR  1845
             +    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  L+ LR
Sbjct  489   QMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQLVNLR  541

Query  1846  YLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKY  2025
             + +           + H +   I+  P                           LR IK+
Sbjct  542   FSS-----------NPHVVTPEILDMPQ--------------------------LRHIKF  564

Query  2026  PYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTET  2193
                +    D+      VQD L +L  +         +  IPN+  LGI C E        
Sbjct  565   KGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE--------  616

Query  2194  WWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWEAITIISML  2364
               D++  L++L  L   +  S ++    L S  +FP SLK+L +    + +  ++II  L
Sbjct  617   KLDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSL  676

Query  2365  PNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCH  2544
             PNL+ LKL        EW   +G F +LK L +    L  W      FP LE L + HC 
Sbjct  677   PNLQILKLRGCEFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCA  736

Query  2545  NLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  737   HLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  785



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score =   372 bits (955),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 290/872 (33%), Positives = 431/872 (49%), Gaps = 123/872 (14%)
 Frame = +1

Query  274   VKDISFRAEDEIESEVMEIIS------NGASHERLHQILQRLAED------------IEG  399
             ++D+S +AED +E  + E  S      N      +H+++ R  ++            I+G
Sbjct  77    IRDVSCKAEDIVEEIMFEYSSSSCLKKNATKFVGVHRLVFRKIDESAITSVYNDICCIKG  136

Query  400   LI---EQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                    R+ TQ LSS       ++H++ G    L DD + +  A +L    + L     
Sbjct  137   RSTPSSSRDVTQSLSS------QKDHVVVG----LYDDFLRI--ADKLTGYPDKL-----  179

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGC---  741
                 V+ I GMGGIGKTT+AK+IY D  I   F++  W TVS+ Y +R +L DL  C   
Sbjct  180   ---DVVVIFGMGGIGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSK  236

Query  742   VAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRI  921
             VA + D+  NE     EL  ++ + L  QRYL+V+DD+W +  WDD++R FP+D+NGSR+
Sbjct  237   VAFIMDEMENE-----ELGERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRV  291

Query  922   LLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPP----EIEEIGKRIV  1089
             ++T+R+ +VA Y          + FL   ESW L  +K+  ++ P     E+E IG  I 
Sbjct  292   MVTSRIMKVARYINPLNP-PHQMRFLTVEESWKLLQKKIFGLDDPSCCDDEMERIGMEIS  350

Query  1090  NKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYH  1269
              KC+GLPLAI + AG+LSK   +   W  IA  ++    ++       IL LSYN+LP H
Sbjct  351   KKCKGLPLAIVMVAGILSKESATASKWSDIAENIHSSFVTEESRPFLDILALSYNHLPRH  410

Query  1270  LKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLI  1449
             LKACFLY G FP+   E+P   L+ LWI EGF+  +S ++LE    +YLQ+LIDR+L+++
Sbjct  411   LKACFLYMGAFPE-DVEVPVWRLIRLWIAEGFIKLESPKTLEFVGQEYLQELIDRSLIIV  469

Query  1450  SKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF-EYANRWL  1626
             SK S+   +KTC +HD+L + C  E K+EK +    +           EP F +  +R L
Sbjct  470   SKRSYDNRVKTCSIHDILRNFCQEEAKQEKLLHVVRR----------LEPHFPQGVHRRL  519

Query  1627  TFRT---TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEIS  1797
              F +    Y    +S+ Y       +  F      S L  S+   + FK++RVLD+V  S
Sbjct  520   HFHSDIFAYSSYTYSNPY-------VRSFLSSKACSVLEDSYFGCMGFKLLRVLDVVNYS  572

Query  1798  FDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGS  1974
             F   P   I  L+ LRYLAL    +  R +    +LQTLI+ +               G+
Sbjct  573   FYGFPIHVIK-LVHLRYLALSINSELPRSISKLKSLQTLIIYW---------------GT  616

Query  1975  KWLQ----GLWKSQSLRFIKYP-----YPFPIDTDE----IPVQDTLHTL--YWVPYLRC  2109
             K ++     LWK   LR I        +  PID         V + L TL    +  +  
Sbjct  617   KEMRILPLELWKMPILRHIHVKGDVLLFGSPIDDHHSKRNFRVLENLQTLCTITISTINF  676

Query  2110  TKEFVLKIPNVKVLGIKCSEIRAFQTETWW-----DNLHYLTKLE--KLIVEDIESEQFE  2268
             +   +  +PN+K L    + +     +  W     +NLH +  LE  KL+          
Sbjct  677   SHRLIATLPNLKTLA--SNLVTGGNHDVDWLGSCLNNLHQMYSLETLKLLFNLPMKNPLP  734

Query  2269  LQSI---NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGF  2439
               SI   N+FP +LK L +  + L W+   ++  LPNLE LKL      G EW T + GF
Sbjct  735   HNSIQRWNAFPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGF  794

Query  2440  PKLKFLYISGAKLKNWE---TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKD  2610
              +LK+L +    L  W+   T S  FP L+ L    C+ L++IP    DI +LQ+IEL  
Sbjct  795   HRLKYLLVESRDLVIWKQASTDSYPFPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYS  854

Query  2611  CFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
             C P     A+ IQ++Q   GN  L V  +  R
Sbjct  855   CSPYATRLARMIQQDQIDSGNSCLEVFIHPAR  886



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score =   372 bits (955),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 263/741 (35%), Positives = 386/741 (52%), Gaps = 59/741 (8%)
 Frame = +1

Query  583   VISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDK  762
             V+SIVGMGGIGKTT+A+K+YDD  +   F++  W TVSQ +  R +L  +  C + + D 
Sbjct  161   VVSIVGMGGIGKTTLARKVYDDIYMEHHFYVRAWITVSQMHQHREMLLGILRCFSLVND-  219

Query  763   EINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLK  942
                 +KST +LA +V R L  +RYL+ +DD+W +  WD ++R FPDD NGSR++LT+RL 
Sbjct  220   -YTYLKSTEQLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLA  278

Query  943   EVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAI  1119
              V +Y+  SG     +  L+ + S  LF+ K+ G  N P E+E+  K+IV KC+GLPLAI
Sbjct  279   NVGIYAS-SGSPPHYMRCLSVDRSLKLFNLKVFGRENCPLELEKATKQIVGKCQGLPLAI  337

Query  1120  TVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGI  1299
              V AG  SK  ++   W+ +A  + L ++ +  ++C  +L LSY +LP+HLK CFLY G 
Sbjct  338   VVVAGFCSKISKTENCWEDVAHKIGLIVSRET-EECMDLLALSYKHLPHHLKPCFLYMGA  396

Query  1300  FPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIK  1479
             FPK   EI    L+ LWI   F+        EE A  YL+DLIDR+L+++ K +  G +K
Sbjct  397   FPK-DYEISVSRLIKLWIAAEFLEYTFEMDFEEVAEGYLKDLIDRSLIMVKKRTSSGKVK  455

Query  1480  TCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA-----NRWLTFRTTY  1644
             TC +HDLL DL +RE  KE+  S +  +S NV+ L  +   FE+      NR     +T+
Sbjct  456   TCEVHDLLHDLIIREAWKER--SIYFTKS-NVV-LSPSVASFEHRIIFNFNR---ASSTH  508

Query  1645  IQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVS------FKMIRVLDLVEISFDE  1806
             ++  F+     H S  L F     G  G P S  Q  S      F  + VLD+    FD 
Sbjct  509   LEVIFNQPSLPHASSFLCF-----GRDGTPGSCSQVDSFITFTNFTWLTVLDISFQPFDH  563

Query  1807  APTFDISDLILLRYLALGT----------IKYVRVLKHHHNLQTLIVK------------  1920
              P  +I  L  LRYLAL +          ++Y++ L  + +  ++ +             
Sbjct  564   LPC-EIWQLFSLRYLALASFTMLPPSICNLRYLQTLIRYSHQASICLPAEIWEIEPLRHL  622

Query  1921  -FPNSC--RieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYW  2091
              F   C  R  + +  +  G+     L  ++   F  +P  F      +     L TL +
Sbjct  623   YFRKCCYFRYVQSEQKDHQGTSSRSNLGLTRWPTFSYHPSEFSRSNLGL---TKLQTLSY  679

Query  2092  VPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETW-WDNLHYLTKLEKLIVEDIESEQFE  2268
             + +    +     +P +K LGI+ SE      +         +   +   ++    + + 
Sbjct  680   ITFGSIKRRIFKGMPKLKKLGIRESEEEHLTAKKMSRKLKKLVLLEKLETLKCFFIKPWI  739

Query  2269  LQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKL  2448
             L+  + FP +LK+L + G +L W  +TI+ MLP LE LKL      G EW + D  F +L
Sbjct  740   LKERDVFPPTLKKLTLRGCQLPWNQMTILCMLPELEVLKLKDYAFQGSEWESTDERFQQL  799

Query  2449  KFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLV  2628
             KFL + G  L +W   S  FP LE L L +C+ L +IP+   +I TLQ IEL  C  S  
Sbjct  800   KFLLLDGTDLIHWIVDSIQFPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSAD  859

Query  2629  ESAKDIQEEQSSYGNDQLVVR  2691
              SA  IQEEQ S GND LVVR
Sbjct  860   VSANRIQEEQHSMGNDDLVVR  880



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score =   373 bits (957),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 309/960 (32%), Positives = 463/960 (48%), Gaps = 167/960 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++    E       ++ 
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHE------GLTI  53

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
              E ++I    ++++   D ++SE   +       ER      +  +L++  E I+  ++Q
Sbjct  54    LEVEII----EVAYTTGDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQE  576
                T+  +    P  S+     EH +       Q + IMVG   E E   + L +   +E
Sbjct  110   WMATSDSMKDLKPQTSSLVSLPEHAVE------QPENIMVGRENEFEMMLDQLAR-GGRE  162

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMT  756
              +++SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +LQ L   ++   
Sbjct  163   LEIVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDEP  222

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             D +         LA+++++RL  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLTTR
Sbjct  223   DDQ---------LADRLQKRLKCRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTR  273

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGL  1107
             + EVA Y+  SGK   ++  +N +ESW L  +K+   GS +  PE E IGK+I  KC GL
Sbjct  274   IVEVAAYAS-SGKPPYHMRLMNFDESWNLLHKKIFEEGSYS--PEFENIGKQIALKCGGL  330

Query  1108  PLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFL  1287
             PLAI V AGLLSK  ++++ WQ IA  ++  +++D   QC  +L LSY++LP HLK CFL
Sbjct  331   PLAIIVIAGLLSKISKTLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKQCFL  390

Query  1288  YFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFI  1467
             YF IF +   +I    L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I  LSF 
Sbjct  391   YFAIFAE-DEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIDNLSFR  449

Query  1468  GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYI  1647
             G I++C +HD+  +LCLRE +   FV+    +S       D     +   R    R+   
Sbjct  450   GTIESCGMHDVTRELCLREARNMNFVNVIRGKS-------DQNSCAQSMQRSFKSRS---  499

Query  1648  QPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDEAPT  1815
                   +   HK   L +       S + +   + V    SFK++RVLDL     +  P 
Sbjct  500   ------RIRIHKVEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDL---GLNTWPI  550

Query  1816  F--DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSK  1977
             F   +  LI LRYL+L   ++   L+ +      + + I+  P S              +
Sbjct  551   FPSGVLSLIHLRYLSL---RFNPCLQQYQGSKEAVPSSIIDIPLSISSL----------R  597

Query  1978  WLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLY--WVPYLR---------------  2106
             +LQ      +L F  Y YPF I   EI     L TL   W  YLR               
Sbjct  598   YLQTF--KLNLPFPSY-YPF-ILPSEILTMPQLRTLCMGW-NYLRSHEPTENRLVLKNLQ  652

Query  2107  ---------CTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE--  2244
                      CT  F    PN+K   V G+       F+      +  YL +LE+L     
Sbjct  653   CLNQLNPRYCTGSFFRLFPNLKKLQVFGVP----EDFRNSQDLYDFRYLYQLEELTFRLY  708

Query  2245  --------DIESEQFELQSINSFPQSL--KELKIVGTELGWEAITIISMLP-NLESLKLL  2391
                        +     Q    F   +  KE+   GT      +      P NL+SL   
Sbjct  709   YPYAACFLKNTAPSGSTQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFR  768

Query  2392  QAYEMGEEWVTGDGGFPK-------------------------LKFLYISGAKLKNWETM  2496
               + +  + ++  G  PK                         LKFL++    ++ W   
Sbjct  769   GEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLKFLFLDDVYIRYWRAS  828

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             SDHFP LER+ L  C NL+ IP  F DITTL LI++  C  S+V SAK IQ++ Q +YG+
Sbjct  829   SDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQQDIQDNYGS  888



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score =   382 bits (981),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 292/889 (33%), Positives = 453/889 (51%), Gaps = 96/889 (11%)
 Frame = +1

Query  121   LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAE  300
             L+ ++  P  +   KD I+ ++  L    +L   +    N  Q  KD+   + ++++  E
Sbjct  615   LELIKRNPDSIALVKDHIEKIQLDLVSFTSLFTGTSYPDNEHQELKDLSTCLTEMAYEVE  674

Query  301   DEIESEVMEIISNGASHERLHQI--LQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHII  474
               I+S  M I   GA+ + L  I  LQ     I+ L   +NT     +   G   Q    
Sbjct  675   YVIDSIEMGI---GANLQHLLWIYDLQERIRFIKNL--AKNTGVPSVAQIRGHVRQ----  725

Query  475   AGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPS  654
                AS  + D +++    + +   + L   S++ R V+S+VGM GIGKTT+AKK+Y+DP+
Sbjct  726   ---ASTPKTDKMVISLGDQEQEVIDRLTWGSSK-RDVVSLVGMAGIGKTTLAKKLYNDPN  781

Query  655   IRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRY  834
             I   FH   W +VSQ Y  R +L ++   +  +TD EI+E+ S A+L  ++R+RL++ +Y
Sbjct  782   IVYHFHCRAWCSVSQVYLKRNLLLNILRDIEGLTD-EIHEM-SDADLEQRLRQRLLKNKY  839

Query  835   LLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNES  1014
             L+V+DD+W    W+ L+R  PDD NGSRI++T+RL++VA+ +    +   +L  LN +ES
Sbjct  840   LIVLDDVWDVEVWNVLERSLPDDGNGSRIMITSRLRKVALEAE-PDRDPHSLRLLNHDES  898

Query  1015  WMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASA  1188
             W L   K+  G    P E+ +IG++I  +C GLPLA+   AG+L KT++ +E W+ IA  
Sbjct  899   WKLLQMKIFHGEGCCPKELVDIGEQIAERCGGLPLAVVAVAGILEKTEKELEQWELIAKE  958

Query  1189  MNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFV  1368
             +N  +  D   +C  IL LSY++LP HLKACFLYFG F +  +++    L+ LWI EGFV
Sbjct  959   LNSQVIGDAETRCKDILQLSYSHLPAHLKACFLYFGAF-QGDKDVRVNKLIQLWIAEGFV  1017

Query  1369  MEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVS  1548
              +   RSLEE A +YL DLIDR+LV+ISK    G +K CR+HDLL DLC  +  ++KF+ 
Sbjct  1018  QKKVPRSLEETAEEYLLDLIDRSLVIISKKRSKGGVKACRIHDLLRDLCQSQSSEDKFLQ  1077

Query  1549  AFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHK---------------  1683
                +  E    L D+       + W+ F +    P    KY  H+               
Sbjct  1078  LVTRYDEPYASLLDS-------DHWVDFDSYC--PSNPVKYESHRLCICLKRKVFVDSRP  1128

Query  1684  ----SRTLLFFFGVSGASGLPVSWRQNVS-----FKMIRVLDLVEISFDEAPTFDISDLI  1836
                 +R+L+F    S +S        N+S     FK+++VLDL  I+   +   ++  L+
Sbjct  1129  SGPSTRSLIF----SASSDTYPRRPYNLSFIPRHFKLVKVLDLECINIGHSFPAEMEFLV  1184

Query  1837  LLRYLAL-GTIKYV-RVLKHHHNLQTLIVK-------FPNSCRieeidsdeeiGSKWLQG  1989
              LRYLA+ G +  + R + +   L+TLIVK        P+S                   
Sbjct  1185  QLRYLAISGDVGSIPRSISNLWKLETLIVKGLSGMVLLPDS-------------------  1225

Query  1990  LWKSQSLR--FIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRC-----TKEFVLKIPNVKV  2148
             LW    LR   +K    F +  D       L  L     L       T++ + K+PN++ 
Sbjct  1226  LWCMTRLRRIHVKKQAAFSMGDDISGYSFQLENLVTFSSLSLSFGMDTEKILRKLPNLRS  1285

Query  2149  LGIKCSEIR-AFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGT  2325
                   + R + Q+   +  L +L +LE L +    + +       S P +LK+L +   
Sbjct  1286  FSCIFLDARDSSQSCNQFPRLDFLPQLESLKI--FYAGRTRKPGEFSLPLNLKKLTLSSF  1343

Query  2326  ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDH  2505
              L W+ I+ I  LPNL+ LKL      GE W   +  FP+L+FL +    L  W    DH
Sbjct  1344  GLPWDHISTIGRLPNLQVLKLASEAFDGESWDMREDEFPELRFLQLDSLNLVQWNASYDH  1403

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQE  2652
              P L +L L +C  L+++P  F DI TL+LI+++ C  SL ES + I E
Sbjct  1404  LPKLAQLVLRNCKRLQEVPYDFADIPTLELIQVQQCGKSLEESVRSIGE  1452



>gb|EYU24175.1| hypothetical protein MIMGU_mgv1a026011mg [Erythranthe guttata]
Length=860

 Score =   370 bits (951),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 292/895 (33%), Positives = 453/895 (51%), Gaps = 105/895 (12%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDY-KDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL  T++   L P P L + +  D+IQ LR K  +      E+      ++  +
Sbjct  4     AYAALVSLTHTLDQILLHPPPTLDIIFDTDQIQSLRDKAEYFLVDFFENYTSSGGNKEME  63

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIE----------  408
             D+   + D ++ AE  +E  VM  I   +S +R  +    L E +E  I+          
Sbjct  64    DLETMIGDAAYAAEYIVEFNVMNQILGRSSADR-EESSNLLFEGVEISIQEFLFIEKELV  122

Query  409   ------QRNTTQMLSSYNPGQSNQEHII-AGGASKLQDDAIMVGHAQELERTKEMLLQCS  567
                   QR     L++     S+   ++ A G +       MVG    ++   E++   S
Sbjct  123   KFKKDMQRPNNYYLTTKASSSSSSRPLLPACGKNS------MVGFDNHMD---EIMGALS  173

Query  568   TQER--QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGC  741
             T E   ++ISIVGMGGIGKTT+A  ++++P I   F L  W TVSQ+Y  ++IL  L   
Sbjct  174   TNESNLRIISIVGMGGIGKTTLATNVFNNPFIVEHFQLRAWFTVSQEYTDKKILLGL---  230

Query  742   VAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRI  921
                     ++++    E+ +++ + L  ++YL+V+DD+W  + WD ++R  PD+SNGSRI
Sbjct  231   --------LHQINDDYEIGDRLHKTLFGRKYLIVMDDMWDIKAWDMVKRFLPDNSNGSRI  282

Query  922   LLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKC  1098
              +TTRL ++AV  G    Y  NL  L  ++SW L  +K+      P E+E  GK I  KC
Sbjct  283   FVTTRLMKLAVDIGSCSPYQLNL--LEKSQSWDLLREKIFAEERCPDELEGTGKSIATKC  340

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
             RGLPLA+ V AG+L+K+K + ++W SI   +   + ++  + C  IL LSYNNLP HLK 
Sbjct  341   RGLPLALVVIAGVLAKSK-TKQHWVSIEKDVTSVVNNEDDEFCMKILLLSYNNLPIHLKP  399

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF +FP+    I  + L+ LW+ EGF+ +   +SLEE   +YL+DLIDRNL+ ++  
Sbjct  400   CFLYFAVFPE-DHIIKAERLVRLWVAEGFIRQYGHKSLEEIGKEYLKDLIDRNLISVNWR  458

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             S  G +  C +HD+L +LC RE +K+ F+ +F ++  N     D     ++  R      
Sbjct  459   SVTGEVTGCNIHDVLSNLCKREAQKDNFILSFARKLYN----PDILTFMKFTPRLSINDG  514

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF  1818
              +   K     +   +R+LL F    GAS    + R    F ++RVLD+V+I     P  
Sbjct  515   KWKGTKHKPYTSQIPTRSLLCF--SKGASTDYTARR----FPLLRVLDVVDI----YPKD  564

Query  1819  DISDLILLRYLAL-GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLW  1995
             +I  LI  RYL + G I  +  L+H            NS                     
Sbjct  565   EILQLINSRYLIMPGEIWQMPQLRH---------VVANS---------------------  594

Query  1996  KSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIR  2175
                    I    P P +  +I + + L TL  V    CT+  + +IPNVK L I C  I 
Sbjct  595   ------IILPDPPPPDNVQKIILLENLQTLSRVVDFECTEAVINRIPNVKKLEIVCGTIG  648

Query  2176  AFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITII  2355
             +        NL  L KLE+L +E I       + +  FP SLKEL +   ++ WE ++++
Sbjct  649   S----NCLRNLGLLHKLEQLNLELITGTSCCGEIV--FPSSLKELILSECKIPWEDMSVV  702

Query  2356  SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALH  2535
               LPNL+ L+L +   +G++W+  +G F +LKFL+I+  +L+ WE  + HFP L +L L 
Sbjct  703   GSLPNLQVLELHKNAAIGKKWIPKEGEFIRLKFLWINMCELEIWEADNTHFPCLVKLNLG  762

Query  2536  HCHNLEKIPEGFTDITTLQLIEL-KDCFPSLVESAKDIQEEQSSYGNDQLVVRDY  2697
             +  NL++IP  F +I  L+ I L  +    L  SA +I E + + G D L V+ +
Sbjct  763   YL-NLKEIPLDFDEILPLRAINLYHNSSNDLRASANEISERRENLGYDALYVQKF  816



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score =   365 bits (938),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 271/738 (37%), Positives = 379/738 (51%), Gaps = 56/738 (8%)
 Frame = +1

Query  505   AIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGW  684
             AIM G    L+      L     E +VI IVGMGGIGKTT+A+ +Y DPS+ S F +  W
Sbjct  3     AIMEGREMHLKYR----LIGGKSELEVIPIVGMGGIGKTTLARNLYHDPSVISHFDVRIW  58

Query  685   ATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGS  864
             AT+SQDY    IL    G +  +       V S   +  ++ + L R+RYL+V+DDIW  
Sbjct  59    ATISQDYSEGGILN---GLLRSVWVGHPLLVLSNERMVEELYKGLKRRRYLIVLDDIWNK  115

Query  865   RGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGS  1044
             + W  L++CFPDD  GSRI++TTRL EVA Y      Y    P L  +ESW L  QK+ +
Sbjct  116   KPWTVLRKCFPDDGTGSRIIVTTRLLEVADYIASGSSYHHMNP-LKDDESWKLLHQKVFA  174

Query  1045  I--NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLH  1218
                  P E+  IG+ I   CRGLPLAI V  GLLS+ +RS   W+ +A  ++     +  
Sbjct  175   PEETCPSELVSIGRNIAENCRGLPLAIDVVGGLLSQAERSQVFWEQVAKDISEAAADNTT  234

Query  1219  DQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEE  1398
                  IL +SYN LP+HLK CFLY GIF K   +I    L+ LW+ EGF+   SG+SLEE
Sbjct  235   AHLFQILLVSYNYLPHHLKPCFLYMGIFKK-DSKIRASKLIKLWVAEGFLKPISGKSLEE  293

Query  1399  GAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVI  1578
              A  YL+ L DRNL+ + +  F GN+K+  +HDLL DLC+R+  +E F+       E  I
Sbjct  294   AAELYLKALADRNLICVPREEFKGNVKSYSIHDLLRDLCVRKAYEENFLFL----KERYI  349

Query  1579  ELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVS-GASGLPVSWRQNV  1755
               GD       A+R       + Q +         +R+ L    VS     L +S     
Sbjct  350   P-GDIHSRRVCAHRIQDIDRPWDQMQL--------TRSFLSMVDVSWEILSLLIS-----  395

Query  1756  SFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVK-FPNS  1932
             +F+++RVLD++ I   + P  +I  L+ LRYLAL T K    +    NLQ LIVK   NS
Sbjct  396   AFRLLRVLDILSIRRIQFPG-EIIQLVNLRYLALRTSKVPSSISRLWNLQFLIVKAIANS  454

Query  1933  CRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDE-----IPVQDTLHTLYWVP  2097
                  +  +    ++          LR IK+   F +  D+     I VQD L +L  + 
Sbjct  455   FNRHVVTPEILDMTQ----------LRHIKFK-GFCVWYDDQYREHIVVQDQLQSLSTIA  503

Query  2098  YLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQS  2277
                 T   +  IPN+K LGI C E         +D++  L++L KL      S +    S
Sbjct  504   DSGLTDRVLRTIPNLKKLGIFCDEK--------FDHVRDLSRLHKLHSLKCSSWRDADLS  555

Query  2278  INSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFL  2457
                FP SLKEL +    +    ++ I  LPNL+ LKL        +W   +G F +LK+L
Sbjct  556   NLIFPDSLKELALHNCVIHDPHMSRIGNLPNLQILKLRCCGIKNRKWKVNEGEFCQLKYL  615

Query  2458  YISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA  2637
              ++   L  W      FP LE L +  C  L +IP G  DI TL++IE+++  P L++S 
Sbjct  616   MMASLHLDFWAADDICFPRLEHLIIRRCSGLPEIPYGIGDIPTLKVIEVREYLPPLLDSV  675

Query  2638  KDIQEEQSSYGNDQLVVR  2691
             + IQ++Q   GND L VR
Sbjct  676   RMIQKKQEKNGNDGLEVR  693



>ref|XP_004250464.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=848

 Score =   369 bits (948),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 301/908 (33%), Positives = 456/908 (50%), Gaps = 115/908 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQK----LCHlkalleesekklNVS  246
             MAY  L+SLI T+  Q L+P   L+       +C  Q+    LC   + L++        
Sbjct  1     MAYAALSSLIYTLN-QLLKPNQSLIC------RCCTQQHLESLCQNLSALQDFLDNTMTK  53

Query  247   Q--AEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQR-LAEDIEGLIEQ--  411
                  K +  R++++ ++AED ++  +  II   A HE   Q   R   E++  + EQ  
Sbjct  54    DIGTLKVIEKRIRNVVYKAEDRVDLSLRSIIL--ADHEDKRQKACRSFYEELLKVEEQVY  111

Query  412   --RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAI---MVGHAQELERTKEMLLQCSTQE  576
               +    M+     G  + E  +A   S L+       +VG   +     + L    T E
Sbjct  112   FLKKEVMMVEFNKHGSKSAE--LATNPSTLEKSKFEENIVGMEDDFNTILDSL-TTQTDE  168

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA---  747
               VI I+GMGGIGKTT+A+K++ D  IRSRF    W T+S++Y+ R++L ++   V    
Sbjct  169   LIVIPILGMGGIGKTTLARKVFGDSYIRSRFDKHAWVTISKEYNQRQMLLEVVSSVTGSK  228

Query  748   -QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
              +M+D ++ E+           + L  +R+L+V+DDIW ++ WD +QR FP+D N SRIL
Sbjct  229   QEMSDDQLMEI---------AYKGLKGRRFLIVIDDIWSTKAWDQIQRIFPNDDNKSRIL  279

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTRLK +A Y  C      +  FL+ ++SW LF++K+   +  PP + +IGK IV +C+
Sbjct  280   LTTRLKNIADYVSCPDFPPHSKSFLSLDDSWNLFTEKIFKKDPCPPLLVKIGKHIVQQCQ  339

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL++ V AGLL K   +  NW+ +   +N      + ++C +IL+LSYN LP +L+AC
Sbjct  340   GLPLSVIVVAGLLGKIDPTHNNWKIVEGNLN-SFFGTVSERCQSILSLSYNYLPQYLRAC  398

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFV-MEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             FLY G F +   EI    L+ LWI E FV    S + LE  A +YLQ+LIDR+LVL+ K 
Sbjct  399   FLYVGGFSE-DMEIDVSKLIRLWIAEQFVKARRSNKRLEVVAEEYLQELIDRSLVLVGKQ  457

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
                G +KTC++HDLL  LC+RE K E  ++  +         GD              R 
Sbjct  458   RANGRMKTCKIHDLLRQLCIREAKTENGLNVMN---------GDVT------------RA  496

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF  1818
              Y        YN  +S  +   F  + + GL    R    F ++  L L+++    +   
Sbjct  497   IY--------YNMQQSSRITRTFIPTSSFGLVFPKR---IFSIVSELKLLKVLDVLSVEC  545

Query  1819  DIS----DLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
             D S     L+ LRY+A   I+    L    NLQT+I++      +           K   
Sbjct  546   DFSCVIPHLVHLRYVA-ARIEKALSLDKLRNLQTIILQSLEETEL-----------KHPL  593

Query  1987  GLWKSQSLRFIKYPYPF----PIDTDEIPVQ------DTLHTLYWVPYLRCTKEFVLKIP  2136
              +W+   +R +    P     P+D++   +       + LHTLY + Y     E + + P
Sbjct  594   DIWRMSEIRHVDIGLPLYISNPLDSENHSIGGHPLFLNNLHTLY-LHYSPFVPEIITRSP  652

Query  2137  NVKVLGIKC-SEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELK  2313
             N+K L I   SE   F      D+L  L  LE L +   +   F   S + FP +LK+L+
Sbjct  653   NLKELKISDRSEHPVF------DSLSLLYDLETLHLATFDPMIF---SGDIFPPNLKKLR  703

Query  2314  IVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWE  2490
             +  T L WE + +++ LPNLE LK   A++ G  W +  D  F KLK L I    L+ WE
Sbjct  704   LSYTRLPWEVVNLLANLPNLEVLKGNDAFK-GTNWRLNEDVVFRKLKHLKIVAGDLQRWE  762

Query  2491  TM-SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSY  2667
                SD+FP+LE+L LH   +LE+IP    +I TL+ I++  C   +  SA  IQEEQ S 
Sbjct  763   VAGSDNFPMLEQLILHQLRDLEEIPVSIGEIMTLKFIQINCCGSGVDTSATKIQEEQQSL  822

Query  2668  GNDQLVVR  2691
             GN +L +R
Sbjct  823   GNYELQLR  830



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score =   370 bits (949),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 280/893 (31%), Positives = 441/893 (49%), Gaps = 66/893 (7%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL++ ++ +Q    R  L VD  D +Q L++KL     +     +   ++Q  +
Sbjct  5     AYASLRSLMQVLDNVQHPARRGQLRVD-ADRVQSLQEKL--QFLVDFLEHRSQRMTQEME  61

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLH-QILQRLAEDIEGLIEQRN--TTQM  429
              +  ++   +  AED I++ V++ +   +  E     +     +DI+ + E+ +  T ++
Sbjct  62    GLAGQIVAAADEAEDFIDTHVVDQLREASEDESYQLAVFSSFCQDIDKVTEKIDAITKEL  121

Query  430   LSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ------ERQVIS  591
             +       + QE            +A+       +    E LLQ   +        QV+ 
Sbjct  122   MMIEEEWGNAQEQKPVVSNLPTSSEALPSSGKNTIIGFDEHLLQVVDELTRDESSLQVLP  181

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEIN  771
             +VGMGG GKT +A+ I+D   +  RF    W T+SQ Y +  IL  L   +    DKE++
Sbjct  182   LVGMGGTGKTILARNIFDHSYVVHRFDKRIWFTISQKYSVHEILARL---LNDGKDKEVS  238

Query  772   EVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVA  951
             E  ++AEL  ++ + L  QRYL+V+D +W +  WD L+  FPD+ NGSR+++TTRL  VA
Sbjct  239   E--TSAELGERLYKNLFGQRYLIVMDGVWSAEAWDALKLFFPDNRNGSRVMMTTRLLNVA  296

Query  952   VYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLP-PEIEEIGKRIVNKCRGLPLAITV  1125
                G    ++  + FL+ ++SW LF  K       P PE+EEIGK I N CRGLPL I V
Sbjct  297   DVLGSQRPHL--MDFLDEDKSWNLFCHKAFAQEGCPYPELEEIGKNIANTCRGLPLTIVV  354

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
               GLL+ +    E W+ +A  +     ++ ++ C  IL LSY+NLP +LK CFLY  +F 
Sbjct  355   IGGLLANSNMEQEYWEYVAKNVRSFANAEHNEHCLKILALSYHNLPIYLKPCFLYTRVF-  413

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +   +I    L  LWI EGF+    G++LEE A +YL++L+DRNL+ I + +  G  K C
Sbjct  414   REDAKIAVSKLTKLWIGEGFLKPIRGKTLEEVAKEYLKNLVDRNLIFIHRWTKKGKPKVC  473

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSD  1665
              +HDLL D+C +E  KE F+     +++ +        +    N  ++ + T   P+   
Sbjct  474   DVHDLLRDICRKEADKEHFIRT--PKAQRIYAYRGNGIVCFLCNDRVSLQQTIDVPEIVA  531

Query  1666  KYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLR  1845
                             S ASGL     +++   + R+  +   S  +      + L  + 
Sbjct  532   GLQL-----------TSNASGLVCEACKSMYRNLARLRWVKAFSVPDREYLQHTKLRYVE  580

Query  1846  YLALGTIKYVRVLKHHH-----NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSL  2010
                + T+  V+ +         +LQTL     ++     +          L  +W+   L
Sbjct  581   MALVNTMDDVKFISPFAMPLLWDLQTLFFTLGDARHPTIV----------LPKIWEMPQL  630

Query  2011  RFI---KYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAF  2181
             R I       P PIDT + P+ + L TL  +   +CT+E + +IPN+K + I        
Sbjct  631   RHIIMGGAILPDPIDTQDSPILENLQTLSLIHDFKCTREVLHRIPNLKKMKIYYLN----  686

Query  2182  QTETWWD----NLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAIT  2349
             + E W      NL +L KLE L V    ++   L+++  FP SLK+L++   ++ WE + 
Sbjct  687   KVEDWSSYCLYNLVHLHKLESLYV---RAKDLSLKNM-GFPTSLKKLELYECKVPWEDMI  742

Query  2350  IISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLA  2529
             II  LPNLE L L      G EW   +G FP+LK L +S + L+ W   + HFP LE+L+
Sbjct  743   IIGSLPNLEVLMLKGCGFKGSEWNPIEGQFPRLKVLELSMSNLECWRAENVHFPNLEKLS  802

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVV  2688
             L    +LE+IP G   I TL LIE+  C  S+V SA  I EEQ S GN+ L V
Sbjct  803   LRLMDDLEEIPSGIGYIATLGLIEVYYCSDSIVNSAMQILEEQRSNGNEDLHV  855



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score =   369 bits (946),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 298/911 (33%), Positives = 451/911 (50%), Gaps = 115/911 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDY---KDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  L+SL+ T++ Q L+P   LV      +  ++   Q LC L+  L+E+ ++    +
Sbjct  1     MAYSALSSLMHTLQ-QLLQPNQRLVCGSCIPQQHVESTYQSLCALQVFLDEATEEAKDIE  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISN--GASHERLHQILQRLAEDIEGLIEQRNTT  423
               K +  R++D+ ++ E  ++S +  +I    G   ER  +      +++E  ++     
Sbjct  60    TLKRLEKRLRDVVYKVEYRVDSRLRNVIVADCGDDRERACKAFNEELQEVEKEVDSLKKE  119

Query  424   QMLSSYNPGQSNQEHIIAGGASKLQ---DDAIMVGHAQELERTKEMLLQCSTQERQVISI  594
              M   +N   S    +    +S  +   +   +VG   +     + L    T E  VI +
Sbjct  120   VMQIEFNKRGSKSAELATTSSSSRRYASEQNTVVGMEDDFNAILDRL-TAQTHELTVIPV  178

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+A+K YDD SIR RF +  W TVS++Y+ R++L D+   +++    E  E
Sbjct  179   VGMGGIGKTTLARKAYDDSSIRYRFDIHSWVTVSENYNERQVLLDVIISISRDRTDESYE  238

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
               S  +LA  V + L  +R+L+++DD+W +  WD +QR FP+D+N SRILLTTRL  VA 
Sbjct  239   TMSINQLAEIVYKGLKGRRFLIIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD  298

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQKLGSINL-PPEIEEIGKRIVNKCRGLPLAITVAA  1131
             Y+        ++ FL+ + SW LF++ L   +L PP++++IGK I+ +CRGLPL+I V A
Sbjct  299   YASPDFP-PHSMSFLSLDNSWNLFTEMLFKKDLCPPQLQKIGKHIIQQCRGLPLSIVVIA  357

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLL K   + +NW+ I   +N                               +FG FP+ 
Sbjct  358   GLLGKMDLTHDNWKKIEENLN------------------------------SFFG-FPE-  385

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRL  1491
               EI    L+ LWI+E F+   S + LE  A +YLQDLIDR+L+L  K    G ++TC++
Sbjct  386   DMEINVSKLIRLWISEQFIKARSYKRLEVVAEEYLQDLIDRSLILAGKRRANGRMRTCKI  445

Query  1492  HDLLFDLCLREVKKEKFVSAFHQR----------SENVIELGDTEPLFEYANRWLTFRT-  1638
             HDLL  LC+ E   E  V A +               VI   D +    Y  R  +  T 
Sbjct  446   HDLLRQLCIIEAHNENVVHAMNANVPMFSEAINDQRRVIVPFDIKEKHVYPTRHSSVITS  505

Query  1639  ---TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEA  1809
                T+I  K+SD  +F +    LF   VS              FK+++VLD+  +  D +
Sbjct  506   MTRTFIFTKYSD-LDFAE----LFCSIVS-------------QFKLLKVLDVYNVRCDFS  547

Query  1810  PTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL--  1983
                 I  LI LRY+A   I     L    NLQT+I++                 SK L  
Sbjct  548   SV--IPKLIHLRYVA-ANIDEAPSLAKLWNLQTIILR--------------NFASKDLHL  590

Query  1984  -QGLWKSQSLRF------IKYPYPFPIDT----DEIPV-QDTLHTLYW--VPYLRCTKEF  2121
              Q +W    +R       I  P P   ++    +E P+  + L TL     PYL    E 
Sbjct  591   PQEIWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTLVLPSSPYL---AEI  647

Query  2122  VLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSL  2301
             + + P +  L I   E R  +     D +  L +LE L +E        + S + FP +L
Sbjct  648   LRRTPYLNKLTI-LDESRHPEYPAILDPISLLQELETLTIEADLGSDLMILSRDIFPPNL  706

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKL  2478
             K+LK+  T L WE + +++ LPNLE LK   A+E G  W +  D  F KLK+L +    L
Sbjct  707   KQLKLSYTTLQWEDMVVLANLPNLEVLKAYSAFE-GTNWKLNEDVVFQKLKYLRLQYGGL  765

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
             + WE  +D FP+LE+L L+    LE+IP+   DI  L+LI+++ C  + V SAK IQEEQ
Sbjct  766   ERWEATNDSFPMLEQLLLYGFRKLEEIPQSIGDIMILKLIQIERCSAAAVTSAKKIQEEQ  825

Query  2659  SSYGNDQLVVR  2691
              S GN +L VR
Sbjct  826   QSLGNYELQVR  836



>gb|ABY61746.1| resistance protein PSH-RGH7 [Solanum tuberosum]
Length=930

 Score =   370 bits (951),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 318/957 (33%), Positives = 469/957 (49%), Gaps = 160/957 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++I+ LR   +K C++    E       ++ 
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKIESLRAILEKSCNIMGDHE------GLTI  53

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
              E ++I    ++++  E  ++SE   +       ER      +  +L++  E I+  ++Q
Sbjct  54    LEVEII----EVAYTTEGMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   --------RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCS  567
                     ++  Q  SS     S  EH +       Q + IMVG   E E   + L +  
Sbjct  110   WMAASDSMKDLKQQTSSL---VSLPEHDVE------QPENIMVGRENEFEMMLDQLAR-G  159

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA  747
              +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +
Sbjct  160   GRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS  219

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
                D          +LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILL
Sbjct  220   DEPD---------YQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILL  270

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNK  1095
             TTR  EVA Y+  SGK   ++  +NS ESW L  +K+    GS +  PE E IGK+I  K
Sbjct  271   TTRNVEVAEYAS-SGKPPHHMRLMNSIESWNLLHKKIFEKEGSYS--PEFENIGKQIALK  327

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             C GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK
Sbjct  328   CGGLPLAITVIAGLLSKMGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLK  387

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
              CFLYF IF +  R I   +L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  
Sbjct  388   PCFLYFAIFAEDER-IYVHELVELWPVEGFLNEEEGKSIEEVAETCINELVDRSLISIHN  446

Query  1456  LSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR  1635
             LSF G  + C +HD+  +LCLRE +   FV+    +S+        +  F+  +R   ++
Sbjct  447   LSFDGKRQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIYK  506

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPT  1815
                +   +      H    L  F  V+            +SFK++RVLDL    +   P+
Sbjct  507   EEEL--AWCRNSEAHSIIVLRLFECVT----------PELSFKLVRVLDL---GWTPCPS  551

Query  1816  F--DISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG  1989
             F   +  LI LRYL+L   ++   L+ +   +     FP+S     +          +  
Sbjct  552   FPSGVLSLIHLRYLSL---RFTPCLQQYREWKE---AFPSSIIDIPLS---------ISS  596

Query  1990  LWKSQSLRFIKYP----YPFPIDTDEIPVQDTLHTLY--WVPYLR---------------  2106
             L   Q+ +F  +P    YPF I   EI     L  LY  W  YLR               
Sbjct  597   LCYLQTFKF-SFPIINNYPF-ILPSEILTMPQLRKLYMGW-NYLRSHEPTENRLVLKSLQ  653

Query  2107  ---------CTKEFVLKIPN---VKVLGI-----KCSEIRAF----QTETWWDNLHYLTK  2223
                      CT  F    PN   +KVLG+     K  ++  F    Q E    ++HY + 
Sbjct  654   CLDHLNPRYCTGSFFRLFPNLKKLKVLGVPEDFRKHKDLYDFRCLYQLEKLAFHIHYSSA  713

Query  2224  L----------------EKLIVEDIESEQFELQSINSFP-----------QSLKELKIVG  2322
                               +   E +  + +   S    P           Q+LK L   G
Sbjct  714   ACFVESTAPSGSTPQDPLRFQTEILRKDFWATASPTDVPILLLPSLDDFPQNLKSLTFRG  773

Query  2323  T-ELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMS  2499
                L W+ ++I+  LP LE LKL      GEEW   + GFP LKFL +    ++ W   S
Sbjct  774   EFSLAWKDLSIVGKLPKLEVLKLSCYAFKGEEWEVVEEGFPHLKFLLLDEVDIRYWRASS  833

Query  2500  DHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYG  2670
             DHFP LERL L +C+ L+ IP  F DITTL LI+++ C  S+  SAK IQ+    YG
Sbjct  834   DHFPYLERLFLKNCYYLDSIPLDFADITTLALIDIEHCQQSVGNSAKQIQQVIQDYG  890



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score =   367 bits (943),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 298/887 (34%), Positives = 443/887 (50%), Gaps = 90/887 (10%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVD--YKDEIQCLRQKLCHlkalleesekklNVSQA  252
             MAY  L SL++ +E      +P+ V+D   K  ++ L +K C LK   E S      S  
Sbjct  1     MAY-NLESLVQILEQLLDHHQPLWVLDPNKKPRLESLLKKACFLKEFFENSSSAAT-SYR  58

Query  253   EKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQML  432
              + V +R++D++++AED +ES +++            Q+L   + + E  I         
Sbjct  59    LQSVESRIRDVAYKAEDVLESHLVD------------QLLS--SPEGESFI---------  95

Query  433   SSYNPGQSNQEHIIAG-GASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGG  609
               ++P   + E +     ++K +  AIM G    L+      L     E +VI IVGMGG
Sbjct  96    --FSPPDLDLEKVTGELDSAKEEMMAIMEGRDMHLKYR----LIGGKSELEVIPIVGMGG  149

Query  610   IGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA  789
             IGKTT+A+ +Y DPS+ S F +  WAT+SQDY    IL    G +  +       +    
Sbjct  150   IGKTTLARNLYHDPSVISHFDVRIWATISQDYSEGGILN---GLLRSIWVSHPLLLLGNE  206

Query  790   ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCS  969
              +  ++ + L R+RYL+V+DDIW  + W  L++CFPDD  GSRI++TTRL EVA Y    
Sbjct  207   RMVEELYKGLKRRRYLIVLDDIWNKKPWTVLRKCFPDDGTGSRIIVTTRLLEVADYIASG  266

Query  970   GKYVCNLPFLNSNESWMLFSQKLGSI--NLPPEIEEIGKRIVNKCRGLPLAITVAAGLLS  1143
               Y    P L  +ESW L  QK+ +       E+  IG+ I   CRGLPLAI V  GLLS
Sbjct  267   SSYHHMNP-LKDDESWKLLHQKVFAAEETCSSELVSIGRNIAENCRGLPLAIDVVGGLLS  325

Query  1144  KTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREI  1323
             + +RS   W+ +A  ++     +       IL++SYN LP+HLK CFLY GIF K   EI
Sbjct  326   QAERSQVFWEQVAKDISEAAADNTTAHLFQILSVSYNYLPHHLKPCFLYMGIF-KEDSEI  384

Query  1324  PTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLL  1503
                 L+ LW+ EGF+   SG+SLEE A  YL+ L DRNL+ + +  F GN+K+  +HDLL
Sbjct  385   RASKLIKLWVAEGFLKPISGKSLEEAAEMYLKALADRNLICVPREEFKGNVKSYSIHDLL  444

Query  1504  FDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHK  1683
              DLC+R+  +E F+    +        GD       A+R         Q +         
Sbjct  445   RDLCVRKAYEENFLFLKARYIP-----GDVSSRRVCAHRIQDIDRPLDQMRL--------  491

Query  1684  SRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGT  1863
             +R++LF   VS     P+      +F+++RVLD++ I     P  +I  L+ LRYLAL T
Sbjct  492   TRSVLFMGNVSWMILSPLI----SAFRLLRVLDILSIGCILFPG-EIIQLVNLRYLALRT  546

Query  1864  IKYVRVLKHHHNLQTLIVK-FPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFP  2040
              K    +    NLQ LIV+   +S     +  +          + +   LR IK+   F 
Sbjct  547   SKVPSSISRLWNLQVLIVEAIADSFNRHVVTPE----------ILEMTQLRHIKFK-GFC  595

Query  2041  IDTDE-----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDN  2205
             +  D+     I VQD L +L  +     T   +  IPN+K LGI C E         +D+
Sbjct  596   VWYDDQYREHIVVQDQLQSLSTIAVSGLTDRVLRTIPNLKKLGIFCDEK--------FDH  647

Query  2206  LHYLTKLEKLIVEDIESEQF-----ELQSINSFPQSLKELKIVGTELGWEAITIISMLPN  2370
             +  L++L KL      S  +     +L ++  FP SLK+L +    +    ++ I  LPN
Sbjct  648   VRDLSRLHKLHSLKCSSGLYVHHHSDLSNL-IFPDSLKKLALQHCVIHDPHMSRIGNLPN  706

Query  2371  LESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNL  2550
             L+ LKL        +W   +G F +LK+L +    +  W      FP LE L + HC  L
Sbjct  707   LQILKLSNCGIKNRKWKVNEGEFCQLKYLIMEHLHMDFWAADDICFPRLEHLIIRHCAWL  766

Query  2551  EKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              +IP G  DI TL++IE++   P L++S + IQ++Q   GND L VR
Sbjct  767   PEIPYGIGDIPTLKVIEVRQYLPPLLDSVRMIQKKQEKNGNDGLEVR  813



>gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Erythranthe guttata]
Length=860

 Score =   369 bits (946),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 274/836 (33%), Positives = 429/836 (51%), Gaps = 69/836 (8%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEII-SNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYN  444
             +++   +  AED IES V++ I S+  S   LH +++ L    E +       ++L + +
Sbjct  57    SQIASAAHAAEDVIESHVVDQIDSDSVSSLDLHAVIEHLDSVKEKVFNVVKEERVLFNDH  116

Query  445   PGQSNQ-EHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKT  621
               Q           +S +  ++ MVG  +EL +  + L        Q+I IVGMGGIGKT
Sbjct  117   LQQGPTFSSFAPRSSSSINGNSKMVGFDEELFQLLDAL-TGRQSSLQIIPIVGMGGIGKT  175

Query  622   TMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELAN  801
             T+A+  Y+   I + F +  W T+SQ+Y ++ I        +++  ++ ++     +LA 
Sbjct  176   TLARNAYEHRLISNHFDVCAWVTISQEYSVKEIF-------SKLLSRQSSQSADEQQLAQ  228

Query  802   KVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYV  981
             ++ + L+ +RYL+++DDIW    W+ +   FPD++NGSRI+LTTRL  VAVY G S    
Sbjct  229   ELYQSLIGRRYLIILDDIWSIDAWEKMMFFFPDNNNGSRIILTTRLSNVAVYFGSS---Y  285

Query  982   CNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKR  1155
              ++ FL+  +SW LF +         PPE+EEIGK+IV KC+GLPL I V   LL K+ +
Sbjct  286   FSMKFLDEYKSWKLFCENAFPQEGCCPPELEEIGKKIVKKCKGLPLLIVVIGALLRKSSK  345

Query  1156  SVENWQSIASAMNLPMTSDLH-DQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTK  1332
             + E W++I+  MN  + S  + +Q   IL+LSY+NLP HLK CFLY GIFP+    I   
Sbjct  346   TREYWENISENMNSILDSSKNMEQSVDILSLSYSNLPAHLKPCFLYMGIFPE-DSVIYVS  404

Query  1333  DLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDL  1512
              L+ LW+ EGF+     ++LEE A  +L+DL+DRNL+L  KL   G  KTC +HDLL DL
Sbjct  405   QLIKLWVAEGFIKSTKTQTLEEIAEDHLKDLVDRNLILPRKLRSTGKTKTCTIHDLLRDL  464

Query  1513  CLREVKKEKF-----VSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNF  1677
             C++  +KEKF     V+  H  +E +           Y  R +       + +F D +  
Sbjct  465   CIKAAEKEKFLIVMRVNDVHINAEGI-----------YKERRIVCHQEIPRRQFIDAF--  511

Query  1678  HKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLAL  1857
              +S +L+  F  +       S    +  K++RVL    I       ++I   + LRY+ +
Sbjct  512   -ESASLIRSFATN-------SNLMEIELKLLRVL-FAPIRRYNNDLYEILKQVNLRYVCV  562

Query  1858  ------GTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFI  2019
                      +  + +    NLQTL ++       ++ D      S+    +W+   LR +
Sbjct  563   RPEVWEDNFERFQKISRVWNLQTLTIR-------DDADEVFVTPSE----IWEMVHLRHV  611

Query  2020  KYPYPFPIDTDEIP---VQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTE  2190
             ++   F +D        V   L T+  V  LR + E   +IPN+K L I  +++ + ++ 
Sbjct  612   EFNKVFIVDPPSKSNDFVLRNLQTVEGVIDLRLSDEVCKRIPNLKKLKITFNDVLSERSS  671

Query  2191  TWWD--NLHYLTKLEKL--IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIIS  2358
               +   N+  L KLE L     +I        ++ + P SLK+L + G  L  E + +I 
Sbjct  672   RHYSLYNIGRLHKLESLKCCFRNILDGSNSPLNLMALPTSLKKLTLQGCCLHSEDLAMIG  731

Query  2359  MLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK-LKNWETMSDHFPVLERLALH  2535
              LP+L+ LKL     +G EW   +GGF +LKFL I   + LK W   S HFPVLE +   
Sbjct  732   SLPHLQFLKLAYVSIVGSEWDPVEGGFLQLKFLKIYSCRDLKYWNADSSHFPVLENIKFV  791

Query  2536  HCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDT  2703
                 L ++P G  +I TL  IEL  C  S+  SA  I EEQ S+GN+ +  R ++ 
Sbjct  792   EVDRLVEVPLGVGEIPTLGAIELVRCTESVAMSAVRILEEQESFGNEAIPCRTFEV  847



>ref|XP_006365681.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score =   364 bits (934),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 263/736 (36%), Positives = 392/736 (53%), Gaps = 68/736 (9%)
 Frame = +1

Query  601   MGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVK  780
             MGGIGKTT+A+K YDD  I+SRF    W T+SQ Y+ R++L ++   +   ++K +    
Sbjct  1     MGGIGKTTLARKAYDDSYIQSRFDKHAWVTISQKYNERQMLLEVASSITTGSNKYM----  56

Query  781   STAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYS  960
             S  +L   V R L  +R+L+V+DDIW +  WD ++R FP+D+N SRILLTTRLK VA Y+
Sbjct  57    SDDQLMEFVYRGLKGRRFLIVIDDIWSTEAWDQMKRIFPNDNNKSRILLTTRLKCVAGYA  116

Query  961   GCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGL  1137
                     +  FL+ ++SW LF++KL    + PP +EE GK IV +CRGLPL++ V AGL
Sbjct  117   SSPDFPPHSKSFLSVDDSWNLFNEKLFKQDHCPPLLEETGKHIVQQCRGLPLSVVVVAGL  176

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRR  1317
             L K   + +NW+++   +N      + +QC +IL+LSY+ LP +L+ACFLY G FP+  +
Sbjct  177   LGKMDPTYDNWKNVEKNLN-SFFGTVSEQCQSILSLSYSYLPQYLRACFLYVGGFPE-DK  234

Query  1318  EIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHD  1497
             EI    L+ LWI E FV   S +SLE  A +YL++LIDR+L+L  +       KTC++HD
Sbjct  235   EIDVSKLIELWIAEQFVKARSNKSLEVVAEEYLEELIDRSLILTGRQRANEWNKTCKIHD  294

Query  1498  LLFDLCLREVKKEKFVSAFHQRSENVI----ELGDTEPLFEYANRWLTFRTTYIQPKFSD  1665
             LL  LCLRE   E  V   H  + NV      + D   +    ++    R  Y +   S 
Sbjct  295   LLRQLCLREAHTENVV---HIMNWNVTMSSEAINDQRRVIVSEHQ---ERQVYSRRHSSG  348

Query  1666  KYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLR  1845
               +  ++   + +FG++   G+     Q    K+++VLD+  I +D +    I  L+ LR
Sbjct  349   ITSITRTFISMQYFGLNFPKGICSFVSQ---LKLLKVLDVSSIQYDFSCV--IPQLVHLR  403

Query  1846  YLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKY  2025
             Y+A   IK    L    NLQT+I+   N  R E          K    +W    +R +  
Sbjct  404   YVA-ARIKEAISLAKLRNLQTIILA--NVERTEL---------KHPLDIWTMTEIRHLDI  451

Query  2026  PYPFPIDTDEIPVQDTLH------------TLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               P  I    +   +++             TL++ P+     E + + PN+K L I    
Sbjct  452   ESPLHISNPCVSENNSIGEQPLFLNNMQTLTLHFSPF---AAEIIRRTPNLKYLKI----  504

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSI--------NSFPQSLKELKIVGT  2325
                   + W   L     L+ LI+ +         S         + FP +LK+L++  T
Sbjct  505   -----IDYWPSILDGPPVLDSLILLEELEMLDIELSTIGPVTFPRDIFPSNLKKLRLSYT  559

Query  2326  ELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWETMSD  2502
              + WEA+ +++ LPNLE LKL  A+  G +W V  D  F KLK+L I+   L+ WE  SD
Sbjct  560   RIPWEAMNLLANLPNLEVLKLDYAF-AGTDWKVDEDVVFHKLKYLQIASDCLERWEIGSD  618

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
             +FP+LE+L L+  + LE+IPE   +I TL LI+L  C   +V SAK IQ+EQ S GN +L
Sbjct  619   NFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQEQQSLGNYEL  678

Query  2683  VVRDYDTRS*ILGAPV  2730
              V+       + G PV
Sbjct  679   QVQIKSNYGVVKGIPV  694



>gb|EYU24151.1| hypothetical protein MIMGU_mgv1a019744mg, partial [Erythranthe 
guttata]
Length=868

 Score =   369 bits (946),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 298/914 (33%), Positives = 467/914 (51%), Gaps = 100/914 (11%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDY-KDEIQCLRQKLCHlkalleesekklNVSQAE  255
             +AY  L SL  T++   L P P L + +  D+IQ LR K  ++     E+      ++  
Sbjct  3     VAYAALVSLTHTLDQILLHPPPTLDIIFDTDQIQSLRDKAEYILVDFFENYTSSGGNKEM  62

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHER--------------------LHQILQ  375
             +D+   +   ++ AE  +E  VM  I   +S +R                    + + L 
Sbjct  63    EDLETMIGVAAYEAEYIVEFNVMNQILGRSSADREESSDLLYEGVKISIREFLFIEKKLV  122

Query  376   RLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHII--AGGASKLQDDAIMVGHAQELERTKE  549
             +  +D+     QR     L++     S+    +  AGG +       MVG    ++   E
Sbjct  123   KFKKDM-----QRPNNYYLTTTKASSSSSSRPLLPAGGKNN------MVGFNNHMD---E  168

Query  550   MLLQCSTQER--QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL  723
             ++   ST E   ++ISIVGMGGIGKTT+A  ++++P +   F L  W TVSQ+Y  ++IL
Sbjct  169   IMGALSTNESNLRIISIVGMGGIGKTTLASNVFNNPFVE-HFQLRAWFTVSQEYTDKKIL  227

Query  724   QDLCGCVAQ--MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
               L   +    +   EI++      + +++ + L  ++YL+V+DD+W  +  D ++R  P
Sbjct  228   LGLLHQINNTYINAHEIDDDDDDYAIGDRLHKTLFGRKYLIVMDDMWDIKACDMVKRFLP  287

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINL-PPEIEEI  1074
             D++NGSRIL+TTRL ++AV  G    Y  NL  L+ ++SW L  +K+ +    P E+E  
Sbjct  288   DNNNGSRILVTTRLMKLAVDIGSCSPYQLNL--LDISQSWDLLREKIFAEECCPDELEGT  345

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK I  KC GLPLA+ V AG+L+K+K   E+W SI   +   + +   + C  IL LSYN
Sbjct  346   GKSIAKKCNGLPLALVVIAGVLAKSKTE-EHWVSIEKDVTSAVNNQDDESCMKILLLSYN  404

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
             NLP HLK CFLYF +FP+    I  + L+ LW+ EGFV +   +SLEE   +YL+DLIDR
Sbjct  405   NLPIHLKPCFLYFAVFPE-DHIINAERLVRLWVAEGFVRQCGHKSLEEIGEEYLEDLIDR  463

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSEN--VIELGDTEPLFE  1608
             NL+L+   S +G +  C +HD+L +LC +E +KE F+ +F ++  N  ++      P   
Sbjct  464   NLILVDLRSIMGEVIDCNIHDVLSNLCRKEAQKENFILSFARKLYNPDILTFMKITPRLS  523

Query  1609  Y-ANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDL  1785
                 +W   + T  +P  S       +R+LL F    GAS    + R    F ++RVLD+
Sbjct  524   INGGKW---KGTKHKPYTSQI----PTRSLLCF--SKGASTDYTARR----FPLLRVLDV  570

Query  1786  VEISFDEAPTFDISDLILLRYLA--LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsd  1959
             V+I     P  +I  LI  RY++    T+     +    +LQTL+V              
Sbjct  571   VDI----YPKDEILQLINSRYVSCMCPTMSMSSSISRLWSLQTLVVD-------------  613

Query  1960  eeiGSKWLQG-LWKSQSLRFIK------YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
                G   L G +W+   LR ++         P P D  +I + + L TL  V    CT+ 
Sbjct  614   ---GELILPGEIWQMPQLRHVEGDSIILPDPPPPDDVHKIILLENLQTLSTVVDFECTEA  670

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQS  2298
              + +I NVK L I C  I +        NL  L KLE+L +E I       + +  FP S
Sbjct  671   VINRIANVKKLEIVCGTIGS----NCLRNLGLLHKLEQLNLELITGTSCCGEIV--FPSS  724

Query  2299  LKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKL  2478
             LK L +   ++ WE ++++  LP LE L+L +   +G++W+  +G FP+LKFL+I   +L
Sbjct  725   LKVLVLSECKIPWEDMSVVGSLPKLEDLELQKNAAVGQKWIPKEGEFPRLKFLWIHKCEL  784

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL-KDCFPSLVESAKDIQEE  2655
             + WE  + HFP LE+L L +  NL++IP  F +I  L+ I L  +    L  SA +I E 
Sbjct  785   EIWEADNTHFPCLEQLHLGYL-NLKEIPLDFDEILPLRAINLDHNSSNDLWASANEISER  843

Query  2656  QSSYGNDQLVVRDY  2697
             + + G D L V+ +
Sbjct  844   RENLGYDALYVQKF  857



>ref|XP_009761982.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=741

 Score =   365 bits (937),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 271/760 (36%), Positives = 393/760 (52%), Gaps = 81/760 (11%)
 Frame = +1

Query  493   LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFH  672
             L ++  +VG   + +  ++ L    T E  V+SIVGMG IGK+T+AK +++ PS+  RF 
Sbjct  40    LDEENTLVGMEDDFKIIRDQLFG-QTPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFD  98

Query  673   LLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDD  852
             +  W TVSQ YD + +L D+         K +    S  EL ++V R+L R+RYL+V+DD
Sbjct  99    ISSWVTVSQAYDAKEMLLDVLS-FGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDD  157

Query  853   IWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVC--NLPFLNSNESWMLF  1026
             +W    WD ++R FPDD NGSRI++TTRL EVA    C+G      ++PFL+  + W L 
Sbjct  158   MWTIEAWDQVRRSFPDDENGSRIMITTRLLEVA---NCAGNDFPPHHMPFLSLEDGWKLL  214

Query  1027  SQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPM  1203
             S K+  + + PP++EE+GK+I  +C+GL L++ V +GLLSK  R+ ++WQ IA  +N  +
Sbjct  215   SLKVFANEDCPPQLEEVGKQIAKQCQGLALSVVVISGLLSKINRTYDDWQQIADNVNSHI  274

Query  1204  TSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSG  1383
              S    QC  IL LSYN LP  LKACFLY G+F +   +I    L+ +W+ EGF+  +S 
Sbjct  275   GST-SQQCLAILALSYNYLPCSLKACFLYMGVFLE-DADISADKLIRIWVAEGFLKRNSH  332

Query  1384  RSLEEGAMKYLQDLIDRNLVLISKLSFI-GNIKTCRLHDLLFDLCLREVKKEKFVSAFHQ  1560
             +  +E   + L++L+ R+L++++   ++ G IK  R+HDL+  +CLRE K EKF    ++
Sbjct  333   KKPKEVGEECLEELVSRSLIMVNNRGWVSGKIKCLRIHDLIRLICLREGKAEKFFHVINE  392

Query  1561  RSENVIELGDTEP-LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPV  1737
               E   E  ++E  LF Y +          Q    +K N    RT+        AS L  
Sbjct  393   CYEVSSEGVESEHRLFLYED------AVQNQNIGLEKGNLDSVRTISCTHK-PHASLLDY  445

Query  1738  SWRQNVS--FKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRV-LKHHHNLQT  1908
                + V   F+++RVLD++ I F   PT +I+ L+ LRYLAL T   V   + +  NLQT
Sbjct  446   ECYKIVDSRFQLLRVLDVLLIYFLHFPT-EITQLVHLRYLALVTSTSVPASISNLWNLQT  504

Query  1909  LIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYP----YPFPIDTDEIPVQDTL  2076
             LIV                    W   +WK  SL    YP     P P         + L
Sbjct  505   LIVH------------SVANELSWPLEIWKISSLIHF-YPGKMYVPAPPKAPNFLGLENL  551

Query  2077  HTLYWVPYLRCT-KEFVLKIPNVKVLGIKCSEIRAFQTETW---WDNLHYLTKLEKLIVE  2244
               L          KE  + IP+VKVL +  ++      + W    DNL YL  L  L + 
Sbjct  552   EELSLSTASSSNLKEIFMAIPHVKVLDVDLNQ------DGWDNLIDNLIYLADLRNLRIL  605

Query  2245  D---IESEQFELQSI---NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
                  +++ F   S    + FP +LK L +  T L                         
Sbjct  606   LRLPFDAQLFRRPSARPYDVFPANLKSLILAETHL-------------------------  640

Query  2407  GEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             G  W   +GGF KLK L I   +L +W   S+  PVLE L L HC+ L++IP    DI T
Sbjct  641   GSNWNLDEGGFKKLKLLDIVQPELVHWHATSESLPVLEYLVLRHCYKLKEIPTEIGDIPT  700

Query  2587  LQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
             L+LIEL  C  S V SA++I +EQ S GN+ L VR Y+TR
Sbjct  701   LKLIELHYCSQSAVTSAEEILDEQQSLGNEVLAVRAYNTR  740



>gb|EYU29512.1| hypothetical protein MIMGU_mgv1a022452mg, partial [Erythranthe 
guttata]
Length=816

 Score =   367 bits (942),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 254/713 (36%), Positives = 388/713 (54%), Gaps = 62/713 (9%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             Q+I IVGMGGIGKTT+A+  Y+   I + F +  WAT+SQ+Y L++I   L         
Sbjct  145   QIIPIVGMGGIGKTTLARNAYESRLILNHFDICAWATISQEYSLKKIFSKLLSRQTSGVG  204

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             +EI +     +L  K+ +RL+ +RYL+++DD+W    W+ +   FPD++NGSRI++TTRL
Sbjct  205   QEIEQ-----QLGQKLYQRLIGRRYLIILDDVWSIDAWEKMMFFFPDNNNGSRIIITTRL  259

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN--LPPEIEEIGKRIVNKCRGLPL  1113
               V++Y G S     +  FL+ ++SW LF +K        PP++EEIGK+I  KC+GLPL
Sbjct  260   SNVSIYFGSS---YFSKKFLDEDKSWNLFCEKAFPQEEVCPPQLEEIGKKIAKKCKGLPL  316

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
              I V  GLL K+  + E W++I+  MN  + S+  +Q   IL+LSY  LP HLK CF Y 
Sbjct  317   LIVVIGGLLRKSSCTQEYWENISQNMNSILDSE--EQNLDILSLSYRQLPAHLKPCFFYT  374

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             GI+P+   EI   +L+ LWI EGF+  +  +SLEE    YL+DL++RNL+ + +L   G 
Sbjct  375   GIYPE-DYEIHLSELIKLWIAEGFIKPNKIKSLEEVGEGYLKDLVERNLLSVGRLRLNGQ  433

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQP  1653
             IKTC +HDL+ DLC++  +KEKF           I   D+        R L         
Sbjct  434   IKTCTIHDLVRDLCIKTAEKEKFFY--------FIRFCDSPRALTKERRILFL------G  479

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMI--RVLDLVEISFDEAPTFDIS  1827
             K S+  +   S  L        ++ L  S+ +N  ++ +  R+L +  + + ++   DI 
Sbjct  480   KNSEINHDLLSHAL-------ESAPLTRSFLRNAGWRPVRFRLLKVFNVDYTDSLPSDIF  532

Query  1828  DLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL----QGLW  1995
             + I LRY+ +    Y    KH H  + L    P +  +       +IG   +      +W
Sbjct  533   EQINLRYVWI----YYDFYKHKHYSREL----PWTVSLLWNVQTLKIGGFGIFYAPTEIW  584

Query  1996  KSQSLRFIKY-----PYPFPI---DTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVL  2151
                 LR++++     P P P+   + D+  V   LHTL  V  L  ++E   +IP+VK+L
Sbjct  585   SMPQLRYLEFARLCLPTP-PLRSQEKDDSIVLKNLHTLKTVVDLNLSEEVCKRIPSVKIL  643

Query  2152  GIKCSEIRAFQT--ETWWDNLHYLTKLEKLIVE--DIESEQFELQSINSFPQSLKELKIV  2319
              IK ++    ++  ET+  N+  L KLE L  +  +++     ++++  FP SLK+L + 
Sbjct  644   KIKYNDFLPERSSRETFIYNIGCLHKLESLNCQLGNVQPCGNLVRNLK-FPTSLKKLTLS  702

Query  2320  GTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMS  2499
             G ++ WE +T I   PNLE L+L      G EW   +G F +LK+L+I+  +LK+W   S
Sbjct  703   GRKIEWEDLTTIGSSPNLEVLQLKDGSMTGSEWNPVEGEFLRLKYLFINSWELKHWNAES  762

Query  2500  DHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
              HFPVLE+L L    +L++IP G  +I TL LI L  C  S   SA  I EEQ
Sbjct  763   FHFPVLEKLYLSGLLHLDEIPLGIGEIPTLALIHLLSCNESASMSAMSILEEQ  815



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   372 bits (954),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 258/725 (36%), Positives = 386/725 (53%), Gaps = 78/725 (11%)
 Frame = +1

Query  556   LQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC  735
             L    +E +VI I GM GIGKTTMAK++Y  P I   FH+  WA+VSQ            
Sbjct  354   LTGQKREIEVILIAGMAGIGKTTMAKRLYKKPLIVHCFHVRAWASVSQS-----------  402

Query  736   GCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGS  915
               ++QM+D+          +  K+ + L  +R+ +V+DDIW +  W+ L+   PDD NGS
Sbjct  403   --LSQMSDEA---------MGVKLYKCLKGKRFFIVIDDIWDAGVWNSLKLYIPDDENGS  451

Query  916   RILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVN  1092
             ++L+T+R+K+VA+         C L FL+ +ESW LF +K+ G+ + P E+ E+GK IV 
Sbjct  452   KVLMTSRIKDVALNPKNECTPHC-LRFLSEDESWDLFERKVFGNESCPQELMEMGKNIVA  510

Query  1093  KCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHL  1272
             KC+GLPLAI V +GL+SK +++ E W+ I   +   + SD  +Q   +L LSY +LP  L
Sbjct  511   KCKGLPLAIVVVSGLISKMEKTRELWEHIGENIGSYIDSD-AEQFMNVLELSYKHLPQRL  569

Query  1273  KACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLIS  1452
             K+CFLY G FP+   EI  + L+ +WI EGF+ +  G+ LE+ A KYL +L+DR+LV++S
Sbjct  570   KSCFLYLGAFPE-DYEISVRKLVRMWIAEGFIQQLEGKKLEDTAEKYLMNLVDRSLVIVS  628

Query  1453  KLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTF  1632
             +      IKT  +HD+L + C+R+ ++  F             L D       ++ ++ F
Sbjct  629   RRRSDNGIKTFLVHDMLRNFCIRKAQETNFA------------LPDYGYQTYCSSPFVNF  676

Query  1633  RTTYIQPKFSDKYNFHKSRTL--LFFFGVSGASGLPVSWRQNVSFK--MIRVLDLVEISF  1800
                Y   +    +NF    T+  L F     A  L VS + NVSFK  ++RVLDL  I  
Sbjct  677   SLDYQNCESLTVFNFFLGNTIDCLVF-----APTLTVSCKPNVSFKYNLVRVLDLRHIME  731

Query  1801  DEAPTFDISDLILLRYLAL--GTIKYVR-VLKHHHNLQTLIVKFPNSCRieeidsdeeiG  1971
             D  P   + +LI L+YLAL  G +  +  V+    NL+TLIV      ++          
Sbjct  732   DNFPR-RVHELIRLKYLALYLGALTCLPPVISRLRNLETLIVDVEKGRKVTLP-------  783

Query  1972  SKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVL-KIPNVKV  2148
                   +WK   LR ++    F  +T             W      +++ +L +IPNV+ 
Sbjct  784   ----DDIWKMFKLRHLQISPEFEFETP------------WPNSAGPSRDILLARIPNVRN  827

Query  2149  LGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE--DIESEQFELQSINSFPQSLKELKIVG  2322
             LG   +         ++D L  L  LEKL  E          + S + FP SLK+L +VG
Sbjct  828   LGFHITLSSREDPFNFFD-LSGLNVLEKLKFEYQTYGMVPVTISSSDKFPSSLKKLTLVG  886

Query  2323  TELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSD  2502
             + + WE ++II MLPNLE LK+   +  G +W T +GGF +L+FL  S   L+ W   +D
Sbjct  887   SHVNWEEMSIIGMLPNLEVLKVKDNFFNGPKWETCEGGFRRLRFLKFSHMDLQEWIATAD  946

Query  2503  HFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQL  2682
              FP LE+L L+ C  L +IP  F D  TLQ+IE+     ++ +SA  IQE Q ++GND+ 
Sbjct  947   DFPSLEKLVLNGCLALTEIPSAFGDSCTLQVIEVYRSSDTVADSACQIQESQRNWGNDEF  1006

Query  2683  VVRDY  2697
              V  Y
Sbjct  1007  KVFIY  1011



>gb|AEW48204.1| disease resistance protein RGH1 [Solanum fernandezianum]
Length=897

 Score =   369 bits (946),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 307/957 (32%), Positives = 462/957 (48%), Gaps = 162/957 (17%)
 Frame = +1

Query  79    MAYVGLTSLIRTV----ELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVS  246
             MAY  +TSL+RT+    EL   + +P     + ++++ LR  L   +           ++
Sbjct  1     MAYAAVTSLMRTIHQSMELTGCDSQP-----FYEKLESLRAIL---EKSFNIKGDHEGLT  52

Query  247   QAEKDVIARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIE  408
               E ++I    ++++  ED ++SE   +       ER      +  +L++  E I   ++
Sbjct  53    ILEVEII----EVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIGSTVK  108

Query  409   Q-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ  573
             Q   T+  +    P  S+     EH         Q + IMVGH  E E   + L++   +
Sbjct  109   QWMATSDSMKDLKPQTSSLVSLPEHAFE------QPENIMVGHENEFEMMLDQLVR-GGR  161

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
             E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +  
Sbjct  162   ELEVVSIVGMGGIGKTTLAAKLYSDPCIMSRFDIRAKATVSQEYYVRNVLLALLSSTSDE  221

Query  754   TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTT  933
              D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLTT
Sbjct  222   PDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTT  272

Query  934   RLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCR  1101
             R  E+A Y+  SGK   ++  +N  ESW L  +K+    GS +  PE E IGK+I  KC 
Sbjct  273   RNVELAEYAS-SGKPPHHMRLMNIIESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCG  329

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK C
Sbjct  330   GLPLAITVIAGLLSKMGQRLDKWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPC  389

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYF IF +  R I  K L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I    
Sbjct  390   FLYFAIFAEDER-IYVKKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHSWR  448

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             F    + C +HD+  +LCLRE +   FV+    +S+        +  F+  +R   ++  
Sbjct  449   FDVETQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIYKEE  508

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF-  1818
              +   +      H    L  F  V+            +SFK++RVLDL        PTF 
Sbjct  509   EL--AWCRNSEAHSIIMLRIFKCVT----------LELSFKLVRVLDL---GLTRRPTFP  553

Query  1819  -DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSKWL  1983
               +  LI LRYL   ++ +   LK +      + + I+  P S                +
Sbjct  554   SGVLSLIHLRYL---SLCFYPCLKQYRGSKEAVPSSIIDIPLS----------------I  594

Query  1984  QGLWKSQSLR-FIKYP--YPF--PIDTDEIP----------------------VQDTLHT  2082
               L   Q+ + ++ +P  YPF  P +   +P                      V  +L  
Sbjct  595   SSLCYLQTFKLYLPFPNYYPFILPSEILTMPQLRKLCMGWNYLQSHEPTENRLVLKSLQC  654

Query  2083  LYWVPYLRCTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIE  2253
             L  +    CT  +    PN+K   V G+       F+         YL +LEKL      
Sbjct  655   LNQLNPRYCTGSYFRLFPNLKKLKVFGVP----EDFRNHKDMSGFRYLYQLEKLTFGTYY  710

Query  2254  SE-------------------QFE----------------LQSINSFPQSLKELKIVGTE  2328
             S                    +F+                L   ++FPQ+LK     G  
Sbjct  711   SSAACFLKNAAPSGSTPQDPLRFQTHFGATAPPTDVPTLLLPPPDAFPQNLKSSTFSGEF  770

Query  2329  -LGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDH  2505
              L W+ ++I+  LP LE LKL     +GEEW   + GFP LKFL++     + W   SDH
Sbjct  771   FLAWKDLSIVGKLPKLEVLKLSWKAFIGEEWEVVEEGFPHLKFLFLDRLYFRYWRASSDH  830

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             FP LERL L  C+ L+ IP  F ++TTL LI++  C  S+  SAK IQ++ Q +YG+
Sbjct  831   FPYLERLFLKDCYILDSIPRDFANVTTLALIDISHCQQSVGNSAKQIQQDIQDNYGS  887



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score =   365 bits (937),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 277/815 (34%), Positives = 404/815 (50%), Gaps = 89/815 (11%)
 Frame = +1

Query  295   AEDEIESEVMEIISNGA-SHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHI  471
             AED IES V++ I +G+ S   L  + + +    + ++E +    +           +H 
Sbjct  23    AEDVIESHVVDQIHSGSISLLDLQTVFEEIDSIKDKVMEFKEEVGL---------KDDHY  73

Query  472   IAGGASKLQDDAIMVGHAQELERTKEMLL--QCSTQERQVISIVGMGGIGKTTMAKKIYD  645
                  S  + +  MVG  ++L R  + L   +C   +RQVI IVGMGGIGKTT+AK  Y+
Sbjct  74    TQPTCSTPEKNT-MVGFDEQLLRLLDKLTGQRC---DRQVIPIVGMGGIGKTTLAKNAYE  129

Query  646   DPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMR  825
                I  RF +  W T+SQ+Y++R +   L   +    D E NE      L  K+ + L  
Sbjct  130   HSLIVHRFDIRTWVTISQEYNVRELFVQLLSTLISEMDSETNE----QLLGQKLHKILWG  185

Query  826   QRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVY--SGCSGKYVCNLPFL  999
             +RYL+V+DDIW    W+++ R FPD++NGSRI++TTR+  VA+Y  S C       L FL
Sbjct  186   RRYLIVIDDIWSVEAWEEVSRFFPDNNNGSRIVVTTRISNVAIYFDSPC-----FELSFL  240

Query  1000  NSNESWMLFSQKLGSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSI  1179
             + ++              P E+E+IGK IV KC+GLPL+I V  GLL ++ R+ E W+S+
Sbjct  241   DEDKI------------CPLELEDIGKEIVRKCKGLPLSIVVIGGLLGRSNRTREYWESV  288

Query  1180  ASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITE  1359
                +   + S   + C  IL+LSY +LP HLK CFLY GIFP+   EI    L+ LW+ E
Sbjct  289   GKKLISMLNSGKDEDCLNILSLSYTHLPAHLKPCFLYMGIFPE-DHEIRVSRLIKLWVVE  347

Query  1360  GFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEK  1539
             GF+  +  + LEE A  YL DLIDRNLV   KL   G I+ C++HDLL DLCL+  +K+K
Sbjct  348   GFIKLNKFQDLEEVARGYLNDLIDRNLVSEYKLGSNGRIRLCKIHDLLRDLCLKVAQKDK  407

Query  1540  FVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDK--YNFHKSRTLLFFFGV  1713
             F+            + DT P      R + F    ++ ++  +   +   +RTL+     
Sbjct  408   FIRV----------MKDTTPRDIERERRIVFNERIMEEEYHSRSLSSLQSARTLVI---R  454

Query  1714  SGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFD--ISDLILLRYLALGTIKYV----  1875
                  LP + R      ++RVL++ + S  +       I D + LRYL   T   +    
Sbjct  455   KDMGPLPSNNR------LLRVLNVYDNSLSKKIYLSKCIFDQVNLRYLGYNTQLNIYGEL  508

Query  1876  -RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQG-LWKSQSLRFIK-YPYPFPID  2046
                +    N+QTLI++                G+ +    +W+ + LR +  Y    P  
Sbjct  509   PSSISLLWNMQTLIIE----------------GNIFAPSEIWEMRQLRHMDIYRLYLPDP  552

Query  2047  TDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKL  2226
                 P+   L TL  V     ++E   +IPNVK L I    I          NL  L KL
Sbjct  553   PSSGPILRNLQTLKTVMNFTWSEEVCKRIPNVKKLNIMF-HIEGPTIHYCLHNLSLLCKL  611

Query  2227  EKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEM  2406
             E L      S    LQ + +FP S+K+L ++   + WE +T+I  L NLE LKL      
Sbjct  612   ESLTCSYSISNNL-LQKL-TFPSSIKKLSLIFCRVNWEDLTLIGSLQNLEVLKLKYDSVR  669

Query  2407  GEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITT  2586
             G  W   +G F +LKFL I  + L  W   S +FPVLE+L L     LE+IP    +I T
Sbjct  670   GAVWNPIEGEFLRLKFLLIHYSDLVYWNADSSNFPVLEKLVLKGMEKLEEIPLDIGEIPT  729

Query  2587  LQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             L  + +  C  S   SA  I EEQ + GN+ L +R
Sbjct  730   LGFVHVNCCSESAAISALKIVEEQENVGNEGLRIR  764



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score =   369 bits (947),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 297/925 (32%), Positives = 456/925 (49%), Gaps = 107/925 (12%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L S++  ++     PR  +  D K++I+ L +K+  L   +E     + +  A + 
Sbjct  15    AYAALVSVLTIIDQIQNHPRFSISFD-KNQIESLGEKVGFLLDFIETDTHGVIIEHA-RV  72

Query  262   VIARVKDISFRAEDEIESEVMEIISNGASHE--RLHQILQ-----------RLAE-----  387
             +  R+   ++ AED IES V++ I    S E  RL ++++           R+ E     
Sbjct  73    LERRIASAAYAAEDVIESHVVDQIQAAGSVEGHRLRKVVKDIMLSMRLKKARMEENHASS  132

Query  388   ----DIEGLIEQRNTTQM-LSSYNPGQSNQEHIIAGGASKLQ-------DDAIMVGHAQE  531
                 D+E +IE  ++ +  +  +     + EH +   ++          D   MVG  ++
Sbjct  133   ISMLDLEKVIEDMDSIKKKVMEFRDESGSNEHDMQPTSTTSSSTPRITTDKNTMVGFDEQ  192

Query  532   LERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDL  711
             L    + L       RQ+I IVGMGGIGKTT+AK  Y+   I   F +  W T+SQ Y++
Sbjct  193   LISLLDKL-TGQRSNRQIIPIVGMGGIGKTTLAKNAYEHSLIAHHFDIRTWVTISQKYNV  251

Query  712   RRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRC  891
             + +L  L   ++   D E +E      L  K+ + L  +RYL+V+DDIWG   WD++   
Sbjct  252   KELLLQLLSMISSEIDSEHDE----QLLGQKLHKILWGRRYLIVIDDIWGIEAWDNVNLF  307

Query  892   FPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIE  1068
             FP+++NGSRI++TTR+  VA +   S   +  L FL+ N+SW LF +K  G    P E+E
Sbjct  308   FPENNNGSRIVVTTRISNVATHFDSS---LFELSFLDENKSWDLFCKKTFGEAGCPLELE  364

Query  1069  EIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLS  1248
             +IGK IV KC+GLPL+ITV  GLL ++  + + W++IA  +   + S   + CS IL+LS
Sbjct  365   DIGKEIVKKCKGLPLSITVIGGLLGRSHMTQKYWKNIAKDLTSFLNSGEDENCSNILSLS  424

Query  1249  YNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLI  1428
             Y  LP HLK CFLY  IFP+  + + ++ L  LW+ EGF+  +  +S EE A  Y+ DLI
Sbjct  425   YTYLPAHLKPCFLYMAIFPEDHKILVSR-LTKLWVAEGFIKSNESQSSEEIARGYINDLI  483

Query  1429  DRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFH---QRSENVIELGDTEP  1599
             DRNL+L   +   GN+K C +HDL+ DLCL   +KE+F+       + +E    +   + 
Sbjct  484   DRNLILKHTMGSNGNVKNCVIHDLVRDLCLMVAQKEEFICVIEDIPRGTERGRRIVCDKK  543

Query  1600  LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV-----SFK  1764
             + +    +  F T  + P+ S        RT      +  A  L  +W  ++     + +
Sbjct  544   IRQVRYPFSVFHTVRLAPRTSTWVTSRDGRTFRALRPLRLAP-LTRTWVTSIDGRLSNNR  602

Query  1765  MIRVLDLVEISFDEAPTFD----ISDLILLRYLALGTIKYVR--VLKHHHN----LQTLI  1914
             ++RV+     S  EA   D    I D + +RYLA    K     VL    N    LQT+I
Sbjct  603   LLRVMS----SNSEAKKTDLRRHIVDHVNMRYLACTNFKLSSAFVLPSSINIVWSLQTII  658

Query  1915  VKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFI--------KYPYPFPIDTDEIPVQD  2070
             ++       +               +W+ + LR +          P+ +    DE  V  
Sbjct  659   IRGKIEAPSQ---------------IWEMRQLRHVDIYRLCLPNSPWSYGHKQDEC-VLP  702

Query  2071  TLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDN-----LHYLTKLEKL  2235
              L TL  V     +KE   ++ NV+ L I       +  E  W N     LH + +L KL
Sbjct  703   NLQTLKKVVNFTWSKEAYKRVVNVRKLNI------VYDDEWEWSNNNDYCLHNICQLHKL  756

Query  2236  IVEDIESEQF----ELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYE  2403
               E +    +     L+ + +FP SLK+LK+ G  LG+E +T+I  LP LE LKL     
Sbjct  757   --ESLSCLSYCGDERLRKL-TFPSSLKKLKLDGFMLGYEDLTVIGSLPCLEVLKLRNNSI  813

Query  2404  MGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDIT  2583
             +  EW   DG F +LK L I G+ L NW   + +FPVLE+L L +   L+ IP    +I 
Sbjct  814   IAREWNPVDGEFLRLKSLLIYGSGLVNWNADTSNFPVLEKLVLEYMDKLDGIPLDIGEIP  873

Query  2584  TLQLIELKDCFPSLVESAKDIQEEQ  2658
             TL+ IEL  C  S + SA  I EEQ
Sbjct  874   TLRHIELNVCNESAIISAMKIAEEQ  898



>emb|CDP18682.1| unnamed protein product [Coffea canephora]
Length=1077

 Score =   372 bits (954),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 274/854 (32%), Positives = 448/854 (52%), Gaps = 78/854 (9%)
 Frame = +1

Query  163   KDEIQCLRQKLCHlkalleesekklNVSQAEKDVIARVKDISFRAEDEIESEVMEIISNG  342
             KD+I  + + L  L++ L +   + N +   + + +RV ++  RAE  I+S V+     G
Sbjct  264   KDQIHSVLEDLVFLRSFLVKIADQRNRNGKLQALWSRVMEVGHRAELAIDSIVV-----G  318

Query  343   ASHERLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGH  522
               HE     L+R+A DI+ L      T++L +Y+  + +   ++     +L D+   + H
Sbjct  319   DKHE----YLERVARDIQLL-----RTEVLETYDITRHD---LLNEVLVRLDDEVKTIIH  366

Query  523   AQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQD  702
             +  L R  ++L          +SIVGM G+GKTT+A ++Y+DP I + FH+L   TVSQ 
Sbjct  367   S--LTRGSKLL--------DFVSIVGMAGLGKTTLANRVYNDPLILNHFHILARCTVSQA  416

Query  703   YDLRRIL-QDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDD  879
             Y +  +L Q LC   ++  D+ +   +S  +LA+K+ + L R RYL+ +DD+W  + W+ 
Sbjct  417   YSMHSLLVQLLCSISSRSPDEYLKMDES--DLAHKLYKLLKRNRYLIFLDDVWEIKAWNL  474

Query  880   LQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLP  1056
             ++R  PDD+NGSRIL T+R++            V +L  L   ESW L  +K+ G    P
Sbjct  475   VERSLPDDANGSRILFTSRIQ----LQFKPDSKVHHLRHLTDEESWKLLQKKVFGKEGFP  530

Query  1057  PEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVEN-WQSIASAMNLPMTSDLHDQCST  1233
             P + ++G +I   C GLPL + + AG+L+ T   VE+ W+ +A ++   +  D  D C  
Sbjct  531   PTLGKVGSQIAKLCWGLPLTVVLVAGILANT---VEDCWEEVAKSLTSSIVLDDED-CMK  586

Query  1234  ILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKY  1413
              L LSY++L   LK C LYFG F K    +  + LL LWI+EGFV +  G+SLE+ A  Y
Sbjct  587   TLELSYSHLSDDLKVCLLYFGAF-KEGENVLVRRLLWLWISEGFVRKIEGKSLEDVANNY  645

Query  1414  LQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDT  1593
             L+DL+DR+LV++S+   +G +KTCRLHDL+ + C+++ K+E F+   H R++  +  G +
Sbjct  646   LKDLVDRSLVMVSEQRAMGGVKTCRLHDLVHEFCVKKAKEENFLHVLHSRNDRFVLTGQS  705

Query  1594  EPLFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIR  1773
              P+       + +R+      +     F   R+LL   G +    LP         K++R
Sbjct  706   NPV------RVCYRSARNLRIWELMLEFPIVRSLLLSKGDALGFWLP---------KLLR  750

Query  1774  VLDLVEISFDEAPTFDISDLILLRYLALGT--IKYV-RVLKHHHNLQTLIVKFPNSCRie  1944
             VLDL E+ F      ++  L  LRYLAL +  +K++   + +   LQT +++        
Sbjct  751   VLDLGELEFGAYFPMEVFLLAHLRYLALHSRGVKFIPAAIANLSRLQTFLLR---GYFTH  807

Query  1945  eidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEI-PVQDTLHTLYWV--PYLRCTK  2115
              +        K L+ LW + S       + FP++  E+ P  D L TL     P  +  +
Sbjct  808   LLLPKTIWNIKTLRHLWTTYSYA----GFIFPVENLEVSPSLDHLDTLSLAIDPSSQSLQ  863

Query  2116  EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHY--LTKLEKLIVEDIESEQFELQSINSF  2289
             + + K+PN++ +  K    R   T      L +  L++LE L +       F      +F
Sbjct  864   KILTKLPNIRRVRCKMPASREEPTRIGDGILVFDCLSQLESLTLSSFVGYGF------TF  917

Query  2290  PQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG  2469
             P +LK+L +   +  W  I+ I MLP LE LKLL    +GE+W   +G FP L+ L +  
Sbjct  918   PLNLKKLTLFYNKQPWSEISTIGMLPKLEVLKLLDYSVVGEDWEMKEGEFPSLRVLKLRA  977

Query  2470  AK-LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
              +  ++W   SD+FP LE+L +H+C  LE++P    +  TL++IE+  C  S+  S K I
Sbjct  978   LRDFRSWTASSDNFPRLEKLVVHNCQMLEEVPSCLGECPTLEMIEVTWCRESVASSVKQI  1037

Query  2647  QEEQSSYGNDQLVV  2688
             Q+ Q   GN+ L +
Sbjct  1038  QQAQKDMGNEFLKI  1051



>ref|XP_009626593.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score =   367 bits (942),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 295/915 (32%), Positives = 453/915 (50%), Gaps = 117/915 (13%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+ T++ Q ++   + +  + ++++ LR  L       E+  K     +  K
Sbjct  1     MAYAAVTSLMSTIQ-QSMQLTGLNLQSFYEKLESLRSIL-------EKPLKTKGDLEVLK  52

Query  259   DVIARVKDISFRAEDEIESEVMEI------ISNGASHERLHQILQRLAEDIEGLIEQRNT  420
              + A + +++   ED +ESE  ++      ++       L  +L++    I+ ++ +   
Sbjct  53    SLEAEIIELACNTEDMVESESRKVFLAKDAVTRKIDSWELFSLLKQAVGHIDYVMNKWMA  112

Query  421   TQMLSSYNPGQSNQEHIIAG-GASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIV  597
              Q + + +     Q   +A      L+ +  MVGH  E E  ++ L +  + E +++SIV
Sbjct  113   VQNMYTNSKDLKAQNLSLADVSQPALELENTMVGHETEFEMLQDQLARGGS-ELEIVSIV  171

Query  598   GMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEV  777
             GMGGIGKTT+A KIY  P I S F +   ATVS +Y  R +L  L   ++  T  E    
Sbjct  172   GMGGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKT-YEFYGQ  230

Query  778   KSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVY  957
             +   +LA+++++ L   RYL+V+DDIW +  WDD++ CF D +NGSRILLTTR  +VA Y
Sbjct  231   QDVGQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEY  290

Query  958   SGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCRGLPLAITVAAG  1134
             +  SGK    +  LNSNESW L   K+        E + IGK I  KC GLPLAITV AG
Sbjct  291   AS-SGKPPYQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAG  349

Query  1135  LLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVR  1314
             LLSK  ++++ WQS+A  ++  +++D+  QC  +L LSY+ LP HLK CFLYF IFP+  
Sbjct  350   LLSKIGKALDEWQSVAENVSSVVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPE-D  408

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
               I    L+ LW  EGF+  +  +S+E+ A KYL+DLIDR+L+ I  LSF G I++C +H
Sbjct  409   ELIFVSKLMELWAAEGFLKVEEMKSIEQVAEKYLKDLIDRSLISIHSLSFDGKIESCGMH  468

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFS----  1662
             D+  +LCLRE +   FV        NVI   D +   E +  + +     I  + +    
Sbjct  469   DVTRELCLREAQNVNFV--------NVIGENDDQNPLEQSMHFSSNSQGRISIQLNQVFH  520

Query  1663  -------DKYNFHKSRTLLFFFGVSGASGLPVSW--RQNVSFKMIRVLDLVEISFDEAPT  1815
                    D Y  ++ R+++ F G         +W  ++++ FK++R+LDL  +  D  P+
Sbjct  521   GIIEKKLDMYPDNEVRSIICFKG---------TWFVQKSLRFKLVRILDLALVRCDTFPS  571

Query  1816  FDISDLILLRYLAL---------------GTIKYVRVLKHHHNLQTLIVKFPNSCRieei  1950
               I DLI LRYLAL                +I     +     LQT I+ FP+  R    
Sbjct  572   -RILDLIHLRYLALTLSPAVEKYIGKEIPSSIDIPPSISSLCYLQTFILNFPHLKR----  626

Query  1951  dsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLK  2130
                           WK +       PYPF + ++ + +Q   H      YLR  +     
Sbjct  627   --------------WKWER------PYPFILPSEILAMQQLRHLCLDWNYLRYHE-----  661

Query  2131  IPNVKVLGIKCSEIRAFQTETWWDNLHYLT--------KLEKLIVEDIESEQFELQSINS  2286
              P  K L +K       Q  + W N  Y T         L+KL +  I  + +  ++I  
Sbjct  662   -PTEKSLVLK-----NLQCLSGW-NPWYCTSSVFRLFPNLKKLQIHGIAEDYYSCRNIYD  714

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAY-----EMGEEWVTGDGGFPKLK  2451
             F + L +L+ +   L +  + +            L+         GE W   D GFP LK
Sbjct  715   F-RYLDQLEELEFHLYYNYLPVRPFFLKSRPSDYLRFTGRKRPHSGEAWEVVDEGFPSLK  773

Query  2452  FLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVE  2631
              L +     + W    DHFP LERL L  C  L+ IP+ F DI TL LI+++ C  S+  
Sbjct  774   LLLLEDLDFEYWRASCDHFPCLERLFLERCRFLDSIPQDFADIITLALIDIRRCKESVGN  833

Query  2632  SAKDIQEE-QSSYGN  2673
             SAK IQ++ Q +Y +
Sbjct  834   SAKQIQQDMQDNYAS  848



>gb|EYU24181.1| hypothetical protein MIMGU_mgv1a025424mg, partial [Erythranthe 
guttata]
Length=702

 Score =   362 bits (929),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 241/699 (34%), Positives = 368/699 (53%), Gaps = 67/699 (10%)
 Frame = +1

Query  565   STQE--RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCG  738
             ST E  R++I IVGMGGIGKT +A  ++++P I  +F +  W  VSQ+   + IL  L  
Sbjct  65    STDESGRRIIPIVGMGGIGKTNLATNVFNNPFIIEKFDIRAWFVVSQECTGKEILLGLLH  124

Query  739   CVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSR  918
              +   T++   E+     L  K+ + L  ++Y +V+DD+W    W+ ++R  PD++NGSR
Sbjct  125   QIINPTNRNELEMNDDDVLGEKLHKTLFGRKYFIVMDDMWDITAWEIVKRFLPDNNNGSR  184

Query  919   ILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNK  1095
             IL+TTRL ++AV  G    Y  NL  L+  +SW L  +K+      P E+EEIG+ I  K
Sbjct  185   ILVTTRLLKLAVDLGSCTPYELNL--LDEAQSWDLLREKVFPEGRCPAELEEIGRNIAKK  242

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             CRGLPLA+ V  GLL+K+K   E+W+ +   +   + ++  + C  +++LSYN+LP +LK
Sbjct  243   CRGLPLALVVIGGLLAKSK--TEDWKYVEEDVTSAVNNEDDELCMKVISLSYNHLPIYLK  300

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
              CFLY  +FP+   +I    L+ LW+ EGFV +   +SLEE   +YL+DLIDRNL+L+SK
Sbjct  301   PCFLYLAVFPQ-DFDIKMSRLVRLWVAEGFVRQCGPKSLEEIGEEYLKDLIDRNLILVSK  359

Query  1456  LSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR  1635
                 G +KTC +HDLL DLC RE + +  +S   +R                A +  T  
Sbjct  360   RGISGEVKTCHIHDLLSDLCRREAQHD-LLSDLCRRE---------------AQKDATLT  403

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPT  1815
              +               R+ L FF ++      +S        ++RVLD+V    D  P 
Sbjct  404   ASI--------------RSFLTFFSMN------LSTYSACRSPLLRVLDVV----DRYPK  439

Query  1816  FDISDLILLRYLALGTIKYVRVLKHHHN---LQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
              +I  LI  RY++   +  +           LQTL+V                    W  
Sbjct  440   DEILQLINSRYVSCTGLISMSSSSILSRLWCLQTLVVG----------GELTLPSEIWQM  489

Query  1987  GLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCS  2166
                +    R I  P P P   ++I V + L TL  V   +CTKE   +IPN+K LGI C 
Sbjct  490   PQLRHVQARRISLPDP-PSRGEKITVLENLQTLSIVKDFKCTKEVTKRIPNLKKLGIVCP  548

Query  2167  EIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAI  2346
              I ++       NL +  KLE L +  + +     +    FP SLK+L +   ++ WE +
Sbjct  549   TIGSYSL----SNLGFFHKLESLSLAFVGTRGRGPRGNMVFPSSLKKLVLSECKIPWEDM  604

Query  2347  TIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERL  2526
             +I+  LPNLE LKL     +G++W++ +G F +LK+L I   +L+ WE+ + HFP LE++
Sbjct  605   SIVGSLPNLEVLKLQSNAAVGQKWISNEGEFARLKYLLIHECELEIWESENTHFPCLEQM  664

Query  2527  ALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKD  2643
              L    +L++IP  F +I  LQ+I+L  C  SL+ S K+
Sbjct  665   HLGTV-SLKEIPSDFAEILPLQVIDLYRCKSSLLASVKE  702



>gb|AGX27492.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=700

 Score =   362 bits (928),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 256/717 (36%), Positives = 383/717 (53%), Gaps = 57/717 (8%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +VI IVGMGGIGKTT+A+ +Y D  +   F +  WAT+SQDYD+ +IL  L   V +   
Sbjct  24    EVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLVTRRPT  83

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
              E+ ++    EL  ++ R L  +RYL+++DD+W S  W+D++  FPD+ NGSRI++TTR 
Sbjct  84    YEMLQM-GNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIIITTRN  142

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL---GSINLPPEIEEIGKRIVNKCRGLP  1110
               +A +      +  N+ FL  +ESW L  QK+   G I   PE+E IG++I   CRGLP
Sbjct  143   SSLANFIAFRSPH-HNMQFLKDDESWNLIHQKVFAPGEI-CSPELESIGRKIAYNCRGLP  200

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L I++  GLLS  KR  + W+ +A  ++    +D+ D+ ++I   +   LPY+LK C LY
Sbjct  201   LTISLIGGLLSYAKRRQDFWEQVAEDLS-SNRADV-DEETSIYISALQLLPYYLKPCLLY  258

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G FP+   EI    L+ LW+ EGF+   SG+ LEE A  YL+ LIDRNL+ I + S  G
Sbjct  259   MGAFPE-DSEIDASRLIKLWVAEGFLKPISGKRLEEAAEMYLKALIDRNLIFIRQQSPQG  317

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             N+K+C +HDLL DLC+++  +E F+S   +       LGD       ++R        I 
Sbjct  318   NVKSCGIHDLLRDLCVKKAYEENFLSIKRRHI-----LGDL-----CSHRVCVHSIRDID  367

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISD  1830
                 D+    +S     F  +  AS   +S   + +F+++RVLD++ I  D+ P  +I  
Sbjct  368   RPL-DQMQLTRS-----FLSIGDASQEILSPLIS-TFRLLRVLDILGIKLDQFPG-EILQ  419

Query  1831  LILLRYLALGTIKYVRVLKHHHNLQTLIV---KFPNSCRieeidsdeeiGSKWLQGLWKS  2001
             L+ LRYLAL T +    +    NLQ LIV   +F ++  +   +            +   
Sbjct  420   LVNLRYLALSTSELPSSISRLWNLQILIVQAIRFSSNPHVVTPE------------ILDM  467

Query  2002  QSLRFIKYPYPFPIDTDE----IPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSE  2169
               LR IK+   +    D+      VQD L +L  +         +  IPN+  LGI C E
Sbjct  468   PQLRHIKFKGIYVWYDDKYREHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDE  527

Query  2170  IRAFQTETWWDNLHYLTKLEKLIVEDIESEQF---ELQSINSFPQSLKELKIVGTELGWE  2340
                       D++  L++L  L   +  S ++    L S  +FP SLK+L +    + + 
Sbjct  528   K--------LDHVIDLSRLHNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYR  579

Query  2341  AITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLE  2520
              ++II  LPNL+ LKL        EW   +G F +LK L +    L  W      FP LE
Sbjct  580   DMSIIGSLPNLQILKLRGCEFENREWEPIEGDFCELKRLIMEKLNLVFWTADDICFPRLE  639

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
              L + HC +L +IP G  DI TLQ+IE+ +C  S+++SA+ IQEEQ S+GN+ L VR
Sbjct  640   HLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  696



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score =   365 bits (936),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 289/888 (33%), Positives = 437/888 (49%), Gaps = 97/888 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L SL   +E     P P + + ++++++ L   L  L+  LE+    + +S+   D
Sbjct  3     AYAALLSLRHIIEQLQHHPSPPIFI-HQNQVESLTDNLNFLQEFLEQGYPCVGISKGAID  61

Query  262   VI-ARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAED--IEGLIEQRNTT---  423
             V  +R+ D +  AED IE+ V++ I   ++ +    I +    D  + G  + +NT    
Sbjct  62    VFESRIADAAHAAEDIIETRVVDQILTESTAQASKDINETWVGDQILGGSRKTKNTRMQD  121

Query  424   ---QMLSSY-----NPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQER  579
                ++LS++     +   S +++++AG    L     MVG  + L    + L+       
Sbjct  122   RLRRILSTFCGAGSSRSPSTRQNVVAG--LDLDKHETMVGFDELLIEVMDKLIG-QHSNL  178

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
              +I IVGMGGIGKTT+A+  Y        F +  W TVSQ+Y++R IL ++  C+ +   
Sbjct  179   CIIPIVGMGGIGKTTLARNAY--VKFIKHFDIRAWVTVSQNYNVREILIEILLCINKAEK  236

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDD-SNGSRILLTTR  936
             +E    K+  EL  KV + L  +RYL+V+DDIW    WD +   FPD+    SRI++TTR
Sbjct  237   RETLSAKNEGELGVKVHQSLWGRRYLIVMDDIWSVEVWDKMNLFFPDNVGQRSRIMITTR  296

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLP  1110
             L +VA      G +   + FLN ++SW L  + +     + PPE+EEIGK+I   C+GLP
Sbjct  297   LSDVASI----GSHGVVMDFLNEDKSWDLLCKSILEKEEDCPPELEEIGKKIAKNCKGLP  352

Query  1111  LAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLY  1290
             L+I V  G L+K+KR+ E+W+ I+  +   + S+   +C  +L LSYN+LP HLK CFLY
Sbjct  353   LSIVVIGGHLAKSKRTREHWEYISENIKKIVNSEDDGRCLKVLQLSYNHLPVHLKPCFLY  412

Query  1291  FGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIG  1470
              G+F +    I    L+ LW++EGFV    G+SLE  + +YLQ+L DRNL+L+ K    G
Sbjct  413   MGVFVE-DNMIRVSCLVKLWVSEGFVKPIKGKSLEVVSREYLQELCDRNLILVHKRGSYG  471

Query  1471  NIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQ  1650
             NIK C +HDLL +LCLRE    +     HQ       L D   L             Y+ 
Sbjct  472   NIKFCSIHDLLRELCLREGINTQRRIGIHQSMSEKDYLRDLHKL------------QYVP  519

Query  1651  PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVL--DLVEISFDEAPTFDI  1824
                S   NF +   LL                    F+++RVL  D  E+  D    ++ 
Sbjct  520   LVRSLICNFEERLPLL-------------------DFRLLRVLKADDKELYNDNNRQYEY  560

Query  1825  SDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQ  2004
             S  ++ R +               NL+ ++  F                  W     K  
Sbjct  561   SVEVVFRLV---------------NLRGVVAPF----------------EIWNMTQLKHV  589

Query  2005  SLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQ  2184
                 ++ P P     D+  V   L TL  +   +C +E V +IPN+  L I   E     
Sbjct  590   HFNVLQLPDPPIGGKDDEFVFGNLQTLTNIRKFKCGEEVVKRIPNINKLQISYFEEPQGF  649

Query  2185  TETWWDNLHYLTKLEKL---IVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAI-TI  2352
                  DNL  L KLE L   +    +  + ++      P SLK+L ++GT+L WE + T 
Sbjct  650   LSYCLDNLGQLHKLESLRFSLYPGNKRSRNDMVQNFILPNSLKKLTLMGTKLKWEDMKTK  709

Query  2353  ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK-LKNWETMSDHFPVLERLA  2529
             I +LPNL+ LKLL+   +G EW T +G F  L++L I   + L+ W T S+HFP LE L 
Sbjct  710   ICLLPNLQVLKLLKYSFVGTEWETVEGQFCNLRYLLIRSCRDLEWWTTDSNHFPRLEHLH  769

Query  2530  LHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGN  2673
             L     L++IP    +I+TLQ I+L  C  S V SAK I +EQ  +GN
Sbjct  770   LEDLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKILKEQEDFGN  817



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score =   366 bits (939),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 289/874 (33%), Positives = 430/874 (49%), Gaps = 125/874 (14%)
 Frame = +1

Query  274   VKDISFRAEDEIESEVMEIIS------NGASHERLHQILQRLAED------------IEG  399
             ++D+S +AED +E  + E  S      N      +H+++ R  ++            I+G
Sbjct  77    IRDVSCKAEDIVEEIMFEYSSSSCLKKNATKFVGVHRLVFRKIDESAITSVYNDMCCIKG  136

Query  400   LI---EQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
                    R+ TQ LSS       ++H++ G    L DD + +  A +L    + L     
Sbjct  137   RSTPSSSRDVTQSLSS------QKDHVVVG----LYDDFLRI--ADKLTGYPDKL-----  179

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGC---  741
                 V+ I GMGGIGKTT+AK+IY D  I   F++  W TVS+ Y +R +L DL  C   
Sbjct  180   ---DVVVIFGMGGIGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSK  236

Query  742   VAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRI  921
             VA + D+  NE     EL  ++ + L  QRYL+V+DD+W +  WDD++R FP+D+NGSR+
Sbjct  237   VAFIMDEMENE-----ELGERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRV  291

Query  922   LLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPP------EIEEIGKR  1083
             ++T+R+ +VA Y          + FL   ESW L  +K+  ++ P       E+E IG  
Sbjct  292   MVTSRIMKVARYINPLNP-PHQMRFLTVEESWKLLQKKIFGLDDPSCCCCDDEMERIGME  350

Query  1084  IVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLP  1263
             I  KC+GLPLAI + AG+LSK   +   W  IA  ++    ++       IL LSYN+L 
Sbjct  351   ISKKCKGLPLAIVMVAGILSKESATASKWSDIAENIHSSFVTEESRPFLDILALSYNHLS  410

Query  1264  YHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLV  1443
              HLKACFLY G FP+   E+P   L+ LWI EGF+  +S ++LE    +YLQ+LIDR+L+
Sbjct  411   RHLKACFLYMGAFPE-DVEVPVWRLIRLWIAEGFIKLESPKTLEFVGQEYLQELIDRSLI  469

Query  1444  LISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLF-EYANR  1620
             ++SK S+   +KTC +HD+L + C  E K+EK +    +           EP F +  +R
Sbjct  470   IVSKRSYDNRVKTCSIHDILRNFCQEEAKQEKLLHVVRR----------LEPHFPQGVHR  519

Query  1621  WLTFRT---TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVE  1791
              L F +    Y    +S+ Y       +  F      S L  S+   + FK++RVLD+V 
Sbjct  520   RLHFHSDIFAYSSYTYSNPY-------VRSFLSSKACSVLEDSYFGCIGFKLLRVLDVVN  572

Query  1792  ISFDEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeei  1968
              SF   P   I  L+ LRYLAL    +  R +    +LQTLI+ +               
Sbjct  573   YSFYGFPIHVIK-LVHLRYLALSINSELPRSISKLKSLQTLIIYW---------------  616

Query  1969  GSKWLQ----GLWKSQSLRFIKYP-----YPFPIDTDE----IPVQDTLHTL--YWVPYL  2103
             G+K ++     LWK   LR I        +  PID         V + L TL    +  +
Sbjct  617   GTKEMRILPLELWKMPILRHIHVKGDVLLFGSPIDDHHSKRNFRVLENLQTLCTITISTI  676

Query  2104  RCTKEFVLKIPNVKVLGIKCSEIRAFQTETWW-----DNLHYLTKLE--KLIVEDIESEQ  2262
               +   +  +PN+K L    + +     +  W     +NLH +  LE  KL+        
Sbjct  677   NFSHRLIATLPNLKTLA--SNLVTGGNHDVDWLGSCLNNLHQMYSLETLKLLFNLPMKNP  734

Query  2263  FELQSI---NSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDG  2433
                 SI   N+FP +LK L +  + L W+   ++  LPNLE LKL      G EW T + 
Sbjct  735   LPRNSIQRWNAFPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEE  794

Query  2434  GFPKLKFLYISGAKLKNWE---TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
             GF +LK+L +    L  W+   T S  FP L+ L    C+ L++IP    DI +LQ+IEL
Sbjct  795   GFHRLKYLLVESRDLVVWKQASTDSYPFPALQHLVFRFCNKLKEIPYEIGDIPSLQVIEL  854

Query  2605  KDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
               C P     A+ IQ++Q   GN  L V  +  R
Sbjct  855   YSCSPYATRLARMIQQDQIDSGNSCLEVFIHPAR  888



>gb|EYU21836.1| hypothetical protein MIMGU_mgv1a023326mg [Erythranthe guttata]
Length=923

 Score =   366 bits (940),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 254/729 (35%), Positives = 390/729 (53%), Gaps = 64/729 (9%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             ++I IVGMGGIGKTT+AK  Y        F +  W TVSQ+Y++R IL ++  C+ +   
Sbjct  226   RIIPIVGMGGIGKTTLAKNAY--LKFMKHFDIRAWVTVSQNYNVREILIEILLCINKAES  283

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             +E    KS  EL  +V + L  +RYL+V+DDIW    WD +Q  FPD+  GSR+++TTRL
Sbjct  284   RETLSAKSEGELGVRVHQSLWGRRYLIVMDDIWSVEVWDKVQIFFPDNGQGSRVMITTRL  343

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPL  1113
               VA      G +   + FLN ++SW L  + +     +  PE+EEIGK+I   C GLPL
Sbjct  344   SNVASI----GSHGVVMGFLNEDKSWDLLCRSVFKEEKDCSPELEEIGKKIAKNCEGLPL  399

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             +I V  G L+K+KR+ E+W+ I+  +   + S+  ++C  +L LSYN+LP HLK CFLY 
Sbjct  400   SIVVIGGHLAKSKRTREHWEYISENIKKIVNSEDDERCLKVLQLSYNHLPVHLKPCFLYM  459

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FP+  ++I    L+ LW++EGFV   +G+SL+  + +YLQ+L DRN++L+ +    GN
Sbjct  460   GVFPE-DKKIRVSWLVKLWVSEGFVKPINGKSLDVVSREYLQELCDRNMILVHERGSYGN  518

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQP  1653
             IK C++HDLL +LCLRE ++E+F+         + +  +T+            R   I  
Sbjct  519   IKFCKIHDLLRELCLREAEREEFLYVKRPHELTIPQGINTQ------------RRIGIHQ  566

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQN---VSFKMIRVLDLVE-ISFDEAPTFD  1821
             + S+K ++H    L     V     L  ++ +    + F+++RVL + + +  D    ++
Sbjct  567   RMSEK-DYHPYPVLRTLQDVPLVRSLICNFEERLPLLDFRLLRVLKVDDNLLIDNIIQYE  625

Query  1822  -----ISDLILLRYLALGT-IKYVRVLKHHH---NLQTLIVK----FPNSCRieeidsde  1962
                  +  L+ LR++A+ + +    V    +   NLQTL+V         C I       
Sbjct  626   YFVEVVFRLVNLRFIAIRSDVPISSVFPSFNLLWNLQTLVVNGGWDVVAPCEI-------  678

Query  1963  eiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNV  2142
                  W     K      ++ P P     D+  +   L TL  +   +C +E V +IPN+
Sbjct  679   -----WNMTQLKHVHFDVLELPDPPIGGKDDEFILGNLQTLTDIRNFKCEEEVVKRIPNI  733

Query  2143  KVLGIK-CSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS------FPQSL  2301
               L I    E + F +    DNL +L KLE L          +++S+N        P SL
Sbjct  734   NKLQISYFVEPQGFLSYR-VDNLGHLHKLESL---RFYIYSLKMRSVNDMVQNFILPNSL  789

Query  2302  KELKIVGTELGWEAITI-ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK-  2475
             K+L ++GT L WE + + I +LPNL+ LKL +   +G +W T +G F  LK L IS  + 
Sbjct  790   KKLTLMGTCLKWEDMKLKIGLLPNLQVLKLEKESFVGHKWETIEGQFCNLKVLLISLCRD  849

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L+ W T ++HFP LE L L   H L++IP    +I+TLQ I+L  C    V SAK I +E
Sbjct  850   LQWWTTDNNHFPRLEHLHLQGLHKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKQILKE  909

Query  2656  QSSYGNDQL  2682
             Q  +GN  L
Sbjct  910   QEDFGNVDL  918



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   372 bits (955),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 257/845 (30%), Positives = 426/845 (50%), Gaps = 104/845 (12%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVM-------------EIISNGASHERLHQILQRLAEDIEGLIE  408
             +RV +I+++AE  I+S ++             +I       + ++  +  + E  +G+  
Sbjct  469   SRVMEIAYKAEFVIDSTLVGDRREYCLDDVARDINVLKIEAQEIYDSISYVGETTKGV--  526

Query  409   QRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
              +  T+M S +     N+E +      K   D++  G +++L+               V+
Sbjct  527   TKTFTRMPSQFTVAAYNEELVPLDDEVKTITDSLTRGGSRQLD---------------VV  571

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
              IVGM G+GKTT+A ++Y+ PS+   FH   W TVSQ Y +  +L  +   +     ++ 
Sbjct  572   CIVGMPGLGKTTLANRVYNSPSVMLHFHKCAWCTVSQAYSMHNMLVQILDSIDSGKLEQC  631

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
              ++    +LA K+++ L+R +YLLV+DD+W ++ W+ L+R  PDD+NGSRIL+T+RL+ +
Sbjct  632   RKMDE-HDLAEKLKQVLLRNKYLLVLDDLWDAKVWNLLERSLPDDANGSRILITSRLQNL  690

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITV  1125
             ++      K V +L  L   ESW L  +KL      PP +  +  RI   CRGLPL + +
Sbjct  691   SLQFKPHSK-VHHLRCLTDEESWNLLQKKLFCKAGCPPRLSGVASRIAKSCRGLPLMVVL  749

Query  1126  AAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFP  1305
              AG+L+ T      W+ +  ++   +  D  + C   L LSY +LP  LK C LYFG F 
Sbjct  750   VAGILANTAEDC--WEEVTKSLTSSIVLD-DEYCMKTLELSYGHLPDDLKPCLLYFGAFQ  806

Query  1306  KVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTC  1485
             +  + +P + LL LWI+EGFV    G+SLE+ A  YL+DL+DR+LV++SK   +G  K C
Sbjct  807   E-DKNVPVRRLLWLWISEGFVQRTEGKSLEDVADDYLKDLVDRSLVMVSKQRTVGGAKAC  865

Query  1486  RLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWL-TFRTTYIQPKFS  1662
             R+HDL+ + C+++ K+E F+  FH  +++    G + PL    NR +   R   +  KF 
Sbjct  866   RVHDLVHEFCVKKAKEENFLHVFHSWNDHT---GPSNPL-RVCNRSVGNLRIWELVLKFP  921

Query  1663  DKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILL  1842
             +       R+LL F       GLP         +++RVLDL E+ F      ++  L+ L
Sbjct  922   N------VRSLLLFKKDDLGFGLP---------ELLRVLDLGELEFVAYFPMEVFLLVHL  966

Query  1843  RYLALGT--IKYV-RVLKHHHNLQTLIVK-------FPNSCRieeidsdeeiGSKWLQGL  1992
             RYLAL T  +K++   + +   LQT +++        PN+                   +
Sbjct  967   RYLALRTRGVKFIPAAIANLSRLQTFLLRGNDIDCLLPNT-------------------I  1007

Query  1993  WKSQSLRFIKYP-------YPFPIDTDEI-PVQDTLHTLYWV----PYLRCTKEFVLKIP  2136
             W  ++LR +  P       + FP++  E+ P    L TL          +  ++ + K+P
Sbjct  1008  WSIKTLRHLLTPNFGFISGFIFPVENLEVSPGLFHLDTLSLAIDPSSPSQSLQKILTKLP  1067

Query  2137  NVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKI  2316
             +++ L  + +  R   T         L++LE L +       F+      FP +LK+L +
Sbjct  1068  SIRRLRCRVTASREKCTGNGILGFDCLSRLESLALRSFVGYGFK------FPLNLKKLSL  1121

Query  2317  VGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETM  2496
                +  W  I+ I  LP LE LKLL    +G+EW   +G FP L+ L +     + W   
Sbjct  1122  SCNKQPWVEISTIGKLPKLEVLKLLTDSVVGKEWEMTEGEFPTLRILKLRDLDFRRWTAS  1181

Query  2497  SDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGND  2676
             SD+FP LE+L +H C  LE++P    +   L++IE++ C  S+  S K IQ+EQ   GN+
Sbjct  1182  SDNFPRLEKLVVHWCRELEEVPFCLGECQALEMIEVRGCRESVANSVKQIQQEQRDMGNE  1241

Query  2677  QLVVR  2691
              L++R
Sbjct  1242  ALILR  1246



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score =   370 bits (951),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 277/850 (33%), Positives = 441/850 (52%), Gaps = 89/850 (10%)
 Frame = +1

Query  238   NVSQAEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGL-IEQR  414
             N +QA +   + V +++++AE  I+S ++     G  HE     L  +A DI  L +E +
Sbjct  361   NQNQAIQTFWSHVVEVAYKAEVIIDSALV-----GDKHE---SCLDAIARDISILKVEAK  412

Query  415   NTTQMLSSYNPGQSNQE-----HIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQER  579
                   ++ N G++ +      H+ +   ++   +  +VG   E++     L + S Q  
Sbjct  413   EIND--NNRNDGKALRATKTFIHMPSQVTAQPSHED-LVGRDDEVKIIINRLKRGSMQ-L  468

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL-QDLCGCVAQMT  756
              +I I GM G+GKTT+A K+Y DPSI   F++  W  VSQ Y +R +L Q L G   + +
Sbjct  469   DIIPIWGMPGLGKTTLANKVYCDPSIEFHFYIRAWCCVSQVYSMRSLLLQILHGTGFKSS  528

Query  757   DKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTR  936
             ++ +    S  +L  K+R+ L R +YL+V+DD+W    W+ L+R  PDD+NGSRIL T+R
Sbjct  529   NQSLE--MSDDDLEEKLRKVLRRNKYLIVLDDLWDIEAWNLLKRSLPDDANGSRILFTSR  586

Query  937   LKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPL  1113
              +  +       K   +L  L   ESW L   KL G    PP + ++G RI N CRGLPL
Sbjct  587   FENFSSQIKQDSK-PHHLRLLTDEESWQLLQNKLFGKGVCPPTLSKVGLRIANNCRGLPL  645

Query  1114  AITVAAGLLSKTKRSVENWQSIASAM---NLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
              I +  G+L+ T+R    W+ +A ++   N+P T    ++    L LSY++LP +LK C 
Sbjct  646   TIILIGGILATTERDCAIWEEVAKSLSSGNVPDT----ERWMKTLELSYSHLPDYLKPCL  701

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF  F +  R+I  + LL LWI+EGFV +  G+S ++ A +YL DL  R+LV+++K   
Sbjct  702   LYFSAFQE-DRDISVQRLLWLWISEGFVQKSEGKSFKDVADEYLMDLTARSLVMVTKERT  760

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEP--LFEYANRWLTFRT  1638
             +G  K CRLHDL+ + C+ + K+E F+  FH   + V   G + P  LF Y+ +  T   
Sbjct  761   MGGAKACRLHDLVHEFCVVKAKEESFLQIFHG-DDVVTYTGLSNPYRLFIYSMKSSTLEE  819

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGAS-GLPVSWRQNVSFKMIRVLDLVEISFDEAPT  1815
                      K      R+LLFF    G    L +S    +  +++RVLDL ++   E   
Sbjct  820   L--------KLFLPNLRSLLFFVDYDGIHHKLDLSPHGFLLPRLLRVLDLRKLFLGEDFP  871

Query  1816  FDISDLILLRYLAL-GTIKYV-RVLKHHHNLQTLIVK-------FPNSCRieeidsdeei  1968
              ++  L+ LRYLA+ G I+Y+   + +   L++ ++K        PN+            
Sbjct  872   MELVSLVHLRYLAIRGHIEYIPSAIANLSKLESFLLKGSGANVVLPNT------------  919

Query  1969  GSKWLQGLWKSQSLRFIK----YPYPFPIDTDEI-PVQDTLHTLYWV--PYLRCTKEFVL  2127
                    +W  ++L+ ++    Y + FP D  E+ P  + L TL     P+ +  ++ + 
Sbjct  920   -------IWNIKTLQHLRTSSFYGFIFPFDNLEVCPDLNNLDTLSLAVDPHSQSLQKILK  972

Query  2128  KIPNV---KVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQS  2298
             K+P++   K +G K  E  A   +     L YL++LE L ++     +FE      FP S
Sbjct  973   KLPSIRRLKCVGDKSGESTANCNKIL--TLSYLSRLESLNLDAFVGYEFE------FPSS  1024

Query  2299  LKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKL  2478
             LK+L +      W +I+ I  LPNLE LKL     +GE+W   +G FP L+FL +S   +
Sbjct  1025  LKKLTLWSNHQPWSSISRIGKLPNLEVLKLRYQAFVGEKWEVEEGEFPNLRFLKLSSLDI  1084

Query  2479  KNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQ  2658
               W   SD+F +LE+L LH C  LE++P    +  TL++IE+  C  S V + K IQ+EQ
Sbjct  1085  HRWTASSDNFSLLEKLVLHDCVKLEEVPSCLGESPTLEMIEVSSCGKSTVNAIKQIQQEQ  1144

Query  2659  SSYGNDQLVV  2688
                GN+ L +
Sbjct  1145  MDMGNEALKI  1154



>gb|EYU29922.1| hypothetical protein MIMGU_mgv1a0259201mg, partial [Erythranthe 
guttata]
Length=778

 Score =   362 bits (928),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 269/780 (34%), Positives = 401/780 (51%), Gaps = 112/780 (14%)
 Frame = +1

Query  511   MVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWAT  690
             MVG  +EL +  ++L        Q+I IVGMGGIGKTT+A+  Y+   I + F +  WAT
Sbjct  48    MVGFEEELIQLLDVL-TARQSSLQIIPIVGMGGIGKTTLARNAYEHRLIVNHFDIRAWAT  106

Query  691   VSQDYDLRRILQDLCGCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRG  870
             +SQ+Y L  I   L     Q++ +  +E     +LA ++ + L+ +RYL+++DDIW    
Sbjct  107   ISQEYSLTEIFSTLFS--PQISSQSTDE----QQLAQQLYQSLIDRRYLIILDDIWSINA  160

Query  871   WDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN  1050
             W+ +   FPD++NGSRI+LTTRL  VAV+ G +        FL+ ++SW LF +K     
Sbjct  161   WEKMMFFFPDNNNGSRIILTTRLSNVAVHFGST---FLTKKFLDKDKSWKLFCEKAFPHE  217

Query  1051  --LPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQ  1224
                P E+E+IGK+I  KC+GLPL I V  G L K+ R+ E W+ I++ ++L       +Q
Sbjct  218   GCCPLELEKIGKKIATKCKGLPLLIVVIGGFLRKSSRTQELWEDISNDISLIPNIREEEQ  277

Query  1225  CSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGA  1404
                IL+LSY +LP HLK CFLY GIFP+  REI    L+ LWI +GF+  +  +SLEE A
Sbjct  278   NLDILSLSYKHLPVHLKPCFLYMGIFPE-GREINVSKLIKLWIADGFIKPNKTQSLEEVA  336

Query  1405  MKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIEL  1584
               YL+DL+DRNL+L+ +L + G IKTC +HDLL DLC++  +KEKF+  +  RS +    
Sbjct  337   ECYLKDLVDRNLLLVGRLGWNGKIKTCTIHDLLRDLCIKASQKEKFL--YLIRSYD----  390

Query  1585  GDTEPLFEYANRWLTFRTTYIQPKFSDKYN-----FH--KSRTLLFFFGVSGASGLPVSW  1743
                 PL     R + F      PK     N     FH  +S  LL    +     LP   
Sbjct  391   ---SPLRIIKERRILF------PKQITAVNCEHPLFHILESAPLLTRTLLGNGGRLP---  438

Query  1744  RQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYVRVLKHHH---------  1896
                 +F+++RVL+ V+++F  +PT DI   + LRY            KH H         
Sbjct  439   ---FNFRLLRVLNAVDMTF--SPT-DILKHVNLRYFP----------KHFHISRELSWSI  482

Query  1897  -----NLQTLIVKFPNSCRieeidsdeeiGSKWLQG--LWKSQSLRFIKYPY----PFPI  2043
                  N+QTL +                 G +++    +W    LR ++  +    P P 
Sbjct  483   MSLLWNVQTLKID---------------GGPRFVAPIEIWSMPQLRHLESTHGMYLPDPP  527

Query  2044  ----DTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLH  2211
                 + D++ V   LHT      L+ ++E   +IPN+K L +   ++          N+ 
Sbjct  528   LRSQEIDDVIVLKNLHTFKGAVNLKLSEEVCKRIPNIKKLKLLYPDLAKRLCYNHLYNIV  587

Query  2212  YLTKLEKL-----IVEDIESEQFELQSIN-------------SFPQSLKELKIVGTELGW  2337
              L KLE L     I       QF +Q +               +P SL+ L +  ++L W
Sbjct  588   MLHKLEYLDCQFGISSKFSVLQFSMQMLKYIACSTPRSLGNLKYPTSLQRLILWHSDLEW  647

Query  2338  EAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVL  2517
             + +T I  LP+LE L+L      G +W   +GGF +LK+L I   +LK W +   HFP+L
Sbjct  648   KDMTAIGSLPDLEVLELGYDSVRGSKWNPVEGGFIRLKYLSIRYLELKYWNSERVHFPIL  707

Query  2518  ERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESA-KDIQEEQSSYGNDQLVVRD  2694
             E L L+  H LE+IP G  +ITTL LI++ +C  S   SA ++   E  + G + + VRD
Sbjct  708   ENLILYQLHELEEIPLGIGEITTLGLIDVDNCNESTAVSALEEDYTEAINIGLENVSVRD  767



>ref|XP_006365682.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=835

 Score =   362 bits (930),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 302/902 (33%), Positives = 451/902 (50%), Gaps = 104/902 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQK----LCHlkalleesekklNVS  246
             MAY  L+SLI T+  Q L+P   LV       +C  Q+    LC   + L++        
Sbjct  1     MAYAALSSLIYTLN-QLLKPNQSLVC------RCCTQEHLESLCQNLSALQDFLDNTTTK  53

Query  247   Q--AEKDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQR--  414
                  K +  R++++ ++AED ++S +  II   A HE   Q   R   +    +EQ+  
Sbjct  54    DIGTLKVIEKRIRNVVYKAEDRVDSSLRSIIL--ADHEDKRQKACRSFYEELLKVEQQVY  111

Query  415   --NTTQMLSSYNP-GQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQ---CSTQE  576
               N   ML  +N  G  + E   A   S L+   I       +E    ++L      T E
Sbjct  112   FLNKEVMLVKFNKHGIKSAES--ATNPSSLEKSKIEENTIVGMEDDFNIILDRVTSQTDE  169

Query  577   RQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRIL----QDLCGCV  744
               VI I GMGGIGKTT+A+K++ D  IRSRF    W T+S++Y+ R++L      + G  
Sbjct  170   LTVIPIFGMGGIGKTTLARKVFGDSYIRSRFDKHAWVTISEEYNERQMLLEVVSSITGSK  229

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
              + +D ++ E+         V + L  +R+L+V+DDIW ++ WD +QR FP+D N SRIL
Sbjct  230   QETSDDQLMEI---------VYKGLKGRRFLIVIDDIWSTKAWDQMQRIFPNDDNKSRIL  280

Query  925   LTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSIN-LPPEIEEIGKRIVNKCR  1101
             LTTRLK VA Y  C      +  FL+ ++SW LF++K+   +  P  + +IGK IV +C+
Sbjct  281   LTTRLKYVADYVSCPDFPPHSKSFLSLDDSWNLFTEKIFKKDPCPSLLVKIGKHIVQQCQ  340

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL++ V AGLL K   +  NW+ +   +N      + ++C +IL+LSYN LP +L+ C
Sbjct  341   GLPLSVIVVAGLLGKIDPTHNNWKIVEKNLN-SFFGTVSERCQSILSLSYNYLPQYLRTC  399

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLY G F +   EI    L+ LWI E FV   + + LE  A +YLQ+LIDR+L+L+ K  
Sbjct  400   FLYVGGFSE-DMEIDVSKLIRLWIAEQFVKVRNNKRLEVVAEEYLQELIDRSLILVGKQR  458

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
                 +KTC++HDLL  LC+RE + E  +        NVI  GD                 
Sbjct  459   ANRRMKTCKIHDLLRQLCIREGQTENGL--------NVIT-GDV----------------  493

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQ-NVSFKMIRVLDLVEISFDEAPTF  1818
                PK       H SR    F  +  + GL    R  ++  ++  +  L  +S +   + 
Sbjct  494   ---PKAIYHSMQHSSRITRTFIPMP-SFGLIFPKRIFSIVLELKLLKVLDVLSIECNFSC  549

Query  1819  DISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWK  1998
              I  LI LRY+A   I+    L    NLQT+I++      +           K    +W 
Sbjct  550   VIPHLIHLRYVA-ARIEKALSLAKLRNLQTIILQSLEETEL-----------KHPVDIWT  597

Query  1999  SQSLRFIKYPYPF----PIDTD-----EIPV-QDTLHTLYWVPYLRCTKEFVLKIPNVKV  2148
                +R +    P     P+D +     E P+  + LHTLY + Y    +E + + PN+K 
Sbjct  598   MSEIRHVDIGLPLYISNPLDAENHSIGEHPLFLNNLHTLY-LHYSPFVEEIITRSPNLKK  656

Query  2149  LGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTE  2328
             L     +I        +D+L  L  LE L +   +   F   S + FP +LK+LK+  T 
Sbjct  657   L-----KISDRSEHPIFDSLSLLHDLETLQIATFDPMIF---SGDIFPPNLKKLKLSYTR  708

Query  2329  LGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLYISGAKLKNWETMSDH  2505
             L WE + +++ LP+LE LK   A++ G  W +  D  F KLK L I    L+ WE  SD+
Sbjct  709   LPWEVVNLLANLPSLEVLKGNDAFK-GTNWRLDEDVVFRKLKHLKIVAGDLQRWEAGSDN  767

Query  2506  FPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLV  2685
             FP+LE+L LH   +LE+IPE   DI TL+ I++  C   +  SA  IQEEQ S  N +L 
Sbjct  768   FPMLEQLILHQLRDLEEIPESIGDIMTLKFIQINCCGSGVDTSATKIQEEQQSLENYELQ  827

Query  2686  VR  2691
             V+
Sbjct  828   VQ  829



>gb|EYU40390.1| hypothetical protein MIMGU_mgv1a018316mg [Erythranthe guttata]
Length=865

 Score =   363 bits (932),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 295/906 (33%), Positives = 457/906 (50%), Gaps = 114/906 (13%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRP---ILVVDYKDEIQCLRQKLCHlkalleesekklNVSQA  252
             AY  L SL  T++ Q L P P    +  D +D+I  LR+K   L     E+         
Sbjct  4     AYAALVSLTHTLD-QILSPPPHHHFINFD-RDQINFLREKADFLIDYFLENHSNTGGDHK  61

Query  253   E-KDVIARVKDISFRAEDEIESEVMEIISNGA--SHERLHQILQRLAEDIEGLIEQRN--  417
             E +D+  R++  +  AE    S    ++S G   + ++ H I + L + I+  ++ +   
Sbjct  62    EIEDLETRIRVAAEGAESVETSTSNNLLSEGVRTAIQQFHSIEEELVK-IKKYVQAKISI  120

Query  418   TTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIV  597
             TT+  SS  P     E+ + G      D  I +  A          L       +VISIV
Sbjct  121   TTEAASSSRPLLPIGENTMVG----FDDHLIQIMGA----------LSTDESNLRVISIV  166

Query  598   GMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEV  777
             GMGGIGKTT+A  +Y+ P I   FH+  W TVSQ+Y  + IL    G + Q+ +   +E 
Sbjct  167   GMGGIGKTTLATHVYNKPFIVQHFHVCVWFTVSQEYTEKEIL---LGLLRQINNTNRDEQ  223

Query  778   KS----------TAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
             K+            +L NK+ + L  ++YL+V+DDIW  + W+ + R  PD++NGSRI++
Sbjct  224   KTGDDDDDYDDDDDQLGNKLHKTLFGRKYLIVMDDIWDIKVWEMINRFLPDNNNGSRIMV  283

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRG  1104
             TTRL  +A+  G    Y  NL  L+  +SW L SQK+      P E+EEIG+ I  KCRG
Sbjct  284   TTRLLRLAMDIGSCSPYQLNL--LDEEQSWDLLSQKIYAEKRCPVELEEIGRSIAKKCRG  341

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPLA+ V AG+L+K+K   ENW+ +   +   + +   D C  IL+LSYN+LP +LK CF
Sbjct  342   LPLALIVIAGVLAKSK--TENWKYVEEDVTSAVRNQGDDFCMKILSLSYNHLPIYLKPCF  399

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
             LYF  FP+   +I    L+ LW+ EGF+ +   +SLEE   +YL++LI+RNL+L+ KL  
Sbjct  400   LYFAAFPE-DFDIQVSRLIRLWVAEGFIRKCEHKSLEEIGEEYLKNLIERNLILVDKLEL  458

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSE-NVIELGDTEP--LFEYANRWLTFR  1635
              G +KTC +HDLL DLC  E +K+ F+      +  + +   +T P  L     +W   +
Sbjct  459   TGEVKTCHIHDLLSDLCRIEAQKDNFILTGKLYNHLDTLPNTETRPTRLSINGGKWKGMK  518

Query  1636  TTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPT  1815
              T  +P          +R+ L F   S       + R+   F ++RVLD+VE    + P 
Sbjct  519   RTPYRP---------PTRSFLSF---SSRDSTDYTARR---FPLLRVLDVVE----KCPK  559

Query  1816  FDISDLILLRYLALGTIKYVRVLKHHH--NLQTLIV-----KFPNSCRieeidsdeeiGS  1974
              +I  L+  RY++      +         +LQTL+V       P+               
Sbjct  560   DEILQLMNSRYVSCTGSISMSSSILSRLWSLQTLVVVDRELVLPSE--------------  605

Query  1975  KWLQGLWKSQSLRFIK------YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIP  2136
                  +W+   LR ++         P P D  +I + + L TL  V   +CT+  + +IP
Sbjct  606   -----IWQMPQLRHVEGDSIILPDPPPPDDVHKIILLENLQTLSTVEDFKCTEAVMKRIP  660

Query  2137  NVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL--IVEDIESEQFELQSINSFPQSLKEL  2310
             N+K L I C  I + +      NL  L KLE+L  +      E         FP SLKEL
Sbjct  661   NLKKLEIICGTIGSNRL----SNLGLLHKLEQLSMLCCPCGGEIV-------FPNSLKEL  709

Query  2311  KIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWE  2490
             ++ G ++ WE +++I  LPNL+ L L +   +G++W+  +G F +LK+L+I   +L+ WE
Sbjct  710   RLHGCKIPWEEMSVIGSLPNLQVLVLFKNAAIGQKWIPNEGEFARLKYLWIHQCELEIWE  769

Query  2491  TMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS--LVESAKDIQEEQSS  2664
               + HFP LE L L +  NL++IP  F +I  LQ I +     +  ++ SA +I E++ +
Sbjct  770   ADNTHFPCLEILRLGYL-NLKEIPSEFAEILPLQKIRVDYNRNNDLILASANEISEQREN  828

Query  2665  YGNDQL  2682
              G D +
Sbjct  829   LGYDGI  834



>emb|CDP20159.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   371 bits (952),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 265/782 (34%), Positives = 414/782 (53%), Gaps = 90/782 (12%)
 Frame = +1

Query  466   HIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYD  645
             HI +  A+ + D+  +VG   E+E     L + S Q   ++ IVGM G+GKTT+A K+Y+
Sbjct  528   HIPSQLAAAMHDED-LVGLDDEVEIITHRLTRGSKQ-LDIVPIVGMPGLGKTTLAHKVYN  585

Query  646   DPSIRSRFHLLGWATVSQDYDLRRIL-QDLCGCVAQMTDKEINEVKSTAELANKVRRRLM  822
              PS+RS FH+ GW  VSQ      +L Q LC   ++  D+ + E ++   LANK+R+ L+
Sbjct  586   APSVRSHFHVHGWCRVSQTCSKHSLLVQLLCSVDSRSPDEYLKEDENN--LANKLRQVLL  643

Query  823   RQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLN  1002
             R RYLL +DD+W    W+ L++  P+D+NGSRIL T+R + ++++   + +   +L  L 
Sbjct  644   RSRYLLFLDDLWDVEAWNLLEKSLPNDANGSRILFTSRYQNLSLHFKPNSE-PHHLRHLT  702

Query  1003  SNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSI  1179
               ESW L  +KL G  + PP + E+G +I   C GLPLA+ + AG+L+ T +  ++W+ +
Sbjct  703   DEESWTLLQRKLFGMEDCPPALSEVGSQISKLCHGLPLAVVLIAGILATTAQ--DSWEEV  760

Query  1180  ASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITE  1359
             A +++  +  D  + C   L LSY++LP +LK C LYF  F +    I  + LL LWI+E
Sbjct  761   AKSLSSIVLED--EYCMKALELSYSHLPDYLKPCLLYFAAFQE-DEVINVRRLLRLWISE  817

Query  1360  GFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEK  1539
              FV +  G+SL+E A  YL  LI+R+LV+  +   +G  K C LHDL+ + C+++ K+E 
Sbjct  818   RFVQQTEGKSLKEAAYDYLTTLINRSLVMAVRQRNVGGAKYCLLHDLVHEFCVKKAKEES  877

Query  1540  FVSAFHQRSENVIEL-GDTEP---LFEYANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFF  1707
             F+ A H  S N + L G + P       A     +  T I P           R+L+ F 
Sbjct  878   FLYAIH--SWNPLCLTGPSNPHRVCVSNARELKIWELTLIFPNL---------RSLILF-  925

Query  1708  GVSGASGLPVSWRQNVSF---KMIRVLDLVEISFDEAPTFDISDLILLRYLALGTIKYV-  1875
                G         +++     K++RVLD+  + F  +   ++  L+ LRYLAL  I Y+ 
Sbjct  926   ---GQDDFK-HEEEDLGILLPKLLRVLDIRNLDFRYSFPMEVVLLVHLRYLALKRIPYIP  981

Query  1876  RVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS---LRFIKY------P  2028
               + +   L+TLIV+ P              G++    +W  ++   LR + Y       
Sbjct  982   SAIANLSRLETLIVEDP-------------FGTELPSTIWNIKTLSHLRVLNYHGVWPMG  1028

Query  2029  YPFPIDTDE-IPVQDTLHTLYWV--PYLRCTKEFVLKIPNVKVLGI------------KC  2163
             + FP+   E  P  D L TL+    P  +  ++ + K+P+++ L               C
Sbjct  1029  FIFPLGNLEGSPDLDHLDTLHLAIDPSPQSLQKILRKLPSLRRLKCMERWNSSREATRNC  1088

Query  2164  SEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEA  2343
             +EI  F           L++LE L +       F+      FP +LK+L +      W  
Sbjct  1089  NEILEFDG---------LSQLESLHLFRFHGCGFK------FPLNLKKLVLSHNRQPWSE  1133

Query  2344  ITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLER  2523
             I+ I  LPNLE LKLL+   +GEEWV  +G FPKL+ L +S  + +NW   SD+F  LE+
Sbjct  1134  ISTIGKLPNLEVLKLLEDCFVGEEWVMKEGEFPKLRVLKLSELEFRNWTAFSDNFSRLEK  1193

Query  2524  LALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR--DY  2697
             L LH C  LEK+P    +  TL++IE+K+C  S+V+S K IQ+EQ   GN+ L +   +Y
Sbjct  1194  LVLHSCEELEKVPSCLGECETLEMIEVKECPESVVDSVKQIQQEQIDMGNEVLKIEIDEY  1253

Query  2698  DT  2703
             DT
Sbjct  1254  DT  1255



>gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Erythranthe 
guttata]
Length=880

 Score =   363 bits (932),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 279/841 (33%), Positives = 436/841 (52%), Gaps = 71/841 (8%)
 Frame = +1

Query  268   ARVKDISFRAEDEIESEVMEII--SNGASHERLHQILQRLAEDIEGLIEQRNTTQMLSSY  441
              R+ + ++  +D +ES +++ I  +N AS +  +  L+ L ++++ +  ++   QM  + 
Sbjct  58    TRIANATYAVQDILESHIVDQIHGANIASDKEFYNGLKELIQEMDFI--KKEVMQMKENN  115

Query  442   NPG----QSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGG  609
             N G    + +    I    S+L      VG    +E   +ML   + ++  +I IVGMGG
Sbjct  116   NMGLFLHKDSSTVDIGPLRSRLTGQNATVGFDDVMEEMMDML---TGRQSDIIPIVGMGG  172

Query  610   IGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINEVKSTA  789
             IGKTT+A+ +Y    I   F +L WAT+SQ++ +R IL ++  C+     KE        
Sbjct  173   IGKTTLARNLYVSRLIVRHFDMLAWATISQEFSMRGILLEILLCIKSQESKETYSAMRED  232

Query  790   ELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCS  969
             EL   + + L+ +RYL+++DD+W    W+ ++  FPD++NGSRI++T+RL+ VA  S  +
Sbjct  233   ELGLVLHKTLIGRRYLIIMDDMWSIEAWELVKFFFPDNNNGSRIIVTSRLRLVA--SQLT  290

Query  970   GKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGL  1137
                   + FL+ ++SW L  + +    G  NL  E+EEIGK+I   C+GLPL+I V  GL
Sbjct  291   DSRGIEMSFLDDDQSWNLLCRNVFGEQGCPNL--ELEEIGKKIAKSCKGLPLSIVVIGGL  348

Query  1138  LSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG-IFPKVR  1314
             L+K+ R+ E W+ +   ++  +  + +++C  IL +SY++L  HLK CFLY G +FP+  
Sbjct  349   LAKSARTREYWEYVFENISSIVNLEDNERCLRILNMSYDHLSVHLKPCFLYLGSVFPEDD  408

Query  1315  REIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLH  1494
             + I    L+ LW+ EGF+   SG+S+E  A +YL DLI+RNLVL+      G IK C +H
Sbjct  409   K-IRVSWLIKLWVAEGFLKPKSGKSMELVAEEYLNDLIERNLVLVHIRGSSGKIKFCIIH  467

Query  1495  DLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYN  1674
             DLL DLCLR+ +KEKFV  F + + + ++    E           +      P+ S    
Sbjct  468   DLLRDLCLRQAEKEKFVCVFTRDNHSSLDAQQIETQHRICIHRGKWEEELDIPRMSHAM-  526

Query  1675  FHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILL---R  1845
               +S +L           LP     +++ +++RVL   + +      + I  +  L   R
Sbjct  527   --QSASLTRSMICDFKEVLP-----SLNMRLLRVLKSNDRALHYGDIYSIEAIFQLVNSR  579

Query  1846  YLALGTIKYVRVLKHHH------NLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQS  2007
             YLA+  + ++++  +        NLQTLIV                  +     +WK   
Sbjct  580   YLAI-RVDWMQISLYLSSLHLLWNLQTLIV-------------YGAWNTIAPPEIWKMHQ  625

Query  2008  LRFIKY---PYPFP----IDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCS  2166
             LR I++     P P     D D+I V + L TL  +   +C++  V +IPNVK L +   
Sbjct  626   LRHIEFVMLDLPDPEMDGRDQDKIIVLENLQTLLQIRNFKCSEAVVKRIPNVKKLRLYYQ  685

Query  2167  EIRAFQTETWWDNLHYLTKLEKLIV------EDIESEQFELQSINSFPQSLKELKIVGTE  2328
             ++    +    +NL  L KLE L        E I      LQ++N FP SLK+L +  T 
Sbjct  686   DVEELSSFC-LNNLCRLEKLESLGCYFAPEKEPIIRNHL-LQNLN-FPHSLKKLLLYRTR  742

Query  2329  LGWEAITI-ISMLPNLESLKLLQAYEMGEEWVTGDG-GFPKLKFLYISG-AKLKNWETMS  2499
             L W  + I I  LP L+ LKL      G+EW T +G  F  LKFL I    +L+ W T S
Sbjct  743   LHWGDMAIKIGSLPFLQVLKLETNAFCGDEWETIEGRQFCNLKFLLIEDCGELRYWRTES  802

Query  2500  DHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQ  2679
              HFP LE+L+L     LE+IP    +I TL+ I LK C  S V SAK+I EEQ   GN+ 
Sbjct  803   SHFPCLEQLSLRDLDILEEIPWDIGEIPTLETIVLKYCSHSAVISAKEIVEEQLENGNED  862

Query  2680  L  2682
             L
Sbjct  863   L  863



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score =   363 bits (933),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 297/935 (32%), Positives = 457/935 (49%), Gaps = 108/935 (12%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK-  258
             AY  L SL   ++   L PRP + +D ++++  L + L  L+  LE      +    E  
Sbjct  3     AYAALLSLKYIIQQIQLHPRPPISLD-QNQVVSLTKSLNFLQDFLEGYSYGSSSISREAV  61

Query  259   DVI-ARVKDISFRAEDEIESEVMEIISNGAS------HERLHQILQRLA----------E  387
             DV+ +R+KD +  AED IE+ +++ I  G        ++ L +++Q +           E
Sbjct  62    DVLESRIKDAAHAAEDIIETRIVDQIRGGGRINSVDFYQDLEKVIQEMGFIKKDVMEIKE  121

Query  388   DIEGLIEQR----NTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEML  555
                G+IE R     +T   SS +P    Q  ++        DD ++    +  ER   + 
Sbjct  122   KNIGIIEDRLHINPSTLGGSSSSPLPMKQIAVVG------LDDQLIEVMDKLTERQSNL-  174

Query  556   LQCSTQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLC  735
                     ++I IVGMGGIGKTT+A   Y +P I  +F +  W T+SQ Y++R IL ++ 
Sbjct  175   --------RIIPIVGMGGIGKTTLAINAYTNPLITEQFDIRAWVTISQTYNVREILVEIL  226

Query  736   GCVAQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGS  915
              C ++   ++    KS  +L  +V + L  +RYL+V+DDIW    WD ++R FPD+  GS
Sbjct  227   LCASKDETRKSLSGKSEGQLGERVHKSLYGRRYLIVLDDIWSVEVWDKVKRFFPDNGQGS  286

Query  916   RILLTTRLKEVA---VYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGK  1080
             R+++TTRL  +    + S   G +   +  L+ + S  L    +     + P E+EEIGK
Sbjct  287   RVMITTRLSNIVLQMIGSQLIGSHGLVMDLLDDDRSCDLMCATIFGKEEDCPVELEEIGK  346

Query  1081  RIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNL  1260
             +I   C+GLPL+I V  GLL+K   + ENW+ I+  +N  +  + +++C  +L LSY+ L
Sbjct  347   KIAKNCKGLPLSIVVIGGLLAKLNPTRENWEYISENLNSIVNVEDNERCLKVLLLSYHYL  406

Query  1261  PYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNL  1440
             P HLK CFLY G+FP+    I    L+ LW++EGF+    G+SLE  + +YL+DL DRNL
Sbjct  407   PVHLKPCFLYMGVFPE-DSNIRVPRLVKLWVSEGFLKPIRGKSLEVVSGEYLEDLCDRNL  465

Query  1441  VLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANR  1620
             + + +    G IK C++HDL+ +LCLRE +KEKF+  + +R     +L   + +     R
Sbjct  466   IRVHQRGTNGRIKFCKIHDLMRELCLREAEKEKFL--YVRRPH---DLNTPQGIINTQRR  520

Query  1621  WLTFRTT----YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLV  1788
                 ++T    Y+        +   +R+L F F      G+  S       +++RVL   
Sbjct  521   ICIHQSTTHKVYLPKALRALQSVPLARSLCFEF-----EGVLPSLDH---CRLLRVLRAA  572

Query  1789  EISFDEAP-----TFDISDLILL---RYLALGTIKYVRVLKHHH------NLQTLIVKFP  1926
             +  F+        T+ + D+  L   RYLA+   +Y  + +         NLQTLIV   
Sbjct  573   DTDFNSYGKNTHCTYTLEDVFQLVNSRYLAVDDFRYENLFRFPSSVYLLWNLQTLIVTSI  632

Query  1927  NSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQD------TLHTLY  2088
             +                    +WK   LR + +P    +    +  QD       L TL 
Sbjct  633   DPVVAPSE-------------IWKMTQLRHVLFPSGLEMPDPPLGGQDGEFVLGNLQTLS  679

Query  2089  WVPYLRCTKEFVLKIPNVKVLGIKCSEIRAF----QTETWWDNLHYLTKLEKL---IVED  2247
              +   +C +E V +IPN+  L I C E   F     +     NL  L KLE         
Sbjct  680   LIRNFKCGEEVVKRIPNITKLKI-CYEGEKFGGYLSSYYCLKNLGRLGKLESFDCYFDNG  738

Query  2248  IESEQFELQSINSFPQSLKELKIVGTELGWEAI-TIISMLPNLESLKLLQAYEMGEEWVT  2424
              E  + ++      P S+K+L +  T L WE + T I  LPNLE LKL     +G EW T
Sbjct  739   YELNRNDMLQNFIIPNSIKKLTLSWTYLKWEDMKTKIGWLPNLEVLKLKYKSFLGGEWET  798

Query  2425  GDGGFPKLKFLYI-SGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIE  2601
              +G F  L+FL I   + L+ W T S HFP LE+L L   + L++IP    +I TL  IE
Sbjct  799   VEGQFCNLRFLQICEDSDLEWWTTDSTHFPRLEQLKLWDLYKLKEIPSCIGEIPTLGSIE  858

Query  2602  LKDCFPSLVESAKDIQEEQSSYGNDQLVVRDYDTR  2706
             L  C  S V SAK+I +EQ   GN     RD+  R
Sbjct  859   LIYCSKSAVISAKEILDEQEDLGN----TRDFLGR  889



>gb|EYU31572.1| hypothetical protein MIMGU_mgv1a024734mg [Erythranthe guttata]
Length=826

 Score =   361 bits (927),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 277/889 (31%), Positives = 439/889 (49%), Gaps = 92/889 (10%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEKD  261
             AY  L SL   ++   + PR  + +D K + + L +K+  L   ++       +++  + 
Sbjct  4     AYAALVSLTNIIDQIHVHPRLPISLD-KKQSESLVEKVGFLLDFIQTDSNGA-ITEEAQF  61

Query  262   VIARVKDISFRAEDEIESEV---MEIISNGASHERLHQILQRLAEDIEGLIEQ--RNTTQ  426
             +  ++  +++ AED IES +   +  +    +H      L  + ED++ + ++      +
Sbjct  62    LERQIASVTYAAEDVIESHIANQLHALDQIHAHLTFLLDLMTVIEDMDSIKKRVMEFKEE  121

Query  427   MLSSYNPGQSNQEHIIAGGASKLQDDA--IMVGHAQELERTKEMLLQCSTQ--ERQVISI  594
                S N   +    I    +S+L  +    M+G  ++L    ++L + + Q  + Q+I+I
Sbjct  122   RRGSKNRKPTYSMPITTSTSSRLVTNGKNTMIGFDEKL---IQLLHRFTGQPSQLQIITI  178

Query  595   VGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEINE  774
             VGMGGIGKTT+AK  Y+   I   F +  W TVSQ Y+++ IL  L    ++  + E N 
Sbjct  179   VGMGGIGKTTLAKHTYEHSLITKYFDIRAWTTVSQTYNVKEILLQLVYGQSKSRNTESNR  238

Query  775   VKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAV  954
              ++  E+  ++ + L  +RYL+VVDDIW    WD + R  PD++NGSRI++TTR+  +++
Sbjct  239   -ETEEEVGKQLYQELWGRRYLIVVDDIWSIEAWDKIHRFLPDNNNGSRIVITTRISNLSI  297

Query  955   YSGCSGKYVCNLPFLNSNESWMLFSQ-KLGSINLPPEIEEIGKRIVNKCRGLPLAITVAA  1131
                  G     L FL+ ++SW LF +   G     PE+++IGK I NKC+GLPL+I V  
Sbjct  298   ----RGSQCLELTFLDEDKSWKLFCEMAFGLEGYLPELKDIGKEIANKCKGLPLSIVVIG  353

Query  1132  GLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKV  1311
             GLL K+ R+ E W+ IA  +   + S  HD C  IL+LSY +LP HLK C L+ GIF + 
Sbjct  354   GLLRKSNRTQEYWKDIAKDLISILNSGEHDDCLNILSLSYTHLPTHLKPCLLHMGIFLE-  412

Query  1312  RREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRL  1491
              +E    +L+ LW+ EGF+  ++ +SLEE A  Y+ DL++RNL+L  K+   G I+T ++
Sbjct  413   DKENYVNELIKLWVAEGFIKPNAIQSLEEIARGYINDLVERNLILKHKMGSNGKIRTFKI  472

Query  1492  HDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKY  1671
             HDL+ DLCL+  + EKF+       +                                  
Sbjct  473   HDLMRDLCLKLAQTEKFICMLKDIPQ----------------------------------  498

Query  1672  NFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF--DISDLILLR  1845
                         G+  A+G P++++Q    +++RVL++++ S +E      DI D + LR
Sbjct  499   ------------GIDSAAG-PLTFKQ----RLLRVLNVLDQSMEEEIDLPKDIFDQVNLR  541

Query  1846  YLALGTIKYVRVLKHHHNLQTLIVKFPNSCRie-eidsdeeiGSKWLQG-LWKSQSLRFI  2019
             YL+ G           +    +    P+S  +   + +    G+ +    +W+ + LR +
Sbjct  542   YLSYGC---------EYAGSMVWDDLPSSISLLWSLQTLSIQGTIFAPSQIWEMRQLRHL  592

Query  2020  KYPY-----PFPIDTDEIPVQDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQ  2184
             K        P P    +  V   L TL  V     T E   +IPNVK L ++        
Sbjct  593   KIVSLYITDPSPDGQQQDIVLRNLQTLVSVVDFALTDEVCKRIPNVKKLSMQFYNREKSS  652

Query  2185  TETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISML  2364
              +    NL YL KLE         +   L +I  FP SLK+L +    L W+ +T+I  L
Sbjct  653   NDYCLYNLCYLLKLESFTCSTHYLDNL-LHNI-IFPNSLKKLTLQHCGLHWDDLTMIGSL  710

Query  2365  PNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCH  2544
             P LE LKL +    G EW   +G F +LKFL I    +  W   S HFPVLE L L    
Sbjct  711   PYLEVLKLKRGSVKGREWNPVEGEFLRLKFLLIYKCDIIYWNADSSHFPVLESLVLVGLV  770

Query  2545  NLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEEQSSYGNDQLVVR  2691
             +L++IP    +ITTL ++ L DC  S   SA  I EEQ    N+ L VR
Sbjct  771   DLDEIPSDIGEITTLGVVSLYDCSESATLSAMKIAEEQECNDNEGLQVR  819



>gb|EYU24185.1| hypothetical protein MIMGU_mgv1a024774mg [Erythranthe guttata]
Length=880

 Score =   362 bits (930),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 262/807 (32%), Positives = 420/807 (52%), Gaps = 69/807 (9%)
 Frame = +1

Query  295   AEDEIESEVMEIISNGASHE--RLHQILQRLAEDIEGLIEQRNTTQMLSSYNPGQSNQEH  468
             A D +E E  + +S G   E   LH I ++L + I+  ++ +N+   LS      S++  
Sbjct  43    AVDRLEPEPSDFLSEGVRTEIQELHSIHKQLVKMIKKDVQPQNS---LSRGASSTSSKPL  99

Query  469   IIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTMAKKIYDD  648
               + G         MVG  + L +    L    +  R +IS+VGMGGIGKTT+A  +++ 
Sbjct  100   PSSKGT--------MVGFQKHLIQMMTTLTANESNLR-IISVVGMGGIGKTTLATNVFNK  150

Query  649   PSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD-----KEINEVKSTAELANKVRR  813
             P +   FHL  W T+S++ + + IL    G + Q+++     KE+N+ + T  L +K+ +
Sbjct  151   PLVLEHFHLRAWVTISKECNKKEIL---LGLLLQISNGYGNVKEMNDEEET--LGDKLYK  205

Query  814   RLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGKYVCNLP  993
              L  ++YL+V+DD+W  + W+ ++R  PD++NGSRI++TTRL ++A   G    Y  N  
Sbjct  206   ELFGRKYLIVMDDMWDIKAWELVKRFLPDNNNGSRIMVTTRLLKLAEDFGSCSPYQLN--  263

Query  994   FLNSNESWMLFSQKL-GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKTKRSVENW  1170
             FL+  +SW L  +K+      P E+E IGK I  KCRGLPLA+ V  GLL+K+K + E+W
Sbjct  264   FLDEAQSWDLLREKVFAEGRCPVELEVIGKSIAKKCRGLPLALVVIGGLLAKSK-TKEHW  322

Query  1171  QSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPTKDLLNLW  1350
             + +   +   + ++  + C  IL LSY +LP ++K C+LYF +FP+    I    L+ LW
Sbjct  323   KYVEEDVTSEVNNEDDEFCMKILWLSYIHLPIYIKPCYLYFAVFPE-DHIIKVSRLVRLW  381

Query  1351  ITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLLFDLCLREVK  1530
             + EGF+ +   +S+EE   +YL+DLI RNL+L++     G ++TCR+HDLL DLC RE +
Sbjct  382   VAEGFIRKCRHKSMEETGEEYLEDLIHRNLILVNTRWVTGEVRTCRIHDLLSDLCRREAQ  441

Query  1531  KEKFVSAFHQRSENVIELGDTEPLFEY-ANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFF  1707
             K+ FV   +    N++      P     + +W     T  +P    +           F 
Sbjct  442   KDNFVLTANL---NIVTHTKITPRLSINSGKWKQKNLTPYRPPVPTRS----------FV  488

Query  1708  GVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTFDISDLILLRYLA-LGTIKYVRVL  1884
               S       + R+   F ++R+ D+V    DE P  +I  LI  RY++ +G++     +
Sbjct  489   SFSKGDSTDYTARR---FPLLRLFDVV----DEYPKDEILQLINSRYVSCMGSMSMPSSI  541

Query  1885  KHHHNLQTLIVKFPNSCRieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPV  2064
                 +LQTL+V                    W     +    RFI    P P +  +I +
Sbjct  542   SQLWSLQTLVV----------YGELILPSEIWHMPQLRHVEGRFIVLSDPLPDNVHKIIL  591

Query  2065  QDTLHTLYWVPYLRCTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE  2244
              + L TL  V   +C++  + KIPN+K L I C  I + +      NL  L KLE+L +E
Sbjct  592   LENLQTLSKVKDFKCSEAVMKKIPNLKKLEIICGTIGSNRL----SNLGLLHKLEQLNLE  647

Query  2245  DIESEQFELQSINSFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVT  2424
              I   +     +  FP SLKEL +   ++ WE ++ +  LPNLE L L +   +G++W++
Sbjct  648   LITGTRCGGGIV--FPSSLKELTLTECKIPWEHMSTVGSLPNLEVLSLRRNAAVGQKWIS  705

Query  2425  GDGGFPKLKFLYISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIEL  2604
              +G F +LK L+I   +L+ WE    HFP LE + L +  NL++IP     I  L+ I L
Sbjct  706   KEGEFARLKSLWIHKCELEIWEADDTHFPCLEIIHLGYL-NLKEIPSDLAAILPLRGINL  764

Query  2605  -KDCFPSLVESAKDIQEEQSSYGNDQL  2682
               +   SL+ SA  I EE+ + G D +
Sbjct  765   DHNTNNSLLASANKILEERENLGYDTV  791



>gb|EYU21178.1| hypothetical protein MIMGU_mgv1a019709mg [Erythranthe guttata]
Length=889

 Score =   362 bits (930),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 294/900 (33%), Positives = 440/900 (49%), Gaps = 111/900 (12%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             ++Y  L SL+ T++     PR    VD K++++ L +K+  L   +E           + 
Sbjct  32    ISYASLVSLLTTMDQIKNHPRFSTSVD-KNQLESLGEKIGFLLEFIE--------KHTDG  82

Query  259   DVIARVKDISFRAEDEIESEVMEIISNG------------------ASHERLHQILQRLA  384
              + +R+   ++ AED IES V++ I  G                  AS   LH +++ + 
Sbjct  83    VLESRIACAAYAAEDVIESHVVDQIKPGIRTKVAKIIHSMRLKKTWASLLDLHSVIEEMD  142

Query  385   EDIEGLIEQRNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQC  564
                + ++E ++  ++ S+ +  Q       +           MVG  ++L +  + L   
Sbjct  143   SIKKKVLELKD--EIGSNEHDMQPTCTTTSSSTPLITTGKNTMVGFEEQLLQLLDKL-TG  199

Query  565   STQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCV  744
                 RQVI IVGMGGIGKTT+AK  Y+   I   F +  W TVSQ Y++  +L  L    
Sbjct  200   QQSNRQVIPIVGMGGIGKTTLAKNAYEHSLIVHHFDIRTWITVSQKYNVIELLLQLLSEK  259

Query  745   AQMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRIL  924
                 D+++        L  K+ + L  +RYL+V+DDIW    W+++ R FPD++NGSRI+
Sbjct  260   NSQIDEQL--------LGQKLHKMLWARRYLIVIDDIWSIEAWEEVSRFFPDNNNGSRIV  311

Query  925   LTTRLKEVAVY--SGCSGKYVCNLPFLNSNESWMLFSQK-LGSINLPPEIEEIGKRIVNK  1095
             +TTR+  VA+Y  S C       L FL+ ++SW LF QK    +  P E+E+IGK I+ K
Sbjct  312   VTTRISNVAIYFDSPC-----FELSFLDEDKSWKLFCQKAFDQVGCPSELEDIGKEIIKK  366

Query  1096  CRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLK  1275
             C+GLPL+I V  GLL ++ R+ + W++IA  +   + S   + C +IL+LSY  LP HLK
Sbjct  367   CKGLPLSICVIGGLLGRSNRTQKYWKNIAKDLTSILNSGEDENCLSILSLSYTYLPAHLK  426

Query  1276  ACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISK  1455
              CFLY GIFP+   +I    L+ LW+ EGF+  +   S EE A  YL DLIDRNLVL   
Sbjct  427   PCFLYMGIFPE-DHKIFVSRLIKLWVAEGFIKSNLSESWEETARGYLSDLIDRNLVLNHW  485

Query  1456  LSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFR  1635
             L   G IK C++HDLL DLCL+   K++F+            + DT+   E   R +   
Sbjct  486   LGSNGRIKICKIHDLLRDLCLKLAHKDEFICV----------MEDTQRGIESGRR-IVCN  534

Query  1636  TTYIQPKFSDKYNFHK------SRTLLFFFGVSGASG-LPVSWRQNVSFKMIRVLDLVEI  1794
               +I  K  +    H       +RTL     V+   G LP +       +++RV+   + 
Sbjct  535   ENFITAKHHESRALHTLQLAPLTRTL-----VTSIDGRLPKN-------RLLRVMSFNKG  582

Query  1795  SFDEAPTFDISDLILLRYLALGTI-------KYVRVLKHHHNLQTLIVKFPNSCRieeid  1953
             +  +     I D + +RYLA   +       K    +    NLQT+I+            
Sbjct  583   ARKKYLCRHIIDQVNMRYLAYYKLTRSFPADKLSSSIDVLWNLQTIII------------  630

Query  1954  sdeeiGSKWLQGLWKSQSLRFIK-YPYPFP-------IDTDEIPVQDTLHTLYWVPYLRC  2109
                    + L  +WK + LR +  Y    P           E  +Q+ L TL  V     
Sbjct  631   ---TANIEALSQIWKMRQLRHVDIYELHLPNPPRNRGQQQSEFVLQN-LQTLKTVFNFVW  686

Query  2110  TKEFVLKIPNVKVLGIK-CSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINS  2286
             ++E   ++ NV+ L IK  S+ +   TE    N+  L KLE L     + +   LQ + +
Sbjct  687   SEEACERLVNVRKLNIKYVSDPQRSSTEYRLYNICRLHKLESLTCCPYDVDNV-LQKL-T  744

Query  2287  FPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYIS  2466
             FP SLK+L + G+ + WE +T+I  LPNLE LKL      G  W   +G F +LKFL I 
Sbjct  745   FPSSLKKLCLEGSMIRWEDLTVIGSLPNLEVLKLKNRLVKGSVWNPVEGEFLRLKFLLIQ  804

Query  2467  GAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
              + L NW   S HFPVLE+L L     LE+IP    +I TL LI++  C  S   SA  I
Sbjct  805   WSDLVNWNADSSHFPVLEKLVLESLKKLEEIPLDIGEIPTLGLIQVHWCSESAAISAMKI  864



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   361 bits (927),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 302/917 (33%), Positives = 458/917 (50%), Gaps = 127/917 (14%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDY---KDEIQCLRQKLCHlkalleesekklNVSQ  249
             MAY  L+SL+ T++ Q L+P   LV      +  I+   Q L  L+  LEE+ K+    +
Sbjct  1     MAYAALSSLMHTLQ-QLLQPNQRLVCGSCIPQQHIESTYQSLSALQVFLEEATKEAKDIE  59

Query  250   AEKDVIARVKDISFRAEDEIESEVMEIISN--GASHERLHQILQRLAEDIEGLIEQRNTT  423
               K +  R++D+ ++ E  ++S +  +I    G   ER  +      +++E  ++     
Sbjct  60    TRKSLEKRIRDVVYKVEYRVDSRLRSVIVADCGDDRERACKAFNEELQEVEKEVDSLKKE  119

Query  424   QMLSSYNPGQSNQEHIIAGGASK------------LQDDAIMVGHAQELERTKEMLLQCS  567
              +   +N   S    +    +S             ++DD I +     L+R     L   
Sbjct  120   VIQIEFNKHGSKSAELATTSSSSRRYAIEQYTVVGMEDDFINI-----LDR-----LTAQ  169

Query  568   TQERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVA  747
             T +  VIS+VGMGGIGKTT+A+K YDD SIR RF    W TVS++Y+ R++L D+   ++
Sbjct  170   THDLTVISVVGMGGIGKTTLARKAYDDSSIRYRFDTHAWVTVSENYNERQVLLDVIISIS  229

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
             +    E  E  ST +LA  V + L  +R+L+++DD+W +  WD +QR FP+D+N SRILL
Sbjct  230   RDRTDESYETMSTDQLAEIVYKGLKGRRFLIIIDDLWSTEAWDQMQRLFPNDNNKSRILL  289

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKLGSINLPP-EIEEIGKRIVNKCRG  1104
             TTRL  VA Y+        ++ FL+ ++SW LF++ L   +L P  +++IGK I+ +CRG
Sbjct  290   TTRLNYVADYASPDFP-PHSMSFLSLDDSWNLFTEMLFKEDLCPLLLQKIGKHIIQQCRG  348

Query  1105  LPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACF  1284
             LPL+I V AG+L K   + +NW+ I   +N                              
Sbjct  349   LPLSIVVIAGILGKMDPTHDNWKKIEENLN------------------------------  378

Query  1285  LYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSF  1464
              +FG FP+   EI    L+ LWI E F+   S R LEE A +YLQDLIDR+L+L  K   
Sbjct  379   SFFG-FPE-DMEINVSKLIRLWIAEQFIKARSYRRLEEVAEEYLQDLIDRSLILAGKRRA  436

Query  1465  IGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYA----NRWLT-  1629
              G ++TC++HDLL  LC+ E   E  V   H  + NV       P+F  A     R +  
Sbjct  437   NGRMRTCKIHDLLRQLCIIEAHNENVV---HAMNANV-------PMFSEAINDQRRVIVP  486

Query  1630  --FRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWR--QNVS-FKMIRVLDLVEI  1794
                +  ++ P          +RT +F    +  S L  + R    VS FK+++VLD+  +
Sbjct  487   FDIKEKHVYPTTHSSVLTSMTRTFIF----TKYSDLDFTERFCSIVSQFKLLKVLDVYNV  542

Query  1795  SFDEAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGS  1974
               D +    I  LI LRY+A   I     L    NLQ++I++                 S
Sbjct  543   RCDFSCV--IPKLIHLRYVA-ANIDEAPSLAKLWNLQSIILR--------------NFAS  585

Query  1975  KWL---QGLWKSQSLRF------IKYPYPFPIDT----DEIPV-QDTLHTLYWV--PYLR  2106
             K L   Q +W    +R       I  P P   ++    +E P+  + L TL     PYL 
Sbjct  586   KDLHLPQEIWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTLVLCSSPYL-  644

Query  2107  CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVE-DIESEQFELQSIN  2283
                E + + P +  L +   E R        D L  L +LE L +E D+ S+   L S +
Sbjct  645   --VEILRRTPYLNKLTV-LDESRHSDCPAILDPLSLLQELETLTIEADLGSDPMIL-SRD  700

Query  2284  SFPQSLKELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEW-VTGDGGFPKLKFLY  2460
              FP +LK+LK+  T L WE + +++ LPNLE LK   A+E G  W +  D  F KLK+L 
Sbjct  701   IFPPNLKQLKLSYTTLQWEDMVVLANLPNLEVLKAYSAFE-GTYWRLNEDVVFQKLKYLR  759

Query  2461  ISGAKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAK  2640
             +    L+ WE  +D+FP+LE+L L+    LE+IP+   +I  L+LI+++ C  + V SAK
Sbjct  760   LQYGSLERWEATNDNFPMLEQLLLYGFRKLEEIPQSIGEIMILKLIQIERCSAAAVTSAK  819

Query  2641  DIQEEQSSYGNDQLVVR  2691
              IQ+EQ S+GN  L VR
Sbjct  820   KIQQEQESWGNYGLQVR  836



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score =   363 bits (931),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 309/963 (32%), Positives = 455/963 (47%), Gaps = 172/963 (18%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE           ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIVEVAYTTEDMVDSESRNAFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q   T+  +    P  S+     EH +       Q + IMVG   E E   + L +   
Sbjct  108   KQWMATSDSMKDLKPQTSSLVSLPEHDVE------QPENIMVGCENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ I   ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSAVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   +I   +L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFTE-DEQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I++C +HD+  +LCLRE +   FV+    +S       D     +   R    R+
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKS-------DQNSCAQSMQRSFKSRS  500

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDE  1806
                      +   HK   L +       S + +   + V    SFK++RVLDL     + 
Sbjct  501   ---------RIRIHKVEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDL---GLNT  548

Query  1807  APTF--DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeei  1968
              P F   +  LI LRYL+L   ++   L+ +      + + I+  P S            
Sbjct  549   WPIFPSGVLSLIHLRYLSL---RFNPCLQQYQGSKEAVPSSIIDIPLSISSLC-------  598

Query  1969  GSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLY--WVPYLR------------  2106
                +LQ      +L F  Y YPF I   EI     L TL   W  YLR            
Sbjct  599   ---YLQTF--KLNLPFPSY-YPF-ILPSEILTMPQLRTLCMGW-NYLRSHEPTENRLVLK  650

Query  2107  ------------CTKEFVLKIPNVK---VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIV  2241
                         CT  F    PN+K   V G+       F+      +  YL +LE+L  
Sbjct  651   NLQCLNQLNPRYCTGSFFRLFPNLKKLQVFGVP----EDFRNSQDLYDFRYLYQLEELTF  706

Query  2242  E----------DIESEQFELQSINSFPQSL--KELKIVGTELGWEAITIISMLP-NLESL  2382
                           +     Q    F   +  KE+   GT      +      P NL+SL
Sbjct  707   RLYYPYAACFLKNTAPSGSTQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSL  766

Query  2383  KLLQAYEMGEEWVTGDGGFPK-------------------------LKFLYISGAKLKNW  2487
                  + M  + ++  G  PK                         LKFL++    ++ W
Sbjct  767   TFRGEFSMAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLKFLFLDDVYIRYW  826

Query  2488  ETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSS  2664
                SDHFP LER+ L  C NL+ IP  F DITTL LI++  C  S+V SAK IQ++ Q +
Sbjct  827   RASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQQDIQDN  886

Query  2665  YGN  2673
             YG+
Sbjct  887   YGS  889



>gb|EYU24172.1| hypothetical protein MIMGU_mgv1a025900mg, partial [Erythranthe 
guttata]
Length=885

 Score =   362 bits (928),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 302/908 (33%), Positives = 461/908 (51%), Gaps = 100/908 (11%)
 Frame = +1

Query  82    AYVGLTSLIRTVELQFLEPRPIL--VVDYKDEIQCLRQKLCHlkalleesekklNVSQAE  255
             AY  L SL  T++ Q L+  P L  +VD K +I+ L QK   L     E+       Q  
Sbjct  4     AYAALVSLTHTID-QILDTPPTLHIIVDRK-QIEIL-QKKADLLLDFLENYTSTRGDQEI  60

Query  256   KDVIARVKDISFRAEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIE---------  408
             + +   + D ++ AE  IE  VM  I    S     +    L E +E  I+         
Sbjct  61    EHLEMMIGDAAYAAEYIIEFNVMNQILAARSRSDREESSNLLFEGVEISIQEFLFIEKEL  120

Query  409   -------QRNTTQMLSSYNPGQSNQEH---IIAGGASKLQDDAIMVGHAQELERTKEMLL  558
                    QR     L++     S+      + AGG +K      MVG    ++   E++ 
Sbjct  121   VKFKKDMQRPNNYYLTTTKASSSSSSSRPLLPAGGKNK------MVGFNDHMD---EIMG  171

Query  559   QCSTQER--QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDL  732
               ST E   ++ISIVGMGGIGKTT+A  + ++P I   F L  W TVSQ+Y  ++IL   
Sbjct  172   ALSTNESNLRIISIVGMGGIGKTTLAINVSNNPYIVEHFQLRAWFTVSQEYTDKKIL---  228

Query  733   CGCVAQMTD-----KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFP  897
              G + Q+ +      EI++      + + + + L  ++YL+V+DD+W  +  D ++R  P
Sbjct  229   LGLLHQINNTYRNAHEIDDDDDDYAIGDILHKTLFGRKYLIVMDDMWDIKACDMVKRFLP  288

Query  898   DDSNGSRILLTTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLPPEIEEI  1074
             D++NGSRIL+TTRL ++AV  G  G Y  NL  L  ++SW L  +K+      P E+E  
Sbjct  289   DNNNGSRILVTTRLMKLAVDIGSRGPYQLNL--LEKSQSWDLLREKIFAEERCPDELEGT  346

Query  1075  GKRIVNKCRGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYN  1254
             GK I  KC GLPLA+ V AG+L+K+K + E+W SI   +   + +   + C  IL LSYN
Sbjct  347   GKSIAKKCNGLPLALVVIAGVLAKSK-TKEHWVSIEKDVTSAVNNQDDESCMKILLLSYN  405

Query  1255  NLPYHLKACFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDR  1434
             NLP HLK CFLYF +FP+    I  + L+ LW+ EGF+ +   +SLEE   +YL+DLIDR
Sbjct  406   NLPIHLKPCFLYFAVFPE-DHIIKVERLVRLWVAEGFIRQCGHKSLEEIGEEYLEDLIDR  464

Query  1435  NLVLISKLSFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSEN--VIELGDTEPLFE  1608
             NL+L+   S  G +  C +HD+L +LC RE +K+ F+ +F ++  N  ++      P   
Sbjct  465   NLILVDWRSVTGEVTDCHIHDVLSNLCRREAQKDNFIFSFARKLYNPDILTFMKITPRLS  524

Query  1609  Y-ANRWLTFRTTYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDL  1785
                 +W   + T  +P  S       +R+LL F    GAS    + R    F ++RVLD+
Sbjct  525   INGGKW---KGTKHKPYTSQI----PTRSLLCF--SKGASTDYTTRR----FPLLRVLDV  571

Query  1786  VEISFDEAPTFDISDLILLRYLA-LGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsde  1962
             V+I     P  +I  LI  RY++ +G +     +    +LQTL V               
Sbjct  572   VDI----YPKDEILQLIYSRYVSCMGLMMLPSSISRLWSLQTLFVD--------------  613

Query  1963  eiGSKWLQG-LWKSQSLRFIK------YPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKEF  2121
               G+  L G +W+   LR ++         P P +  +I + + L TL  V    C++  
Sbjct  614   --GALILPGEIWQMPQLRHVEANSIILPDPPPPDNVQKIILLENLQTLSGVVDFECSEAV  671

Query  2122  VLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQSL  2301
             + +IPNVK L I C  I +        NL  L KLE+L ++         + +  FP SL
Sbjct  672   INRIPNVKKLEIVCGTIGS----NCLRNLGLLHKLEQLYLKLNTGTSCCGEIV--FPSSL  725

Query  2302  KELKIVGTELGWEAITIISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAKLK  2481
             KEL +   ++ WE ++++  LPNL+ L+L +   +G++W+  +G F +LKFL+I   +L+
Sbjct  726   KELMLSECKIPWEDMSVVGSLPNLQVLELRKNAAIGQKWIPKEGEFTRLKFLWIHECELE  785

Query  2482  NWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPS-LVESAKDIQEEQ  2658
              WE  + HFP LE+L L  C NL +IP  F +I  L+ I L     + L+ SA +I E +
Sbjct  786   IWEADNTHFPCLEQLHL-GCLNLIEIPLDFAEILPLRGINLHHYSSNDLLASANEISERR  844

Query  2659  SSYGNDQL  2682
              +   D L
Sbjct  845   ENLDYDAL  852



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score =   363 bits (931),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 304/955 (32%), Positives = 460/955 (48%), Gaps = 155/955 (16%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             MAY  +TSL+RT+  Q +E     +  + ++++ LR  L          EK  NV+   +
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLESLRAIL----------EKSCNVTGDHE  49

Query  259   DVI---ARVKDISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLIEQ  411
             ++      + ++++  ED ++SE   +       ER      +  +L++  E I+  ++Q
Sbjct  50    ELTILEVEILEVAYTTEDMVDSESRSVFLAQNLEERNRAMWEIFFVLEQALECIDSTVKQ  109

Query  412   -RNTTQMLSSYNPGQSNQEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQERQVI  588
                T+  +    P  S+   +        Q + IMVG   E E   + L++   +E +V+
Sbjct  110   WMATSDSMKDLKPQTSSLVSLPDHAFE--QPENIMVGRENEFEMMLDQLVR-GGRELEVV  166

Query  589   SIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTDKEI  768
             SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    +   D + 
Sbjct  167   SIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQ-  225

Query  769   NEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEV  948
                     LA+++++ L  +RYL+V+DDIW ++ WD ++ CFPD   GSRILLTTR  EV
Sbjct  226   --------LADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEV  277

Query  949   AVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCRGLPLA  1116
             A Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC GLPLA
Sbjct  278   AEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKCGGLPLA  334

Query  1117  ITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFG  1296
             ITV AGLLSK  ++++ WQ++A  ++  +++DL  +C  +L LSY++LP HLK CFLYF 
Sbjct  335   ITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFA  394

Query  1297  IFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNI  1476
             IF +  R I    L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I  LSF G I
Sbjct  395   IFAEDER-ISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKI  453

Query  1477  KTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPK  1656
             ++C +HD+  +LCLRE +   FV+    +S       D     +   R    R+      
Sbjct  454   ESCGMHDVTRELCLREARNMNFVNVIRGKS-------DQNSCAQSMQRSFKSRS------  500

Query  1657  FSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDEAPTF--  1818
                +   HK   L +       S + +   + V    SFK++RVLDL     +  P F  
Sbjct  501   ---RIRIHKLEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDL---GLNTWPIFPS  554

Query  1819  DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeeiGSKWLQ  1986
              +  LI LRYL+L   ++   L+ +      + + I+  P S               +LQ
Sbjct  555   GVLSLIHLRYLSL---RFNPCLQQYQGSKEAVPSSIIDIPLSISSLC----------YLQ  601

Query  1987  GLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLY--WVPYLR------------------  2106
                   +L F  Y YPF I   EI     L TL   W  YLR                  
Sbjct  602   TF--KLNLPFPSY-YPF-ILPSEILTMPQLRTLCMDW-NYLRSHEPTENRLVLKNLQCLN  656

Query  2107  ------CTKEFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-----------  2235
                   CT  F    PN+K L +         ++  +D   YL +LE+L           
Sbjct  657   QLNPRYCTGSFFRLFPNLKKLQVFGVPEDFRNSQDLYD-FRYLYQLEELTFRLYYPYAAC  715

Query  2236  IVEDIESEQFELQSINSFPQSL--KELKIVGTELGWEAITIISMLP-NLESLKLLQAYEM  2406
              +++        Q    F   +  KE+   GT      +      P NL+SL     + +
Sbjct  716   FLKNTAPSGSTPQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFRGEFSV  775

Query  2407  GEEWVTGDGGFPKLK-------------------------FLYISGAKLKNWETMSDHFP  2511
               + ++  G  PKL+                         FL++    ++ W   SDHFP
Sbjct  776   AWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLNFLFLDDVYIRYWRASSDHFP  835

Query  2512  VLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
              LERL L  C NL+ IP  F DITTL LI++  C  S+V SAK IQ++ Q +YG+
Sbjct  836   YLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQQDIQDNYGS  890



>ref|XP_006346790.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=890

 Score =   362 bits (928),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 291/853 (34%), Positives = 438/853 (51%), Gaps = 101/853 (12%)
 Frame = +1

Query  295   AEDEIESEVMEIISNGASHERLHQILQRLAEDIEGLIEQRNTTQM----LSSYNPGQSNQ  462
             AED +E ++ +I+  G+S      ILQ   +D+  L E+ +TT+     + S++  Q  +
Sbjct  71    AEDVVEMKISQIV-RGSSWT--FGILQH--QDLLPLFEKMDTTKKQVMEIVSHHADQVLE  125

Query  463   ---EHIIAGGASK--LQDDAIMVGHAQELERTKEMLLQCSTQERQVISIVGMGGIGKTTM  627
                + +I   +++  + +D I+ G   +LE     L +   ++  V++I GMGGIGKTT+
Sbjct  126   LYGDSLIGTYSTRYPMLEDDIVQGLDDDLEIIINRL-KGRPRDLDVVTISGMGGIGKTTL  184

Query  628   AKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ----MTDKEINEVKSTAEL  795
             AKK YD  +IR  F +L W T+SQ++  R +L +   C+ +    +  K+ N++    +L
Sbjct  185   AKKAYDQVTIRYHFDILAWVTISQEFRARNVLLEALHCIPKKSVSVNAKDYNKMDDN-QL  243

Query  796   ANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRLKEVAVYSGCSGK  975
             A  V++ L  QRYL VVDDIW +  WD L+R FPD +N SR+LLTTR  EVA+Y+     
Sbjct  244   AELVQKSLKGQRYLFVVDDIWSTDVWDSLRRIFPDCNNRSRVLLTTRETEVAMYANTCSP  303

Query  976   YVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPLAITVAAGLLSKT  1149
             +   +  L+    W L   K+     + PPE+EEIGK IV KC+GLPL I+V AG LSK 
Sbjct  304   H--KMRLLSLENGWRLLCDKVFGPKRDHPPELEEIGKVIVEKCQGLPLTISVIAGHLSKI  361

Query  1150  KRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYFGIFPKVRREIPT  1329
              R++E W+ +A  ++  + S   D+C  +L LSY++LP  LK CFL  G FP+   ++ T
Sbjct  362   ARTLECWKDVARNLSEIIASH-PDKCLGVLGLSYHHLPNRLKPCFLSMGDFPE-DFQVET  419

Query  1330  KDLLNLWITEGFVME--DSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGNIKTCRLHDLL  1503
               L+ +WI EGF++   ++G++LEE A+ YL+DLI RNL+   K  F   IKTC +HDLL
Sbjct  420   WRLIQIWIAEGFIIRTFENGKTLEEVAIDYLEDLISRNLIQARKRRFNCEIKTCGIHDLL  479

Query  1504  FDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQPKFSDKYNFHK  1683
              + CL E +  K +     R         T P   +  R  +F     QP+F    +F +
Sbjct  480   REFCLIEAEMTKHMHVERTRP--------TLPTQRHNARHFSF-----QPRFYPFADFSE  526

Query  1684  -----SRTLLFFFGVSGASG--------LPVSWRQNVS------FKMIRVLDL--VEISF  1800
                  +R++  F  +             LP+    +++      F ++RVL +   ++ F
Sbjct  527   ILPTVARSIFLFSHLDQPLEPYIKLLMILPIYRHNHITHDFFSRFNLLRVLAIFNTDVWF  586

Query  1801  DEAPTFDISDLILLRYLALG-TIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSK  1977
             +  P   I+ L  LRYL     +K    +   +NLQTLI                  G  
Sbjct  587   ESFPLV-ITTLFHLRYLQFPFHVKIPGSISKLNNLQTLICS----------------GHT  629

Query  1978  WLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDT----LHTLYWVPYLRCTKEFVLKIPNVK  2145
               + +W  ++LR+I    P  + +  I    T    L  L  V Y  CTKE    IPN+K
Sbjct  630   LPREIWMMKNLRYICLEVPSHLPSPRIGSLVTGMSNLEELSGVCYFSCTKEVFSGIPNLK  689

Query  2146  VLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSIN--SFPQSLKELKIV  2319
             VL I    I         D    L+ L KL V  +    +    I    FP SL+ L + 
Sbjct  690   VLIIHLPHISKGIPHHQLD----LSGLTKLEVFKLYGAPYLRDPIKRFGFPTSLRRLSLS  745

Query  2320  GT-ELGWEAITIISM-LPNLESLKLLQAYE-------MGEEWVTGDGG-FPKLKFLYISG  2469
                   W  ++  +M LPNLE LKL+  YE       + +EW   D   F  LK L +SG
Sbjct  746   QCCYFDWADLSSTAMMLPNLEVLKLIH-YEPLSNECRLSDEWRMSDKDVFKSLKLLLLSG  804

Query  2470  AKLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQ  2649
               LK+WE  SD+FP+L+RL L  C +L++IP  F +I TL+ +EL DC  +  +SAK+I+
Sbjct  805   TNLKHWEASSDNFPILKRLVLKKCRHLQEIPADFGEICTLESVELHDCSATAEDSAKNIE  864

Query  2650  EEQSSYGNDQLVV  2688
              EQ   GN+ L V
Sbjct  865   REQEDMGNNILKV  877



>ref|XP_011072171.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=882

 Score =   361 bits (927),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 294/911 (32%), Positives = 458/911 (50%), Gaps = 86/911 (9%)
 Frame = +1

Query  82    AYVGLTSLIRTVE-LQFLEPRPILVVDYKDEIQCLRQKLCHlkalleesekklNVSQAEK  258
             AY  L SL+  ++ +Q L  R  L +D K++IQ L++K+               +S   +
Sbjct  5     AYASLVSLMDVLDNVQHLGRRRRLHLD-KEQIQNLQEKV--KLLQDFLEVHSQRISPEME  61

Query  259   DVIARVKDISFRAEDEIESEVMEIISNGASHERLHQI-LQRLAEDIEGLIEQRNT-TQML  432
             +++ ++  +   A+D I+  V   +   +  + LH I L    + I+ +IE+ ++ T+ L
Sbjct  62    NLVRQLLVLVDDADDIIDFHVANQLREESQDKSLHTIALTSFCQYIDKIIEKIDSITEKL  121

Query  433   ----SSYNPGQSNQEHI-IAGGASKL--QDDAIMVGHAQELERTKEMLLQCSTQERQVIS  591
                   +   Q  Q  + +  G++ L   D+  M+G  + L +  + L +      Q++ 
Sbjct  122   MMVKEEWIDVQEQQPEVSMPVGSTSLPYSDENTMLGFDERLLQVVDELTR-DESNLQILP  180

Query  592   IVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQ--------DLCGCVA  747
             IVGMGGIGKTT+A+  +D P I +RF +  W T+SQ Y +++ILQ        D+ G   
Sbjct  181   IVGMGGIGKTTLAQNAHDHPYIVNRFDIRIWFTISQQYSVQKILQKYFFNDNKDIIGSTD  240

Query  748   QMTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILL  927
             Q+           AEL  ++ + L  +RYL+++DD+W  + W+D     P++ N SR+L+
Sbjct  241   QL---------GVAELGERLHKLLFGKRYLIIMDDVWSIKTWEDFMLYLPNNGNKSRVLV  291

Query  928   TTRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL-GSINLP-PEIEEIGKRIVNKCR  1101
             TTRL EVA    C   +   + FL+ ++SW L   K+    + P PE+EEIG+ I   CR
Sbjct  292   TTRLLEVA-RPLCFDNHYFTVDFLDEDKSWDLLCGKVFAQKSCPYPELEEIGREIAKGCR  350

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPL+I V  GLL+K+ ++ E W  +A  +   +     + C  IL+LSYN+L  HLK C
Sbjct  351   GLPLSIVVIGGLLAKSNKTREYWGFVAKNVTSFVNYGDDEYCLKILSLSYNSLSIHLKPC  410

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLY  +FP+  +EI   +L  LWI+EGF+    G+SLEE A +YL+DL DRNL+ I K +
Sbjct  411   FLYTRVFPE-DQEIRAPELKKLWISEGFLKPVGGKSLEEAAEEYLKDLTDRNLIFIRKRT  469

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
               GNI+TC +HD+L +LC RE  KE  +     +S+ +      +P F++          
Sbjct  470   RRGNIRTCGVHDILRELCFREYSKEHLIRV--PKSQRIA--FQVQPKFDFC---------  516

Query  1642  YIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV-----SFKMIRVLDL-VEISFD  1803
             ++  +  D+ N    + L+     + AS L      N+       + ++V DL  + SF+
Sbjct  517   FLCGRLPDRLNRIHLKQLVGLRSTTVASSLVCEACNNMYPDLNRLRWVKVFDLDNDQSFE  576

Query  1804  EAPTFDISDLILLRYLALGTIKYVRVLKHHHNLQTLIVKFPNSCRieeidsdeeiGSKWL  1983
               P         LRYLA+       V    + L+  IV FPN+  +       ++   ++
Sbjct  577   TFPQH-----TKLRYLAVQDQHATMV---DYLLEWKIV-FPNTISLLWNLQILDLDLFYM  627

Query  1984  QG--------LWKSQSLRFIK---YPYPFPIDTD----EIPVQDTLHTLYWVPYLRCTKE  2118
                       +W+   LR +    +  P P+  D    +  + + L TL    + RC KE
Sbjct  628   DTHTLVLSSEIWEIPKLRHLNVQSFRLPDPLVNDLEGQDFTILEYLSTLSSEGF-RCIKE  686

Query  2119  FVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDIESEQFELQSINSFPQS  2298
              V +IPN+K L           ++    NL  L KLE L +     E + L    +FP S
Sbjct  687   VVKRIPNLKKLNASYRSYSGDASDCSLSNLVQLNKLESLSL-----EYYSLLENITFPTS  741

Query  2299  LKELKIVGTELGWEAITII-SMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISGAK  2475
             LK+L +   E+ W  +TII S+LPNLE LKL  A+  G+EW   +G F +LK L+IS   
Sbjct  742   LKKLSLSYCEIPWRKMTIISSLLPNLEVLKLNNAFR-GQEWDPSEGEFLRLKVLHISFCD  800

Query  2476  LKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE  2655
             L  W     HFP L+ L+L     LE+IP    DI TL  I L+ C  S V SA +I  E
Sbjct  801   LMLWGAEDIHFPNLQYLSLEGMFKLEEIPLSIGDIATLHSIHLQFCGESAVNSATEILTE  860

Query  2656  QSSYGNDQLVV  2688
             Q   GN+ L V
Sbjct  861   QKENGNESLQV  871



>ref|XP_011072558.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=742

 Score =   357 bits (917),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 265/734 (36%), Positives = 384/734 (52%), Gaps = 78/734 (11%)
 Frame = +1

Query  580   QVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQMTD  759
             +++ IVGMGGIGKT +A+ +Y++P I   F    W TVSQ+Y++R IL +L  C  +   
Sbjct  29    RIVPIVGMGGIGKTALARNVYENPLIVQYFDTCAWVTVSQEYNIREILLELV-CPER---  84

Query  760   KEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTTRL  939
             KE  E+ S   L   + R L  +RYL+V+DD+W    WD ++  FP ++  SRI++TTRL
Sbjct  85    KESKEMLSGDALGEMLYRSLCGRRYLIVMDDMWSIEAWDKIKLFFPSNNKESRIMITTRL  144

Query  940   KEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL--GSINLPPEIEEIGKRIVNKCRGLPL  1113
               +A+    SG     + FL  NESW LF   +     + P E+EEIGKR+   C+GLPL
Sbjct  145   SNLAL--QISGSRGLTMNFLKENESWDLFCNTVFGEKSSCPLELEEIGKRVAKNCKGLPL  202

Query  1114  AITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKACFLYF  1293
             ++ +  GLL+K++++   W+ IA  ++  +  + + +C  +L +SY  LP HLK CFLY 
Sbjct  203   SLILIGGLLAKSEKTRNYWEYIAENLSSIVNLEDNKRCLRVLYMSYLELPIHLKPCFLYM  262

Query  1294  GIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLSFIGN  1473
             G+FP+ +    ++ L  LW+ E F+   SG+SLEE A +YL+DLIDRNL+++ +L   G 
Sbjct  263   GVFPEDKVTYVSR-LRKLWVAERFLKPISGKSLEEVAGEYLKDLIDRNLIIVHRLGSSGK  321

Query  1474  IKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTTYIQP  1653
             I++C++HDLL DLCLRE +KEKF+ +        +E+G  + +          R    Q 
Sbjct  322   IRSCKMHDLLRDLCLREAQKEKFLCS--------LEIGQAKTIHR--------RIVVHQN  365

Query  1654  KFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV-------SFKMIRVL------DLVEI  1794
                +KY+  K         +  ++ LP S   +V       S +++RVL      DL  +
Sbjct  366   SSMEKYDTSK---------ILHSAQLPRSLTCDVQEAFPLDSLRLLRVLKQTYSEDLHYL  416

Query  1795  SF-DEAPTFDISDLILLRYLALG-----TIKYVRVLKHHHNLQTLIVKFPNSCRieeids  1956
                D  P   I  L+ L+YLA       +  +   +    NLQTLIVK  +   I     
Sbjct  417   RRKDWYPIEAIFKLVNLQYLAFSAEMNLSSSFPSSMHLLWNLQTLIVKRTDGQLIYAPPE  476

Query  1957  deeiGSKWLQGLWKSQSLRFIKYP---YPFPIDT----DEIPVQDTLHTLYWVPYLRCTK  2115
                        +WK   LR ++ P    P P  T    DE  V   L  +  +   +C +
Sbjct  477   -----------IWKMHQLRHVQVPGLGLPDPPTTTATKDEF-VLPNLQKMSQIKNFKCAE  524

Query  2116  EFVLKIPNVKVLGIKCSEIRAFQTETWWDNLHYLTKLEKLIVEDI-ESEQFELQSINSFP  2292
               V++IPN++ L I  SE    Q     +NL YL KLE L V  I E    +L+ + SFP
Sbjct  525   TVVVRIPNIRKLHIFYSESSISQYCP--ENLGYLQKLESLYVSLISEVRGIDLERL-SFP  581

Query  2293  QSLKELKIVGTELGWEAITI-ISMLPNLESLKLLQAYEMGEEWVTGDGGFPKLKFLYISG  2469
              SLK+L + G    W+ I   I  LP L+ LKL      G  W T +G F  L+FL ++ 
Sbjct  582   HSLKKLTLWGGGFQWKQINAKIGSLPLLQGLKLYNDSVKGGIWNTVEGQFCSLRFLQMTC  641

Query  2470  A-KLKNWETMSDHFPVLERLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDI  2646
               KL  W   S HFP L  L L     L+KIP  F +I TL+LIEL  C  S V SAKDI
Sbjct  642   IYKLNRWRVDSSHFPCLNILRLVELRKLQKIPSSFAEIQTLELIELYMCRDSAVLSAKDI  701

Query  2647  QEEQSSYGNDQLVV  2688
              E+Q  +GN    V
Sbjct  702   AEQQEEFGNHDFRV  715



>gb|AEW48193.1| disease resistance protein RGH4 [Solanum chacoense]
Length=914

 Score =   362 bits (928),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 301/952 (32%), Positives = 468/952 (49%), Gaps = 145/952 (15%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            V  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLESLRAILEKSCNIM-----------VDH  48

Query  250   AEKDVI-ARVKDISFRAEDEIESEVMEIISNGASHERLHQI------LQRLAEDIEGLIE  408
              E  ++   + ++++  ED ++SE   +       ER   +      L++  E I   ++
Sbjct  49    EELTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFFLEQALECIASTVK  108

Query  409   Q-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCSTQ  573
             Q   T+  +    P  S+     EH +       Q + IMVG   E E   + L++   +
Sbjct  109   QWMATSDSMKDLKPQTSSLVSLPEHDVE------QPENIMVGRENEFEMMLDQLVR-GGR  161

Query  574   ERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQM  753
             E +V+SIVGMGGIGKTT+A K+Y DP I SRF +    TVSQ+Y +R ++    G ++ +
Sbjct  162   ELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVRNVI---LGLLSSI  218

Query  754   TDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLTT  933
             +D+  N+      LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLTT
Sbjct  219   SDEPENQ------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTT  272

Query  934   RLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKCR  1101
             R  EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC 
Sbjct  273   RNLEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFETEGSYS--PEFENIGKQIALKCG  329

Query  1102  GLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKAC  1281
             GLPLAITV AGLLSK  + ++ WQ IA  ++  +++D   QC  +L LSY++LP HLK C
Sbjct  330   GLPLAITVTAGLLSKIGQRLDEWQRIAENLSSVVSTDPEAQCMRVLALSYHHLPSHLKPC  389

Query  1282  FLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKLS  1461
             FLYF IF +    I    L+ LW  EGF+ E+ G+S+EE A   + +L+DR+L+ I KLS
Sbjct  390   FLYFAIFAE-DEGIFVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHKLS  448

Query  1462  FIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRTT  1641
             F G I++C +HD+  +LCLRE +   FV+    +S+        +  F+  +R   ++  
Sbjct  449   FDGEIQSCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKKRSRISIYKEE  508

Query  1642  YIQ-PKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNVSFKMIRVLDLVEISFDEAPTF  1818
              +   + S+ ++   SR         G + + +     +SFK++RVLDL    +   P F
Sbjct  509   ELAWCRNSEAHSIIMSR---------GFNCITL----ELSFKLVRVLDL---GWTPCPIF  552

Query  1819  --DISDLILLRYLAL----------GTIKYVR--------VLKHHHNLQTLIVKFPNSCR  1938
                +  LI LRYL+L          G+I+ V          +     LQT  +  P +  
Sbjct  553   PSGVLSLIHLRYLSLCFNPCLLQYRGSIEAVPSSIIDIPLSISRLCYLQTFKLYLPFTDS  612

Query  1939  ieeidsdeeiGSKWLQGLWKSQSLRFIKYPYPFPIDTDEIPVQDTLHTLYWVPYLRCTKE  2118
                I   E +    L+ L       +++   P    T+   V  +L  L  +    CT  
Sbjct  613   YPFILPSEILTMPQLRKL--RMGWNYLRSHEP----TENRLVLKSLQCLNQLNPRNCTGS  666

Query  2119  FVLKIPN---VKVLGIKCSEIRAFQTETWWDNLHYLTKLEKL-----------IVEDIES  2256
             F    PN   +KV G++      F+      +  YL +LEKL           ++E    
Sbjct  667   FFRLFPNLKKLKVFGVQ----EDFRNHKDLYDFRYLYQLEKLAFRVYYPGAACVLESTAP  722

Query  2257  EQFELQSINSFPQSLKELKIVGTELGWEAITIISMLP-------NLESLKLLQAYEMGEE  2415
                  Q    F   L   K    +    A     +LP       NL+SL     + +  +
Sbjct  723   SGSTPQDPLRFQTKLLYKKTKFGKAAPPADVPTLLLPPPDAFPQNLKSLTFSGEFFLASK  782

Query  2416  WVTGDGGFPKL-------------------------KFLYISGAKLKNWETMSDHFPVLE  2520
              ++  G  PKL                         KFL++    ++ W   SDHFP LE
Sbjct  783   DLSIVGKLPKLEVLKLSDNAVIGEEWEVVEEGFPHLKFLFLDNVYIRYWRASSDHFPYLE  842

Query  2521  RLALHHCHNLEKIPEGFTDITTLQLIELKDCFPSLVESAKDIQEE-QSSYGN  2673
             RL L +C++L+ IP  F DITTL LI++  C  S+ +SAK IQ++ Q +YG+
Sbjct  843   RLFLRNCYDLDSIPPDFADITTLTLIDISSCRQSVGKSAKQIQQDIQDNYGS  894



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score =   362 bits (929),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 308/963 (32%), Positives = 456/963 (47%), Gaps = 172/963 (18%)
 Frame = +1

Query  79    MAYVGLTSLIRTVELQFLEPRPILVVDYKDEIQCLR---QKLCHlkalleesekklNVSQ  249
             MAY  +TSL+RT+  Q +E     +  + ++++ LR   +K C++            +  
Sbjct  1     MAYAAVTSLMRTIH-QSMELTGCDLQPFYEKLKSLRAILEKSCNI------------MGD  47

Query  250   AEKDVIARVK--DISFRAEDEIESEVMEIISNGASHER------LHQILQRLAEDIEGLI  405
              E   I  V+  ++++  ED ++SE   +       ER      +  +L++  E I+  +
Sbjct  48    HEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTV  107

Query  406   EQ-RNTTQMLSSYNPGQSN----QEHIIAGGASKLQDDAIMVGHAQELERTKEMLLQCST  570
             +Q   T+  +    P  S+     EH +       Q + IMVG   E E   + L +   
Sbjct  108   KQWMATSDSMKDLKPQTSSLVSLPEHDVE------QPENIMVGRENEFEMMLDQLAR-GG  160

Query  571   QERQVISIVGMGGIGKTTMAKKIYDDPSIRSRFHLLGWATVSQDYDLRRILQDLCGCVAQ  750
             +E +V+SIVGMGGIGKTT+A K+Y DP I SRF +   ATVSQ+Y +R +L  L    + 
Sbjct  161   RELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSD  220

Query  751   MTDKEINEVKSTAELANKVRRRLMRQRYLLVVDDIWGSRGWDDLQRCFPDDSNGSRILLT  930
               D +         LA+++++ L  +RYL+V+DDIW +  WDD++ CFPD  NGSRILLT
Sbjct  221   EPDDQ---------LADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLT  271

Query  931   TRLKEVAVYSGCSGKYVCNLPFLNSNESWMLFSQKL----GSINLPPEIEEIGKRIVNKC  1098
             TR  EVA Y+  SGK   ++  +N +ESW L  +K+    GS +  PE E IGK+I  KC
Sbjct  272   TRNVEVAEYAS-SGKPPHHMRLMNFDESWNLLHKKIFEKEGSYS--PEFENIGKQIALKC  328

Query  1099  RGLPLAITVAAGLLSKTKRSVENWQSIASAMNLPMTSDLHDQCSTILTLSYNNLPYHLKA  1278
              GLPLAITV AGLLSK  + ++ WQ I   ++  +++D   QC  +L LSY++LP HLK 
Sbjct  329   GGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKP  388

Query  1279  CFLYFGIFPKVRREIPTKDLLNLWITEGFVMEDSGRSLEEGAMKYLQDLIDRNLVLISKL  1458
             CFLYF IF +   +I   +L+ LW  EGF+ E+ G+S+EE A   + +LIDR+L+ I   
Sbjct  389   CFLYFAIFTE-DEQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNF  447

Query  1459  SFIGNIKTCRLHDLLFDLCLREVKKEKFVSAFHQRSENVIELGDTEPLFEYANRWLTFRT  1638
             SF G I++C +HD+  +LCLRE +   FV+    +S       D     +   R    R+
Sbjct  448   SFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKS-------DQNSCAQSMQRSFKSRS  500

Query  1639  TYIQPKFSDKYNFHKSRTLLFFFGVSGASGLPVSWRQNV----SFKMIRVLDLVEISFDE  1806
                      +   HK   L +       S + +   + V    SFK++RVLDL     + 
Sbjct  501   ---------RIRIHKVEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDL---GLNT  548

Query  1807  APTF--DISDLILLRYLALGTIKYVRVLKHHHN----LQTLIVKFPNSCRieeidsdeei  1968
              P F   +  LI LRYL+L   ++   L+ +      + + I+  P S            
Sbjct  549   WPIFPSGVLSLIHLRYLSL---RFNPCLQQYQGSKEAVPSSIIDIPLSISSLC-------  598

Query  1969  GSKWLQGLWKSQSLRFIKYPYPFPIDTDE