BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25303_g1_i1 len=2398 path=[2376:0-174 2551:175-198 2575:199-223
2600:224-362 2739:363-586 2963:587-623 @3000@!:624-1176
3553:1177-1898 4275:1899-1900 4277:1901-2089 4466:2090-2151
4528:2152-2397]

Length=2398
                                                                      Score     E

ref|XP_007224874.1|  hypothetical protein PRUPE_ppa022710mg            1068   0.0     
emb|CDP12483.1|  unnamed protein product                               1062   0.0     
ref|XP_009618436.1|  PREDICTED: cycloartenol synthase-like isofor...   1055   0.0     
dbj|BAA33462.1|  Oxidosqualene Cyclase                                 1049   0.0     Panax ginseng [Chinese ginseng]
ref|XP_004240118.1|  PREDICTED: cycloartenol synthase-like             1046   0.0     
ref|XP_006360676.1|  PREDICTED: cycloartenol synthase-like             1045   0.0     
ref|XP_009370029.1|  PREDICTED: cycloartenol Synthase-like             1036   0.0     
ref|XP_006474339.1|  PREDICTED: cycloartenol synthase 2-like isof...   1031   0.0     
ref|XP_006453168.1|  hypothetical protein CICLE_v10007532mg            1027   0.0     
ref|XP_004299757.1|  PREDICTED: cycloartenol synthase-like             1025   0.0     
ref|XP_011019952.1|  PREDICTED: cycloartenol synthase 2-like           1007   0.0     
ref|XP_008223939.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...   1006   0.0     
ref|XP_002309028.2|  hypothetical protein POPTR_0006s07890g            1004   0.0     Populus trichocarpa [western balsam poplar]
emb|CBD47302.1|  cycloartenol synthase                                  999   0.0     Dioscorea zingiberensis
emb|CAM91422.1|  cycloartenol synthase                                  996   0.0     Dioscorea zingiberensis
gb|EYU23540.1|  hypothetical protein MIMGU_mgv1a020935mg                994   0.0     
ref|XP_011094034.1|  PREDICTED: cycloartenol Synthase                   991   0.0     
gb|EYU26563.1|  hypothetical protein MIMGU_mgv1a001814mg                991   0.0     
ref|XP_010271332.1|  PREDICTED: cycloartenol Synthase isoform X2        990   0.0     
ref|XP_010271331.1|  PREDICTED: cycloartenol Synthase isoform X1        990   0.0     
ref|XP_011078187.1|  PREDICTED: cycloartenol synthase-like isofor...    989   0.0     
ref|XP_010541955.1|  PREDICTED: cycloartenol synthase                   989   0.0     
gb|AIW81530.1|  cycloartenol synthase protein                           989   0.0     
gb|ADC84219.1|  putative 2,3 oxidosqualene cyclase                      987   0.0     Actaea racemosa
gb|AIU41742.1|  cycloartenol synthase                                   986   0.0     
gb|AIK19224.1|  triterpene synthase                                     985   0.0     
ref|XP_010048521.1|  PREDICTED: cycloartenol synthase-like              984   0.0     
ref|XP_011078186.1|  PREDICTED: cycloartenol synthase-like isofor...    984   0.0     
ref|XP_006296684.1|  hypothetical protein CARUB_v10013036mg             983   0.0     
ref|XP_009409584.1|  PREDICTED: cycloartenol synthase-like              983   0.0     
gb|EYU26562.1|  hypothetical protein MIMGU_mgv1a001674mg                983   0.0     
ref|XP_007019803.1|  Cycloartenol synthase 1 isoform 2                  983   0.0     
ref|XP_007019802.1|  Cycloartenol synthase 1 isoform 1                  983   0.0     
dbj|BAE53431.1|  cycloartenol synthase                                  982   0.0     Lotus japonicus
ref|XP_010677527.1|  PREDICTED: cycloartenol synthase 2                 981   0.0     
ref|XP_002883756.1|  cycloartenol synthase                              981   0.0     
emb|CDP12480.1|  unnamed protein product                                981   0.0     
ref|XP_007153003.1|  hypothetical protein PHAVU_004G178300g             981   0.0     
ref|XP_010467143.1|  PREDICTED: cycloartenol synthase-like              980   0.0     
ref|XP_010244585.1|  PREDICTED: cycloartenol synthase 2 isoform X1      980   0.0     
gb|KHN32929.1|  Cycloartenol synthase                                   979   0.0     
ref|XP_010488811.1|  PREDICTED: cycloartenol synthase-like              979   0.0     
ref|XP_010413093.1|  PREDICTED: cycloartenol synthase                   979   0.0     
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                   979   0.0     
ref|XP_008223938.1|  PREDICTED: cycloartenol synthase 2                 979   0.0     
sp|Q8W3Z3.1|CAS2_BETPL  RecName: Full=Cycloartenol synthase 2           979   0.0     Betula platyphylla [Asian white birch]
gb|KFK39919.1|  hypothetical protein AALP_AA3G306200                    978   0.0     
ref|XP_009764154.1|  PREDICTED: cycloartenol Synthase-like              978   0.0     
ref|XP_009370034.1|  PREDICTED: cycloartenol synthase 2                 978   0.0     
ref|XP_009345284.1|  PREDICTED: cycloartenol synthase 2-like            977   0.0     
ref|XP_007225240.1|  hypothetical protein PRUPE_ppa001844mg             977   0.0     
ref|XP_009362029.1|  PREDICTED: cycloartenol synthase 2-like            977   0.0     
ref|XP_003610947.1|  Cycloartenol synthase                              976   0.0     
ref|XP_006396090.1|  hypothetical protein EUTSA_v10002412mg             976   0.0     
ref|XP_002264289.1|  PREDICTED: cycloartenol Synthase                   976   0.0     Vitis vinifera
gb|AAC04931.1|  cycloartenol synthase                                   975   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAA23533.1|  cycloartenol synthase                                  975   0.0     Pisum sativum [garden pea]
ref|XP_009136183.1|  PREDICTED: cycloartenol synthase                   974   0.0     
ref|XP_006396089.1|  hypothetical protein EUTSA_v10002412mg             974   0.0     
ref|XP_006850984.1|  hypothetical protein AMTR_s00025p00210690          974   0.0     
ref|NP_178722.1|  cycloartenol synthase                                 974   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AIY33888.1|  cycloartenol synthase                                   972   0.0     
ref|XP_009620777.1|  PREDICTED: cycloartenol Synthase-like isofor...    972   0.0     
ref|XP_006372242.1|  cycloartenol synthase family protein               972   0.0     
gb|KHN32928.1|  Cycloartenol synthase                                   972   0.0     
sp|Q9SXV6.1|CAS1_GLYGL  RecName: Full=Cycloartenol synthase             971   0.0     Glycyrrhiza glabra
ref|XP_002308131.2|  cycloartenol synthase family protein               970   0.0     Populus trichocarpa [western balsam poplar]
sp|O82139.1|CAS1_PANGI  RecName: Full=Cycloartenol Synthase             970   0.0     Panax ginseng [Chinese ginseng]
gb|KDP27754.1|  hypothetical protein JCGZ_19783                         969   0.0     
emb|CDX93093.1|  BnaA03g38150D                                          969   0.0     
gb|AGK62447.1|  cycloartenol synthase                                   969   0.0     
emb|CDY50938.1|  BnaC03g74380D                                          968   0.0     
ref|XP_008391430.1|  PREDICTED: cycloartenol synthase 2 isoform X1      968   0.0     
ref|XP_003517615.1|  PREDICTED: cycloartenol synthase-like              968   0.0     
ref|XP_002269849.1|  PREDICTED: cycloartenol synthase                   966   0.0     Vitis vinifera
gb|ABX75046.1|  cycloartenol synthase 1                                 966   0.0     Polygala tenuifolia [Chinese senega-root]
ref|XP_010067808.1|  PREDICTED: cycloartenol synthase 2-like isof...    965   0.0     
ref|XP_004513124.1|  PREDICTED: cycloartenol synthase-like              965   0.0     
dbj|BAA86933.1|  oxidosqualene cyclase                                  965   0.0     Taraxacum officinale [dandelion]
ref|XP_004159000.1|  PREDICTED: cycloartenol synthase-like              964   0.0     
ref|XP_004141754.1|  PREDICTED: cycloartenol synthase-like              964   0.0     
ref|XP_004299756.1|  PREDICTED: cycloartenol synthase-like              964   0.0     
gb|ABY60426.1|  cycloartenol synthase                                   964   0.0     Panax notoginseng [san-qi]
gb|AAS83469.1|  cycloartenol synthase                                   963   0.0     Bupleurum kaoi
ref|XP_006362808.1|  PREDICTED: cycloartenol Synthase-like isofor...    962   0.0     
gb|AEO27878.1|  cycloartenol synthases                                  962   0.0     
sp|Q9SLP9.1|CAS1_LUFAE  RecName: Full=Cycloartenol synthase; Shor...    962   0.0     Luffa aegyptiaca [dishcloth gourd]
gb|AFS49705.1|  cycloartenol synthase                                   962   0.0     
ref|XP_008462186.1|  PREDICTED: cycloartenol synthase                   962   0.0     
ref|XP_010906067.1|  PREDICTED: cycloartenol synthase-like              961   0.0     
gb|AGC82085.1|  cycloartenol synthase protein                           961   0.0     
ref|XP_006340479.1|  PREDICTED: cycloartenol Synthase-like              961   0.0     
ref|XP_010927167.1|  PREDICTED: cycloartenol synthase-like              960   0.0     
ref|XP_009102615.1|  PREDICTED: cycloartenol synthase-like              960   0.0     
ref|XP_008228021.1|  PREDICTED: cycloartenol synthase                   960   0.0     
gb|AEM42981.1|  cycloartenol synthase                                   960   0.0     
ref|XP_011019951.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    959   0.0     
dbj|BAB83253.1|  cycloartenol synthase                                  959   0.0     Cheilocostus speciosus [crepe-ginger]
ref|XP_010067807.1|  PREDICTED: cycloartenol synthase 2-like isof...    958   0.0     
sp|Q6BE25.1|CAS1_CUCPE  RecName: Full=Cycloartenol synthase             958   0.0     Cucurbita pepo
dbj|BAF73929.1|  cycloartenol synthase                                  958   0.0     Rhizophora stylosa
ref|XP_011017592.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    958   0.0     
ref|NP_001233784.1|  cycloartenol synthase                              957   0.0     
ref|XP_006381170.1|  hypothetical protein POPTR_0006s07870g             956   0.0     
ref|XP_004303790.1|  PREDICTED: cycloartenol synthase-like              956   0.0     
ref|XP_010927166.1|  PREDICTED: cycloartenol synthase-like isofor...    956   0.0     
ref|XP_008348400.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    956   0.0     
gb|AFC67276.1|  cycloartenol synthase                                   956   0.0     
gb|AAS01524.1|  cycloartenol synthase                                   956   0.0     Centella asiatica [Asiatic pennywort]
ref|XP_010927164.1|  PREDICTED: cycloartenol Synthase-like isofor...    955   0.0     
ref|XP_008809071.1|  PREDICTED: cycloartenol synthase-like isofor...    955   0.0     
sp|Q2XPU6.1|CAS1_RICCO  RecName: Full=Cycloartenol synthase; Shor...    955   0.0     Ricinus communis
ref|XP_010927163.1|  PREDICTED: cycloartenol synthase-like isofor...    955   0.0     
ref|XP_007214976.1|  hypothetical protein PRUPE_ppa001806mg             955   0.0     
dbj|BAE95410.1|  lanosterol synthase                                    954   0.0     Lotus japonicus
sp|Q8W3Z4.1|CAS1_BETPL  RecName: Full=Cycloartenol synthase             953   0.0     Betula platyphylla [Asian white birch]
ref|XP_010068963.1|  PREDICTED: cycloartenol Synthase-like              952   0.0     
ref|XP_009764017.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    952   0.0     
gb|EYU25760.1|  hypothetical protein MIMGU_mgv1a001797mg                951   0.0     
dbj|BAE95409.1|  oxidosqualene cyclase                                  951   0.0     Lotus japonicus
ref|XP_008453521.1|  PREDICTED: probable oxidosqualene cyclase          949   0.0     
dbj|BAF73930.1|  cycloartenol synthase                                  949   0.0     Kandelia candel
gb|KHG12373.1|  Cycloartenol synthase 2                                 949   0.0     
emb|CDX77512.1|  BnaA07g06500D                                          949   0.0     
sp|E2IUB0.1|CASS_KALDA  RecName: Full=Cycloartenol synthase; Shor...    949   0.0     
gb|AGF87141.1|  cycloartenol synthase                                   948   0.0     
ref|XP_006403308.1|  hypothetical protein EUTSA_v10003155mg             947   0.0     
ref|XP_004166391.1|  PREDICTED: LOW QUALITY PROTEIN: probable oxi...    946   0.0     
sp|Q6BE23.1|OXSC_CUCPE  RecName: Full=Probable oxidosqualene cyclase    945   0.0     Cucurbita pepo
ref|XP_006474653.1|  PREDICTED: cycloartenol Synthase-like              943   0.0     
ref|XP_002877385.1|  hypothetical protein ARALYDRAFT_905658             943   0.0     
ref|XP_010655242.1|  PREDICTED: cycloartenol synthase-like              943   0.0     
ref|XP_010520562.1|  PREDICTED: lanosterol synthase isoform X2          942   0.0     
ref|XP_006408625.1|  hypothetical protein EUTSA_v10001913mg             941   0.0     
ref|XP_002310905.1|  hypothetical protein POPTR_0007s15200g             940   0.0     Populus trichocarpa [western balsam poplar]
dbj|BAA84603.1|  oxidosqualene cyclase                                  940   0.0     Allium macrostemon
ref|XP_002262960.1|  PREDICTED: cycloartenol Synthase-like              939   0.0     Vitis vinifera
ref|XP_004137362.1|  PREDICTED: probable oxidosqualene cyclase-like     939   0.0     
gb|AAG44096.1|AF216755_1  cycloartenol synthase                         938   0.0     Abies magnifica [California red fir]
ref|XP_006646871.1|  PREDICTED: cycloartenol synthase-like              937   0.0     
ref|XP_002453283.1|  hypothetical protein SORBIDRAFT_04g003200          937   0.0     Sorghum bicolor [broomcorn]
gb|KHG27893.1|  Cycloartenol synthase                                   937   0.0     
ref|XP_006484812.1|  PREDICTED: cycloartenol synthase 2-like            937   0.0     
ref|XP_003632939.1|  PREDICTED: cycloartenol synthase-like              937   0.0     
ref|XP_007023625.1|  Cycloartenol synthase 1                            935   0.0     
ref|XP_010520561.1|  PREDICTED: lanosterol synthase isoform X1          935   0.0     
gb|KFK33925.1|  hypothetical protein AALP_AA5G078800                    934   0.0     
gb|ADG60271.1|  cycloartenol synthase                                   934   0.0     
emb|CDX85104.1|  BnaC07g08020D                                          934   0.0     
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g             933   0.0     
ref|XP_008679954.1|  PREDICTED: cycloartenol synthase isoform X1        933   0.0     
gb|AAF03375.1|AF169966_1  putative cycloartenol synthase                932   0.0     Oryza sativa [red rice]
ref|NP_001045848.1|  Os02g0139700                                       932   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AAT38891.1|  cycloartenol synthase                                   932   0.0     Avena strigosa
ref|XP_011031251.1|  PREDICTED: cycloartenol synthase-like              932   0.0     
ref|NP_001168640.1|  hypothetical protein                               931   0.0     Zea mays [maize]
ref|XP_002269889.1|  PREDICTED: cycloartenol Synthase-like              930   0.0     Vitis vinifera
emb|CAC84559.1|  cycloartenol synthase                                  929   0.0     Avena strigosa
ref|XP_004951930.1|  PREDICTED: cycloartenol synthase-like              929   0.0     
gb|AAT38889.1|  cycloartenol synthase                                   928   0.0     Avena longiglumis
ref|XP_009379198.1|  PREDICTED: cycloartenol synthase-like              928   0.0     
ref|NP_190099.3|  lanosterol synthase 1                                 927   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391431.1|  PREDICTED: cycloartenol synthase isoform X2        926   0.0     
gb|AAT38888.1|  cycloartenol synthase                                   926   0.0     Avena longiglumis
gb|AAT38890.1|  cycloartenol synthase                                   925   0.0     Avena prostrata
ref|XP_010106929.1|  hypothetical protein L484_008202                   924   0.0     
ref|XP_009346737.1|  PREDICTED: cycloartenol synthase-like              923   0.0     
gb|AAT38887.1|  cycloartenol synthase                                   923   0.0     Avena clauda
gb|AAT38892.1|  cycloartenol synthase                                   923   0.0     Avena ventricosa
gb|KEH27284.1|  cycloartenol synthase                                   922   0.0     
gb|AEM42982.1|  cucurbitadienol synthase                                922   0.0     
gb|KEH22896.1|  cycloartenol synthase                                   922   0.0     
ref|XP_010655252.1|  PREDICTED: cycloartenol Synthase isoform X1        921   0.0     
ref|XP_003620644.1|  Lanosterol synthase                                920   0.0     
dbj|BAA85267.1|  oxidosqualene cyclase                                  919   0.0     Luffa aegyptiaca [dishcloth gourd]
emb|CBI18419.3|  unnamed protein product                                915   0.0     
ref|XP_010655253.1|  PREDICTED: cycloartenol Synthase isoform X2        915   0.0     
ref|XP_006453177.1|  hypothetical protein CICLE_v10007530mg             912   0.0     
gb|KHN10150.1|  Cycloartenol synthase                                   912   0.0     
ref|XP_004513136.1|  PREDICTED: cycloartenol synthase-like              912   0.0     
ref|XP_004513122.1|  PREDICTED: cycloartenol synthase-like              909   0.0     
emb|CAB72151.1|  oxidosqualene cyclase-like protein                     909   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574426.1|  PREDICTED: cycloartenol synthase                   908   0.0     
ref|XP_006474650.1|  PREDICTED: cycloartenol synthase 2-like            908   0.0     
emb|CBI18420.3|  unnamed protein product                                906   0.0     
ref|XP_009618437.1|  PREDICTED: cycloartenol synthase 2-like isof...    905   0.0     
dbj|BAI48072.1|  cycloartenol synthase                                  903   0.0     Polypodiodes niponica
dbj|BAF93208.1|  cycloartenol synthase                                  902   0.0     Adiantum capillus-veneris [maidenhair fern]
gb|KDO62053.1|  hypothetical protein CISIN_1g043885mg                   901   0.0     
ref|XP_002453282.1|  hypothetical protein SORBIDRAFT_04g003190          899   0.0     Sorghum bicolor [broomcorn]
ref|XP_004140567.1|  PREDICTED: cucurbitadienol synthase-like           896   0.0     
ref|XP_008459938.1|  PREDICTED: cucurbitadienol synthase                894   0.0     
ref|XP_002527812.1|  Cycloartenol synthase, putative                    892   0.0     Ricinus communis
dbj|BAJ91961.1|  predicted protein                                      892   0.0     
ref|XP_011078188.1|  PREDICTED: cycloartenol synthase-like isofor...    890   0.0     
ref|XP_008342985.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    889   0.0     
gb|AIT72030.1|  oxidosqualene cyclase                                   889   0.0     
sp|Q6BE24.1|CUCS_CUCPE  RecName: Full=Cucurbitadienol synthase          889   0.0     Cucurbita pepo
ref|XP_010065704.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    884   0.0     
ref|XP_001758555.1|  predicted protein                                  880   0.0     
dbj|BAB83254.1|  multifunctional triterpene synthase                    879   0.0     Cheilocostus speciosus [crepe-ginger]
ref|XP_004975971.1|  PREDICTED: cycloartenol synthase-like              879   0.0     
gb|EEE56272.1|  hypothetical protein OsJ_05323                          878   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010111091.1|  hypothetical protein L484_015147                   878   0.0     
gb|EEC72452.1|  hypothetical protein OsI_05794                          878   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003620645.1|  Lanosterol synthase                                874   0.0     
ref|XP_007160210.1|  hypothetical protein PHAVU_002G302200g             874   0.0     
gb|EPS63519.1|  cycloartenol synthase                                   869   0.0     
ref|XP_008362456.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    867   0.0     
dbj|BAA86930.1|  lupeol synthase                                        867   0.0     Olea europaea
ref|XP_002964244.1|  hypothetical protein SELMODRAFT_266790             864   0.0     
ref|XP_008655663.1|  PREDICTED: cycloartenol synthase-like isofor...    863   0.0     
ref|XP_003573825.1|  PREDICTED: cycloartenol synthase-like isofor...    863   0.0     
ref|XP_010252186.1|  PREDICTED: lupeol synthase-like                    862   0.0     
emb|CBI24038.3|  unnamed protein product                                861   0.0     
ref|XP_002989569.1|  hypothetical protein SELMODRAFT_269539             861   0.0     
ref|XP_002964634.1|  hypothetical protein SELMODRAFT_81943              860   0.0     
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2              860   0.0     
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1              860   0.0     Vitis vinifera
ref|XP_007153001.1|  hypothetical protein PHAVU_004G1782001g            860   0.0     
gb|AFW80117.1|  hypothetical protein ZEAMMB73_095189                    860   0.0     
emb|CAN60556.1|  hypothetical protein VITISV_020304                     860   0.0     Vitis vinifera
ref|XP_008655662.1|  PREDICTED: cycloartenol synthase-like isofor...    860   0.0     
ref|XP_007014712.1|  Beta-Amyrin Synthase isoform 1                     860   0.0     
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...    859   0.0     
ref|XP_006474340.1|  PREDICTED: cycloartenol synthase 2-like isof...    859   0.0     
ref|XP_002989509.1|  hypothetical protein SELMODRAFT_129950             859   0.0     
ref|XP_002989508.1|  hypothetical protein SELMODRAFT_160256             859   0.0     
gb|KHN16704.1|  Lupeol synthase                                         857   0.0     
ref|XP_003530475.1|  PREDICTED: lupeol synthase isoform 1               856   0.0     
ref|XP_010656690.1|  PREDICTED: lupeol synthase isoform X3              855   0.0     
ref|XP_004308480.1|  PREDICTED: lupeol synthase-like                    856   0.0     
gb|EMT12088.1|  Cycloartenol synthase                                   850   0.0     
ref|XP_003573823.1|  PREDICTED: cycloartenol synthase-like isofor...    852   0.0     
ref|XP_003570909.1|  PREDICTED: cycloartenol synthase-like              850   0.0     
sp|H2KWF1.1|PAKSY_ORYSJ  RecName: Full=Parkeol synthase                 846   0.0     
gb|KHN00954.1|  Lupeol synthase                                         843   0.0     
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1         843   0.0     
ref|XP_010244586.1|  PREDICTED: cycloartenol synthase 2 isoform X2      837   0.0     
ref|XP_008353332.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    835   0.0     
dbj|BAA86932.1|  lupeol synthase                                        841   0.0     Taraxacum officinale [dandelion]
ref|XP_007019806.1|  Cycloartenol synthase 1 isoform 5                  835   0.0     
ref|XP_010095206.1|  Lupeol synthase                                    840   0.0     
ref|XP_010669609.1|  PREDICTED: lupeol synthase-like                    838   0.0     
ref|XP_006453169.1|  hypothetical protein CICLE_v10007532mg             832   0.0     
ref|XP_010932783.1|  PREDICTED: cycloartenol Synthase-like isofor...    835   0.0     
dbj|BAE53430.1|  lupeol synthase                                        832   0.0     Lotus japonicus
sp|Q8W3Z2.1|LUPS_BETPL  RecName: Full=Lupeol synthase                   828   0.0     Betula platyphylla [Asian white birch]
ref|XP_008809074.1|  PREDICTED: cycloartenol synthase-like isofor...    822   0.0     
ref|XP_007014713.1|  Beta-Amyrin Synthase isoform 2                     824   0.0     
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                    826   0.0     
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like               825   0.0     
gb|KEH27290.1|  beta-amyrin synthase                                    824   0.0     
ref|XP_006453174.1|  hypothetical protein CICLE_v100104161mg            817   0.0     
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1    822   0.0     
dbj|BAL41371.1|  lupeol synthase                                        821   0.0     
gb|EYU25764.1|  hypothetical protein MIMGU_mgv1a024154mg                818   0.0     
gb|AIE17466.1|  oxidosqualene cyclase                                   818   0.0     
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2           818   0.0     Panax ginseng [Chinese ginseng]
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1     817   0.0     Glycyrrhiza glabra
gb|AIU41743.1|  beta-amyrin synthase                                    816   0.0     
ref|XP_008679955.1|  PREDICTED: cycloartenol synthase isoform X2        811   0.0     
ref|XP_006353758.1|  PREDICTED: lupeol synthase-like                    815   0.0     
gb|ABY90140.2|  beta-amyrin synthase                                    813   0.0     Bupleurum chinense
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g             813   0.0     
emb|CDP08999.1|  unnamed protein product                                813   0.0     
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                    811   0.0     
ref|XP_009786280.1|  PREDICTED: lupeol synthase                         811   0.0     
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase              811   0.0     Betula platyphylla [Asian white birch]
ref|XP_010234656.1|  PREDICTED: cycloartenol synthase-like isofor...    807   0.0     
gb|EMS63323.1|  Cycloartenol synthase                                   804   0.0     
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                    808   0.0     
gb|AGG09939.1|  beta-amyrin synthase                                    808   0.0     
gb|EEE56271.1|  hypothetical protein OsJ_05320                          808   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011085901.1|  PREDICTED: beta-amyrin synthase-like               807   0.0     
gb|AHY94897.1|  cycloartenol synthase                                   807   0.0     
emb|CAN65909.1|  hypothetical protein VITISV_001242                     805   0.0     Vitis vinifera
gb|ACN34296.1|  unknown                                                 803   0.0     Zea mays [maize]
ref|XP_004243674.1|  PREDICTED: lupeol synthase isoform X1              805   0.0     
gb|ADK12003.1|  beta-amyrin synthase                                    804   0.0     
ref|XP_002270934.1|  PREDICTED: beta-amyrin synthase                    804   0.0     
ref|XP_010234657.1|  PREDICTED: cycloartenol synthase-like isofor...    800   0.0     
ref|XP_010106930.1|  Cycloartenol synthase                              803   0.0     
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...    802   0.0     
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like               801   0.0     
gb|ADM89633.1|  beta-amyrin synthase                                    801   0.0     
gb|ACA13386.1|  beta-amyrin synthase                                    800   0.0     
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1         799   0.0     
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1           798   0.0     
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...    798   0.0     
ref|NP_001234604.1|  beta-amyrin synthase                               798   0.0     
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like               798   0.0     
gb|AIK19223.1|  triterpene synthase                                     797   0.0     
emb|CBI18407.3|  unnamed protein product                                800   0.0     
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1    796   0.0     
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg                795   0.0     
ref|XP_004513125.1|  PREDICTED: lupeol synthase-like                    795   0.0     
ref|XP_003563865.1|  PREDICTED: achilleol B synthase-like               794   0.0     
gb|AAS83468.1|  beta-armyrin synthase                                   793   0.0     
gb|ACB87531.1|  beta-amyrin synthase                                    793   0.0     
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like               792   0.0     
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like               792   0.0     
ref|XP_002513298.1|  Cycloartenol synthase, putative                    791   0.0     
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...    791   0.0     
gb|AIS39794.1|  mixed amyrin synthase 2                                 791   0.0     
gb|AAX14716.1|  beta-amyrin synthase                                    790   0.0     
ref|XP_008678653.1|  PREDICTED: achilleol B synthase-like               790   0.0     
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                    789   0.0     
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase              789   0.0     
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg             789   0.0     
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like               789   0.0     
gb|EPS65499.1|  beta-amyrin synthase                                    788   0.0     
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like               786   0.0     
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg             788   0.0     
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like               788   0.0     
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1    788   0.0     
gb|ADE88148.1|  beta-amyrin synthase                                    788   0.0     
ref|XP_010669612.1|  PREDICTED: lupeol synthase-like                    788   0.0     
gb|AIE17465.1|  oxidosqualene cyclase                                   788   0.0     
gb|ACN34222.1|  unknown                                                 787   0.0     
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like               787   0.0     
gb|AHI17180.1|  beta-amyrin synthase                                    787   0.0     
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1         786   0.0     
gb|AFM82492.1|  lupeol synthase                                         786   0.0     
ref|XP_010068959.1|  PREDICTED: cycloartenol synthase-like              781   0.0     
dbj|BAE43642.1|  beta-amyrin synthase                                   786   0.0     
gb|KEH25838.1|  beta-amyrin synthase                                    786   0.0     
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1     786   0.0     
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                    786   0.0     
dbj|BAE53429.1|  beta-amyrin synthase                                   786   0.0     
gb|AHX97777.1|  beta-amyrin synthase                                    785   0.0     
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like               785   0.0     
ref|XP_007214979.1|  hypothetical protein PRUPE_ppa001817mg             785   0.0     
ref|XP_011009935.1|  PREDICTED: beta-amyrin synthase-like isoform X2    783   0.0     
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like               783   0.0     
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                    783   0.0     
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g             783   0.0     
gb|AGA17940.1|  beta-amyrin synthase                                    783   0.0     
ref|NP_001152006.1|  cycloartenol synthase                              783   0.0     
ref|XP_011009936.1|  PREDICTED: beta-amyrin synthase-like isoform X3    781   0.0     
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase                 783   0.0     
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like               783   0.0     
ref|XP_007023608.1|  Beta-Amyrin Synthase                               782   0.0     
gb|ACV21067.1|  beta-amyrin synthase                                    782   0.0     
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1    782   0.0     
ref|XP_011009932.1|  PREDICTED: beta-amyrin synthase-like isoform X1    781   0.0     
ref|XP_004488915.1|  PREDICTED: beta-amyrin synthase-like               781   0.0     
gb|AGG20314.1|  alpha- and beta-amyrin synthase                         781   0.0     
ref|XP_002265019.2|  PREDICTED: beta-amyrin synthase-like               781   0.0     
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like               781   0.0     
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like               781   0.0     
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1    781   0.0     
gb|AHF49822.1|  bAS                                                     781   0.0     
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2    780   0.0     
ref|XP_002527337.1|  Cycloartenol synthase, putative                    779   0.0     
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                   780   0.0     
emb|CDP15852.1|  unnamed protein product                                780   0.0     
ref|XP_003604121.1|  Beta-amyrin synthase                               780   0.0     
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like               779   0.0     
gb|KEH28511.1|  beta-amyrin synthase                                    779   0.0     
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                    779   0.0     
ref|XP_002269328.2|  PREDICTED: beta-Amyrin Synthase 1-like             779   0.0     
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg             779   0.0     
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1    778   0.0     
gb|EMT02613.1|  Cycloartenol synthase                                   778   0.0     
ref|XP_006656974.1|  PREDICTED: achilleol B synthase-like               778   0.0     
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                    778   0.0     
gb|KHN39383.1|  Beta-amyrin synthase                                    778   0.0     
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like              777   0.0     
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                          777   0.0     
ref|XP_008362478.1|  PREDICTED: beta-amyrin synthase                    776   0.0     
ref|XP_008240807.1|  PREDICTED: lupeol synthase-like                    776   0.0     
gb|ACM89978.1|  putative beta amyrin synthase                           776   0.0     
emb|CBI18393.3|  unnamed protein product                                780   0.0     
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1        776   0.0     
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                    775   0.0     
ref|XP_004966341.1|  PREDICTED: achilleol B synthase-like               775   0.0     
gb|KHN38108.1|  Beta-amyrin synthase                                    776   0.0     
ref|XP_010539602.1|  PREDICTED: camelliol C synthase-like isoform X5    775   0.0     
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like               775   0.0     
dbj|BAA86931.1|  cycloartenol synthase                                  768   0.0     
ref|XP_010696136.1|  PREDICTED: beta-amyrin synthase-like               775   0.0     
ref|XP_010234472.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    775   0.0     
ref|XP_010655247.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X2       773   0.0     
gb|KFK40207.1|  hypothetical protein AALP_AA3G344300                    773   0.0     
gb|AGA17939.1|  lupeol synthase                                         773   0.0     
emb|CBI18382.3|  unnamed protein product                                778   0.0     
ref|XP_010655243.1|  PREDICTED: beta-Amyrin Synthase 1                  773   0.0     
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1    773   0.0     
ref|XP_002271333.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X1       772   0.0     
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like               772   0.0     
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like               773   0.0     
ref|XP_006488698.1|  PREDICTED: beta-amyrin synthase-like               774   0.0     
gb|ABL07607.1|  beta-amyrin synthase                                    771   0.0     
ref|NP_001234597.1|  delta-amyrin synthase                              771   0.0     
ref|NP_178016.2|  beta-amyrin synthase                                  771   0.0     
ref|XP_006301366.1|  hypothetical protein CARUB_v10021777mg             771   0.0     
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g             771   0.0     
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                    770   0.0     
ref|XP_010313692.1|  PREDICTED: delta-amyrin synthase-like isofor...    767   0.0     
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                    769   0.0     
ref|XP_002305339.1|  putative oxidosqualene cyclase family protein      768   0.0     
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like               769   0.0     
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                    769   0.0     
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like               768   0.0     
ref|XP_004972557.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    769   0.0     
ref|XP_002444042.1|  hypothetical protein SORBIDRAFT_07g006300          768   0.0     
emb|CBI18406.3|  unnamed protein product                                774   0.0     
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                    768   0.0     
gb|ABK76265.1|  beta-amyrin synthase                                    768   0.0     
ref|XP_004951925.1|  PREDICTED: achilleol B synthase-like               768   0.0     
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase                766   0.0     
ref|XP_004951923.1|  PREDICTED: achilleol B synthase-like isoform X1    766   0.0     
ref|XP_002310349.1|  beta-Amyrin synthase family protein                766   0.0     
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1    766   0.0     
gb|ACH88048.1|  beta-amyrin synthase                                    766   0.0     
ref|NP_001176396.1|  Os11g0189600                                       763   0.0     
ref|XP_006598558.1|  PREDICTED: LOW QUALITY PROTEIN: probable oxi...    765   0.0     
dbj|BAG82628.1|  beta-amyrin synthase                                   764   0.0     
ref|XP_010472733.1|  PREDICTED: amyrin synthase LUP2 isoform X1         763   0.0     
gb|KDP27753.1|  hypothetical protein JCGZ_19782                         755   0.0     
gb|KEH18380.1|  beta-amyrin synthase                                    763   0.0     
ref|XP_006389936.1|  hypothetical protein EUTSA_v10018166mg             763   0.0     
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS      763   0.0     
ref|XP_002445263.1|  hypothetical protein SORBIDRAFT_07g007030          762   0.0     
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like               761   0.0     
ref|XP_008341139.1|  PREDICTED: cycloartenol synthase 2-like            753   0.0     
ref|XP_003521102.1|  PREDICTED: beta-amyrin synthase-like isoform X1    761   0.0     
gb|AAO33580.1|AF478455_1  multifunctional beta-amyrin synthase          761   0.0     
emb|CDX88493.1|  BnaC06g39370D                                          761   0.0     
ref|XP_010932785.1|  PREDICTED: cycloartenol synthase-like isofor...    759   0.0     
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like                 761   0.0     
ref|XP_004959022.1|  PREDICTED: achilleol B synthase-like               761   0.0     
ref|NP_001061273.2|  Os08g0223900                                       761   0.0     
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                    761   0.0     
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...    761   0.0     
ref|NP_683508.1|  camelliol C synthase 1                                760   0.0     
gb|AFF27505.1|  beta-amyrin synthase                                    759   0.0     
gb|AAC17070.1|  Strong similarity to lupeol synthase gb|U49919 fr...    760   0.0     
ref|XP_010655249.1|  PREDICTED: beta-amyrin synthase                    759   0.0     
ref|XP_006377610.1|  putative oxidosqualene cyclase family protein      758   0.0     
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like               758   0.0     
ref|XP_009104558.1|  PREDICTED: amyrin synthase LUP2-like               757   0.0     
ref|NP_178017.2|  lupeol synthase 2                                     757   0.0     
emb|CBI18408.3|  unnamed protein product                                759   0.0     
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1     756   0.0     
emb|CDY57947.1|  BnaA07g38460D                                          756   0.0     
ref|XP_011006636.1|  PREDICTED: beta-amyrin synthase-like               756   0.0     
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg             756   0.0     
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg             755   0.0     
ref|XP_009149097.1|  PREDICTED: amyrin synthase LUP2-like               754   0.0     
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like               754   0.0     
ref|XP_003604122.1|  Beta-amyrin synthase                               751   0.0     
emb|CDY35103.1|  BnaA06g11130D                                          754   0.0     
ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like          753   0.0     
ref|XP_006300770.1|  hypothetical protein CARUB_v10019849mg             753   0.0     
emb|CDP14235.1|  unnamed protein product                                750   0.0     
ref|XP_011037652.1|  PREDICTED: beta-amyrin synthase-like               752   0.0     
ref|XP_010323971.1|  PREDICTED: lupeol synthase isoform X2              751   0.0     
ref|XP_003570908.1|  PREDICTED: achilleol B synthase-like               753   0.0     
ref|XP_004309763.1|  PREDICTED: beta-amyrin synthase-like               752   0.0     
ref|XP_002887124.1|  ATLUP2                                             752   0.0     
gb|EEE52290.1|  hypothetical protein OsJ_34282                          751   0.0     
ref|XP_010245750.1|  PREDICTED: beta-amyrin synthase-like isoform X2    750   0.0     
ref|NP_001068103.1|  Os11g0562100                                       751   0.0     
ref|XP_008645047.1|  PREDICTED: achilleol B synthase-like isoform X2    749   0.0     
gb|ABG22398.1|  Cycloartenol synthase, putative, expressed              747   0.0     
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like               750   0.0     
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like               750   0.0     
ref|XP_010429766.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    749   0.0     
gb|AAG41762.1|AF099968_1  pentacyclic triterpene synthase               749   0.0     
dbj|BAE43643.1|  putative oxidosqulene cyclase                          749   0.0     
ref|XP_010429765.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    749   0.0     
gb|AFZ93646.1|  cycloartenol synthase                                   742   0.0     
ref|NP_001067700.1|  Os11g0285000                                       749   0.0     
ref|XP_008645046.1|  PREDICTED: achilleol B synthase-like isoform X1    748   0.0     
ref|XP_006659942.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    753   0.0     
gb|KEH17471.1|  beta-amyrin synthase                                    748   0.0     
gb|AIK21791.1|  beta-amyrin synthase                                    746   0.0     
ref|XP_010417511.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    748   0.0     
ref|XP_009364429.1|  PREDICTED: beta-amyrin synthase-like               747   0.0     
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...    747   0.0     
ref|XP_010052737.1|  PREDICTED: beta-amyrin synthase-like isoform X2    743   0.0     
gb|KEH25840.1|  beta-amyrin synthase                                    746   0.0     
ref|XP_010052738.1|  PREDICTED: beta-amyrin synthase-like isoform X3    743   0.0     
ref|XP_009106614.1|  PREDICTED: amyrin synthase LUP2                    747   0.0     
emb|CDX87419.1|  BnaA07g34540D                                          746   0.0     
ref|XP_006409183.1|  hypothetical protein EUTSA_v10022563mg             747   0.0     
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg             746   0.0     
ref|XP_010472735.1|  PREDICTED: amyrin synthase LUP2 isoform X2         746   0.0     
ref|XP_010429762.1|  PREDICTED: amyrin synthase LUP2-like               746   0.0     
gb|AFW70110.1|  hypothetical protein ZEAMMB73_823385                    739   0.0     
gb|AAT38895.1|  beta-amyrin synthase                                    746   0.0     
gb|AAT38894.1|  beta-amyrin synthase                                    745   0.0     
gb|KDP37006.1|  hypothetical protein JCGZ_06062                         746   0.0     
ref|XP_010417510.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    745   0.0     
ref|XP_010417512.1|  PREDICTED: amyrin synthase LUP2-like isoform X3    745   0.0     
emb|CAN77299.1|  hypothetical protein VITISV_033299                     744   0.0     
ref|XP_008228019.1|  PREDICTED: beta-amyrin synthase-like               745   0.0     
emb|CAC84558.1|  beta-amyrin synthase                                   744   0.0     



>ref|XP_007224874.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
 gb|EMJ26073.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
Length=793

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/687 (76%), Positives = 585/687 (85%), Gaps = 4/687 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWL SVNNHIGRQYWEFDPNLGT EER QV+K R EF KNRFQ KHSSDLLMR+QF KE
Sbjct  11    DPWLTSVNNHIGRQYWEFDPNLGTPEERAQVEKARHEFRKNRFQSKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGL--QQVKVGS-EEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             K  EM     QVK  S EEEISEEAV  TLRR L FYST+QA DG WP DYGGPLFLLP 
Sbjct  71    KACEMKQVPAQVKARSDEEEISEEAVGITLRRALSFYSTLQAEDGFWPGDYGGPLFLLPG  130

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LVIGLSV  A++A+L  EHQ+E+ RY+YNHQN+DGGWGLHIEG STMFCTAL+YVTLR+L
Sbjct  131   LVIGLSVTGALHAILPHEHQQEICRYLYNHQNMDGGWGLHIEGPSTMFCTALSYVTLRLL  190

Query  1694  GEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             GEE DGG+GAM +ARKWILD GG TFIPSWGK+WLSVLGVYEWSGNNPLPPELWLLPY +
Sbjct  191   GEEMDGGDGAMDRARKWILDRGGVTFIPSWGKMWLSVLGVYEWSGNNPLPPELWLLPYSL  250

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             PIHPGRMWCHCRMVYLPMSYLYGKR+VGPIN  +LSLRRELY   YH IDWD ARN CAK
Sbjct  251   PIHPGRMWCHCRMVYLPMSYLYGKRFVGPINGLVLSLRRELYTFPYHLIDWDQARNLCAK  310

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP +QDI+W  L  + EPLL KWPF++LR+KAL   M HI +EDE T Y+CIGP
Sbjct  311   EDLYYPHPILQDILWGSLQKVGEPLLMKWPFSRLRQKALRTVMQHIHYEDENTQYICIGP  370

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A + HLSRIKDYLW+AEDGMKM GYNGSQ WDV  AVQAI+A
Sbjct  371   VNKVLNMICCWVEDPNSKAYRNHLSRIKDYLWVAEDGMKMQGYNGSQFWDVALAVQAILA  430

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             TNL +E G +L+KAH FI  +Q+K +S  N L  WYRH +KGGWPFSTPDNGWPVSDCTA
Sbjct  431   TNLVNESGFVLQKAHNFIKNTQVKANSSGN-LSYWYRHISKGGWPFSTPDNGWPVSDCTA  489

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAAL+LS M  ++VGEAI+  +LYDAV++ILSLQN++GGFA+YELTRSY WLE++NP
Sbjct  490   EGLKAALLLSLMPSEIVGEAIQADQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMINP  549

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F KL+PG+RRKEIEACI KA+ FI++IQLPDGSW
Sbjct  550   AETFGDIIIDYQYVECTSAAIEGLKSFMKLYPGHRRKEIEACIVKAVKFIESIQLPDGSW  609

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVCYTYGTWFGI+GLV GG TY + H IR+ACDFLLSKQL SGGWGESYLSCQ+KV
Sbjct  610   YGSWGVCYTYGTWFGIKGLVAGGKTYHTSHSIRRACDFLLSKQLGSGGWGESYLSCQNKV  669

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN+EGNK HIVNT WAML LIEAGQ 
Sbjct  670   YTNLEGNKPHIVNTGWAMLGLIEAGQA  696



>emb|CDP12483.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1062 bits (2747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/686 (74%), Positives = 583/686 (85%), Gaps = 2/686 (0%)
 Frame = -3

Query  2228  DDP-WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFE  2052
             DDP WL S NNH+GR++W+FDPNLGT +ER +++K+R EF + RF+IKHSSDLLMR+QF 
Sbjct  12    DDPVWLTSSNNHVGREFWKFDPNLGTLQERAEIEKVREEFRRKRFEIKHSSDLLMRIQFA  71

Query  2051  KEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             KE   EM L QV + SEEEI+EEAVV TLRR LRFYS +QA DGHWP DYGGPLFLLP L
Sbjct  72    KENPCEMNLPQVNIASEEEITEEAVVTTLRRALRFYSNLQAEDGHWPGDYGGPLFLLPGL  131

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             +IGL +M AIN VL EE QKE+ RY+YNHQN DGGWG+HIEGHSTMF TALNYV+LR+LG
Sbjct  132   IIGLYIMGAINTVLSEEQQKEIRRYLYNHQNEDGGWGIHIEGHSTMFATALNYVSLRLLG  191

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             +  DGG+G+M+KAR WI+DHGG TFIPSWGKLWLSVLG Y+WSGNNPLPPELWLLPY +P
Sbjct  192   QAEDGGDGSMEKARNWIIDHGGVTFIPSWGKLWLSVLGAYDWSGNNPLPPELWLLPYFLP  251

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPGRMWCHCRMVYLPMSYLYG+RYVG ++ T+LSLRRELY   YHQIDW+LARNQCAKE
Sbjct  252   IHPGRMWCHCRMVYLPMSYLYGRRYVGRVDGTVLSLRRELYAQPYHQIDWNLARNQCAKE  311

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP IQDI+W GLH + EPLL  WP +KLR +AL++ M HI +EDE T+YVCIGPV
Sbjct  312   DLYYPHPLIQDILWGGLHKVAEPLLMNWPLSKLRHRALSIVMQHIHYEDENTHYVCIGPV  371

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E+P+S A+K HL+RIKDYLW+AEDGMKM GYNGSQLWD   AV AIIAT
Sbjct  372   NKVLNMVCCWVEDPNSNAIKSHLARIKDYLWVAEDGMKMKGYNGSQLWDAALAVHAIIAT  431

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEYG ML+KAH FI  SQI +DS  N + SWYRH +KG WPFSTPDNGWPVSD TAE
Sbjct  432   NLQDEYGLMLKKAHKFITASQIGKDSSGNPV-SWYRHISKGAWPFSTPDNGWPVSDTTAE  490

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LKAAL+LSRM+ DV GEAIE  +LYDAV+++LS QN SGGFA+YELTRSY WLE++NP+
Sbjct  491   GLKAALLLSRMSYDVAGEAIEQEKLYDAVNVLLSYQNTSGGFASYELTRSYAWLEMVNPA  550

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETFG+I+IDYQYVECTSAAI  LK+F K++PGYR KEIEACI KAL FI++IQL DGSWY
Sbjct  551   ETFGDIVIDYQYVECTSAAIQALKFFTKIYPGYRSKEIEACIQKALNFIESIQLSDGSWY  610

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSWG+C+TYGTWFGI GL+ GG TYE+   IRKACDFLLSKQL  GGWGESYLS Q+KVY
Sbjct  611   GSWGICFTYGTWFGITGLLAGGRTYENSESIRKACDFLLSKQLRFGGWGESYLSSQNKVY  670

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQV  174
             T IEGNK HIV+T+WA+L LIEA Q 
Sbjct  671   TEIEGNKSHIVSTSWALLGLIEAEQA  696



>ref|XP_009618436.1| PREDICTED: cycloartenol synthase-like isoform X1 [Nicotiana tomentosiformis]
Length=762

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/686 (76%), Positives = 588/686 (86%), Gaps = 5/686 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             ++PW+ S NNH+GRQYWEFD + GT EER  V+ +R  F++NRF +KHSSDLL+R+QFEK
Sbjct  10    NEPWVTSSNNHVGRQYWEFDKDGGTLEERCHVENIRQHFYENRFHVKHSSDLLLRLQFEK  69

Query  2048  EKGQEMG-LQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             EK  +M  L +VK+ SEEE SEEAV  TLRR LRFYST+QA DGHWPADYGGPLFLLP L
Sbjct  70    EKQIDMKKLGKVKIESEEETSEEAVKTTLRRALRFYSTLQAEDGHWPADYGGPLFLLPGL  129

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             VI L +M  +NAVL EEHQKE+LRY+YNHQN+DGGWGLHIEGHSTMFCTALNYVTLR+LG
Sbjct  130   VISLYIMGVVNAVLSEEHQKEILRYLYNHQNVDGGWGLHIEGHSTMFCTALNYVTLRLLG  189

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             E  D  + AM+KARKWIL+HGG TFIPSWGKLWLS LGVYEWSGNNPLPPELWLLPY +P
Sbjct  190   E--DINDEAMEKARKWILEHGGLTFIPSWGKLWLSALGVYEWSGNNPLPPELWLLPYFLP  247

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPGRMWCHCRMVYL MSYLYG RYVGPINSTILSLRRELY   YH IDWDLARNQCAKE
Sbjct  248   IHPGRMWCHCRMVYLAMSYLYGTRYVGPINSTILSLRRELYTCPYHHIDWDLARNQCAKE  307

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP +QDI+W+ LHN  EPLL +WP +KLRKKAL   M+HI +EDE TNY+CIGPV
Sbjct  308   DLYYPHPLVQDILWESLHNFAEPLLMQWPLSKLRKKALNTVMEHIHYEDENTNYICIGPV  367

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E+P+S A+K+HLSRIKDYLWLAEDGMKM GYNGSQLWDV F VQAI++T
Sbjct  368   NKVLNMLCCWVEDPESKAIKLHLSRIKDYLWLAEDGMKMKGYNGSQLWDVSFGVQAILST  427

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL +EYG ML+ AH FI  SQ++EDS  + L+ WYR S +GGWPFST DNGW VSDCTAE
Sbjct  428   NLPEEYGLMLKNAHHFIKASQVREDSSGD-LKKWYRQSCRGGWPFSTVDNGWIVSDCTAE  486

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
             ALKAA++LS+M  D+VGEAI    L DAVDL+LSLQN++GGFA+YELTRSY WLE++NPS
Sbjct  487   ALKAAVLLSQMPSDIVGEAIASHNLCDAVDLLLSLQNSNGGFASYELTRSYAWLEMINPS  546

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETFG+I IDYQYVECTSAAI  L+ F+KL+P YR K+IEACI KAL FI++IQLPDGSWY
Sbjct  547   ETFGDITIDYQYVECTSAAIQALQSFKKLYPQYREKDIEACIRKALYFIESIQLPDGSWY  606

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQL-PSGGWGESYLSCQDKV  255
             GSWGVCYTYGTWFGI GL+ GG TYESC  IRKAC FLLSKQL PSGGWGESYLS Q KV
Sbjct  607   GSWGVCYTYGTWFGISGLIAGGKTYESCKSIRKACHFLLSKQLQPSGGWGESYLSSQHKV  666

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQ  177
             YTNIEGNK HIVNTAWAMLALIEAGQ
Sbjct  667   YTNIEGNKSHIVNTAWAMLALIEAGQ  692



>dbj|BAA33462.1| Oxidosqualene Cyclase [Panax ginseng]
Length=780

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/698 (72%), Positives = 591/698 (85%), Gaps = 15/698 (2%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DP L+SVNNHIGRQ+WEFDPNLGT EER  + KLR +FH NRF++KHSSDLLMR QFE+E
Sbjct  10    DPGLKSVNNHIGRQFWEFDPNLGTPEERAHIDKLRQQFHNNRFRVKHSSDLLMRYQFERE  69

Query  2045  KGQEMGLQ-QVKVGSEEEISE-----EAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFL  1884
             K +++G   +VK GSE EI+      E V   LRR L+FYSTIQA DGHWP DYGGPLFL
Sbjct  70    KSRKLGDDDEVKSGSEGEITTSSSGVEGVKMALRRALKFYSTIQADDGHWPGDYGGPLFL  129

Query  1883  LPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTL  1704
             LP LVIGL VM  ++ +L +EHQ+EM RYIYNHQN+DGGWGLHIEG STM CTALNY+TL
Sbjct  130   LPGLVIGLYVMGVMDTILAKEHQREMCRYIYNHQNVDGGWGLHIEGCSTMLCTALNYITL  189

Query  1703  RIL--GEERD------GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNpl  1548
             R+L  G+E +         G+++KAR+WI+DHGGAT+IPSWGK WLS+LGVYEWSGNNPL
Sbjct  190   RLLIRGDEEEEIRDEAANGGSLEKARRWIIDHGGATYIPSWGKFWLSILGVYEWSGNNPL  249

Query  1547  ppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQI  1368
             PPE+WLLPY +P+HPGRMW HCRMVYLPMSYLYG+R+VGPINST+LSLRRELY H YHQI
Sbjct  250   PPEMWLLPYFLPLHPGRMWNHCRMVYLPMSYLYGRRFVGPINSTVLSLRRELYTHPYHQI  309

Query  1367  DWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHE  1188
             +WDLARNQCA+EDLYYPHP IQD++W  LH  VE L+ +WP +K+R++ALT AM HI +E
Sbjct  310   NWDLARNQCAQEDLYYPHPLIQDMLWSCLHKGVERLIMQWPLSKIRQRALTTAMQHIHYE  369

Query  1187  DETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLW  1008
             DE T+Y+C+GPVNKVLNM+C W+E+P+S+A  +HLSRIKDYLW+AEDGMKM GYNGSQLW
Sbjct  370   DENTSYICLGPVNKVLNMVCCWVEDPNSMANILHLSRIKDYLWVAEDGMKMKGYNGSQLW  429

Query  1007  DVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTP  828
             DVGFAVQAI++T L DEYGSML+KAH FI +SQ++EDS  N L SW RH +KGGWPFSTP
Sbjct  430   DVGFAVQAILSTGLVDEYGSMLKKAHDFIKISQVREDSPGN-LSSWNRHISKGGWPFSTP  488

Query  827   DNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELT  648
             DNGWPVSDCTAE LKAAL+LS M  D+VGEAI P  LYDAV+ ILSLQN +GGFA+YELT
Sbjct  489   DNGWPVSDCTAEGLKAALLLSNMPFDIVGEAISPVHLYDAVNWILSLQNCTGGFASYELT  548

Query  647   RSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTF  468
             RSY WLE+LNP+ETFG+I+IDYQYVECTSAAI GLK F +L+PGYRRKEIEACI KA  F
Sbjct  549   RSYAWLELLNPAETFGDIVIDYQYVECTSAAIQGLKSFMRLYPGYRRKEIEACIAKATNF  608

Query  467   IQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGW  288
             I++IQLPDGSWYGSWG+CYTYGTWFGI+GLV  G T  +C+ IR+ACDFLLSKQL SGGW
Sbjct  609   IESIQLPDGSWYGSWGICYTYGTWFGIKGLVAAGRTNRNCYSIRRACDFLLSKQLGSGGW  668

Query  287   GESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             GESYLSCQ+KVYT+IEGN  H+ NT WAMLALIEAGQ 
Sbjct  669   GESYLSCQNKVYTSIEGNISHVANTGWAMLALIEAGQA  706



>ref|XP_004240118.1| PREDICTED: cycloartenol synthase-like [Solanum lycopersicum]
Length=758

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/685 (74%), Positives = 578/685 (84%), Gaps = 7/685 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DDPW+RS+NN++GRQYWEFD N GT EER  V+ +R  F  NRF +KHSSDLL+R+QF K
Sbjct  10    DDPWIRSLNNNVGRQYWEFDQNSGTDEERSHVEDIREHFSMNRFHVKHSSDLLLRLQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
              K  EM L++VK+ SEEE+    V  TL+ GLRFYSTIQA DGHWPADYGGPLFLLP LV
Sbjct  70    GKQIEM-LEKVKIESEEEL----VKTTLKMGLRFYSTIQADDGHWPADYGGPLFLLPGLV  124

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +MEA+N VL EEHQKE+LRY+YNHQN DGGWGLHIEGHSTMFCTALNYV +R++  
Sbjct  125   ISLFIMEAMNVVLSEEHQKEILRYLYNHQNKDGGWGLHIEGHSTMFCTALNYVAIRLING  184

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             E +  N AM+KARKWI++HGG T+IPSWGK WLSVLGVYEWSGNNPLPPELWLLPY VP+
Sbjct  185   ENNVNNEAMEKARKWIIEHGGVTYIPSWGKFWLSVLGVYEWSGNNPLPPELWLLPYFVPV  244

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYL MSYLYG+RYVGPINS ILSLRRELY   YH IDWDLARNQCAKED
Sbjct  245   HPGRMWCHCRMVYLAMSYLYGRRYVGPINSNILSLRRELYTTPYHHIDWDLARNQCAKED  304

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W+GLH I EPLL +WP +KLRKKAL   M+HI +EDE TNY+CIGPVN
Sbjct  305   LYYPHPLVQDILWEGLHKIGEPLLMQWPLSKLRKKALNTVMEHIHYEDENTNYICIGPVN  364

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+PDS A+K+HLSRIKDYLWLAEDGMKM GYNGSQLWDV F VQAI+ATN
Sbjct  365   KVLNMLCCWVEDPDSQAIKLHLSRIKDYLWLAEDGMKMKGYNGSQLWDVSFGVQAILATN  424

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EYG ML+ AH FI  SQ +E+S  +  + WYR  ++GGWPFST DNGW VSDCTAEA
Sbjct  425   LPQEYGVMLKNAHHFIKASQARENSNGD-AKKWYRQHSRGGWPFSTVDNGWIVSDCTAEA  483

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA+++LS M  D+VGE   P RL++AVDLILSLQN++GGFA+YELTRSY WLE++NPSE
Sbjct  484   LKASILLSLMPLDIVGEVTAPHRLFEAVDLILSLQNSNGGFASYELTRSYAWLEMINPSE  543

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I IDYQYVECTSA I  L+ F+K +P +R KEIEACINKAL FIQTIQLPDGSWYG
Sbjct  544   TFGDITIDYQYVECTSAVIQALESFKKNYPKHREKEIEACINKALQFIQTIQLPDGSWYG  603

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQL-PSGGWGESYLSCQDKVY  252
             SWGVCYTYGTWFGI GLV GG TYE+C  IRKAC+FLLSKQL  SGGWGESYLS Q K+Y
Sbjct  604   SWGVCYTYGTWFGICGLVAGGYTYENCKSIRKACNFLLSKQLQSSGGWGESYLSSQHKIY  663

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+EGNK H VNTAWAMLALIEAGQ
Sbjct  664   TNLEGNKPHNVNTAWAMLALIEAGQ  688



>ref|XP_006360676.1| PREDICTED: cycloartenol synthase-like [Solanum tuberosum]
Length=759

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/686 (75%), Positives = 580/686 (85%), Gaps = 8/686 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPW+RS+NN++GRQYWEFD N GT EER  V+ +R  FHKNRF +KHSSDLL+R+QF K
Sbjct  10    NDPWIRSLNNNVGRQYWEFDQNSGTDEERSHVEDIREHFHKNRFHVKHSSDLLLRLQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             EK  EM L++VK+ SEEE+    V  TL+RGLRFYSTIQA DGHWPADYGGPLFLLP LV
Sbjct  70    EKQIEM-LEKVKIESEEEL----VKTTLKRGLRFYSTIQADDGHWPADYGGPLFLLPGLV  124

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL-G  1692
             I L +M A+N VL EEHQKE+LRY+YNHQN DGGWGLHIEGHSTMFCTALNYV +R++ G
Sbjct  125   ISLFIMRAVNVVLSEEHQKEILRYLYNHQNKDGGWGLHIEGHSTMFCTALNYVAIRLIDG  184

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             E  +  N AM+KARKWI++HGG T IPSWGK WLSVLGVYEWSGNNPLPPELWLLPY +P
Sbjct  185   ENINVNNEAMEKARKWIIEHGGVTHIPSWGKFWLSVLGVYEWSGNNPLPPELWLLPYFLP  244

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPGRMWCHCRMVYL MSYLYG+RYVGPINS ILSLRRELY   YH IDWDLARNQCAKE
Sbjct  245   IHPGRMWCHCRMVYLAMSYLYGRRYVGPINSIILSLRRELYTIPYHHIDWDLARNQCAKE  304

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP +QDI+W+GLH I EPLL + P +KLRKKAL   M+HI +EDE TNY+CIGPV
Sbjct  305   DLYYPHPLVQDILWEGLHKIGEPLLMQLPLSKLRKKALNTVMEHIHYEDENTNYICIGPV  364

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E+P+S A+K+HLSRIKDYLWLAEDGMKM GYNGSQLWDV F VQAI+AT
Sbjct  365   NKVLNMLCCWVEDPNSQAIKLHLSRIKDYLWLAEDGMKMKGYNGSQLWDVSFGVQAILAT  424

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL  EYG ML+ AH FI  SQ++E+S  +  + WYR  ++GGWPFST DNGW VSDCTAE
Sbjct  425   NLPQEYGVMLKNAHHFIKASQVRENSNGD-AKKWYRQHSRGGWPFSTVDNGWIVSDCTAE  483

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
             ALKA+LMLS M  D+VGE I P RL DAVDLILSLQN++GGFA+YELTRSY WLE++NPS
Sbjct  484   ALKASLMLSLMPLDIVGEVIAPHRLCDAVDLILSLQNSNGGFASYELTRSYAWLEMINPS  543

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETFG+I IDYQYVECTSA I  L+ F+K +P +R KEIEACINKAL FIQTIQLPDGSWY
Sbjct  544   ETFGDITIDYQYVECTSAVIQALQSFKKNYPKHREKEIEACINKALHFIQTIQLPDGSWY  603

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQL-PSGGWGESYLSCQDKV  255
             GSWGVCYTYGTWFGI GLV GG TYE+C  IRKAC FLLSKQL PSGGWGESY S Q KV
Sbjct  604   GSWGVCYTYGTWFGICGLVAGGYTYENCKSIRKACHFLLSKQLRPSGGWGESYHSSQHKV  663

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQ  177
             YTN+EGN+ H VNTAWAMLALIEAGQ
Sbjct  664   YTNLEGNRPHNVNTAWAMLALIEAGQ  689



>ref|XP_009370029.1| PREDICTED: cycloartenol Synthase-like [Pyrus x bretschneideri]
Length=772

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/690 (74%), Positives = 579/690 (84%), Gaps = 7/690 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWL SVNNH+GRQYWEFDPNLG  EER QV K+R EFHKNRF+ KHSSDLLMR+QF KE
Sbjct  11    EPWLTSVNNHVGRQYWEFDPNLGAPEERAQVDKVRLEFHKNRFRTKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGL--QQVK--VGSEEE-ISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLL  1881
               ++  +   QVK   G EEE ISEEAV  TLRR LR+YST+QA DG WP DYGGPLFLL
Sbjct  71    ASEKKQVVSDQVKDKSGDEEEVISEEAVGITLRRALRYYSTLQADDGFWPGDYGGPLFLL  130

Query  1880  PFLVIGLSVMEAINAVL-QEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTL  1704
             P LV+GL V  A++ +L  ++HQ+E+ RY+YNHQNIDGGWGLHIEG STMFCTAL+YVTL
Sbjct  131   PGLVVGLYVTGALHTILPHDQHQQEICRYLYNHQNIDGGWGLHIEGPSTMFCTALSYVTL  190

Query  1703  RILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
             R+LGEE DGG GAM KARKWILD GG TFIPSWGK+WLSVLGVYEWSGNNPLPPELWLLP
Sbjct  191   RLLGEEIDGGYGAMDKARKWILDRGGVTFIPSWGKMWLSVLGVYEWSGNNPLPPELWLLP  250

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             Y +PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI+  ILSLRRELY   YH IDWD ARN 
Sbjct  251   YSLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPIDGLILSLRRELYTFPYHLIDWDQARNL  310

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPHP +QD+V   LH + EPLL  WPF+KLR+KAL   M HI +EDE T Y+C
Sbjct  311   CAKEDLYYPHPLLQDMVGGSLHKVGEPLLKGWPFSKLRQKALRTIMQHIHYEDENTQYIC  370

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             IGPVNKVLNMIC W E+P+S   K HLSRIKDYLW+AEDGMKM GYNGSQ WDV  AVQA
Sbjct  371   IGPVNKVLNMICCWAEDPNSKPYKHHLSRIKDYLWVAEDGMKMQGYNGSQCWDVALAVQA  430

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             I+ATNL  E GSML+KAH FI  +Q++ +S  N   +WYRH +KGGWPFSTPDNGW VSD
Sbjct  431   ILATNLFTESGSMLKKAHDFIKNTQVRTNSSRN-PSNWYRHISKGGWPFSTPDNGWSVSD  489

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CTAE LKAAL+LS +  ++VGEA++   LYDAV++ILSLQN++GGFA+YELTRSYPWLE+
Sbjct  490   CTAEGLKAALLLSSIPSEIVGEAVQTDHLYDAVNVILSLQNSTGGFASYELTRSYPWLEM  549

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             +NP+ETFG+IIIDYQYVECTSAAI GLK F KL+PG+RRKEI ACI +A+ FI++IQ PD
Sbjct  550   INPAETFGDIIIDYQYVECTSAAIQGLKSFMKLYPGHRRKEILACIARAVKFIESIQQPD  609

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSWGVCYTYGTWFGI+GLV GG TY++ H IRKACDFLLSKQL SGGWGESYLSCQ
Sbjct  610   GSWYGSWGVCYTYGTWFGIKGLVAGGKTYQTSHSIRKACDFLLSKQLDSGGWGESYLSCQ  669

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             +KVYTN+EGNK HIVNT WAML LI+AGQ 
Sbjct  670   NKVYTNLEGNKPHIVNTGWAMLGLIDAGQA  699



>ref|XP_006474339.1| PREDICTED: cycloartenol synthase 2-like isoform X1 [Citrus sinensis]
Length=766

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/687 (74%), Positives = 581/687 (85%), Gaps = 4/687 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWL S+NNHIGRQ+WEFDPNLGT EERQQV KLR +F +NRF  KHSSDLLMR+QF KE
Sbjct  14    DPWLTSLNNHIGRQFWEFDPNLGTPEERQQVNKLRNDFTENRFLTKHSSDLLMRLQFAKE  73

Query  2045  KGQEMG-LQQVKVGSEEEISEEAVVRT-LRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
                EM  L QVKV  EEEIS+E VV T LRR LRFYS++QA DG WP DYGGPLFLLP L
Sbjct  74    NACEMKQLPQVKVKDEEEISDEQVVSTTLRRALRFYSSLQAEDGFWPGDYGGPLFLLPGL  133

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             V+GL V  A+NA+L  EH++EM+RY+YNHQN DGGWGLHIEG STMFCTAL+YVTLR+LG
Sbjct  134   VMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCSTMFCTALSYVTLRLLG  193

Query  1691  EERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             E  DGG+ GAM+KARKWILD GG T IPSWGK+WLSVLGVYEWSGNNPLPPE+WLLPY +
Sbjct  194   ETMDGGDDGAMEKARKWILDRGGVTSIPSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYFL  253

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P HPGRMWCHCRM+YLPMSYLYG R+VGP NS ILSLR+ELY   YH IDWD ARN CAK
Sbjct  254   PFHPGRMWCHCRMMYLPMSYLYGTRFVGPFNSLILSLRKELYTLPYHSIDWDHARNFCAK  313

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP IQDI+W  LH I EPL+ KWPF+KLR  AL   M HI +EDE T Y+CIGP
Sbjct  314   EDLYYPHPMIQDILWGCLHKIGEPLVKKWPFSKLRHNALKTVMQHIHYEDENTQYICIGP  373

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A K HLSRIKDYLWLAEDGMKM GYNGSQLWDV FAVQAI+A
Sbjct  374   VNKVLNMICCWVEDPNSEAYKRHLSRIKDYLWLAEDGMKMQGYNGSQLWDVTFAVQAILA  433

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             T+L DE GS L+KA  F+  +Q++ED   + L  WYRH +KGGWPFST DNGWPV DCTA
Sbjct  434   TDLVDECGSTLKKAFSFLKNTQVREDCSGD-LNYWYRHISKGGWPFSTADNGWPVLDCTA  492

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAA++LS++  D+VGEAI+ ++LYDAV++ILSLQN++GGFA+YELTRSY WLE++NP
Sbjct  493   EGLKAAILLSQLPADIVGEAIQENQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMINP  552

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F K++PG+RRKEIEACI KA+ FI++ Q PDGSW
Sbjct  553   AETFGDIIIDYQYVECTSAAIQGLKSFMKIYPGHRRKEIEACIEKAIEFIESKQQPDGSW  612

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVC+TYGTWFG++GLV  G TYE+ + I+KAC+FLLSKQL SGGWGES LSCQ+KV
Sbjct  613   YGSWGVCFTYGTWFGVKGLVTCGKTYENSNNIKKACNFLLSKQLDSGGWGESDLSCQNKV  672

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN+EGNK H+VNTAWAML+LIEAGQ 
Sbjct  673   YTNLEGNKSHLVNTAWAMLSLIEAGQA  699



>ref|XP_006453168.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
 gb|ESR66408.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
Length=766

 Score =  1027 bits (2656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/687 (73%), Positives = 579/687 (84%), Gaps = 4/687 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWL S+NNHIGRQ+WEFDPNLGT EERQQV KLR +F +NRF  KHSSDL MR+QF KE
Sbjct  14    DPWLTSLNNHIGRQFWEFDPNLGTPEERQQVNKLRNDFTENRFLTKHSSDLFMRLQFAKE  73

Query  2045  KGQEMG-LQQVKVGSEEEISEEAVVRT-LRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
                EM  L QVKV  EEEIS+E VV T LRR LRFYS++QA DG WP DYGGPLFLLP L
Sbjct  74    NACEMKQLPQVKVKDEEEISDEQVVSTTLRRALRFYSSLQAEDGFWPGDYGGPLFLLPGL  133

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             V+GL V  A+NA+L  EH++EM+RY+YNHQN DGGWGLHIEG STMFCTAL+YVTLR+LG
Sbjct  134   VMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCSTMFCTALSYVTLRLLG  193

Query  1691  EERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             E  DGG+ GAM+KARKWILD GG T IPSWGK+WLSVLGVYEWSGNNPLPPE+WLLPY +
Sbjct  194   ETMDGGDDGAMEKARKWILDRGGVTSIPSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYFL  253

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P HPGRMWCHCRM+YLPMSYLYG R+VGP NS ILSLR+ELY   YH IDWD ARN CAK
Sbjct  254   PFHPGRMWCHCRMMYLPMSYLYGTRFVGPFNSLILSLRKELYTLPYHSIDWDHARNFCAK  313

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLY PHP IQDI+W  LH I EPL+ KWPF+KLR  AL   M HI +EDE T Y+CIGP
Sbjct  314   EDLYNPHPMIQDILWGCLHKIGEPLVKKWPFSKLRHNALKTVMQHIHYEDENTQYICIGP  373

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A K HLSRIKDYLWLAEDGMKM GYNGSQLWDV FAVQAI+A
Sbjct  374   VNKVLNMICCWVEDPNSEAYKRHLSRIKDYLWLAEDGMKMQGYNGSQLWDVTFAVQAILA  433

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             T+L DE GS L+KA  F+  +Q++ED   + L  WYRH +KGGWPFST DNGWPV DCTA
Sbjct  434   TDLVDECGSTLKKAFSFLKNTQVREDCSGD-LNYWYRHISKGGWPFSTADNGWPVLDCTA  492

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAA++LS++  D+VGEAI+ ++LYDAV++ILSLQN++GGFA+YELTRSY WLE++NP
Sbjct  493   EGLKAAILLSQLPADIVGEAIQENQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMINP  552

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F K++PG+RRKEIEACI KA+ FI++ Q PDGSW
Sbjct  553   AETFGDIIIDYQYVECTSAAIQGLKSFMKIYPGHRRKEIEACIEKAIEFIESKQQPDGSW  612

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVC+TYGTWFG++GLV  G TYE+ + I+KAC+FLLSKQL SGGWGES LSCQ+KV
Sbjct  613   YGSWGVCFTYGTWFGVKGLVTCGKTYENSNNIKKACNFLLSKQLDSGGWGESDLSCQNKV  672

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN+EGNK H+VNTAWAML+LIEAGQ 
Sbjct  673   YTNLEGNKSHLVNTAWAMLSLIEAGQA  699



>ref|XP_004299757.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =  1025 bits (2650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/686 (73%), Positives = 577/686 (84%), Gaps = 4/686 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             D  L SVNNHIGRQYWEF  NLGT EER QV++ R EF  NRF+ KHSSDLLMR+QF KE
Sbjct  15    DRRLTSVNNHIGRQYWEFYRNLGTPEERAQVEEARLEFRNNRFRSKHSSDLLMRLQFAKE  74

Query  2045  K-GQEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             K    M L  QVKV SE+EI+EE V  TLRRGL+FYST+Q  DG WP DYGGPLFLLP L
Sbjct  75    KESDRMELPAQVKVKSEDEITEEVVTTTLRRGLKFYSTLQTEDGFWPGDYGGPLFLLPGL  134

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             VIGL+V  A++A+L  +H KE+ RYIYNHQN DGGWGLHIEG STMFCTAL+YV+LR+LG
Sbjct  135   VIGLAVTGALDAILSHQHHKEICRYIYNHQNKDGGWGLHIEGPSTMFCTALSYVSLRLLG  194

Query  1691  EERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             EE DGG+ GAM+KARKWIL  GG T IPSWGK+WLSVLGVYEW GNNPLPPELWLLP  +
Sbjct  195   EEMDGGDDGAMEKARKWILHRGGVTSIPSWGKMWLSVLGVYEWDGNNPLPPELWLLPDFL  254

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P+HPGRMWCHCRMVYLPMSYLYGKR+VGPIN  ILSLRRELY   YH  DWD ARN CAK
Sbjct  255   PVHPGRMWCHCRMVYLPMSYLYGKRFVGPINGLILSLRRELYTFPYHLTDWDQARNLCAK  314

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP +QD++W  LH + EPLL +WPF+KLR+KALT  M+HI +EDE T Y+CIGP
Sbjct  315   EDLYYPHPILQDVLWGSLHKVGEPLLMRWPFSKLRQKALTTVMEHIHYEDENTQYICIGP  374

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A K HL RIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI++
Sbjct  375   VNKVLNMICCWVEDPNSEAYKCHLLRIKDYLWVAEDGMKMQGYNGSQLWDVALAVQAILS  434

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             TNL +EYGS+L+KA+ FI  +Q++ DS    L  WYRH +KGGWPFSTPDNGWPVSDCTA
Sbjct  435   TNLVNEYGSVLKKANGFIKNTQVRRDS-YGDLSYWYRHISKGGWPFSTPDNGWPVSDCTA  493

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAAL LSRM  ++VGEAI   +L+DAV+++LSLQN++GGFA+YELTRSYPWLE++NP
Sbjct  494   EGLKAALSLSRMPREIVGEAIAADQLHDAVNVVLSLQNSNGGFASYELTRSYPWLEMINP  553

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F  L+P +R+KEIEACI KA+ FI++IQLPDGSW
Sbjct  554   AETFGDIIIDYQYVECTSAAIKGLKAFMNLYPWHRKKEIEACIGKAVQFIESIQLPDGSW  613

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVCYTYGTWFGI+GLV  G TY++ + IR+AC FLLSKQL SGGWGES+LSCQ+KV
Sbjct  614   YGSWGVCYTYGTWFGIKGLVASGKTYQTSNSIRRACHFLLSKQLDSGGWGESFLSCQNKV  673

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQ  177
             YTN+EGNK HIVNT WAMLALIEAGQ
Sbjct  674   YTNLEGNKPHIVNTGWAMLALIEAGQ  699



>ref|XP_011019952.1| PREDICTED: cycloartenol synthase 2-like [Populus euphratica]
Length=756

 Score =  1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/685 (70%), Positives = 562/685 (82%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPWLRSVNNH+GRQ+WEFDP+LGT EER QV+  R EF K+RF +KHSSDLLMR QF +
Sbjct  10    NDPWLRSVNNHVGRQFWEFDPHLGTPEERAQVENYRNEFTKSRFLMKHSSDLLMRFQFAR  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E   EM L   KV SEEEI++E V  TLRR LRFYST+Q  DG WP DYGGP+FLLP LV
Sbjct  70    ENPCEMKLPMAKVRSEEEITKEVVDTTLRRSLRFYSTLQTEDGFWPGDYGGPMFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V  A+N +L  +H++EM RY+YNHQN+DGGWGLH+EG STMFCT L+YVTLR+LGE
Sbjct  130   ICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHVEGSSTMFCTVLSYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             E DGG+G+M+KARKW+LDHGGAT IPSWGK+WLSVLGVYEWSGNNPL PELWLLPY+ P 
Sbjct  190   EMDGGDGSMEKARKWVLDHGGATHIPSWGKMWLSVLGVYEWSGNNPLLPELWLLPYLFPA  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGR+WCH RMVYLPMSYLYGK++V    S +LS+RRE+Y   YHQIDW+  RN CAKED
Sbjct  250   HPGRLWCHSRMVYLPMSYLYGKKFVCSTTSLVLSIRREIYTIPYHQIDWEQTRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
              YYPHP +QDIVW  +H  VEPLL +WPF+KLR++AL   M  + +EDETT YVC+GPVN
Sbjct  310   SYYPHPLLQDIVWACIHKAVEPLLTRWPFSKLRQRALDSVMQRVHYEDETTQYVCLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K HL+RIKDYLW+AEDGMKM GYNGSQLWDV FAVQAI+ATN
Sbjct  370   KVLNMLCCWVEDPNSEAYKCHLARIKDYLWVAEDGMKMQGYNGSQLWDVSFAVQAILATN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
               DE+  ML+KAH FI  +Q++ +S  ++   WYRH +KG WPFSTPDNGWPVSDCTAE 
Sbjct  430   FVDEFAPMLKKAHNFIRNTQVRTNSSDDF-NDWYRHISKGAWPFSTPDNGWPVSDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA ++LSR+  D+VGEAI     YDAV++ILSLQN +GGFA+YELTRSY WLE+LNP+E
Sbjct  489   LKAGILLSRLPSDMVGEAIPADWFYDAVNVILSLQNKNGGFASYELTRSYAWLEMLNPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG I+IDYQYVECTSA I GLK F+K +PG+R+KEIEAC+ KA+ FI+  Q PDGSWYG
Sbjct  549   TFGNIMIDYQYVECTSAVIQGLKSFKKSYPGHRKKEIEACMVKAIDFIERTQQPDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI GLV GG TY++   IR AC+FLLSKQL SGGWGESYLS QDKVYT
Sbjct  609   SWGVCFTYGTWFGITGLVAGGRTYQNSSNIRIACEFLLSKQLVSGGWGESYLSSQDKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G K H+VNT WAMLALIEAGQ 
Sbjct  669   NLGGGKSHLVNTGWAMLALIEAGQA  693



>ref|XP_008223939.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol Synthase-like [Prunus 
mume]
Length=742

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/687 (73%), Positives = 561/687 (82%), Gaps = 33/687 (5%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWL SVNNHIGRQYWEFDPNLGT EER QV+K R EF KNRFQ KHSSDLLMR+QF KE
Sbjct  11    DPWLTSVNNHIGRQYWEFDPNLGTPEERDQVEKARHEFRKNRFQSKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGL--QQVKVGS-EEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             K  EM     QVKV S EEEISEEAV  TLRR L FYST+QA DG WP DYGGPLFLLP 
Sbjct  71    KASEMKQVPAQVKVRSDEEEISEEAVGITLRRALSFYSTLQAEDGFWPGDYGGPLFLLPG  130

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LVIGLSV  A++A+L  EHQ+E+ RY+YNHQNIDGGWGLHIEG STMFCTAL+YVTLR+L
Sbjct  131   LVIGLSVTGALHAILPHEHQQEIWRYLYNHQNIDGGWGLHIEGPSTMFCTALSYVTLRLL  190

Query  1694  GEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             GEE DGG+GAM +ARKWILD GG TFIPSWGK+WLSVLGVYEWSGNNPLPPELWLLPY +
Sbjct  191   GEEMDGGDGAMDRARKWILDRGGVTFIPSWGKMWLSVLGVYEWSGNNPLPPELWLLPYSL  250

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             PIHPGRMWCHCRMVYLPMSYLY                             D ARN CAK
Sbjct  251   PIHPGRMWCHCRMVYLPMSYLY-----------------------------DQARNLCAK  281

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP +QDI+W  L  + EPLL KWPF++LR+KAL   M HI +EDE T Y+CIGP
Sbjct  282   EDLYYPHPILQDILWGSLQKVGEPLLMKWPFSRLRQKALRTVMQHIHYEDENTQYICIGP  341

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A K HLSRIKDYLW+AEDGMKM GYNGSQ WDV  AVQAI+A
Sbjct  342   VNKVLNMICCWLEDPNSKAYKNHLSRIKDYLWVAEDGMKMQGYNGSQFWDVALAVQAILA  401

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             TNL +E G +L+KAH FI  +Q+K +S  N L  WYRH +KGGWPFST DNGWPVSDCTA
Sbjct  402   TNLVNESGFVLQKAHNFIKNTQVKTNSSGN-LSYWYRHISKGGWPFSTSDNGWPVSDCTA  460

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAAL+LS M  ++VGEA++  +LYDAV++ILSLQN++GGFA+YELTRSY WLE++NP
Sbjct  461   EGLKAALLLSLMPSEIVGEAMQADQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMINP  520

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F KL+PG+RRKEIEACI KA+ FI++IQLPDGSW
Sbjct  521   AETFGDIIIDYQYVECTSAAIEGLKSFMKLYPGHRRKEIEACIAKAIKFIESIQLPDGSW  580

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVCYTYGTWFGI+GLV GG  Y + H IR+ACDFLLSKQL SGGWGESYLSCQ+KV
Sbjct  581   YGSWGVCYTYGTWFGIKGLVAGGKNYHTSHSIRRACDFLLSKQLGSGGWGESYLSCQNKV  640

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN+EGNK H+VNT WAML LIEAGQ 
Sbjct  641   YTNLEGNKPHMVNTGWAMLGLIEAGQA  667



>ref|XP_002309028.2| hypothetical protein POPTR_0006s07890g [Populus trichocarpa]
 gb|EEE92551.2| hypothetical protein POPTR_0006s07890g [Populus trichocarpa]
Length=756

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/685 (70%), Positives = 560/685 (82%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPWL+SVNNH+GRQ+WEFDP+LGT EER QV+  R EF K+RF  KHSSDLLMR QF +
Sbjct  10    NDPWLKSVNNHVGRQFWEFDPHLGTPEERAQVENYRNEFTKSRFLTKHSSDLLMRFQFAR  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E   EM L   KV SEEEI++E V  TLRR LRFYST+QA DG WP DYGGP+FLLP LV
Sbjct  70    ENPCEMKLPMAKVRSEEEITKEVVDTTLRRSLRFYSTLQAEDGFWPGDYGGPMFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V  A+N +L  +H++EM RY+YNHQN+DGGWGLHIEG STMFCT L+YVTLR+LGE
Sbjct  130   ICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHIEGSSTMFCTVLSYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             E DGG+G+M KARKW+LDHGGAT IPSWGK+WLSVLGVYEWSGNNPL PELWLLPY+ P 
Sbjct  190   EMDGGDGSMGKARKWVLDHGGATHIPSWGKMWLSVLGVYEWSGNNPLLPELWLLPYLFPA  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGR+WCHCRMVYLPMSYLYGK++V    S +LS+RRE+Y   YHQIDWD  RN CAKED
Sbjct  250   HPGRLWCHCRMVYLPMSYLYGKKFVCSTTSLVLSIRREIYTIPYHQIDWDQTRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDIVW  +H  VEPL  +WP +KLR++AL   M  + +EDETT YVC+GPVN
Sbjct  310   LYYPHPLLQDIVWACIHKAVEPLFTRWPLSKLRQRALDSVMQRVHYEDETTQYVCLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K HL+RI DYLW+AEDGMKM GYNGSQLWDV FAVQAI+ATN
Sbjct  370   KVLNMLCCWVEDPNSEAYKCHLARINDYLWVAEDGMKMQGYNGSQLWDVSFAVQAILATN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
               DE+  ML+KAH F+  +Q++ +S  ++   W RH +KG WPFSTPDNGWPVSDCTAE 
Sbjct  430   FADEFAPMLKKAHNFMKNTQMRTNSSDDF-NDWNRHISKGAWPFSTPDNGWPVSDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA ++LSR+  D+VGEAI     YDAV++ILSLQN +GGFA+YELTRSY WLE+LNP+E
Sbjct  489   LKAGILLSRLPSDMVGEAIPADWFYDAVNVILSLQNKNGGFASYELTRSYAWLEMLNPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG I+IDYQYVECTSA I GLK F+K +PG+R+KEIEAC+ KA+ FI+  Q PDGSWYG
Sbjct  549   TFGNIMIDYQYVECTSAVIQGLKSFKKSYPGHRKKEIEACMVKAIDFIERTQQPDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI+GLV GG TY++   IR AC+FLLSKQL SGGWGESYLS QDKVYT
Sbjct  609   SWGVCFTYGTWFGIKGLVAGGRTYQNSSSIRIACEFLLSKQLVSGGWGESYLSSQDKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G K H+VNT WAMLALIEAGQ 
Sbjct  669   NLGGGKSHLVNTGWAMLALIEAGQA  693



>emb|CBD47302.1| cycloartenol synthase [Dioscorea zingiberensis]
Length=759

 Score =   999 bits (2582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/700 (67%), Positives = 574/700 (82%), Gaps = 4/700 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GRQ WEFDPNL T EE  +V++ R  FH++RF+ KHSSDLLMR+QF KE
Sbjct  11    NPWLRTTNNHVGRQVWEFDPNLRTPEELAEVERAREAFHQHRFEKKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L QVKV  +E+++EEAV  T+RR +  +ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPLELTLPQVKVRDDEDVTEEAVTTTVRRAISRHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQ+E+ RY+YNHQN DGGWGLHIEGHSTMF +AL Y+TLR+LGE+
Sbjct  131   ALYVTGALNTVLSPEHQREICRYLYNHQNKDGGWGLHIEGHSTMFGSALTYITLRLLGEK  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              +GG+GAM++ RKWILDHGGATFI SWGK WLSVLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  191   TEGGDGAMQRGRKWILDHGGATFITSWGKFWLSVLGVFDWSGNNPLPPEVWMLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+VGPI   I SLR+ELYN  Y QI+W+LARNQCAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGKRFVGPITPLIQSLRKELYNLSYDQINWNLARNQCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP ++LR+KAL   M HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILLRWPGSRLREKALHSTMQHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K HL RI DYLW+AEDGMKM GYNGSQLWD  F VQAI+AT+L
Sbjct  371   VLNMLCCWVEDPNSEAFKFHLPRIYDYLWVAEDGMKMQGYNGSQLWDTAFTVQAIVATDL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+KAH +I  +Q+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   SEEFGPPLKKAHDYIKNTQVLEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LSR++ ++VGE ++  RLY+AV++ILSL N  GGFATYELTRSY W+EI+NP+ET
Sbjct  490   KASLLLSRISPEIVGEPVDAKRLYNAVNVILSLMNEDGGFATYELTRSYAWMEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI KA++FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIECCIKKAVSFIEKIQKPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+ GG TY++   IRKACDFLLSK+LPSGGWGESYLSCQDKVYTN
Sbjct  610   WAVCFTYGTWFGVLGLIAGGKTYQNSPCIRKACDFLLSKELPSGGWGESYLSCQDKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFIN  135
             +EGN+ H VNT+W MLALI AGQ     + +  G K+ IN
Sbjct  670   LEGNRPHAVNTSWVMLALIGAGQAERDPMPLHRGAKVLIN  709



>emb|CAM91422.1| cycloartenol synthase [Dioscorea zingiberensis]
Length=759

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/700 (67%), Positives = 573/700 (82%), Gaps = 4/700 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GRQ WEFDPNL T EE  +V++ R  FH++RF+ KHSSDLLMR+QF KE
Sbjct  11    NPWLRTTNNHVGRQVWEFDPNLRTPEELAEVERAREAFHQHRFEKKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L QVKV  +E+++EEAV  T+RR +  +ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPLELTLPQVKVRDDEDVTEEAVTTTVRRAISRHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQ+E+ RY+YNHQN DGGWGLHIEGHSTMF +AL Y+TLR+LGE+
Sbjct  131   ALYVTGALNTVLSPEHQREICRYLYNHQNKDGGWGLHIEGHSTMFGSALTYITLRLLGEK  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              +GG+GAM++ RKWILDHGGATFI SWGK WLSVLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  191   TEGGDGAMQRGRKWILDHGGATFITSWGKFWLSVLGVFDWSGNNPLPPEVWMLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+VGPI   I SLR+ELYN  Y QI+W+LARNQCAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGKRFVGPITPLIQSLRKELYNLSYDQINWNLARNQCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP ++LR+KAL   M HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILLRWPGSRLREKALHSTMQHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K HL RI DYLW+AEDGMKM GYNGSQLWD  F VQAI+AT+L
Sbjct  371   VLNMLCCWVEDPNSEAFKFHLPRIYDYLWVAEDGMKMQGYNGSQLWDTAFTVQAIVATDL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+KAH +I  +Q+ ED   + L  WYRH +KG WPFST D+GW +SDCTAE L
Sbjct  431   SEEFGPPLKKAHDYIKNTQVLEDCPGD-LSFWYRHISKGAWPFSTADHGWTISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LSR++ ++VGE ++  RLY+AV++ILSL N  GGFATYELTRSY W+EI+NP+ET
Sbjct  490   KASLLLSRISPEIVGEPVDAKRLYNAVNVILSLMNEDGGFATYELTRSYAWMEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI KA++FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIECCIKKAVSFIEKIQKPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+ GG TY++   IRKACDFLLSK+LPSGGWGESYLSCQDKVYTN
Sbjct  610   WAVCFTYGTWFGVLGLIAGGKTYQNSPCIRKACDFLLSKELPSGGWGESYLSCQDKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFIN  135
             +EGN+ H VNT+W MLALI AGQ     + +  G K+ IN
Sbjct  670   LEGNRPHAVNTSWVMLALIGAGQAERDPMPLHRGAKVLIN  709



>gb|EYU23540.1| hypothetical protein MIMGU_mgv1a020935mg [Erythranthe guttata]
Length=758

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/687 (69%), Positives = 560/687 (82%), Gaps = 7/687 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPW+ S NN+ GRQ+WEFD   GT EE  QV+K R  F   R+ IK SSD LM +QF+K
Sbjct  11    EDPWITSTNNNAGRQFWEFDRIPGTPEEEAQVEKARDCFRSRRYHIKQSSDALMGIQFKK  70

Query  2048  EKGQ--EMGLQQVKVGSEEEI-SEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLP  1878
             +K    E+ ++QVKV SEEEI SEE VV+ L R LRFYST+QA DGHWP DY GPLFLLP
Sbjct  71    KKKNCGELDMEQVKVASEEEIKSEETVVKALTRALRFYSTLQAEDGHWPGDYSGPLFLLP  130

Query  1877  FLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRI  1698
              LVI L+VM A+ +++ +EH+KE+LRY+YNHQNIDGGWGLH E  S+MF T LNYV LR+
Sbjct  131   GLVIALTVMGAVKSIISDEHKKEILRYLYNHQNIDGGWGLHTEARSSMFSTTLNYVALRL  190

Query  1697  LGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             LG+E DGG+GAM KAR WIL HGGATF+ SWGK WLSVLGVYEW G+NPLPPELWLLPY 
Sbjct  191   LGQEMDGGDGAMHKARTWILVHGGATFVSSWGKCWLSVLGVYEWEGSNPLPPELWLLPYF  250

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             VP+HPGRMWC  R+VYLPMSYLYGKR+VGPIN  ILSLR+ELY   YH IDW+LARNQC+
Sbjct  251   VPVHPGRMWCQTRLVYLPMSYLYGKRFVGPINGLILSLRKELYTQSYHMIDWNLARNQCS  310

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KED+Y+P P +Q+I+W+ LH   EPL  +WPF KLR  ALT  + HI +ED TTNY+C G
Sbjct  311   KEDVYFPRPLLQEIIWNCLHKFGEPLAMQWPFCKLRNTALTTVIKHIHNEDVTTNYLCAG  370

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNM+C WI++P+S+AVK HLSRIKDYLW+AEDG+KM GYNGSQLWD   AV+ I+
Sbjct  371   PVNKVLNMLCCWIDDPESVAVKRHLSRIKDYLWVAEDGLKMKGYNGSQLWDTALAVRGIV  430

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
              TNL  EYG ML++AH FI +SQI  DS      S YRHS+KGGWPFST D+GWPVSDCT
Sbjct  431   GTNLPQEYGFMLKRAHEFIKISQITSDSS----GSRYRHSSKGGWPFSTADHGWPVSDCT  486

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AE LKAA+MLS +  ++ G+A+E ++L+DAVDLILSLQN+SGGFATYELTRSY W+E++N
Sbjct  487   AEGLKAAIMLSELPSEIAGQALEQNKLHDAVDLILSLQNSSGGFATYELTRSYAWIEVIN  546

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             PSETFG I+IDYQYVECTS+AI GLK F K++P YRRKEIEACI+KAL FI++IQL DGS
Sbjct  547   PSETFGNIVIDYQYVECTSSAIQGLKQFNKIYPNYRRKEIEACIDKALQFIESIQLSDGS  606

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWG+CYTYGTWFGI GLV GG TYE+   +RKACDFLLSKQLP GGWGESYLS QDK
Sbjct  607   WYGSWGICYTYGTWFGITGLVAGGKTYENSLSVRKACDFLLSKQLPCGGWGESYLSSQDK  666

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             VYTNI  +K H VNT WAMLALIEAGQ
Sbjct  667   VYTNIAKDKSHNVNTGWAMLALIEAGQ  693



>ref|XP_011094034.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094035.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094036.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094037.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094038.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
Length=757

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/703 (66%), Positives = 566/703 (81%), Gaps = 4/703 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
               PWLRSVN H+GRQ WEF+P+LG+ EE  +++KLR EF  +RFQ KHSSDLLMR QF K
Sbjct  10    SSPWLRSVNGHVGRQIWEFNPSLGSPEELAEIEKLREEFRNHRFQKKHSSDLLMRFQFSK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV   E+I+E+ V  TLRR + F+ST+QAHDGHWP DYGGP+FL+P LV
Sbjct  70    ENPSTTNLPQVKVKDIEDITEDKVATTLRRAISFHSTLQAHDGHWPGDYGGPMFLMPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NA+L +EH++E+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE
Sbjct  130   ITLSITGALNAILSKEHRREICRYLYNHQNPDGGWGLHIEGPSTMFGSVLTYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             E + G+GAM+K R WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPYI+P 
Sbjct  190   EPNDGDGAMEKGRNWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYILPF  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH+IDWD ARN+CAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEIDWDRARNECAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  LH  VEP+L +WP  KLR KAL   M+HI +EDE T Y+CIGPVN
Sbjct  310   LYYPHPVVQDLLWASLHKAVEPVLMRWPGKKLRDKALRTVMEHIHYEDENTRYICIGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  370   KVLNMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +E+G  LR+AH +I  SQ+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  430   LAEEFGPTLRRAHTYIKNSQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  ++VGE ++  RLYDAV++I SLQN +GGFATYELTRSY WLE++NP+E
Sbjct  489   LKAVLLLSKLPAEIVGEPLDAKRLYDAVNVIFSLQNTAGGFATYELTRSYSWLELINPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+R++E+E CI K+  FI+ IQ  DGSWYG
Sbjct  549   TFGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKEEVERCIEKSAKFIERIQEADGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SW VC+TYGTWFGI+GLV  G ++ +C  IRKAC+FLLSKQLP GGWGESYLSCQ+KVY+
Sbjct  609   SWAVCFTYGTWFGIKGLVAAGRSFNNCAAIRKACNFLLSKQLPCGGWGESYLSCQNKVYS  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFINNH  129
             N+EGN+ H+VNT WAML+LI+AGQ     L +    K+ IN+ 
Sbjct  669   NLEGNRSHVVNTGWAMLSLIDAGQAERDPLPLHRAAKVLINSQ  711



>gb|EYU26563.1| hypothetical protein MIMGU_mgv1a001814mg [Erythranthe guttata]
Length=756

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/686 (70%), Positives = 565/686 (82%), Gaps = 5/686 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDP-NLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFE  2052
             D+  L S NNH+GRQ+WEFDP  +GT E+   V+K RA+F  +R++IK SSDLLMR Q  
Sbjct  12    DNECLTSFNNHVGRQFWEFDPLFVGTPEQHALVEKARADFRNSRYEIKQSSDLLMRNQLA  71

Query  2051  KEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             K+  +       +   EE   EE VV TLR+ LRFYST+QA DGHWP DYGGPLFLLP L
Sbjct  72    KKSDEH---ISEEEEEEEISREEKVVNTLRKALRFYSTLQAEDGHWPGDYGGPLFLLPGL  128

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             VI LSVM+A+  ++ +EH+KEM RY+YNHQN+DGGWGLHIEG S++FCT LNYV+LR+LG
Sbjct  129   VIALSVMDAVKTIITDEHKKEMCRYLYNHQNLDGGWGLHIEGRSSIFCTVLNYVSLRLLG  188

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             +E DGG+GAM KAR WILDHGGAT+IPSWGK WLSVLGVYEW GNNPLPPELWLLPY +P
Sbjct  189   QEMDGGDGAMHKARTWILDHGGATYIPSWGKCWLSVLGVYEWDGNNPLPPELWLLPYFLP  248

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPGRMWCHCRMVYLPMSYLYGKR++GPI+  +LSLR+ELYN  YHQIDW+LARNQC+KE
Sbjct  249   IHPGRMWCHCRMVYLPMSYLYGKRFIGPISGVVLSLRKELYNQAYHQIDWNLARNQCSKE  308

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLY+PHP IQDI+W  LH   EPL+ KWPF+KLR +AL+  M HI++ED  TNY+CIGPV
Sbjct  309   DLYFPHPLIQDILWKCLHKFAEPLVMKWPFSKLRNRALSTVMKHIEYEDVNTNYLCIGPV  368

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKV+NM+C WI++P+S AVK HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ T
Sbjct  369   NKVMNMLCCWIDDPNSTAVKRHLSRIKDYLWVAEDGMKMNGYNGSQLWDVVLAVQAIVGT  428

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL  EY  ML++AH FI +SQ+ +DS  + L  WYRHS+KGGWPFST DNGW   DCTAE
Sbjct  429   NLPQEYDLMLKRAHQFIKMSQMSKDSSGD-LSCWYRHSSKGGWPFSTADNGWAAGDCTAE  487

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LKAAL+LS++  ++ G+A+E ++LYDAVDLILSLQN+SGGFA+YELTRS  WLE++NPS
Sbjct  488   GLKAALILSQLPYEIAGQALEQNKLYDAVDLILSLQNSSGGFASYELTRSNAWLEMINPS  547

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             E FG+IIIDYQYVECTSAAI GLK F KL+PGYRRK IEACI +AL FI+++QL DGSWY
Sbjct  548   EIFGDIIIDYQYVECTSAAIQGLKQFSKLYPGYRRKNIEACIKEALHFIESMQLSDGSWY  607

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSW VCYTYGTWFGI GL+ GG TYE+   +RK C+FLLSKQLPSGGWGESYLS QDKVY
Sbjct  608   GSWAVCYTYGTWFGITGLITGGKTYENSLAVRKGCEFLLSKQLPSGGWGESYLSSQDKVY  667

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQV  174
             TN+  +  HIVNT WAMLALIEAGQ 
Sbjct  668   TNVGKDVSHIVNTGWAMLALIEAGQA  693



>ref|XP_010271332.1| PREDICTED: cycloartenol Synthase isoform X2 [Nelumbo nucifera]
Length=757

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/683 (69%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP   T E   +V+K R  F K RF+ KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPESRTPEHLMEVEKARDHFTKLRFEKKHSSDLLMRLQFTKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               ++ L QVKV   E+++EEAV  TLRR + FYSTIQAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PFDIQLPQVKVQDTEDVTEEAVTITLRRAISFYSTIQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V   +NAVL +EHQ+EM RYIYNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  
Sbjct  132   LHVTGTLNAVLTKEHQREMCRYIYNHQNRDGGWGLHIEGPSTMFGTALNYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             D G GAM+K  +WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WL  Y++P HP
Sbjct  192   DSGQGAMEKGHRWILDHGGATEITSWGKMWLSVLGAFEWSGNNPLPPEIWLCSYLLPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+ELY   YH++DW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELYTVPYHEVDWNQARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QD++W  LH ++EP+L  WP  KLR+KAL   M HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDLLWASLHKVLEPILMSWPGKKLREKALFTVMQHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P++ A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAIIA+NL 
Sbjct  372   LNMLCCWVEDPNTEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIIASNLT  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHEYIKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS+++ ++VGE ++  RLYDAV+++LSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLLLSKISSNIVGEPLDSRRLYDAVNVVLSLQNKDGGFATYELTRSYSWLELVNPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI KA  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALASFKKLYPGHRREEIENCIRKAAKFIEKIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             G+C+TY TWFGI+GL+  G T++    IRKACDFLLSKQL SGGWGESYLSCQ+KVYT++
Sbjct  611   GICFTYATWFGIKGLITAGKTFKDSSSIRKACDFLLSKQLDSGGWGESYLSCQNKVYTDL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK HIVNT WAMLALI++GQ 
Sbjct  671   EGNKAHIVNTGWAMLALIDSGQA  693



>ref|XP_010271331.1| PREDICTED: cycloartenol Synthase isoform X1 [Nelumbo nucifera]
Length=758

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/683 (69%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP   T E   +V+K R  F K RF+ KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPESRTPEHLMEVEKARDHFTKLRFEKKHSSDLLMRLQFTKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               ++ L QVKV   E+++EEAV  TLRR + FYSTIQAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PFDIQLPQVKVQDTEDVTEEAVTITLRRAISFYSTIQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V   +NAVL +EHQ+EM RYIYNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  
Sbjct  132   LHVTGTLNAVLTKEHQREMCRYIYNHQNRDGGWGLHIEGPSTMFGTALNYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             D G GAM+K  +WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WL  Y++P HP
Sbjct  192   DSGQGAMEKGHRWILDHGGATEITSWGKMWLSVLGAFEWSGNNPLPPEIWLCSYLLPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+ELY   YH++DW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELYTVPYHEVDWNQARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QD++W  LH ++EP+L  WP  KLR+KAL   M HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDLLWASLHKVLEPILMSWPGKKLREKALFTVMQHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P++ A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAIIA+NL 
Sbjct  372   LNMLCCWVEDPNTEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIIASNLT  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHEYIKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS+++ ++VGE ++  RLYDAV+++LSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLLLSKISSNIVGEPLDSRRLYDAVNVVLSLQNKDGGFATYELTRSYSWLELVNPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI KA  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALASFKKLYPGHRREEIENCIRKAAKFIEKIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             G+C+TY TWFGI+GL+  G T++    IRKACDFLLSKQL SGGWGESYLSCQ+KVYT++
Sbjct  611   GICFTYATWFGIKGLITAGKTFKDSSSIRKACDFLLSKQLDSGGWGESYLSCQNKVYTDL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK HIVNT WAMLALI++GQ 
Sbjct  671   EGNKAHIVNTGWAMLALIDSGQA  693



>ref|XP_011078187.1| PREDICTED: cycloartenol synthase-like isoform X2 [Sesamum indicum]
Length=756

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/685 (71%), Positives = 565/685 (82%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +D WL++ N+H GRQ+WEFDP  GT EER  V+K R+ F  +R + KHSSDLLMR+QF K
Sbjct  10    NDAWLKNSNDHTGRQFWEFDPTAGTAEERALVEKARSNFKASRNETKHSSDLLMRIQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E   E+ L QVKV SEEEI+EE  V TL+R +RFYS++QA DGHWP DYGGPLFLLP L+
Sbjct  70    ENPSEVELPQVKVDSEEEITEETTVITLKRAMRFYSSLQAEDGHWPGDYGGPLFLLPGLI  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+M+++N +L EEHQKE+ RY+YNHQN DGGWGLHIEG S+MFCTALNYV+LR+LGE
Sbjct  130   IALSIMDSLNTILPEEHQKEIRRYLYNHQNPDGGWGLHIEGRSSMFCTALNYVSLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               DGG+GAM KAR WIL+ GGAT+ PSWGK WLSVLGVYEW GNNPLPPELWLLPY +PI
Sbjct  190   GADGGDGAMHKARTWILERGGATYTPSWGKFWLSVLGVYEWEGNNPLPPELWLLPYFLPI  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI   ILSLR+ELY   YHQIDWDLARNQC+KED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITDIILSLRKELYAQSYHQIDWDLARNQCSKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY+PHP +QDI+W  LH  VEPLL +WP +KLR +AL+  M HIQ+ED  TNY+C+G V+
Sbjct  310   LYFPHPLLQDILWKCLHKFVEPLLMQWPLSKLRHRALSTVMKHIQYEDVNTNYLCLGAVD  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WI  P S+AVK HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ TN
Sbjct  370   KVLNMLCCWINNPSSMAVKRHLSRIKDYLWVAEDGMKMKGYNGSQLWDVTLAVQAIVGTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EYGS L++AH FI  SQ++ DS      SWYRH +KGGWPFST DNGWP  DCTAE 
Sbjct  430   LPHEYGSTLKRAHEFIKKSQLRNDSP-GTPGSWYRHGSKGGWPFSTADNGWPALDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK AL+LS +  +V GEA+EP +LY+AVDLILSLQN+SGGFA+YELTRSY WLE++NP +
Sbjct  489   LKTALILSLLPPEVAGEALEPDKLYNAVDLILSLQNSSGGFASYELTRSYAWLEMINPVQ  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDYQ+ ECTSAAI GLK F +LHPG R K+I+ CI KAL FI++ QL DGSWYG
Sbjct  549   TFGDIMIDYQHAECTSAAIQGLKMFNRLHPGCRGKDIQTCIKKALNFIESTQLSDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVCYTYGTWFGI GL+ GG TYE+   +RKACDFLLSKQLPSGGWGESYLS QDKVYT
Sbjct  609   SWGVCYTYGTWFGITGLIAGGKTYENSLSVRKACDFLLSKQLPSGGWGESYLSSQDKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             NI  NK HIVNTAWAMLAL+EAGQ 
Sbjct  669   NIRNNKSHIVNTAWAMLALLEAGQA  693



>ref|XP_010541955.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541956.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541957.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541958.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
Length=757

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 560/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+ NNH+GRQ WEFDP LGT EE  ++++ R  F +NRF  KHSSDLLMR+QF +E
Sbjct  11    SPWLRTTNNHVGRQVWEFDPRLGTPEELAEIEEARKSFAENRFVHKHSSDLLMRLQFSRE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QV+V   ++ISEE V  TLRR L F+STIQAHDGHWP DYGGP+FLLP LVI
Sbjct  71    NPVRQVLPQVEVKDTDDISEEMVANTLRRALNFHSTIQAHDGHWPGDYGGPMFLLPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVT+R+LGE 
Sbjct  131   ALSITGALNAVLSEQHKQEMCRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTMRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WIL+HGGAT+I SWGK+WL+VLGV+EWSGNNPLPPE+WLLPYI+PIH
Sbjct  191   PNDGDGAMEKGRDWILNHGGATYITSWGKMWLTVLGVFEWSGNNPLPPEIWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH++DW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHEVDWNKARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPVVQDILWASLHKVVEPILMRWPVTKLREKALRTAIEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FA+QAI ATN 
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTAFAIQAIFATNF  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG +L+KA+ +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCT+E L
Sbjct  431   VEEYGDVLKKANSYIKKSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTSEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E  RLYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  490   KAALLLSKVSPEIVGEPVEAKRLYDAVNVILSLQNADGGFATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+R+KE++ CI KA  FI++ Q PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRQKEVDQCIKKAAKFIESSQAPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TY  WFG++GLV  G T+ +   IRKAC+FLLSKQLPSGGWGESYLSCQDKVYT 
Sbjct  610   WAVCFTYAIWFGVKGLVATGKTFSNSASIRKACEFLLSKQLPSGGWGESYLSCQDKVYTK  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQ  177
             ++GN+ H+VNT WAML LI AGQ
Sbjct  670   LKGNRSHVVNTGWAMLTLIGAGQ  692



>gb|AIW81530.1| cycloartenol synthase protein [Dioscorea composita]
Length=759

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/684 (67%), Positives = 563/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLRS NNH+GRQ WEFDPNLG+ EE  +V+K+R  F ++R++ KHSSDLLMR+QF KE
Sbjct  11    SPWLRSTNNHVGRQVWEFDPNLGSPEELAEVEKVREAFRQHRYEKKHSSDLLMRLQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L QVK+G + +++EEAV   LRR +  +ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPLELTLPQVKIGDDGDVTEEAVTTVLRRAISRHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  +HQ+E++RY+YNHQN DGGWGLHIEGHSTMF + L Y+TLR+LGEE
Sbjct  131   ALYVTGALNTVLSAQHQQEIIRYLYNHQNKDGGWGLHIEGHSTMFGSVLTYITLRLLGEE  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              +GG+G+M++ RKWILDHGGATFI SWGK WLSVLGV++WSGNNPLPPE+W+LPYI+PIH
Sbjct  191   AEGGDGSMQRGRKWILDHGGATFITSWGKFWLSVLGVFDWSGNNPLPPEMWMLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+VGPI   +LSLR+ELYN  Y +IDW+LARNQCAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGKRFVGPITPLVLSLRKELYNLSYDRIDWNLARNQCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH   EP+L  WP +KLR+KAL   M HI +EDE T YVCIGPVNK
Sbjct  311   YYPHPLLQDILWASLHKFAEPILLHWPGSKLREKALRTTMQHIHYEDENTRYVCIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  F VQAI+ATNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIVATNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+   L+KAH +I  +Q+++D   + L  WYRH +KG WPFST D+GWP+SDCT+E L
Sbjct  431   SEEFAHPLKKAHDYIRNTQVRDDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTSEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +   RLY AV++ILSL N  GGFATYELTRSY W+E++NP+ET
Sbjct  490   KASLLLSQISREIVGEPLNAERLYGAVNVILSLMNEDGGFATYELTRSYAWMELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSA+I  L  F+KL+P +RR+EIE+CI KA+ FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSASIQALTSFKKLYPKHRREEIESCIKKAVEFIEKIQKPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYG WFGI GL+ GG TY++   +RKACDFLLSK+LPSGGWGESYLSCQDKVYTN
Sbjct  610   WAVCFTYGIWFGILGLIAGGRTYQNSSSVRKACDFLLSKELPSGGWGESYLSCQDKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H VNT WAMLALI+AGQ 
Sbjct  670   LEGNRAHAVNTGWAMLALIDAGQA  693



>gb|ADC84219.1| putative 2,3 oxidosqualene cyclase [Actaea racemosa]
 gb|ADC84220.1| putative 2,3 oxidosqualene cyclase [Actaea racemosa]
Length=757

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/685 (69%), Positives = 557/685 (81%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPWLRSVNNH+GRQ WEFD NLGT EE  +V+K R +F  ++F+ KHSSDLLMR+Q  K
Sbjct  10    EDPWLRSVNNHVGRQVWEFDRNLGTPEELIEVEKAREDFSNHKFEKKHSSDLLMRLQLAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E    + L +V+V   EE++EEAV  TLRRGL FYSTIQ HDGHWP DYGGPLFL+P LV
Sbjct  70    ENPCSIDLPRVQVKDTEEVTEEAVTTTLRRGLSFYSTIQGHDGHWPGDYGGPLFLMPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LSV  A+NAVL  EHQ+E  RYIYNHQN DGGWGLHIEG STMF T LNYVTLR+LGE
Sbjct  130   IALSVTGALNAVLSSEHQRETRRYIYNHQNEDGGWGLHIEGSSTMFITTLNYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               D G GAM+KARKWIL+HG AT   SWGK+WLSVLGV+EWSGNNPLPPE+WLLPY +P 
Sbjct  190   GADDGEGAMEKARKWILNHGSATATTSWGKMWLSVLGVFEWSGNNPLPPEMWLLPYCLPF  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY+  YH+IDW+ ARN CAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTIESLRKELYSVPYHEIDWNQARNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH  VEP+L +WP NKLR+K+L   M HI +EDE T Y+CIGPVN
Sbjct  310   LYYPHPLVQDILWTSLHYGVEPILTRWPANKLREKSLLTTMQHIHYEDENTRYICIGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  370   KVLNMLCCWVEDPNSEAFKLHIPRIYDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIISTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L ++Y   LRKAH +I  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  430   LFEDYAPTLRKAHKYIKDSQVLDDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS++    VG+ I   +LYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+E
Sbjct  489   LKAALLLSKIPSKSVGDPINAKQLYDAVNVILSLQNGDGGFATYELTRSYPWLELINPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECT+AAI  L  F+KL+PG+RR++IE C+ KA+ F++ IQ PDGSWYG
Sbjct  549   TFGDIVIDYPYVECTAAAIQALTSFKKLYPGHRREDIENCVEKAVKFLKEIQAPDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GLV  G T+ +   IRKACDFLLSK+L SGGWGESYLSCQ+KVYT
Sbjct  609   SWGVCFTYGIWFGIKGLVAAGETFTNSSSIRKACDFLLSKELDSGGWGESYLSCQNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N++GN+ H+VNT WAM ALI+AGQ 
Sbjct  669   NLKGNRPHLVNTGWAMSALIDAGQA  693



>gb|AIU41742.1| cycloartenol synthase [Chlorophytum borivilianum]
Length=758

 Score =   986 bits (2549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/685 (68%), Positives = 564/685 (82%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ NNH+GRQ WEFD N  G+ EE  +++  R  F  NRF  KHS+DLLMR+QFE+
Sbjct  11    NPWLRTTNNHVGRQIWEFDSNYQGSHEELLEIENARRNFSDNRFNQKHSADLLMRIQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      + QVK+   E+++EEAV RTLRR L +YS IQAHDGHWP DYGGP+FL+P LV
Sbjct  71    ENPLREVIPQVKLKDNEDVTEEAVTRTLRRALNYYSVIQAHDGHWPGDYGGPMFLMPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NAVL EEH+KEM+RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE
Sbjct  131   ITLSITGALNAVLSEEHKKEMIRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G+GAM+ AR WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPYI+P 
Sbjct  191   GANEGDGAMENARNWILNHGGATAITSWGKMWLSVLGCFEWSGNNPLPPEIWLLPYILPF  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+EL+   YH IDW+ ARN CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELFTVPYHDIDWNQARNSCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  LH  VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDVLWGCLHKFVEPVLLHWPGKKLREKALCTAIEHIHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAIIATN
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRIHDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIIATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L DEYG+ L KAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  431   LVDEYGATLGKAHSYIKNSQVLEDCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL LS++  ++VGE +E +RLY+AV++ILSLQN  GGFATYELTRSYPWLE++NP+E
Sbjct  490   LKAALSLSKIPAEIVGEPLEANRLYNAVNVILSLQNADGGFATYELTRSYPWLELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+RR++IE CI+KA  F+++IQL DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALASFKKLYPGHRRQDIENCISKATAFLESIQLNDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI+GLV  G  +++C  IR+AC+FLLSKQ  SGGWGESYLSCQ+KVY+
Sbjct  610   SWGVCFTYGTWFGIKGLVAAGKNFKNCSAIRQACNFLLSKQCASGGWGESYLSCQNKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGN+ H+VNT+WAMLALI+AGQ+
Sbjct  670   NLEGNRTHVVNTSWAMLALIDAGQI  694



>gb|AIK19224.1| triterpene synthase [Eugenia uniflora]
Length=757

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/684 (68%), Positives = 561/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLRS+NNH+GRQ WEFDPN G+ EE Q+++  RA F K+RF+ KHSSDL+MR+QF KE
Sbjct  11    NPWLRSLNNHVGRQIWEFDPNCGSPEEIQEIEDARANFAKHRFEKKHSSDLIMRIQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L  VKV   +EI+EE V   L+R + F+ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NTGNVVLPPVKVKDSDEITEETVTHILKRAISFHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE 
Sbjct  131   ALSITGALNAVLSEQHKQEMCRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVTLRLLGEA  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+KA+KWILDHG AT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++P H
Sbjct  191   ANDGQGAMEKAQKWILDHGSATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QDI+W  LH  VEP+L  WP  KLR+K L  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPMAQDILWATLHKAVEPILLNWPGKKLREKGLRTAIEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  FA QAII+TNL
Sbjct  371   VLNMLCCWAEDPNSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTVFAAQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+GS L+KAH++I  SQ+ ED   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEFGSTLQKAHMYIKNSQVLEDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  ++VGE I+  RLYDAV++ILSLQN+ GGFATYELTRSY WLE++NP+ET
Sbjct  490   KAALLLSKIPSEIVGEPIDAKRLYDAVNVILSLQNDDGGFATYELTRSYAWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RR+EI+ CI +A  FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIQDCIERAARFIEKIQAPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG+ GLV  G +Y +   +RKAC+FLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGVLGLVAAGRSYTNSASLRKACEFLLSKQLASGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG++ H+VNT+WAMLALI+AGQ 
Sbjct  670   LEGDRSHVVNTSWAMLALIDAGQA  693



>ref|XP_010048521.1| PREDICTED: cycloartenol synthase-like [Eucalyptus grandis]
 gb|KCW80791.1| hypothetical protein EUGRSUZ_C02167 [Eucalyptus grandis]
Length=765

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/706 (67%), Positives = 578/706 (82%), Gaps = 8/706 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             + W+ SVN+HIGRQYWEFDPN   ++EE  +V++ +  F  NRFQ KHSSDLLMR+QF +
Sbjct  11    EAWVTSVNHHIGRQYWEFDPNPEASEEELARVEEAQNRFQMNRFQAKHSSDLLMRLQFAR  70

Query  2048  EKG--QEMGLQQVKVGSEEEISEE-AVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLP  1878
             E    +   LQ  +V +EEE+ E  A+ +TLRRGLR+Y+++QA DG WP DYGGPLFLLP
Sbjct  71    ENPTVETKELQPGQVENEEEVDEAMAIEKTLRRGLRYYASLQAEDGFWPGDYGGPLFLLP  130

Query  1877  FLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRI  1698
              LVI L V  A+  +L  EHQ+E+ R++YNHQN DGGWGLHIEG STMFCT L+YVTLR+
Sbjct  131   GLVISLHVTGALTTILSSEHQREIRRHLYNHQNGDGGWGLHIEGRSTMFCTTLSYVTLRL  190

Query  1697  LGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             LGE   GG+G M KARKWILDHGGAT+IP+WGK+WLSVLGVY+WSGNNPLPPE+WLLP+ 
Sbjct  191   LGEGESGGDGTMDKARKWILDHGGATYIPAWGKMWLSVLGVYDWSGNNPLPPEIWLLPHF  250

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             +PIHPGR WCHCRMVYLPMSYLYGKR+VG INST+LSLRRELY   YHQIDWD ARN CA
Sbjct  251   LPIHPGRFWCHCRMVYLPMSYLYGKRFVGRINSTVLSLRRELYTTYYHQIDWDKARNLCA  310

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLYYPHP +QD++W GLH I EPLL +WP +KLRKKAL   M HI +EDE T Y+C+G
Sbjct  311   KEDLYYPHPWVQDVLWSGLHKIGEPLLMQWPLSKLRKKALDHVMQHIHYEDENTRYICLG  370

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNM+C W+E+ +S A K HL RIKDYLW+AEDGMKM GYNGSQLWDV F+VQAI+
Sbjct  371   PVNKVLNMVCCWVEDSNSEAFKRHLPRIKDYLWVAEDGMKMQGYNGSQLWDVAFSVQAIL  430

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             ATNL D++GS+L+KAH FI  +Q++E+S    L  WYRH ++GGWPFSTPDNGWPVSDCT
Sbjct  431   ATNLVDQFGSVLKKAHDFIKNTQVRENSS-GELNQWYRHVSRGGWPFSTPDNGWPVSDCT  489

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             +E LKAAL+LSRM  ++VG++I+  +L+DAV+LILSLQN +GGFA+YELTRSYP LEI+N
Sbjct  490   SEGLKAALLLSRMPSEIVGDSIKADQLFDAVNLILSLQNKNGGFASYELTRSYPRLEIIN  549

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+E FG+I+IDY YVECTSA I  L  F K++P +RRKEI++C+ KA+ F+++IQLPDGS
Sbjct  550   PAEIFGDIMIDYPYVECTSAVIQALTSFVKMYPHHRRKEIDSCVAKAINFLESIQLPDGS  609

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWGVCYTYGTWFG++GLV GG TY +   IR+AC FLLSKQL SGGWGESYLS QDK
Sbjct  610   WYGSWGVCYTYGTWFGVKGLVAGGRTYANSSSIRRACSFLLSKQLDSGGWGESYLSSQDK  669

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFINNH  129
             VYT++EG+K H+VNT+WA+LALI+AGQ     L ++   K+ +N+ 
Sbjct  670   VYTSLEGDKSHLVNTSWAILALIKAGQAERDPLPLQCAVKVLVNSQ  715



>ref|XP_011078186.1| PREDICTED: cycloartenol synthase-like isoform X1 [Sesamum indicum]
Length=757

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/686 (71%), Positives = 565/686 (82%), Gaps = 2/686 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +D WL++ N+H GRQ+WEFDP  GT EER  V+K R+ F  +R + KHSSDLLMR+QF K
Sbjct  10    NDAWLKNSNDHTGRQFWEFDPTAGTAEERALVEKARSNFKASRNETKHSSDLLMRIQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E   E+ L QVKV SEEEI+EE  V TL+R +RFYS++QA DGHWP DYGGPLFLLP L+
Sbjct  70    ENPSEVELPQVKVDSEEEITEETTVITLKRAMRFYSSLQAEDGHWPGDYGGPLFLLPGLI  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+M+++N +L EEHQKE+ RY+YNHQN DGGWGLHIEG S+MFCTALNYV+LR+LGE
Sbjct  130   IALSIMDSLNTILPEEHQKEIRRYLYNHQNPDGGWGLHIEGRSSMFCTALNYVSLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               DGG+GAM KAR WIL+ GGAT+ PSWGK WLSVLGVYEW GNNPLPPELWLLPY +PI
Sbjct  190   GADGGDGAMHKARTWILERGGATYTPSWGKFWLSVLGVYEWEGNNPLPPELWLLPYFLPI  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI   ILSLR+ELY   YHQIDWDLARNQC+KED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITDIILSLRKELYAQSYHQIDWDLARNQCSKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY+PHP +QDI+W  LH  VEPLL +WP +KLR +AL+  M HIQ+ED  TNY+C+G V+
Sbjct  310   LYFPHPLLQDILWKCLHKFVEPLLMQWPLSKLRHRALSTVMKHIQYEDVNTNYLCLGAVD  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WI  P S+AVK HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ TN
Sbjct  370   KVLNMLCCWINNPSSMAVKRHLSRIKDYLWVAEDGMKMKGYNGSQLWDVTLAVQAIVGTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EYGS L++AH FI  SQ++ DS      SWYRH +KGGWPFST DNGWP  DCTAE 
Sbjct  430   LPHEYGSTLKRAHEFIKKSQLRNDSP-GTPGSWYRHGSKGGWPFSTADNGWPALDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK AL+LS +  +V GEA+EP +LY+AVDLILSLQN+SGGFA+YELTRSY WLE++NP +
Sbjct  489   LKTALILSLLPPEVAGEALEPDKLYNAVDLILSLQNSSGGFASYELTRSYAWLEMINPVQ  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDYQ+ ECTSAAI GLK F +LHPG R K+I+ CI KAL FI++ QL DGSWYG
Sbjct  549   TFGDIMIDYQHAECTSAAIQGLKMFNRLHPGCRGKDIQTCIKKALNFIESTQLSDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK-VY  252
             SWGVCYTYGTWFGI GL+ GG TYE+   +RKACDFLLSKQLPSGGWGESYLS QDK VY
Sbjct  609   SWGVCYTYGTWFGITGLIAGGKTYENSLSVRKACDFLLSKQLPSGGWGESYLSSQDKQVY  668

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQV  174
             TNI  NK HIVNTAWAMLAL+EAGQ 
Sbjct  669   TNIRNNKSHIVNTAWAMLALLEAGQA  694



>ref|XP_006296684.1| hypothetical protein CARUB_v10013036mg [Capsella rubella]
 gb|EOA29582.1| hypothetical protein CARUB_v10013036mg [Capsella rubella]
Length=761

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 561/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDP+LGT EE   V+K R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPSLGTPEELAAVEKARTSFAENRFFQKHSSDLLMRLQFAREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+G  ++++E+ V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    VISAVLPQVKIGDTDDVTEKIVENTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H+ EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKHEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GA++K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAIEKGRDWILNHGGATKITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI STILSLR+EL+   YH++DW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTILSLRKELFTVPYHEVDWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QD++W  LHN VEP+L +WP   LR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDVLWASLHNFVEPVLMRWPGANLREKAIRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LW+AEDGMKM GYNGSQLWD GFA+QAI+ATN  
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWIAEDGMKMQGYNGSQLWDTGFAIQAILATNFV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             DEYG +L+KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   DEYGPVLKKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE I+  RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPIDAKRLYDAVNVIISLQNPDGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVY+N+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNTAWA+L LI AGQ 
Sbjct  671   EGNRSHVVNTAWALLTLISAGQA  693



>ref|XP_009409584.1| PREDICTED: cycloartenol synthase-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/682 (68%), Positives = 556/682 (82%), Gaps = 1/682 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNHIGRQ WEFDP+LGT EE  +V+++R EF KNRF+ KHSSDLLMR+QF KE 
Sbjct  12    PWLRTNNNHIGRQVWEFDPSLGTPEEIAEVERVREEFRKNRFEKKHSSDLLMRLQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               E+    +K+   E+++EEAV+ +LRR +   ST+QAHDGHWP DYGGP+FL+P L+I 
Sbjct  72    PLELDFPIIKLQDHEDVTEEAVLTSLRRAISRISTLQAHDGHWPGDYGGPMFLMPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF TAL YV LR+LGE  
Sbjct  132   LYVTGALNTVLTPEHQKEIRRYLYNHQNKDGGWGLHIEGTSTMFGTALTYVILRLLGEGS  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             DGG GAM+K R WILDHG AT I SWGK+WLSVLGV++WSGNNPLPPE+WLLPY +P+HP
Sbjct  192   DGGFGAMEKGRNWILDHGSATAITSWGKMWLSVLGVFDWSGNNPLPPEMWLLPYFLPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSY+YGKR+VGPI  T++SLR ELYN  Y QIDW+ ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYIYGKRFVGPITPTVVSLRTELYNIPYDQIDWNQARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP IQDI+W  LH IVEP+L  WP NKLR+KA+  AM HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLIQDILWASLHKIVEPILMHWPGNKLREKAINTAMQHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C WIEEP+S A K+HL R+ DYLW+AEDGMKM GYNGSQLWD  F VQAII+TNL 
Sbjct  372   LNMLCCWIEEPNSEAFKLHLPRVSDYLWVAEDGMKMQGYNGSQLWDTAFTVQAIISTNLS  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  L+KAH F+  +Q+ ED   + L SWYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGPTLKKAHEFVKNTQVLEDCPGD-LNSWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS+++ ++VG  I+  +LYDAV++ILSL N  GGFATYELTRSY WLEI+NP+ETF
Sbjct  491   ASLLLSKISPEIVGYQIDGRKLYDAVNVILSLMNQDGGFATYELTRSYAWLEIINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+RR+EI+ CI K+  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIDNCITKSARFIEKIQQADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYG WFG++GLV  G TYES   IRK+C+FLLSKQL SGGWGESYLSCQDKVYTNI
Sbjct  611   GVCFTYGIWFGVKGLVAAGRTYESSSCIRKSCNFLLSKQLASGGWGESYLSCQDKVYTNI  670

Query  242   EGNKWHIVNTAWAMLALIEAGQ  177
             EGN+ H VNT WAML LI+AGQ
Sbjct  671   EGNRTHAVNTGWAMLTLIDAGQ  692



>gb|EYU26562.1| hypothetical protein MIMGU_mgv1a001674mg [Erythranthe guttata]
Length=775

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/702 (69%), Positives = 575/702 (82%), Gaps = 18/702 (3%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFE  2052
             +DP L S NNH GRQ+WEFDP + GT EE+  ++K RA+F  +R++IK SSDLLMR+Q  
Sbjct  12    NDPSLASFNNHAGRQFWEFDPLITGTPEEQALIEKARADFRNSRYEIKQSSDLLMRIQLA  71

Query  2051  KEKG-QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             KE G   + L+QVKV SEEE++EE VV TL+R LRFYST+QA DGHWP DYGGPLFLLP 
Sbjct  72    KENGCGAVDLEQVKVESEEEVTEEKVVITLKRALRFYSTLQAEDGHWPGDYGGPLFLLPG  131

Query  1874  LV---------------IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHS  1740
             LV               I L +M+A+  VL EEH KE+ RY+YNHQN+DGGWGLHIE  S
Sbjct  132   LVRILNYSVITPPLKHIISLYIMKALKTVLPEEHTKEICRYLYNHQNLDGGWGLHIEAQS  191

Query  1739  TMFCTALNYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSG  1560
             +MFCT LNYV+LR+LG+E DGG+GAM KAR WILDHGGAT+ PSWGK WLSVLGVYEW G
Sbjct  192   SMFCTILNYVSLRLLGQEMDGGDGAMHKARTWILDHGGATYTPSWGKCWLSVLGVYEWDG  251

Query  1559  NNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHD  1380
             NNPLPPE+WLLPY +P+HPGRMWCH RMVYLPMSYLYGKR+VGPINS +LSLR+ELYN D
Sbjct  252   NNPLPPEIWLLPYFLPVHPGRMWCHARMVYLPMSYLYGKRFVGPINSVVLSLRKELYNQD  311

Query  1379  YHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDH  1200
             YHQIDW+LARNQC+KEDLY+PHP +QD++W  L    EPLL +WPF+KLR +ALT  M H
Sbjct  312   YHQIDWNLARNQCSKEDLYFPHPLLQDVLWKCLDKFAEPLLMQWPFSKLRNRALTTVMKH  371

Query  1199  IQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNG  1020
             ++++D  +NYVC+GPVNKVLNM+C WI +P+S AVK HLSRIKDYLW+AEDGMKM GYNG
Sbjct  372   MEYDDVNSNYVCLGPVNKVLNMLCCWINDPNSTAVKRHLSRIKDYLWVAEDGMKMNGYNG  431

Query  1019  SQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWP  840
             SQLWD  FAVQAI+ TNL  EYG ML+KAH FI +SQ+++DS  + L  WYRH  KGGWP
Sbjct  432   SQLWDTVFAVQAIVGTNLPQEYGLMLKKAHQFIKISQMRKDSAGD-LSLWYRHRCKGGWP  490

Query  839   FSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFAT  660
             FST DNGWPVSDCT+E LKAA+MLS +  +V GE +E ++LYD+VDLILSLQN++GGFA+
Sbjct  491   FSTSDNGWPVSDCTSEGLKAAVMLSELPLEVAGEGLEQNKLYDSVDLILSLQNSNGGFAS  550

Query  659   YELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINK  480
             YELTRSY WLE++NPSETFG+I+IDYQYVECTSAAI GLK F KL+P YRRK+I+ CI+K
Sbjct  551   YELTRSYAWLEVINPSETFGDIVIDYQYVECTSAAIQGLKQFNKLYPNYRRKDIDTCIDK  610

Query  479   ALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP  300
             A+ FI++IQL DGSWYGSW VCYTYGTWFGI GL+ GG TYE+   +RK C+FLLSKQLP
Sbjct  611   AVDFIESIQLSDGSWYGSWAVCYTYGTWFGITGLIKGGKTYENSLAVRKGCEFLLSKQLP  670

Query  299   SGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             SGGWGESYLS QDKVYTNI  +  HIVNT WAMLALIEAGQ 
Sbjct  671   SGGWGESYLSSQDKVYTNIGKDVSHIVNTGWAMLALIEAGQA  712



>ref|XP_007019803.1| Cycloartenol synthase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY17028.1| Cycloartenol synthase 1 isoform 2, partial [Theobroma cacao]
Length=748

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/684 (68%), Positives = 556/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+VNNH+GRQ WEFDP+LG+ EE  ++ K R  F  NRFQ KHSSDLLMR+QF KE
Sbjct  11    SPWLRTVNNHVGRQIWEFDPDLGSPEEIMEIDKARHNFTDNRFQRKHSSDLLMRLQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   E I+E  V  TLRR + F+S++QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPVPVVLPQVKVEEAENITEGMVTNTLRRAINFHSSLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL EEH+KEM RY+YNHQN DGGWGLHIEG STMF T L+YVTLR+L E 
Sbjct  131   SLSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLSEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM++ R WIL HGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPY++P H
Sbjct  191   ANDGQGAMERGRDWILSHGGATQITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTIPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  L  +VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPMVQDILWASLDKVVEPILMHWPGKKLREKALQTAIEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKA+ +I  SQ++ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   TEEYGLTLRKANTYIKNSQVREDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  ++VGE +E   LYDAV++ILSLQN  GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAALLLSKIPSEIVGEPVEAKCLYDAVNVILSLQNADGGYATYELTRSYCWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+  HPG+R++EI+ CI KA  FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKNSHPGHRQEEIDQCIQKAAKFIESIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  GN + +C  IRKACDFLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  610   WGVCFTYGTWFGVKGLVAAGNNFNNCSSIRKACDFLLSKQLPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             IEGN+ H+VNT WAMLAL+ AGQ 
Sbjct  670   IEGNRPHVVNTGWAMLALMAAGQA  693



>ref|XP_007019802.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 ref|XP_007019804.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 ref|XP_007019805.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17027.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17029.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17030.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
Length=756

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/684 (68%), Positives = 556/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+VNNH+GRQ WEFDP+LG+ EE  ++ K R  F  NRFQ KHSSDLLMR+QF KE
Sbjct  11    SPWLRTVNNHVGRQIWEFDPDLGSPEEIMEIDKARHNFTDNRFQRKHSSDLLMRLQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   E I+E  V  TLRR + F+S++QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPVPVVLPQVKVEEAENITEGMVTNTLRRAINFHSSLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL EEH+KEM RY+YNHQN DGGWGLHIEG STMF T L+YVTLR+L E 
Sbjct  131   SLSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLSEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM++ R WIL HGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPY++P H
Sbjct  191   ANDGQGAMERGRDWILSHGGATQITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTIPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  L  +VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPMVQDILWASLDKVVEPILMHWPGKKLREKALQTAIEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKA+ +I  SQ++ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   TEEYGLTLRKANTYIKNSQVREDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  ++VGE +E   LYDAV++ILSLQN  GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAALLLSKIPSEIVGEPVEAKCLYDAVNVILSLQNADGGYATYELTRSYCWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+  HPG+R++EI+ CI KA  FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKNSHPGHRQEEIDQCIQKAAKFIESIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  GN + +C  IRKACDFLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  610   WGVCFTYGTWFGVKGLVAAGNNFNNCSSIRKACDFLLSKQLPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             IEGN+ H+VNT WAMLAL+ AGQ 
Sbjct  670   IEGNRPHVVNTGWAMLALMAAGQA  693



>dbj|BAE53431.1| cycloartenol synthase [Lotus japonicus]
Length=757

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/684 (68%), Positives = 555/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLRS N+H+GRQ WEFDP LG+ ++  +++  R  FH NRF  KHSSDLLMR+QF KE
Sbjct  11    NPWLRSTNSHVGRQVWEFDPKLGSPQDLAEIETARNNFHDNRFSHKHSSDLLMRIQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L +VKV   E+++EEAVV TLRR + F+ST+Q+HDGHWP DYGGP+FL+P LVI
Sbjct  71    NPIGEVLPKVKVKDVEDVTEEAVVTTLRRAISFHSTLQSHDGHWPGDYGGPMFLMPDLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL +EH+KEM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLTDEHRKEMCRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G G M+KAR WIL HGGAT+I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPY +P H
Sbjct  191   PNDGQGDMEKARDWILGHGGATYITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYALPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+EL+   YH IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELFTIPYHDIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP  KLR+KA+   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPVLMQWPGKKLREKAINSVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FA QAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAAQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKAH FI  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEYGPTLRKAHTFIKNSQVLEDCPGD-LNKWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L LS++A D+VGE ++  RLYDAV++ILSLQN  GG ATYELTRSY WLE++NP+ET
Sbjct  490   KAILSLSKIAPDIVGEPLDAKRLYDAVNVILSLQNEDGGLATYELTRSYSWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+RR+EI+  I KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFRKLYPGHRREEIQHSIEKAAAFIEKIQSSDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GL+  G ++ +C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  610   WGVCFTYGTWFGVKGLIAAGKSFSNCSSIRKACEFLLSKQLPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H VNT WAMLALIEA Q 
Sbjct  670   LEGNRPHAVNTGWAMLALIEAEQA  693



>ref|XP_010677527.1| PREDICTED: cycloartenol synthase 2 [Beta vulgaris subsp. vulgaris]
Length=757

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/684 (70%), Positives = 568/684 (83%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GRQ WEFDP LGT E+ ++V++ R  F K+RF+ KHSSDLLMR+QF +E
Sbjct  11    NPWLRTTNNHVGRQIWEFDPELGTPEQIREVEEARENFRKHRFEQKHSSDLLMRIQFAQE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV  E+EI+EE VV TLRR L + ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NSGNVVLPQVKVEDEDEITEETVVTTLRRALSYNSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LSV  A+NAVL +EHQKEM RY+YNHQN DGGWGLHIEG STMF T L YVTLR+LGE 
Sbjct  131   ALSVSGALNAVLSKEHQKEMRRYLYNHQNEDGGWGLHIEGQSTMFGTVLTYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM++ RKWIL+HG AT I SWGK+WLSVLGV+EW+GNNP+PPELWLLPYI+PIH
Sbjct  191   ADDGDGAMERGRKWILEHGSATAITSWGKMWLSVLGVFEWTGNNPMPPELWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLRRELYN  YH+IDW+ ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRRELYNVPYHEIDWNQARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP  +LR+KAL+ AM+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILMRWPGKRLREKALSTAMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI D+LW+AEDGMKM GYNGSQLWD GF VQAI+ATN 
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDFLWIAEDGMKMQGYNGSQLWDTGFMVQAILATNF  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG+ LRKAH FI  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   EEEYGATLRKAHTFIKNSQVTEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  D+VGE  E  RLYDAV++ILSLQN+ GGFATYELTRSYPWLE+LNP+ET
Sbjct  490   KAALLLSKLPSDIVGEPSEVKRLYDAVNVILSLQNDDGGFATYELTRSYPWLELLNPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F++L+PG+RR+EIE CI +A  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALVSFKRLYPGHRREEIENCIKQAARFIEKIQAADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G  Y++C  I KACDFLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVKGLVAAGKNYDTCPSIHKACDFLLSKQLSSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             IEGN+ H+VNT WAML LI+AGQ 
Sbjct  670   IEGNQAHVVNTGWAMLTLIDAGQA  693



>ref|XP_002883756.1| cycloartenol synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60015.1| cycloartenol synthase [Arabidopsis lyrata subsp. lyrata]
Length=759

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 562/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDPNLGT E+   V++ R  F  NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPNLGTPEDLAAVEEARKSFSDNRFLQKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+   ++++EE V  TL+RG+ FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    LISPVLPQVKIEDTDDVTEEMVENTLKRGVDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY++NHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYLFNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFA+QAI+ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAIQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L+KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLKKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE I+  RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPIDAKRLYDAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVY+N+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSSHVAKACEFLLSKQQPSGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNTAWAMLALI AGQ 
Sbjct  671   EGNRSHVVNTAWAMLALIGAGQA  693



>emb|CDP12480.1| unnamed protein product [Coffea canephora]
Length=758

 Score =   981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/701 (66%), Positives = 565/701 (81%), Gaps = 5/701 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQE-ERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
              PWLR+ N H+GRQ+WEFDPN    E E   +++ R  F  NRF+ KHS+DLLMR+QF K
Sbjct  11    SPWLRTTNGHVGRQFWEFDPNAAVSEGELAAIEEARENFRINRFEKKHSADLLMRLQFAK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L ++KV   E+++E+ V +TLRR + FYST+Q HDGHW  DYGGP+FL+P L+
Sbjct  71    ENTSNAVLPKIKVKEIEDLTEDNVAQTLRRAISFYSTLQTHDGHWAGDYGGPMFLMPGLI  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NAVL +EH+ EM RYIYNHQN DGGWGLHIEG STMF +ALNYVTLR+LGE
Sbjct  131   ITLSITGALNAVLSKEHKLEMCRYIYNHQNPDGGWGLHIEGPSTMFGSALNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G+GAM+K RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WLLPY +P+
Sbjct  191   GPNDGDGAMEKGRKWILDHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEIWLLPYALPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+E+Y   YH+IDW+LARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKEIYAVPYHEIDWNLARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH ++EP+L  WP  KLR+KA+++AM+H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWASLHKVLEPILMHWPGKKLREKAVSVAMEHVHYEDENTRYLCIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKA+ FI  SQ+ +D   + L SWYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  431   LAEEYGPTLRKAYTFIKNSQVLDDCPGD-LDSWYRHISKGAWPFSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA   LS++  ++VGE I+  RLYD+V++ILSLQN+ GGFATYELTRSY WLE +NP+E
Sbjct  490   LKAYFSLSKLPSELVGETIDVKRLYDSVNVILSLQNSDGGFATYELTRSYAWLETINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+RR+E++ CI +A  FI+ IQ  DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALTAFKKLYPGHRREEVQRCIERAALFIEKIQATDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFG++GLV  G  + +C  IRKACDFLLSKQLPSGGWGESYLSCQ+KVY+
Sbjct  610   SWGVCFTYGLWFGVKGLVASGRNFNNCSAIRKACDFLLSKQLPSGGWGESYLSCQNKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFIN  135
             N+EGN+ H+VNTAWAMLALI+AGQ       + +  K+ IN
Sbjct  670   NLEGNRSHMVNTAWAMLALIDAGQTERDPTPLHIAAKVLIN  710



>ref|XP_007153003.1| hypothetical protein PHAVU_004G178300g [Phaseolus vulgaris]
 gb|ESW24997.1| hypothetical protein PHAVU_004G178300g [Phaseolus vulgaris]
Length=757

 Score =   981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/683 (68%), Positives = 555/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLRS+NNH+GRQ WEFDP LG+ ++  +++K R  FH NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRSLNNHVGRQVWEFDPKLGSPQDLLEIEKARQNFHDNRFTNKHSSDLLMRLQFAREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               +  L +V V   ++++EE V +TLRR + F+ST+Q HDGHWP DYGGP+FL+P LVI 
Sbjct  72    PIQEVLPKVGVEDIQDVTEEVVTKTLRRAVTFHSTLQCHDGHWPGDYGGPMFLMPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL EEH+KE+ RY+YNHQN DGGWGLHIEG STMF + L+YVTLR+LGE  
Sbjct  132   LSITGALNAVLTEEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G G M+KAR WIL HGGAT I SWGK+WLSVLGVYEWSGNNPLPPE+WLLPYI+P HP
Sbjct  192   NDGQGEMEKARDWILGHGGATLITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYILPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             G+MWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+ELY   YH IDWD ARN CAKEDLY
Sbjct  252   GKMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELYTVPYHDIDWDQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  +EP+L  WP  KLR+KA+T  M+HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWGSLHKFLEPILMHWPGKKLREKAITSTMEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  +RKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGPTIRKAHTYIKNSQVLEDCPGD-LNKWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++A +VVGE +E  RLYD+V++ILSLQN  GGFATYEL RSY WLE++NP+ETF
Sbjct  491   AVLSLSKIAPEVVGEPLEVKRLYDSVNVILSLQNEDGGFATYELKRSYNWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVEC+SAAI  L  FRKL+PG+RR+EI+ CI KA  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECSSAAIQALASFRKLYPGHRREEIQRCIEKAAAFIEKIQTSDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYG WFGI+GL+  G T+ +C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVY+N+
Sbjct  611   GVCFTYGAWFGIKGLIAAGKTFSNCSSIRKACEFLLSKQLPSGGWGESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H VNT WAMLALI+AGQ 
Sbjct  671   EGNRSHAVNTGWAMLALIDAGQA  693



>ref|XP_010467143.1| PREDICTED: cycloartenol synthase-like [Camelina sativa]
Length=759

 Score =   980 bits (2533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 563/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDP+LGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPSLGTPEELAAVEEARKSFTENRFLKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+   ++++E+ V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    LISPALPQVKIDDTDDLTEKIVENTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMHRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE+T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDESTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFA+QAI+ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAIQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +LRKAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLRKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS++  ++VGE I+  RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   ASLLLSKVPKEIVGEPIDAKRLYDAVNVIISLQNPDGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+P +R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPVHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVYTN+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNTAWA+LALI AGQ 
Sbjct  671   EGNRSHVVNTAWALLALIGAGQA  693



>ref|XP_010244585.1| PREDICTED: cycloartenol synthase 2 isoform X1 [Nelumbo nucifera]
Length=757

 Score =   980 bits (2533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/684 (69%), Positives = 555/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLR+ NNH+GRQ WEFDP LGT EE  +V+K R  F K RF+ KHSSDLLMR+QF KE
Sbjct  11    NSWLRTTNNHVGRQVWEFDPKLGTPEEIMEVEKAREGFQKRRFEKKHSSDLLMRIQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
               Q   L QVKV   E++++EAV  TL+R + FYSTIQAHDGHWP DYGGP+FLLP L+I
Sbjct  71    NPQSTILPQVKVKDSEDVTDEAVKITLKRAISFYSTIQAHDGHWPGDYGGPMFLLPGLII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L +  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE 
Sbjct  131   ILYITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G GAM+K RKWILDHGG T I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +P H
Sbjct  191   TDDGEGAMEKGRKWILDHGGVTAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH++DW+ A N CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEVDWNQACNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL  A+ HI +ED+ T YVCIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILKCWPGKRLREKALLTAIQHIHYEDDNTRYVCIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+++L
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLLRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISSSL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  L+KAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEYGPTLKKAHEYIKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+   ++VGE +   RLYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  490   KAALLLSKSPPEIVGEPLNAKRLYDAVNVILSLQNGHGGFATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+P +R++EIE CI +A  F++ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTLFKKLYPRHRQEEIEICIKRAANFLEGIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFGI+GL+  G T+++   IRKACDFLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGIKGLIAAGRTFKNNSSIRKACDFLLSKQLASGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             + GNK HIVNT WAMLALI+AGQ 
Sbjct  670   LGGNKAHIVNTGWAMLALIDAGQA  693



>gb|KHN32929.1| Cycloartenol synthase [Glycine soja]
Length=757

 Score =   979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/684 (67%), Positives = 560/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++NNH+GRQ WEFDP LG+ ++  +++K R  FH NRF  KHS+DLLMRMQF +E
Sbjct  11    NPWLRTLNNHVGRQVWEFDPKLGSPQDLLEIEKARQNFHDNRFTHKHSADLLMRMQFARE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L +V V   E++++E V +TLRR + F+ST+Q HDGHWP DYGGP+FL+P LVI
Sbjct  71    NPTREVLPKVGVKDIEDVTQEIVTKTLRRAVSFHSTLQCHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+N VL EEH+KE+ RY+YNHQN DGGWGLHIEG STMF + L+Y+TLR+LGE 
Sbjct  131   TLSITGALNTVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYITLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G G M+KAR WIL HGGAT+I SWGK+WLSVLGVYEWSGNNPLPPE+WLLPY++P H
Sbjct  191   PNDGQGEMEKARDWILGHGGATYITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI+ T+LSLR+ELY   YH IDWD ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPISPTVLSLRKELYTVPYHDIDWDQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH  +EP+L  WP  +LR+KA+  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKFLEPILMHWPGKRLREKAIISALEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAIIA+NL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIIASNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  +RKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEFGPTIRKAHAYIKNSQVLEDCPGD-LNKWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++A ++VGE I+  RLYD+V+++LSLQN  GGFATYEL RSY WLEI+NP+ET
Sbjct  490   KAVLLLSKIAPEIVGEPIDVKRLYDSVNVVLSLQNEDGGFATYELKRSYNWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+RR+EI+ CI+KA TFI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALASFRKLYPGHRREEIQRCIDKATTFIEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYG WFG++GL+  G ++ +C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  610   WGVCFTYGAWFGVKGLIAAGRSFSNCSSIRKACEFLLSKQLPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WAMLALI+AGQ 
Sbjct  670   LEGNRSHVVNTGWAMLALIDAGQA  693



>ref|XP_010488811.1| PREDICTED: cycloartenol synthase-like [Camelina sativa]
Length=759

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/684 (67%), Positives = 564/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+ NNH+GRQ+WEFDP+LGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E
Sbjct  11    SPWLRTTNNHVGRQFWEFDPSLGTPEELAAVEEARKSFTENRFLKKHSSDLLMRLQFSRE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVK+   ++++E+ V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I
Sbjct  71    NLISPVLPQVKIEDTDDVTEKIVENTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE 
Sbjct  131   TLSITGALNTVLSEQHKQEMHRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIH
Sbjct  191   PNDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH IVEP+L +WP   LR+KA+  A++HI +EDE+T Y+CIGPVNK
Sbjct  311   YYPHPLVQDVLWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDESTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFAVQAI+ATNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAVQAILATNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG +LRKAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   VEEYGPVLRKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS++  ++VGE ++  RL+DAV++I+SLQN  GG ATYELTRSYPWLE++NP+ET
Sbjct  490   KASLLLSKVPKEIVGEPVDAKRLFDAVNVIISLQNPDGGLATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVYTN
Sbjct  610   WAVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNTAWA+LALI AGQ 
Sbjct  670   LEGNRSHVVNTAWALLALIGAGQA  693



>ref|XP_010413093.1| PREDICTED: cycloartenol synthase [Camelina sativa]
 ref|XP_010413100.1| PREDICTED: cycloartenol synthase [Camelina sativa]
Length=759

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/683 (67%), Positives = 564/683 (83%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDP+LGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPSLGTPEELAAVEEARKSFTENRFLKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+   ++++E+ V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    LISPVLPQVKIEDTDDVTEKIVENTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMHRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE+T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDESTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFA+QAI+ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAIQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +LRKAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLRKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS++  ++VGE ++  RL+DAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   ASLLLSKVPKEIVGEPVDAKRLFDAVNVIISLQNPDGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVYTN+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNTAWA+LALI AGQ 
Sbjct  671   EGNRSHVVNTAWALLALIGAGQA  693



>ref|XP_003516849.1| PREDICTED: cycloartenol synthase [Glycine max]
Length=757

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/684 (67%), Positives = 560/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++NNH+GRQ WEFDP LG+ ++  +++K R  FH NRF  KHS+DLLMRMQF +E
Sbjct  11    NPWLRTLNNHVGRQVWEFDPKLGSPQDLLEIEKARQNFHDNRFTHKHSADLLMRMQFARE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L +V V   E++++E V +TLRR + F+ST+Q HDGHWP DYGGP+FL+P LVI
Sbjct  71    NPTREVLPKVGVKDIEDVTQEIVTKTLRRAVSFHSTLQCHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+N VL EEH+KE+ RY+YNHQN DGGWGLHIEG STMF + L+Y+TLR+LGE 
Sbjct  131   TLSITGALNTVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYITLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G G M+KAR WIL HGGAT+I SWGK+WLSVLGVYEWSGNNPLPPE+WLLPY++P H
Sbjct  191   PNDGQGEMEKARDWILGHGGATYITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI+ T+LSLR+ELY   YH IDWD ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPISPTVLSLRKELYTVPYHDIDWDQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH  +EP+L  WP  +LR+KA+  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKFLEPILMHWPGKRLREKAIISALEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAIIA+NL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIIASNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  +RKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEFGPTIRKAHTYIKNSQVLEDCPGD-LNKWYRHISKGAWPFSTGDHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++A ++VGE I+  RLYD+V++ILSLQN  GGFATYEL RSY WLEI+NP+ET
Sbjct  490   KAVLLLSKIAPEIVGEPIDVKRLYDSVNVILSLQNEDGGFATYELKRSYNWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+RR+EI+ CI+KA TFI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALASFRKLYPGHRREEIQHCIDKATTFIEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYG WFG++GL+  G ++ +C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  610   WGVCFTYGAWFGVKGLIAAGRSFSNCSSIRKACEFLLSKQLPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WAMLALI+AGQ 
Sbjct  670   LEGNRSHVVNTGWAMLALIDAGQA  693



>ref|XP_008223938.1| PREDICTED: cycloartenol synthase 2 [Prunus mume]
Length=757

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE  +++K R  FH NRF  KHSSDL MRMQ  KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPKLGTPEELLEIEKAREHFHNNRFVKKHSSDLFMRMQLSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L Q+KV   E+++ E V   LRR + F+S++QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PGHAVLPQIKVKDTEDVTGETVTNILRRAINFHSSLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  RKWILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRKWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW++ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNAPYHEIDWNVARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPFVQDILWSSLHMAVEPILMRWPGKKLREKALKTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS LRK H FI  SQ+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSTLRKGHKFIKDSQVLENCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++  RL+D+V+++LSLQN+ GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDAKRLFDSVNVVLSLQNSDGGFATYELTRSYRWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+R +EIE CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALASFKKLYPGHRSEEIERCIKRAVEFIEKIQESDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLASGGWAESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAMLALI+AGQ 
Sbjct  671   EGDRSHVVNTGWAMLALIDAGQA  693



>sp|Q8W3Z3.1|CAS2_BETPL RecName: Full=Cycloartenol synthase 2 [Betula platyphylla]
 dbj|BAB83086.1| cycloartenol synthase [Betula platyphylla]
Length=757

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/684 (67%), Positives = 556/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR++NNH+GRQ WEFDP LG+ EE  ++++ R    K RF+ KHSSDLLMR+QF KE
Sbjct  11    SPWLRTLNNHVGRQVWEFDPKLGSPEELAEIERARETSLKVRFEKKHSSDLLMRIQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
               +   L QVKV   E+++EE V R LRR + F+ST+QAHDGHW  DYGGP+FL+P LVI
Sbjct  71    NPRGAVLPQVKVNETEDVTEEMVTRMLRRAISFHSTLQAHDGHWAGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+N VL EEH+KEM RY+YNHQN DGGWGLHIEG STMF T L+YVTLR+LGE 
Sbjct  131   TLSITGALNTVLSEEHKKEMCRYLYNHQNKDGGWGLHIEGPSTMFGTVLSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GA+++ RKWILDHG AT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++P+H
Sbjct  191   ANDGQGAIERGRKWILDHGSATAIISWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPVH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T++SLR+ELY+  YH+IDW+ ARN CAKE L
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVMSLRKELYSVPYHEIDWNQARNLCAKEXL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L +WP  +LR+KAL   ++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKLVEPVLMRWPGKRLREKALRTVLEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRINDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  L KAH++I  SQ++ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   FEEYGPTLEKAHMYIKKSQVREDCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  DVVGE +   RLYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  490   KAALLLSKIPPDVVGEPLVEERLYDAVNVILSLQNADGGFATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+K +P +R +E++ CI +A  F + IQ  DGSWYGS
Sbjct  550   FGDIVIDYNYVECTSAAIQALTSFKKSYPKHREEEVDVCIKRAAMFTEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  G  +  C GIRKACDFLLSKQLPSGGWGESYLSCQ+KVY++
Sbjct  610   WGVCFTYGTWFGVKGLVAAGKNFNDCFGIRKACDFLLSKQLPSGGWGESYLSCQNKVYSH  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WAMLALIEAGQ 
Sbjct  670   VEGNRSHVVNTGWAMLALIEAGQA  693



>gb|KFK39919.1| hypothetical protein AALP_AA3G306200 [Arabis alpina]
Length=759

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/683 (67%), Positives = 564/683 (83%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDP LGT EE   +++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPKLGTPEELAAIEEARESFSENRFVKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QV +   ++++++ V  TL+RG+ FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    SISSVLPQVNIKDGDDVTDKMVETTLKRGVDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL ++H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSDQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGEGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+IDW++ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEIDWNVARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWATLHKIVEPVLMRWPGANLREKAIKTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD GFAVQAI+ATN  
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRINDYLWLAEDGMKMQGYNGSQLWDTGFAVQAILATNFV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L+KAH ++  SQ+++D   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLKKAHSYVKNSQVQDDCAGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS+++ ++VGE ++ +RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVSKEIVGEPVDTNRLYDAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALIAFRKLYPGHRKKDVDECIEKAVKFIESIQATDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG+ GLV  G T ++   + KAC+FLLSKQLPSGGWGESYLSCQ+KVY+++
Sbjct  611   GVCFTYGTWFGVEGLVAVGKTLKNSPHVAKACEFLLSKQLPSGGWGESYLSCQEKVYSHL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK H+VNTAWA+LALI AGQ 
Sbjct  671   EGNKSHVVNTAWALLALIGAGQA  693



>ref|XP_009764154.1| PREDICTED: cycloartenol Synthase-like [Nicotiana sylvestris]
 ref|XP_009764155.1| PREDICTED: cycloartenol Synthase-like [Nicotiana sylvestris]
Length=699

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/686 (66%), Positives = 557/686 (81%), Gaps = 1/686 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GR+ WEFDP LG+ E+R +++K R  FHK+RF+ KHS+DL+MR Q  KE
Sbjct  11    NPWLRTTNNHVGRELWEFDPELGSPEDRAEIEKFREHFHKHRFEQKHSADLIMRYQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV   E+I+E+ V  TLRR L FYST+Q HDGHW  DYGGP+FL+P +VI
Sbjct  71    NPGITILPQVKVQGNEDITEDTVATTLRRALNFYSTLQTHDGHWAGDYGGPMFLMPGMVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LSV  A+NAVL  EH++EM+RY+YNHQN DGGWGLHIEGHSTMF + L+YVTLR+LGE 
Sbjct  131   ALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHSTMFGSVLSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K RKWILDHG AT I SWGK+WL+VLG ++WSGNNPLPPE+WLLPY +PIH
Sbjct  191   ANDGEGAMEKGRKWILDHGSATAITSWGKMWLAVLGAFDWSGNNPLPPEIWLLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM YLYGKR++GPI  T+LSLR+EL+   YH+IDW+ ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMCYLYGKRFIGPITPTVLSLRKELFTVPYHEIDWNKARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILMHWPGKRLREKALCTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             +LNM+C W+E+P+S A K+HL RI DY+W+AEDGMKM GYNGSQ WD  FA+QAIIAT L
Sbjct  371   ILNMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKMKGYNGSQSWDTSFAIQAIIATEL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYGS LRKAH FI  +Q+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   GEEYGSALRKAHSFIKNTQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VG+ +E  R YDAV+++LSLQN+ GGFATYEL+RSYPWLEI+NP+ET
Sbjct  490   KATLLLSKLPSEIVGDPLEAKRFYDAVNVLLSLQNSGGGFATYELSRSYPWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVERCIAKAAAFIEKIQEADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y +   IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVLGLLAAGRNYTNSSSIRKACDFLLSKQISSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL  168
             +EGN++H+VNT+WAML LI AGQV++
Sbjct  670   LEGNRYHVVNTSWAMLTLIAAGQVLI  695



>ref|XP_009370034.1| PREDICTED: cycloartenol synthase 2 [Pyrus x bretschneideri]
Length=757

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/683 (67%), Positives = 556/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE  ++++ R  +H NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPKLGTPEELLEIERARENYHNNRFAKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV    +++EEAV  TLRRG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PGRAVLPQVKVKDTADVTEEAVTNTLRRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILLRWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS+LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSILRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTGDHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDTKRLYDAVNVILSLQNGDGGFATYELTRSYGWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA+I  L  F+ L+P +RR+EIE+CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSASIQALVSFKNLYPSHRREEIESCIKRAVEFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGKNYNNSSSIRKACDFLLSKQLASGGWSESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAMLALI+AGQ 
Sbjct  671   EGDRSHVVNTGWAMLALIDAGQA  693



>ref|XP_009345284.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
Length=757

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/683 (68%), Positives = 556/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE  ++++ R  +H NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPKLGTPEELLEIERARENYHNNRFAKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV    +++EEAV  TLRRG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PGRDVLPQVKVKDTADVTEEAVTNTLRRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPYI+PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYILPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILLRWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS+LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSILRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTGDHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDTKRLYDAVNVILSLQNGDGGFATYELTRSYGWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA+I  L  F+KL+P +RR+EIE+CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSASIQALVSFKKLYPSHRREEIESCIKRAVEFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGKNYNNSSSIRKACDFLLSKQLASGGWSESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAML LI+AGQ 
Sbjct  671   EGDRSHVVNTGWAMLGLIDAGQA  693



>ref|XP_007225240.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
 gb|EMJ26439.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
Length=757

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/683 (67%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE  +++K R  F  NRF  KHSSDL MRMQ  KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPKLGTPEELLEIEKAREHFRNNRFVKKHSSDLFMRMQLSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L Q+KV   E+++ E V  TLRR + F+S++QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PGHAVLPQIKVKDTEDVTGETVTNTLRRAINFHSSLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH++E+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKREICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  RKWILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRKWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW++ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNVARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILMRWPGKKLREKALKTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS LRK H FI  SQ+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSTLRKGHKFIKDSQVLENCPGD-LDFWYRHISKGAWPFSTGDHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE I+  RLYD+V+++LSLQN+ GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPIDAKRLYDSVNVVLSLQNSDGGFATYELTRSYRWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+R +EIE CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALASFKKLYPGHRSEEIEHCIKRAVEFIEKIQESDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLASGGWAESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAMLALI+AGQ 
Sbjct  671   EGDRSHVVNTGWAMLALIDAGQA  693



>ref|XP_009362029.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
 ref|XP_009362030.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
Length=756

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/683 (67%), Positives = 557/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++ +++GRQ WEFDP LGT EE  ++++ R  +H NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLKDNVGRQLWEFDPKLGTPEELLEIERARENYHNNRFVKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++EE V  TL+RG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PVPAVLPQVKVKDTEDVTEETVTNTLKRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGN  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILMRWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSTLRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++ +RLYDAV++ILSLQNN GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDANRLYDAVNVILSLQNNDGGFATYELTRSYSWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA+I  L+ F+KL+PG+RR+EIE CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSASIQALESFKKLYPGHRREEIEHCIKRAVEFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLTSGGWSESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAMLALI+ GQ 
Sbjct  671   EGDRSHVVNTGWAMLALIDGGQA  693



>ref|XP_003610947.1| Cycloartenol synthase [Medicago truncatula]
 gb|AES93905.1| cycloartenol synthase [Medicago truncatula]
Length=757

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/683 (67%), Positives = 550/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDPN G+ ++   ++ +R  F  NRF  KHS DLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQLWEFDPNSGSPQDLADIESVRQNFRNNRFSHKHSDDLLMRIQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               +  + +V+V   E+++EE+V  TLRR L FYST+Q+HDGHWP DY GP+FLLP LVI 
Sbjct  72    PMKEVIPKVRVKDVEDVNEESVTTTLRRALNFYSTLQSHDGHWPGDYAGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KEM RY+YNHQN DGGWGLHIEG STMF + L+YVTLR+LGE  
Sbjct  132   LSITGALNAVLTDEHRKEMRRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G G M+KAR WIL+HGGAT I SWGK+WLSVLGV+EWSGNNPLPPELWLLPYI+P HP
Sbjct  192   NDGEGDMEKARDWILEHGGATHITSWGKMWLSVLGVFEWSGNNPLPPELWLLPYILPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPM YLYGKR+VGPI  TILSLR+EL+   YH +DW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMCYLYGKRFVGPITPTILSLRKELFTVPYHDVDWNQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH +VEP+   WP  KLR+KA+   M+HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWATLHKVVEPIFMNWPCKKLREKAVETVMEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  F  QAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDYLWIAEDGMKMQGYNGSQLWDTSFIAQAIISTNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  LRKAH FI  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGPTLRKAHTFIKNSQVSEDCPGD-LSKWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++A ++VGE ++  RLYDAV++I+SLQN  GG ATYELTRSY WLEI NP+ETF
Sbjct  491   AVLLLSKIAPEIVGEPLDAKRLYDAVNVIISLQNEDGGLATYELTRSYSWLEICNPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+RR+EI+ CI KA  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYTYVECTSAAIQALSTFRKLYPGHRREEIQRCIEKAAAFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GL+  G ++ +C  IRKACDFLLSKQLPSGGWGESYLSCQ+KVY+N+
Sbjct  611   GVCFTYGTWFGVKGLIAAGKSFSNCLSIRKACDFLLSKQLPSGGWGESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             E N+ H+VNT WAMLALIEA Q 
Sbjct  671   ESNRSHVVNTGWAMLALIEAEQA  693



>ref|XP_006396090.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
 gb|ESQ36869.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
Length=701

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/683 (67%), Positives = 561/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NN++GRQ+WEFDP LGT EE   +++ R  F +NR   KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNNVGRQFWEFDPKLGTPEELADIEEARKSFSENRLVKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++++ V  TL+RG+ FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    MISQVLPQVKVKDSEDVTDKMVENTLKRGVGFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM++ R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEQGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYG R+VGPI ST+LSLR+EL+   YH+IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGTRFVGPITSTVLSLRKELFTVPYHEIDWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KAL   ++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLTRWPGANLREKALRTTLEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD GFAVQAI+ATNL 
Sbjct  372   LNMLCCWVENPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTGFAVQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L+KAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLKKAHSYVKHSQVSEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE ++ +RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPLDTNRLYDAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALIAFRKLYPGHRKKDVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G T +S   + +AC+FLLSKQL +GGWGESYLSCQDKVY+N+
Sbjct  611   GVCFTYGTWFGVKGLVAVGKTLKSSPNVARACEFLLSKQLSTGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK H+VNTAWA+LALI AGQV
Sbjct  671   EGNKSHVVNTAWALLALIGAGQV  693



>ref|XP_002264289.1| PREDICTED: cycloartenol Synthase [Vitis vinifera]
 emb|CBI24077.3| unnamed protein product [Vitis vinifera]
Length=760

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/683 (67%), Positives = 558/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ WEFDP+LG+ E+R+++++ R  F K+RF+ KHS+DL+MR+QF KE 
Sbjct  12    PWLRTTNNHVGRQVWEFDPDLGSAEQREEIERARETFSKHRFEKKHSADLIMRIQFLKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                + L QVKV   E+++E+AV  TLRR + F+ST+QAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    AGTVVLPQVKVKDTEDVTEDAVTNTLRRAINFHSTLQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH++EM RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE  
Sbjct  132   LSITGALNAVLSKEHRQEMCRYLYNHQNKDGGWGLHIEGPSTMFGTVLNYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             +  +GAM+K R WIL+HGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPYI+P+HP
Sbjct  192   NDADGAMEKGRDWILNHGGATAITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYILPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGP+  T+LSLR+ELY   YH+IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPLTPTVLSLRKELYTVPYHEIDWNQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  L  +VEP+L  WP  KLR+KAL   ++H+ +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWTSLDKVVEPILMHWPGKKLREKALRTVLEHVHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD  F VQAII+T+L 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIFDFLWLAEDGMKMQGYNGSQLWDTAFCVQAIISTDLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH ++  SQ+ ED   N L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHAYLKKSQVLEDCPGN-LDYWYRHISKGAWPFSTGDHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++  ++VGE ++  +LYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AILLLSKIPSEIVGEPLDAKQLYDAVNVILSLQNGDGGFATYELTRSYAWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAA+  L  F K +PG+RR+EIE CI KA  FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAALQALTSFNKFYPGHRREEIEHCIKKATMFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TY  WFGI+GLV  G  Y +C  I KACDFLLSKQL SGGWGESYLSCQ+KVY+N+
Sbjct  611   GVCFTYAIWFGIKGLVAAGKNYNNCSSICKACDFLLSKQLASGGWGESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             +GN+ H+VNTAWAMLALI+AGQ 
Sbjct  671   DGNRSHVVNTAWAMLALIDAGQA  693



>gb|AAC04931.1| cycloartenol synthase [Arabidopsis thaliana]
Length=759

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/683 (67%), Positives = 560/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDPNLGT E+   V++ R  F  NRF  KHS+DLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPNLGTPEDLAAVEEARKSFSDNRFVQKHSADLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+   ++++EE V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    LISPVLPQVKIEDTDDVTEEMVETTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+G M+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGDMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFA+QAI+ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAIQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLEKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE I+  RLY+AV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPIDAKRLYEAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVY+N+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             +GN+ H+VNTAWAMLALI AGQ 
Sbjct  671   DGNRSHVVNTAWAMLALIGAGQA  693



>dbj|BAA23533.1| cycloartenol synthase [Pisum sativum]
Length=756

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/683 (67%), Positives = 552/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP+ G+ ++   ++  R  FH NRF  KHS DLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPHSGSPQDLDDIETARRNFHDNRFTHKHSDDLLMRLQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L +VKV   E+++EEAV  TLRRGL FYSTIQ+HDGHWP DYGGP+FL+P LVI 
Sbjct  72    PMNEVLPKVKVKDVEDVTEEAVATTLRRGLNFYSTIQSHDGHWPGDYGGPMFLMPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LSV  A+NAVL +EH+KEM RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSVTGALNAVLTDEHRKEMRRYLYNHQNKDGGWGLHIEGPSTMFGSVLCYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G G M++ R WIL+HGGAT+I SWGK+WLSVLGV+EWSGNNP+PPE+WLLPY +P+HP
Sbjct  192   NDGEGDMERGRDWILEHGGATYITSWGKMWLSVLGVFEWSGNNPMPPEIWLLPYALPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHDIDWNQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+   WP  KLR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWATLHKFVEPVFMNWPGKKLREKAIKTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FA QAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWVAEDGMKMQGYNGSQLWDTAFAAQAIISTNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             DE+G  L+KAH FI  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   DEFGPTLKKAHAFIKNSQVSEDCPGD-LSKWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++A ++VGE ++  RLYDAV++ILSLQN +GG ATYELTRSY WLEI+NP+ETF
Sbjct  491   AVLLLSKIAPEIVGEPLDSKRLYDAVNVILSLQNENGGLATYELTRSYTWLEIINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+ID  YVECTSAAI  L  F KL+PG+RR+EI+ CI KA+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDCPYVECTSAAIQALATFGKLYPGHRREEIQCCIEKAVAFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFGI+GL+  G  + +C  IRKAC+FLLSKQLPSGGW ESYLSCQ+KVY+N+
Sbjct  611   GVCFTYGTWFGIKGLIAAGKNFSNCLSIRKACEFLLSKQLPSGGWAESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNT WAMLALIEA Q 
Sbjct  671   EGNRSHVVNTGWAMLALIEAEQA  693



>ref|XP_009136183.1| PREDICTED: cycloartenol synthase [Brassica rapa]
Length=759

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/683 (67%), Positives = 559/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDPNLGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPNLGTPEELAAVEEARKSFRENRFAKKHSSDLLMRLQFSRES  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QV +   ++++E+ V  TL+RG+ FYSTIQA DGHW  DYGGP+FLLP L+I 
Sbjct  72    LSRPVLPQVNIKDGDDVTEKMVETTLKRGVDFYSTIQASDGHWAGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H+ EM RY++NHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKAEMRRYLHNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+  R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPYI+PIHP
Sbjct  192   NDGDGAMEIGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYILPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH++DW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVDWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KAL   ++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLTRWPGANLREKALRTTLEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQA++ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTSFAVQAVLATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L+KAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLKKAHSYVKNSQVSEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE ++  RLYDAV++I+SLQN  GGFATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPVDTKRLYDAVNVIISLQNADGGFATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALVAFRKLYPGHRKKEVDECIEKAVKFIESIQESDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GL   G T ++   + KAC+FLLSKQLPSGGWGESYLSCQDKVY+N+
Sbjct  611   AVCFTYGTWFGVKGLEAAGKTLKNSPTVAKACEFLLSKQLPSGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H+VNTAWA+L+LI AGQV
Sbjct  671   EGNRSHVVNTAWALLSLIGAGQV  693



>ref|XP_006396089.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
 gb|ESQ36868.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
Length=759

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/683 (67%), Positives = 560/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NN++GRQ+WEFDP LGT EE   +++ R  F +NR   KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNNVGRQFWEFDPKLGTPEELADIEEARKSFSENRLVKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++++ V  TL+RG+ FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    MISQVLPQVKVKDSEDVTDKMVENTLKRGVGFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM++ R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEQGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYG R+VGPI ST+LSLR+EL+   YH+IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGTRFVGPITSTVLSLRKELFTVPYHEIDWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KAL   ++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLTRWPGANLREKALRTTLEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD GFAVQAI+ATNL 
Sbjct  372   LNMLCCWVENPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTGFAVQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L+KAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLKKAHSYVKHSQVSEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE ++ +RLYDAV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKEIVGEPLDTNRLYDAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALIAFRKLYPGHRKKDVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G T +S   + +AC+FLLSKQL +GGWGESYLSCQDKVY+N+
Sbjct  611   GVCFTYGTWFGVKGLVAVGKTLKSSPNVARACEFLLSKQLSTGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK H+VNTAWA+LALI AGQ 
Sbjct  671   EGNKSHVVNTAWALLALIGAGQA  693



>ref|XP_006850984.1| hypothetical protein AMTR_s00025p00210690 [Amborella trichopoda]
 gb|ERN12565.1| hypothetical protein AMTR_s00025p00210690 [Amborella trichopoda]
Length=761

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/685 (67%), Positives = 558/685 (81%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR++NNHIGRQ WEFDP  G+ ++R+ V+K R EF  NRF+ KHSSDLLMRMQF KE
Sbjct  11    DPWLRTLNNHIGRQVWEFDPTFGSSDDREAVEKARMEFRANRFEHKHSSDLLMRMQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                +    QVKV   E+I+EEA+  TL+R + F++TIQAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPIKEIPPQVKVEENEDITEEAITTTLKRAIGFHTTIQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-  1689
              L V  A+N VL  EH+KE+ RY+YNHQN DGGWGLHIEGHSTMF TAL YVTLR+LGE 
Sbjct  131   VLYVTGALNTVLSTEHRKEICRYLYNHQNKDGGWGLHIEGHSTMFGTALTYVTLRLLGEG  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               DG +GAM+K RKW+LDHGG T I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +P+
Sbjct  191   PEDGEDGAMEKGRKWVLDHGGLTAISSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPL  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGK++VGPI +T+LSLR+ELY   Y+++DW+ ARN CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKKFVGPITTTVLSLRKELYTIPYNKVDWNDARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH + EP+   WP +KLR+KAL   M HI +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWGFLHKVGEPIFMHWPGSKLREKALHTVMQHIHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII++N
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRILDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIISSN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EY   L+KAH +I  SQ+ E+     L+ WYRH +KG WPFST D+GWP+SDCT E 
Sbjct  431   LVQEYYPALKKAHDYIKYSQVLENC-YGDLQFWYRHISKGAWPFSTRDHGWPISDCTGEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK AL+LS+++ D VGE I  +R YDAV++I+S+QN+ GGFATYELTRSY WLE++NP+E
Sbjct  490   LKVALLLSQISHDAVGEPIPANRFYDAVNVIISMQNSGGGFATYELTRSYAWLELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+P +R KEIE CI+KA+ FI++IQ PDGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALASFKKLYPAHRTKEIETCISKAVHFIESIQRPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TY TWFG++GLV  G TY++   IRKACDFLLSKQLPSGGW ESYLSCQDKVY+
Sbjct  610   SWGVCFTYATWFGVKGLVSAGKTYQTSPSIRKACDFLLSKQLPSGGWSESYLSCQDKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N++GN+ H+VNTAWAMLALI+AGQ 
Sbjct  670   NLKGNRLHLVNTAWAMLALIDAGQA  694



>ref|NP_178722.1| cycloartenol synthase [Arabidopsis thaliana]
 sp|P38605.2|CAS1_ARATH RecName: Full=Cycloartenol synthase; Short=AtCYC; AltName: Full=2,3-epoxysqualene--cycloartenol 
cyclase [Arabidopsis thaliana]
 gb|AAM15015.1| cycloartenol synthase [Arabidopsis thaliana]
 gb|AAM19773.1| At2g07050/T4E14.16 [Arabidopsis thaliana]
 gb|AAN64509.1| At2g07050/T4E14.16 [Arabidopsis thaliana]
 gb|AEC06032.1| cycloartenol synthase [Arabidopsis thaliana]
Length=759

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/683 (67%), Positives = 559/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDPNLGT E+   V++ R  F  NRF  KHS+DLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPNLGTPEDLAAVEEARKSFSDNRFVQKHSADLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVK+   ++++EE V  TL+RGL FYSTIQAHDGHWP DYGGP+FLLP L+I 
Sbjct  72    LISPVLPQVKIEDTDDVTEEMVETTLKRGLDFYSTIQAHDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+G M+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGDMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+++W+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVNWNEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP   LR+KA+  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKIVEPVLMRWPGANLREKAIRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI D+LWLAEDGMKM GYNGSQLWD GFA+QAI+ATNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDFLWLAEDGMKMQGYNGSQLWDTGFAIQAILATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG +L KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPVLEKAHSFVKNSQVLEDCPGD-LNYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++   +VGE I+  RLY+AV++I+SLQN  GG ATYELTRSYPWLE++NP+ETF
Sbjct  491   AALLLSKVPKAIVGEPIDAKRLYEAVNVIISLQNADGGLATYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALISFRKLYPGHRKKEVDECIEKAVKFIESIQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQ PSGGWGESYLSCQDKVY+N+
Sbjct  611   AVCFTYGTWFGVKGLVAVGKTLKNSPHVAKACEFLLSKQQPSGGWGESYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             +GN+ H+VNTAWAMLALI AGQ 
Sbjct  671   DGNRSHVVNTAWAMLALIGAGQA  693



>gb|AIY33888.1| cycloartenol synthase [Nicotiana tabacum]
Length=757

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/684 (66%), Positives = 554/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GR+ WEFDP LG+ E+R ++ K R  FHK+RF+ KHS+DL+MR Q  KE
Sbjct  11    NPWLRTTNNHVGRELWEFDPELGSPEDRAEIDKFREHFHKHRFEQKHSADLIMRYQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV   E+I+E+ V  TLRR L FYST+Q HDGHW  DYGGP+FL+P +VI
Sbjct  71    NPGITILPQVKVQGNEDITEDTVATTLRRALSFYSTLQTHDGHWAGDYGGPMFLMPGMVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LSV  A+NAVL  EH++EM+RY+YNHQN DGGWGLHIEGHSTMF + L+YVTLR+LGE 
Sbjct  131   ALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHSTMFGSVLSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K RKWILDHG AT I SWGK+WL+VLG ++WSGNNPLPPE+WLLPY +PIH
Sbjct  191   ANDGEGAMEKGRKWILDHGSATAITSWGKMWLTVLGAFDWSGNNPLPPEIWLLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM YLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMCYLYGKRFVGPITPTVLSLRKELFTVPYHEIDWNKARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL + M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILMHWPGKRLREKALRIVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             +LNM+C W+E+P+S A K+HL RI DY+W+AEDGMK+ GYNGSQ WD  FA+QAIIAT L
Sbjct  371   ILNMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKIKGYNGSQSWDTSFAIQAIIATEL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYGS LRKAH FI  +Q+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   GEEYGSALRKAHSFIKNTQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VG+ ++  R YDAV+++LSLQN+ GGFATYEL+RSYPWLEI+NP+ET
Sbjct  490   KATLLLSKLPSEIVGDPLDAKRFYDAVNVLLSLQNSGGGFATYELSRSYPWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVERCIAKAAAFIEKIQEADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y +   IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVLGLLAAGRNYTNSSSIRKACDFLLSKQISSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN++H+VNT+WAML LI AGQ 
Sbjct  670   LEGNRYHVVNTSWAMLTLIAAGQA  693



>ref|XP_009620777.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620778.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620779.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Nicotiana tomentosiformis]
Length=757

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/684 (66%), Positives = 554/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+ NNH+GR+ WEFDP LG+ E+R ++ K R  FHK+RF+ KHS+DL+MR Q  KE
Sbjct  11    NPWLRTTNNHVGRELWEFDPELGSPEDRAEIDKFREHFHKHRFEQKHSADLIMRYQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV   E+I+EE V  TLRR L FYST+Q HDGHW  DYGGP+FL+P +VI
Sbjct  71    NPGITILPQVKVQGNEDITEETVATTLRRALSFYSTLQTHDGHWAGDYGGPMFLMPGMVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LSV  A+NAVL  EH++EM+RY+YNHQN DGGWGLHIEGHSTMF + L+YVTLR+LGE 
Sbjct  131   ALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHSTMFGSVLSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K RKWILDHG AT I SWGK+WL+VLG ++WSGNNPLPPE+WLLPY +PIH
Sbjct  191   ANDGEGAMEKGRKWILDHGSATAITSWGKMWLTVLGAFDWSGNNPLPPEIWLLPYFLPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM YLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMCYLYGKRFVGPITPTVLSLRKELFTVPYHEIDWNKARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL + M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILMHWPGKRLREKALRIVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             +LNM+C W+E+P+S A K+HL RI DY+W+AEDGMK+ GYNGSQ WD  FA+QAIIAT L
Sbjct  371   ILNMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKIKGYNGSQSWDTSFAIQAIIATEL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYGS LRKAH FI  +Q+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   GEEYGSALRKAHSFIKNTQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VG+ ++  R YDAV+++LSLQN+ GGFATYEL+RSYPWLEI+NP+ET
Sbjct  490   KATLLLSKLPSEIVGDPLDAKRFYDAVNVLLSLQNSGGGFATYELSRSYPWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVERCIAKAAAFIEKIQEADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y +   IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVLGLLAVGRNYTNSSSIRKACDFLLSKQISSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN++H+VNT+WAML LI AGQ 
Sbjct  670   LEGNRYHVVNTSWAMLTLIAAGQA  693



>ref|XP_006372242.1| cycloartenol synthase family protein [Populus trichocarpa]
 gb|ERP50039.1| cycloartenol synthase family protein [Populus trichocarpa]
Length=760

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/685 (68%), Positives = 553/685 (81%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ NNHIGRQ WEFDP L  +  E ++++  R  F +NRF  KHS+DL+MRMQFEK
Sbjct  11    NPWLRTTNNHIGRQVWEFDPTLTLSPREIEEIENARRNFTENRFLFKHSADLIMRMQFEK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV   EE++EEAV  TL+R L FYS+IQAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPVPEVLPQVKVKESEEVTEEAVAATLKRALNFYSSIQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NAVL +EH+KEM+RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE
Sbjct  131   ITLSITGALNAVLSDEHKKEMIRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G+GAM K   WIL+HG AT I SWGK+WLSVLGV+EWSGNNP+PPE+WLLPY++P+
Sbjct  191   GPNDGDGAMDKGHDWILNHGSATMITSWGKMWLSVLGVFEWSGNNPMPPEMWLLPYLLPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+EL+   YH+IDW+ ARN CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPIVLSLRKELFTVPYHEIDWNQARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD +W  L    EP+L  WP  KLR++AL  AM+H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDALWALLDKAAEPVLMHWPGKKLREQALHTAMEHMHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI+DYLWLAEDGMKM GYNGSQLWD  FAVQAII+T 
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRIQDYLWLAEDGMKMQGYNGSQLWDTSFAVQAIISTK  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  431   LVEEYGPTLRKAHAYIKNSQVLEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS++  ++VGE +  +R YDAV++ILSLQN  GGFATYELTRSY WLE++NP+E
Sbjct  490   LKAALLLSKITPEIVGEPLAANRFYDAVNVILSLQNGDGGFATYELTRSYSWLELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+R++EIE CI KA  FI++IQ  DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALVSFKKLYPGHRQEEIERCIRKATKFIESIQEKDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI GLV  GN +     IRKACDFLLSKQ  SGGWGESYLSCQ+KVY+
Sbjct  610   SWGVCFTYGTWFGINGLVAAGNFFNDNSSIRKACDFLLSKQCSSGGWGESYLSCQNKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNTAWAMLALIEAGQ 
Sbjct  670   NLEGNKTHVVNTAWAMLALIEAGQA  694



>gb|KHN32928.1| Cycloartenol synthase [Glycine soja]
Length=767

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/685 (68%), Positives = 562/685 (82%), Gaps = 2/685 (0%)
 Frame = -3

Query  2228  DDPW-LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFE  2052
             +D W ++SVNNHIGRQ+WEFDP+LGT+EER QV+++  EF+KNRF+ KHSSDLLMR+QFE
Sbjct  11    EDEWIMQSVNNHIGRQFWEFDPHLGTKEERAQVEQVHKEFNKNRFKYKHSSDLLMRLQFE  70

Query  2051  KEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             +EKG +  L ++++ SE++I+EE V  TL+R LR YS +QA DG WPADYGGPLFLLP L
Sbjct  71    REKGLKTKLSKIEIQSEQDINEEVVRNTLKRALRSYSALQADDGFWPADYGGPLFLLPGL  130

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             VIGLSV   +N VL  EHQ EM RY++NHQN DGGWGLHIEG STMFCTALNYVTLR+LG
Sbjct  131   VIGLSVTGVLNVVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGSSTMFCTALNYVTLRLLG  190

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             E+ DGG GA++KAR WIL HGG T+IPSWGKLWLSVLGVYEWSG  P+PPE WL PY +P
Sbjct  191   EDIDGGEGAIQKARTWILHHGGVTYIPSWGKLWLSVLGVYEWSGMKPIPPETWLFPYFLP  250

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
              HPGRMWCH R+VYLPMSYLYG+R+VGPIN+ ILSLR+ELY   YH ++W+ A+N CAKE
Sbjct  251   FHPGRMWCHSRLVYLPMSYLYGRRFVGPINTIILSLRKELYTIPYHLVNWNEAKNLCAKE  310

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLY+P P IQ+I+W  LHNI EPLL  WP +KLR+KAL   M HI +EDE TNY+CIGPV
Sbjct  311   DLYHPCPMIQNILWGFLHNIGEPLLMHWPCSKLREKALHYIMQHIHYEDENTNYICIGPV  370

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E P+S A K H+SRIKDYLWLAEDGMKM GYNGSQ WDV F++QAI+A 
Sbjct  371   NKVLNMVCCWLENPNSHAFKYHISRIKDYLWLAEDGMKMQGYNGSQFWDVTFSIQAILAI  430

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEYGS+L+KA+ FI  SQI  +S  N L  WYRH +KGGWPFST DNGWPVSDCTAE
Sbjct  431   NLEDEYGSILKKANNFIKYSQITANSSGN-LSHWYRHISKGGWPFSTADNGWPVSDCTAE  489

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LKAA++LS +  + VG+ +E  +L+DAV+LILSLQN +GGFA+YELTRSY WLE +NP+
Sbjct  490   GLKAAILLSNLPFETVGKPMETEQLWDAVNLILSLQNRNGGFASYELTRSYAWLEKINPT  549

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETF +I+IDYQ VECTS+AI GL  F + +P +RRKEI+ CI KA  +I++IQL +GSWY
Sbjct  550   ETFEDIMIDYQCVECTSSAIQGLVLFTQRYPRHRRKEIKTCIAKAANYIESIQLANGSWY  609

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSWG+CY YGTWFGI+GL+  G +Y+    IR+ C+FLLSKQ   GGWGESY++CQ KVY
Sbjct  610   GSWGICYIYGTWFGIKGLIDAGKSYQDSQSIRRGCEFLLSKQQLCGGWGESYIACQQKVY  669

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+EGNK H+VNTAWAMLALIEAGQ
Sbjct  670   TNLEGNKSHVVNTAWAMLALIEAGQ  694



>sp|Q9SXV6.1|CAS1_GLYGL RecName: Full=Cycloartenol synthase [Glycyrrhiza glabra]
 dbj|BAA76902.1| cycloartenol synthase [Glycyrrhiza glabra]
Length=757

 Score =   971 bits (2511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/683 (67%), Positives = 552/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+VNNH+GRQ WEFDP LG+ E+  +++K R  FH NRF  KHS+DLLMR+ F KE 
Sbjct  12    PWLRTVNNHVGRQVWEFDPKLGSPEDLLEIEKARQNFHDNRFTHKHSADLLMRIHFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L +V+V   E+++EE V  TLRR + F+ST+Q+HDGHWP DYGGP+FL+P LVI 
Sbjct  72    PMNEVLPKVRVKDIEDVTEETVKTTLRRAINFHSTLQSHDGHWPGDYGGPMFLMPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL EEH+KE+ RY+YNHQN DGGWGLHIEG STMF + LNYV LR+LGE  
Sbjct  132   LSITGALNAVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVALRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             +   G M+K R WIL HGGATFI SWGK+WLSVLGVYEWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   NDRQGEMEKGRDWILGHGGATFITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYVLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+ELY   YH IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELYTIPYHDIDWNQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  +EP+L  WP  KLR+ A+  A++HI +ED+ T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHKFLEPILMHWPGKKLREMAIKTAIEHIHYEDDNTRYLCIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  F  QAII++NL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDTAFTAQAIISSNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHTYIKNSQVLEDCPGD-LSKWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++A ++VGE ++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLLLSKIAPEIVGEPLDAKRLYDAVNVILSLQNEDGGFATYELTRSYTWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+RR+EI+ CI KA +FI+  Q  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIQCCIEKAASFIEKTQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GL+  G ++ +C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVY+N+
Sbjct  611   GVCFTYGTWFGVKGLIAAGKSFNNCSSIRKACEFLLSKQLPSGGWGESYLSCQNKVYSNV  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             E N+ H+VNT WAMLALI+A Q 
Sbjct  671   ESNRSHVVNTGWAMLALIDAEQA  693



>ref|XP_002308131.2| cycloartenol synthase family protein [Populus trichocarpa]
 gb|EEE91654.2| cycloartenol synthase family protein [Populus trichocarpa]
Length=760

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/685 (67%), Positives = 558/685 (81%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ N+HIGRQ WEFDP L  + EE  +++  R  F KNRFQ KHS+DL+MRMQFEK
Sbjct  11    NPWLRTNNDHIGRQIWEFDPKLTLSPEEISEIENARQNFTKNRFQSKHSADLIMRMQFEK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVK+   E+++EEAV  TL+RGL +YS+IQAHDGHWP DYGGP+FL+P LV
Sbjct  71    ENPVSEVLPQVKLKESEKVTEEAVTTTLKRGLDYYSSIQAHDGHWPGDYGGPMFLMPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A++AVL +EH+KE++RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE
Sbjct  131   ITLSITGALHAVLSDEHKKEIIRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GAM+KAR WIL+HGGAT I SWGK+WLSVLGV+EWSGNNP+PPE+WLLPY++P+
Sbjct  191   GPNDGEGAMEKARDWILNHGGATMITSWGKMWLSVLGVFEWSGNNPMPPEMWLLPYLLPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+EL+   YH+I+W+ AR  CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELFTVPYHEIEWNQARTLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  L    EP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDVLWALLDKAAEPVLMHWPGKKLREKALCTAIEHIHYEDENTRYLCIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+H+ RI+DYLWLAEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHIPRIQDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EY   L+KAH F+  SQI ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  431   LVEEYSPTLKKAHAFVKNSQILEDCPGD-LHFWYRHISKGAWPFSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS++  ++VGE +  +R YDAV+++LSLQN  GGFATYELTRSY WLE++NP+E
Sbjct  490   LKAALLLSKIPSEIVGEPLVANRFYDAVNVLLSLQNGDGGFATYELTRSYSWLELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+R +EIE+CI KA  FI++IQ  DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALTSFKKLYPGHRSEEIESCIRKATMFIESIQEKDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GLV  G  + +   IRKACDFLLSKQ  SGGWGESYLSCQ+K Y+
Sbjct  610   SWGVCFTYGIWFGIKGLVAAGKNFNNSSSIRKACDFLLSKQCSSGGWGESYLSCQNKTYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             NIEGN+ H+VNTAWAML+LIEAGQ 
Sbjct  670   NIEGNRAHVVNTAWAMLSLIEAGQA  694



>sp|O82139.1|CAS1_PANGI RecName: Full=Cycloartenol Synthase [Panax ginseng]
 dbj|BAA33460.1| Cycloartenol Synthase [Panax ginseng]
Length=758

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/684 (67%), Positives = 555/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++N+H+GRQ WEFDPN+G+ EE  +V+K+R  F  +RF+ KHS+DLLMR+QF  E
Sbjct  11    NPWLRTLNDHVGRQIWEFDPNIGSPEELAEVEKVRENFRNHRFEKKHSADLLMRIQFANE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   E+ISE+ V  TL+R + FYST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPGSVVLPQVKVNDGEDISEDKVTVTLKRAMSFYSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+   +N VL +EH++E+ RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE 
Sbjct  131   TLSITGVLNVVLSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K R+WILDHG AT I SWGK+WLSVLGV+EWSGNNPLPPE WLLPYI+PIH
Sbjct  191   ANDGQGAMEKGRQWILDHGSATAITSWGKMWLSVLGVFEWSGNNPLPPETWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCH RMVYLPMSYLYGKR+VGPI  T+LSLR+E+++  YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHRRMVYLPMSYLYGKRFVGPITPTVLSLRKEVFSVPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  L  + EP+   WP  KLR+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLIQDILWASLDKVWEPIFMHWPAKKLREKSLRTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL R+ D+LWLAEDGMKM GYNGSQLWD  FAVQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRLHDFLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKAH F+  SQ+ +D   + L +WYRH +KG WPFST D+GWP+SDCTAE  
Sbjct  431   AEEYGPTLRKAHTFMKNSQVLDDCPGD-LDAWYRHVSKGAWPFSTADHGWPISDCTAEGF  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L LS++  ++VGE ++  RLYDAV++ILSLQN+ GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAVLQLSKLPSELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYSWLELVNPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL PG+RR+EI+  I KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTAFKKLFPGHRREEIQHSIEKAALFIEKIQSSDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFGI+GLV  G T+ SC  IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGIKGLVTAGRTFSSCASIRKACDFLLSKQVASGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WAMLALI+AGQ 
Sbjct  670   LEGNRSHVVNTGWAMLALIDAGQA  693



>gb|KDP27754.1| hypothetical protein JCGZ_19783 [Jatropha curcas]
Length=758

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/682 (67%), Positives = 556/682 (82%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLR+ N+H GRQ WEFDP LG+ EE  +++  R  F KNRF  KHSSDLLMR+QF KE  
Sbjct  14    WLRTNNDHYGRQVWEFDPKLGSPEELLEIENARQNFSKNRFDKKHSSDLLMRIQFGKENP  73

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L QVK+   ++++EEAV  TL+R L FYSTIQA+DGHWP DYGGP+FL+P LVI L
Sbjct  74    LGAVLPQVKLNDTQDVTEEAVTTTLKRALNFYSTIQAYDGHWPGDYGGPMFLMPGLVITL  133

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             SV  A+NAVL EEH++EM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE  +
Sbjct  134   SVTGALNAVLSEEHKREMCRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGAN  193

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GAM++ R WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +P HPG
Sbjct  194   DGEGAMERGRNWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPFHPG  253

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN CAKEDLYY
Sbjct  254   RMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTLPYHEIDWNHARNHCAKEDLYY  313

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH IVEP+L  WP  KLR+KAL+ A++HI +EDE T Y+CIGPVNKVL
Sbjct  314   PHPLVQDVLWGVLHKIVEPILMHWPAKKLREKALSTAIEHIHYEDENTRYICIGPVNKVL  373

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FA+QAI++TNL +
Sbjct  374   NMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAIQAILSTNLVE  433

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             +YG  LRKAH+++  SQ+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  434   DYGPTLRKAHIYLKKSQVLENCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  492

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++  ++VGE ++ + LYDAV++ILSLQN+SGGFATYELTRSY WLE++NP+ETFG
Sbjct  493   ALLLSKIPSEIVGEGVDANHLYDAVNVILSLQNDSGGFATYELTRSYNWLELINPAETFG  552

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F KL+P +R++EI+ CI KA  FI+ IQ  DGSWYGSWG
Sbjct  553   DIVIDYPYVECTSAAIQALMSFSKLYPEHRQEEIDCCITKATKFIENIQAADGSWYGSWG  612

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYGTWFGI+GLV  G  + +C  IR+AC+FLLSKQ PSGGWGESYLSC+ KVY+++E
Sbjct  613   VCFTYGTWFGIKGLVAAGRNFNNCSSIRRACEFLLSKQRPSGGWGESYLSCEKKVYSHLE  672

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             G K H+VNTAWAML+LI+AGQ 
Sbjct  673   GGKSHVVNTAWAMLSLIDAGQA  694



>emb|CDX93093.1| BnaA03g38150D [Brassica napus]
Length=768

 Score =   969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/692 (66%), Positives = 560/692 (81%), Gaps = 10/692 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+W+FDPNLGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWDFDPNLGTPEELAAVEEARKSFRENRFAKKHSSDLLMRLQFSRES  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QV +   ++++E+ V  TL+RG+ FYSTIQA DGHW  DYGGP+FLLP L+I 
Sbjct  72    LSRQVLPQVNIKDGDDVTEKMVETTLKRGVDFYSTIQASDGHWAGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQ---------NIDGGWGLHIEGHSTMFCTALNYV  1710
             LS+  A+N VL E+H+ EM RY++NHQ         N DGGWGLHIEG STMF + LNYV
Sbjct  132   LSITGALNTVLSEQHKAEMRRYLHNHQANTHYLLILNEDGGWGLHIEGPSTMFGSVLNYV  191

Query  1709  TLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwl  1530
             TLR+LGE  + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WL
Sbjct  192   TLRLLGEGPNDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWL  251

Query  1529  lPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLAR  1350
             LPYI+PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH++DW+ AR
Sbjct  252   LPYILPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVDWNEAR  311

Query  1349  NQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNY  1170
             N CAKEDLYYPHP +QDI+W  LH IVEP+L +WP   LR+KAL   ++HI +EDE T Y
Sbjct  312   NLCAKEDLYYPHPLVQDILWASLHKIVEPVLTRWPGANLREKALRTTLEHIHYEDENTRY  371

Query  1169  VCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAV  990
             +CIGPVNKVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAV
Sbjct  372   ICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTSFAV  431

Query  989   QAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPV  810
             QA++ATNL +EYG +L+KAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+
Sbjct  432   QAVLATNLVEEYGPVLKKAHSYVKNSQVSEDCPGD-LSYWYRHISKGAWPFSTADHGWPI  490

Query  809   SDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWL  630
             SDCTAE LKAAL+LS++  ++VGE ++  RLYDAV++I+SLQN  GGFATYELTRSYPWL
Sbjct  491   SDCTAEGLKAALLLSKVPKEIVGEPVDTKRLYDAVNVIISLQNADGGFATYELTRSYPWL  550

Query  629   EILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQL  450
             E++NP+ETFG+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ 
Sbjct  551   ELINPAETFGDIVIDYPYVECTSAAIQALVAFRKLYPGHRKKEVDECIEKAVKFIESIQE  610

Query  449   PDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLS  270
              DGSWYGSW VC+TYGTWFG++GL   G T ++   + KAC+FLLSKQLPSGGWGESYLS
Sbjct  611   SDGSWYGSWAVCFTYGTWFGVKGLEAAGKTLKNSPTVAKACEFLLSKQLPSGGWGESYLS  670

Query  269   CQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             CQDKVY+N+EGN+ H+VNTAWA+L+LI AGQV
Sbjct  671   CQDKVYSNLEGNRSHVVNTAWALLSLIGAGQV  702



>gb|AGK62447.1| cycloartenol synthase [Panax quinquefolius]
Length=757

 Score =   969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/684 (67%), Positives = 556/684 (81%), Gaps = 2/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++N+H+GRQ WEFDPN+G+ EE  +++K+R  F  +RF+ KHS+DLLMR+QF  E
Sbjct  11    NPWLRTLNDHVGRQIWEFDPNIGSPEELAEIEKVRENFRDHRFEKKHSADLLMRIQFANE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   E+I E+ V  TL+R + FYST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPGSVVLPQVKVNDGEDILEDKVTVTLKRAMSFYSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL +EH++E+ RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K R+WILDHG AT I SWGK+WLSVLGV+EWSGNNPLPPE WLLPYI+PIH
Sbjct  191   ANDGQGAMEKGRQWILDHGSATAITSWGKMWLSVLGVFEWSGNNPLPPETWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLRR +++  YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRR-VFSVPYHEIDWNQARNLCAKEDL  309

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  L  + EP+   WP  KLR+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  310   YYPHPLIQDILWASLDKVWEPIFMHWPAKKLREKSLRTVMEHIHYEDENTRYICIGPVNK  369

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL R+ D+LWLAEDGMKM GYNGSQLWD  FAVQAII+TNL
Sbjct  370   VLNMLCCWVEDPNSEAFKLHLPRLHDFLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTNL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKAH F+  SQ+ +D   + L +WYRH +KG WPFST D+GWP+SDCTAE  
Sbjct  430   AEEYGPTLRKAHTFMKNSQVLDDCPGD-LDAWYRHVSKGAWPFSTADHGWPISDCTAEGF  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L LS++  ++VGE ++  RLYDAV++ILSLQN+ GG+ATYELTRSY WLE++NP+ET
Sbjct  489   KAVLQLSKLPSELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYSWLELVNPAET  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL PG+RR+EI+  I KA  FI+ IQ  DGSWYGS
Sbjct  549   FGDIVIDYPYVECTSAAIQALTAFKKLFPGHRREEIQHSIEKAALFIEKIQSSDGSWYGS  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFGI+GLV  G T+ SC  IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  609   WGVCFTYGTWFGIKGLVTAGRTFSSCASIRKACDFLLSKQVASGGWGESYLSCQNKVYTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WAMLALI+AGQ 
Sbjct  669   LEGNRSHVVNTGWAMLALIDAGQA  692



>emb|CDY50938.1| BnaC03g74380D [Brassica napus]
Length=763

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/687 (66%), Positives = 558/687 (81%), Gaps = 5/687 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ+WEFDPNLGT EE   V++ R  F +NRF  KHSSDLLMR+QF +E 
Sbjct  12    PWLRTTNNHVGRQFWEFDPNLGTPEELAAVEEARKSFRENRFAKKHSSDLLMRLQFSREN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QV V   ++++E+ V  TL+RG+ FYSTIQA DGHW  DYGGP+FLLP L+I 
Sbjct  72    LSRPVLPQVNVKDGDDVTEKMVETTLKRGVDFYSTIQASDGHWAGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQ----NIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LS+  A+N VL E+H+ EM RY++NHQ    N DGGWGLHIEG STMF + LNYVTLR+L
Sbjct  132   LSITGALNTVLSEQHKSEMRRYLHNHQANTYNEDGGWGLHIEGPSTMFGSVLNYVTLRLL  191

Query  1694  GEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             GE  + G+GAM+K R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +
Sbjct  192   GEGPNDGDGAMEKGRDWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFL  251

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH++DW+ ARN CAK
Sbjct  252   PIHPGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEVDWNEARNLCAK  311

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP +QDI+W  LH IVEP+L +WP   LR+KAL   ++HI +EDE T Y+CIGP
Sbjct  312   EDLYYPHPLVQDILWASLHKIVEPVLTRWPGANLREKALRTTLEHIHYEDENTRYICIGP  371

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQA++A
Sbjct  372   VNKVLNMLCCWVEDPNSEAFKLHLPRIHDYLWVAEDGMKMQGYNGSQLWDTSFAVQAVLA  431

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             TN  +EYG +L+KAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTA
Sbjct  432   TNFVEEYGPVLKKAHSYVKNSQVSEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTA  490

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAAL+LS++  ++VGE ++  RLYDAV++I+SLQN  GGFATYELTRSYPWLE++NP
Sbjct  491   EGLKAALLLSKVPKEIVGEPVDTKRLYDAVNVIISLQNADGGFATYELTRSYPWLELINP  550

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+I+IDY YVECTSAAI  L  FRKL+PG+R+KE++ CI KA+ FI++IQ  DGSW
Sbjct  551   AETFGDIVIDYPYVECTSAAIQALIAFRKLYPGHRKKEVDECIEKAVKFIESIQESDGSW  610

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSW VC+TYGTWFG++GL   G T ++   + KAC+FLLSKQLPSGGWGESYLSCQDKV
Sbjct  611   YGSWAVCFTYGTWFGVKGLEAAGKTLKNSPTVAKACEFLLSKQLPSGGWGESYLSCQDKV  670

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             Y+N++GN+ H+VNTAWA+L+LI AGQV
Sbjct  671   YSNLDGNRSHVVNTAWALLSLIGAGQV  697



>ref|XP_008391430.1| PREDICTED: cycloartenol synthase 2 isoform X1 [Malus domestica]
Length=756

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/683 (67%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++ N++GRQ WEFDP LGT EE  ++++ R  +  NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLXNNVGRQVWEFDPKLGTPEELLEIERARENYXNNRFVKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++E+ V  TL+RG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PVPAVLPQVKVKDTEDVTEKTVTNTLKRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGN  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILMHWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSTLRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++ +RLYDAV++ILSLQNN GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDANRLYDAVNVILSLQNNDGGFATYELTRSYSWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA+I  L+ F+KL+P +RR+EIE CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSASIQALESFKKLYPCHRREEIEHCIKRAVEFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLTSGGWSESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EG++ H+VNT WAMLALI+ GQ 
Sbjct  671   EGDRSHVVNTGWAMLALIDGGQA  693



>ref|XP_003517615.1| PREDICTED: cycloartenol synthase-like [Glycine max]
Length=767

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/685 (68%), Positives = 561/685 (82%), Gaps = 2/685 (0%)
 Frame = -3

Query  2228  DDPW-LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFE  2052
             +D W ++SVNNHIGRQ+WEFDP+LGT+EER QV+++  EF+KNRF+ KHSSDLLMR+QFE
Sbjct  11    EDEWIMQSVNNHIGRQFWEFDPHLGTKEERAQVEQVHKEFNKNRFKYKHSSDLLMRLQFE  70

Query  2051  KEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             +EKG +  L ++++ SE++I+EE V  TL+R LR YS +QA DG WPADYGGPLFLLP L
Sbjct  71    REKGLKTKLSKIEIQSEQDINEEVVRNTLKRALRSYSALQADDGFWPADYGGPLFLLPGL  130

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             VIGLSV   +N VL  EHQ EM RY++NHQN DGGWGLHIEG STMFCTALNYVTLR+LG
Sbjct  131   VIGLSVTGVLNVVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGSSTMFCTALNYVTLRLLG  190

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             E+ DGG GA++KAR WIL HGG T+IPSWGKLWLSVLGVYEWSG  P+PPE WL PY +P
Sbjct  191   EDIDGGEGAIQKARTWILHHGGVTYIPSWGKLWLSVLGVYEWSGMKPIPPETWLFPYFLP  250

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
              HPGRMWCH R+VYLPMSYLYG+R+VGPIN+ ILSLR+ELY   YH ++W+ A+N CAKE
Sbjct  251   FHPGRMWCHSRLVYLPMSYLYGRRFVGPINTIILSLRKELYTIPYHLLNWNEAKNLCAKE  310

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLY+P P IQ+I+W  LHNI EPLL  WP +KLR+KAL   M HI +EDE TNY+CIGPV
Sbjct  311   DLYHPCPMIQNILWGFLHNIGEPLLMHWPCSKLREKALHYIMQHIHYEDENTNYICIGPV  370

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E P+S A K H+SRIKDYLWLAEDGMKM GYNGSQ WDV F++QAI+A 
Sbjct  371   NKVLNMVCCWLENPNSHAFKYHISRIKDYLWLAEDGMKMQGYNGSQFWDVTFSIQAILAI  430

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEYGS+L+KA+ FI  SQI  +S  N L  WYRH +KGGWPFST DNGWPVSDCTAE
Sbjct  431   NLEDEYGSILKKANNFIKYSQITANSSGN-LSHWYRHISKGGWPFSTADNGWPVSDCTAE  489

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LKAA++LS +  + VG+ +E  +L+DAV+LILSLQN +GGFA+YELTRSY WLE +NP+
Sbjct  490   GLKAAILLSNLPFETVGKPMETEQLWDAVNLILSLQNRNGGFASYELTRSYAWLEKINPT  549

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETF +I+IDYQ VECTS+AI GL  F + +P +R KEI+ CI KA  +I++IQL +GSWY
Sbjct  550   ETFEDIMIDYQCVECTSSAIQGLVLFTQRYPRHRWKEIKTCIAKAANYIESIQLANGSWY  609

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSWG+CY YGTWFGI+GL+  G +Y+    IR+ C+FLLSKQ   GGWGESY++CQ KVY
Sbjct  610   GSWGICYIYGTWFGIKGLIDAGKSYQDSQSIRRGCEFLLSKQQLCGGWGESYIACQQKVY  669

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+EGNK H+VNTAWAMLALIEAGQ
Sbjct  670   TNLEGNKSHVVNTAWAMLALIEAGQ  694



>ref|XP_002269849.1| PREDICTED: cycloartenol synthase [Vitis vinifera]
 emb|CBI18422.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/685 (69%), Positives = 555/685 (81%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DDPWLR++N H+GRQ WEFDP+LGTQEER QV + R  F   RF+ KHSSDLLMRMQF +
Sbjct  10    DDPWLRTLNGHVGRQVWEFDPHLGTQEERNQVDEARRSFADLRFEKKHSSDLLMRMQFAR  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   +E++EE V  TLRRGL FYSTIQAHDGHWP DYGGP+FLLP LV
Sbjct  70    ENPCVANLPQIKVQDLKEVTEEVVTTTLRRGLNFYSTIQAHDGHWPGDYGGPMFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ+EM RY++NHQN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  130   ITLYITGALNVVLSIEHQREMCRYLFNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
              R G  G M+K RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WL PYI+PI
Sbjct  190   GRFGAEGVMEKGRKWILDHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYILPI  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSY+YGKR+VGPI  TI+SLR+ELY   Y ++DW+ ARNQCAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYIYGKRFVGPITPTIISLRKELYIVPYQEVDWNQARNQCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPH  +QDI+W  LH ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  310   LYYPHSLVQDILWASLHKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  370   KVLNMLCCWIEDPNSEAFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTCFAVQAIISTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  430   LGGEYGLTLRKAHEFIKNSQVLEDCPGD-LKFWYRHISKGAWPFSTADHGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS+++ + VGE ++  +L+DAV++ILSLQN  GGFATYELTRSY W+E++NP+E
Sbjct  489   LKAVLLLSKLSLETVGEPLDMEQLFDAVNVILSLQNADGGFATYELTRSYRWVELINPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY Y ECTSAAI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSWYG
Sbjct  549   TFGDIVIDYPYAECTSAAIQALTSFKKLYPEHRRHEIENCISKAAKFIEDIQAPDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ+KVYT
Sbjct  609   SWGVCFTYGGWFGIKGLIAAGNTYSNCPCIRKACDYLLSKELGSGGWGESYLSCQNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G+K H VNTAWAMLALI+AGQ 
Sbjct  669   NLPGDKPHNVNTAWAMLALIDAGQA  693



>gb|ABX75046.1| cycloartenol synthase 1 [Polygala tenuifolia]
Length=761

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/685 (67%), Positives = 551/685 (80%), Gaps = 3/685 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNL--GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             PWLR+ N+HIGRQ WEFD  L  G+ ++ ++++  R  F++NRFQ KHSSDLLMR+QF K
Sbjct  14    PWLRTGNDHIGRQVWEFDNELEVGSTQQLEEIENARKLFYENRFQNKHSSDLLMRIQFAK  73

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV    +I+EE V  TLRR + F+ST+QAHDGHWP DYGGPLFL+P LV
Sbjct  74    EYPGTKVLPQVKVKDGNDITEEVVTTTLRRAISFHSTLQAHDGHWPGDYGGPLFLMPGLV  133

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A NAVL E+H+KEM RY+YN QN DGGWGLHIEGHSTMF + LNYVTLR+LGE
Sbjct  134   ITLSITGAPNAVLSEQHRKEMCRYLYNRQNKDGGWGLHIEGHSTMFGSVLNYVTLRLLGE  193

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GAM++ R WIL HGGAT I SWGK+WLSVLGVYEWSGNNPLPPE+ L+PYI+P 
Sbjct  194   GANDGEGAMERGRDWILGHGGATMITSWGKMWLSVLGVYEWSGNNPLPPEIRLIPYILPF  253

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELYN  YH+I+WD AR+QCAKED
Sbjct  254   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYNTPYHEINWDHARSQCAKED  313

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  LH  +EP+L +WP  KLR KAL  AM+HI +EDE T Y+CIGPVN
Sbjct  314   LYYPHPLLQDLIWTSLHKGIEPILMRWPGKKLRDKALRTAMEHIHYEDENTRYLCIGPVN  373

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             K LNM+C W+E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII++N
Sbjct  374   KALNMLCCWVEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISSN  433

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +E+   LRKAH +I  +Q+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  434   LGEEFEVTLRKAHAYIKNTQVLEDCPGD-LHHWYRHISKGAWPFSTADHGWPISDCTAEG  492

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAA +LS+    +VGE ++  RLYDAV++ILSLQN  GGFATYELTRSYPWLE+ NP+E
Sbjct  493   LKAAPLLSKFPSKMVGEPLDAKRLYDAVNVILSLQNPDGGFATYELTRSYPWLELTNPAE  552

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+ L+PGYR++EIE CI KA+ F + IQ  DGSWYG
Sbjct  553   TFGDIVIDYTYVECTSAAIQALVSFKGLYPGYRKEEIERCIEKAVAFTEQIQSSDGSWYG  612

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+C+TYGTWFG+R LV  G TY++C  +RKAC FLLSKQLPSGGWGESYL+CQ+KVYT
Sbjct  613   SWGICFTYGTWFGVRALVTAGKTYDNCSSVRKACKFLLSKQLPSGGWGESYLTCQNKVYT  672

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+E ++ H+VNTAWAM+AL +AGQ 
Sbjct  673   NLEEDRSHVVNTAWAMMALFDAGQA  697



>ref|XP_010067808.1| PREDICTED: cycloartenol synthase 2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW66020.1| hypothetical protein EUGRSUZ_G03312 [Eucalyptus grandis]
Length=762

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/687 (68%), Positives = 564/687 (82%), Gaps = 2/687 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DD  +RS+ +++GRQYWEF+ N GT +E   ++++R  F +NR ++K SSDLLMR+QF K
Sbjct  10    DDLEVRSMYDNLGRQYWEFESNSGTPDELAMIERMRQAFTQNRHRVKQSSDLLMRLQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             EK +   +++V+VG EE+ISEEAVV TL+R +RFYST+QA DGHWP DYGGPLFLLP LV
Sbjct  70    EKSRAEEVEKVRVGEEEDISEEAVVNTLKRTIRFYSTLQAEDGHWPGDYGGPLFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGL +   +++VL  EH+KEM+RY+YNHQN DGGWG+HIEG STMF T L+YVTLR+LG+
Sbjct  130   IGLYITGDLHSVLSSEHRKEMIRYLYNHQNEDGGWGIHIEGKSTMFGTGLSYVTLRLLGQ  189

Query  1688  ERDGGNGA-MKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             + +GG GA M +AR WILD GG T IPSWGKLWLSVLGVY+W GNNPLPPE+WLLPYI+P
Sbjct  190   DANGGEGAAMDRARAWILDRGGVTSIPSWGKLWLSVLGVYDWRGNNPLPPEIWLLPYILP  249

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             +HPGRMWCHCRMVYLPMSYLYGKR+V P++  +LSLR+ELY   Y+Q  WD  RN CAKE
Sbjct  250   LHPGRMWCHCRMVYLPMSYLYGKRFVAPLSPLVLSLRKELYVQPYNQTYWDHTRNLCAKE  309

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP IQD+ W  L  +VEPLL +WPF KLRK AL+  M+HI +EDET++Y+CIGPV
Sbjct  310   DLYYPHPWIQDMFWSCLSKVVEPLLARWPFYKLRKIALSTVMEHIHYEDETSHYICIGPV  369

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C +IE P+S A K HLS+IKDYLW+AEDGMKM GYNGSQLWDV F+VQA++AT
Sbjct  370   NKVLNMVCCYIENPNSKAYKHHLSKIKDYLWVAEDGMKMQGYNGSQLWDVAFSVQALLAT  429

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DE  S L+KAH F+  SQI+ DS  + L +WYRH  KGGWPFSTP++GW +SDCTAE
Sbjct  430   NLVDECHSTLKKAHEFVKNSQIRADSSRD-LANWYRHIGKGGWPFSTPEHGWIISDCTAE  488

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
             ALK AL+L+ M   +VG AI   +LYDAV++ILSLQN +GGFATYE TRSYPWLE +NPS
Sbjct  489   ALKVALLLAEMQPSIVGNAIAVDQLYDAVNVILSLQNQNGGFATYEQTRSYPWLETINPS  548

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETFG+IIIDY YVECTSAAI  LK F +L+P +R KEIEAC+ KA+ +I++IQLPDGSWY
Sbjct  549   ETFGDIIIDYPYVECTSAAIQSLKAFIRLYPHHRTKEIEACVLKAIEYIESIQLPDGSWY  608

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSWGVCYTYGTWFGI GLV GG TY+S   IR+ACDFLLSKQL SGGWGESYLS Q K Y
Sbjct  609   GSWGVCYTYGTWFGINGLVAGGRTYQSSESIRRACDFLLSKQLDSGGWGESYLSSQIKRY  668

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQVI  171
             TN+EGN+ H+VNT+WAMLALIE GQ +
Sbjct  669   TNLEGNRMHLVNTSWAMLALIECGQDV  695



>ref|XP_004513124.1| PREDICTED: cycloartenol synthase-like [Cicer arietinum]
Length=757

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/683 (67%), Positives = 554/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP+LG+ ++   V+  R  FH NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQIWEFDPHLGSPQDLFDVETARRNFHDNRFTHKHSSDLLMRLQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               +  L +V+V   E+++ E V  TLRR + FYST+Q+HDGHWP DYGGP+FL+P LVI 
Sbjct  72    PIDQLLPKVRVKDVEDVTVETVTTTLRRAMSFYSTLQSHDGHWPGDYGGPMFLMPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LSV  A+NAVL +EH+KEM RY+YNHQN DGGWGLHIEG STMF + L+YVTLR+LGE  
Sbjct  132   LSVTGALNAVLTDEHRKEMCRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G G M+KAR WIL HGGATFI SWGK+WLSVLGVYEWSGNNPLPPE+WLLPY++P+HP
Sbjct  192   NDGEGEMEKARDWILAHGGATFITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYMLPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPM YLYGKR+VGPI  TILSLR+ELY   YH IDW+ +RN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMCYLYGKRFVGPITPTILSLRKELYTTAYHDIDWNQSRNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+   WP  KLR+KAL   ++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWASLHMFVEPIFMNWPGKKLREKALKTVIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FA QAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWVAEDGMKMQGYNGSQLWDTAFAAQAIISTNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             DE+G  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   DEFGPTLRKAHTYIKNSQVLEDCQGD-LSKWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  +VVGE ++  RLYD+V++ILSLQN  GGFATYELTRSY WLEI+NP+ETF
Sbjct  491   AALLLSKITPEVVGEPLDAKRLYDSVNVILSLQNEDGGFATYELTRSYNWLEIINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  FRKL PG+R++EI+ CI KA+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYTYVECTSAAIQALTTFRKLFPGHRQEEIQCCIKKAVDFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GL+  G ++++C  IRKAC+FLLSKQLPSGGW ESYLSCQ+KVY+N+
Sbjct  611   GVCFTYGTWFGVKGLIAAGKSFDNCLSIRKACEFLLSKQLPSGGWAESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             E N+ H+VNT WAMLALI+A Q 
Sbjct  671   ENNRSHVVNTGWAMLALIDAEQA  693



>dbj|BAA86933.1| oxidosqualene cyclase [Taraxacum officinale]
Length=758

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/685 (68%), Positives = 550/685 (80%), Gaps = 6/685 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQF-E  2052
             DDP +RSVN+H+GRQYWEFDP+ GT EE+ Q++ +R EF +NR  + HSSDLLMR Q   
Sbjct  11    DDPEVRSVNHHMGRQYWEFDPHAGTPEEQSQIESMREEFTRNRLNVTHSSDLLMRFQLTS  70

Query  2051  KEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             K +G   G+++  V  EE   +E VV+TL++ L+FYS++Q  DG WP DYGGPLFLLP L
Sbjct  71    KNRG---GIEKSHV-KEEGGDDEVVVKTLKKALKFYSSLQGEDGSWPGDYGGPLFLLPGL  126

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             +IGL VM   + VL  E Q E+ RY+YNHQN+DGGWGLHIEG+STM  TALNYV+LR+LG
Sbjct  127   IIGLHVMGMKDLVLSIEQQNEIRRYLYNHQNVDGGWGLHIEGNSTMLSTALNYVSLRLLG  186

Query  1691  EERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             EE D G GAM KA+ WIL HG  T IPSWGKLWLSVLGVYEW GNNPLPPE WLLPY +P
Sbjct  187   EELDDGKGAMTKAQSWILKHGSVTHIPSWGKLWLSVLGVYEWRGNNPLPPETWLLPYFLP  246

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             +HPGR+WCH RMVYLPMSYLYGKR+VGPI+S +LSLRRELY+  Y+Q++WDLAR QCAK+
Sbjct  247   LHPGRLWCHTRMVYLPMSYLYGKRFVGPISSIVLSLRRELYSTLYYQVNWDLARKQCAKD  306

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP IQD++WD L+ IVEPLL +WP  KLRK+AL   M HI     T    CIGPV
Sbjct  307   DLYYPHPLIQDLLWDSLNKIVEPLLMQWPVAKLRKEALKTVMQHIIMRMRTRTIFCIGPV  366

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C W+E+P +   K+HLSRIKDYLW+AEDGMKM GYNGSQLWDV F+VQAI+AT
Sbjct  367   NKVLNMLCCWVEDPKTPINKLHLSRIKDYLWVAEDGMKMQGYNGSQLWDVVFSVQAIVAT  426

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEY SML KAH FI  SQ+K++S  N  +SWYRH ++GGWPFSTPDNGWPVSDCTAE
Sbjct  427   NLVDEYSSMLHKAHDFIKNSQVKKNSSGNS-QSWYRHISRGGWPFSTPDNGWPVSDCTAE  485

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
             ALK  LMLS+M  D+VGEAI P  LYDAV++ILSLQN+ G FATYELTRSY WLE++NP+
Sbjct  486   ALKTVLMLSQMPHDIVGEAIAPECLYDAVNVILSLQNSDGSFATYELTRSYSWLELVNPA  545

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             ETFG+I+IDY YVECTSA +  L+ F KL+P +RR +IE CI KA+ FI+  QL DGSWY
Sbjct  546   ETFGDIVIDYPYVECTSAVVQSLRSFTKLYPSHRRIQIETCIEKAIAFIERSQLGDGSWY  605

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSW +CYTYGTWFGI+GLV GG TYE+ H IRKAC FLLSKQL SGGWGESY SCQ K Y
Sbjct  606   GSWAICYTYGTWFGIKGLVAGGKTYETSHSIRKACAFLLSKQLHSGGWGESYTSCQQKTY  665

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+ GNK HI NT+WA+LALIEAGQ
Sbjct  666   TNLVGNKSHITNTSWALLALIEAGQ  690



>ref|XP_004159000.1| PREDICTED: cycloartenol synthase-like [Cucumis sativus]
Length=765

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/682 (67%), Positives = 554/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++NNH+GRQ W F P L + E+ QQ+Q+ R  F+ +RF+ KHSSD+LMRMQF KE  
Sbjct  21    WLSTLNNHVGRQVWHFHPELDSPEDLQQIQQARQHFYDHRFEKKHSSDILMRMQFAKENS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E++ EEAV +TLRR + FYSTIQA DGHWP DYGGP+FLLP LVI L
Sbjct  81    SFVNLPQIKVKDKEDVVEEAVTQTLRRAMNFYSTIQADDGHWPGDYGGPMFLLPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGEE +
Sbjct  141   SITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G G +  ARKWILDHGGAT I SWGK+WLSVLGVYEW+GNNPLPPELWLLPY++P HPG
Sbjct  201   DGQGGVDNARKWILDHGGATAITSWGKMWLSVLGVYEWAGNNPLPPELWLLPYLLPCHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH+IDW+ ARNQCAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEIDWNEARNQCAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH++ EPL  +WP  +LR+KAL   M+HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVQDVLWASLHHVYEPLFMRWPAKRLREKALRTVMEHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  FAVQAI++T L +
Sbjct  381   NMLCCWVEDPHSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIMSTKLIE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG+ +RKAH ++  SQ+ ED   + L+SWYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYGTTIRKAHKYMKDSQVLEDCPGD-LQSWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG++++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  500   VLLLSKLPSEIVGKSVDEERLYDAVNVILSLQNTDGGFATYELTRSYRWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  FRKL+PG+R  EI  CI KA  FI++IQ  DGSWYGSWG
Sbjct  560   DIVIDYPYVECTSAAIQALAAFRKLYPGHRSNEISNCIAKAADFIESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGI+GLV  G  YE+   +RKACDFLLSK+LP+GGWGESYLSCQDKVYTNI+
Sbjct  620   VCFTYGGWFGIKGLVAAGRRYENSSSLRKACDFLLSKELPAGGWGESYLSCQDKVYTNIK  679

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              ++ H+VNTAWAML+LI+AGQ 
Sbjct  680   DDRSHLVNTAWAMLSLIDAGQA  701



>ref|XP_004141754.1| PREDICTED: cycloartenol synthase-like [Cucumis sativus]
Length=765

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/682 (67%), Positives = 554/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++NNH+GRQ W F P L + E+ QQ+Q+ R  F+ +RF+ KHSSD+LMRMQF KE  
Sbjct  21    WLSTLNNHVGRQVWHFHPELDSPEDLQQIQQARQHFYDHRFEKKHSSDILMRMQFAKENS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E++ EEAV +TLRR + FYSTIQA DGHWP DYGGP+FLLP LVI L
Sbjct  81    SFVNLPQIKVKDKEDVVEEAVTQTLRRAMNFYSTIQADDGHWPGDYGGPMFLLPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGEE +
Sbjct  141   SITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G G +  ARKWILDHGGAT I SWGK+WLSVLGVYEW+GNNPLPPELWLLPY++P HPG
Sbjct  201   DGQGGVDNARKWILDHGGATAITSWGKMWLSVLGVYEWAGNNPLPPELWLLPYLLPCHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH+IDW+ ARNQCAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEIDWNEARNQCAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH++ EPL  +WP  +LR+KAL   M+HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVQDVLWASLHHVYEPLFMRWPAKRLREKALRTVMEHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  FAVQAI++T L +
Sbjct  381   NMLCCWVEDPHSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIMSTKLVE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG+ +RKAH ++  SQ+ ED   + L+SWYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYGTTIRKAHKYMKDSQVLEDCPGD-LQSWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG++++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  500   VLLLSKLPSEIVGKSVDEERLYDAVNVILSLQNTDGGFATYELTRSYRWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  FRKL+PG+R  EI  CI KA  FI++IQ  DGSWYGSWG
Sbjct  560   DIVIDYPYVECTSAAIQALAAFRKLYPGHRSNEISNCIAKAADFIESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGI+GLV  G  YE+   +RKACDFLLSK+LP+GGWGESYLSCQDKVYTNI+
Sbjct  620   VCFTYGGWFGIKGLVAAGRRYENSSSLRKACDFLLSKELPAGGWGESYLSCQDKVYTNIK  679

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              ++ H+VNTAWAML+LI+AGQ 
Sbjct  680   DDRSHLVNTAWAMLSLIDAGQA  701



>ref|XP_004299756.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=757

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/683 (67%), Positives = 552/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE ++V+K R  +  +RF  KHSSD LMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPTLGTPEELEEVEKAREHYRNHRFVHKHSSDRLMRIQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               +  L Q+KV   E++++E V   L+R + F+ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PVKDVLPQIKVKDTEDLTDETVTTILKRAINFHSTLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHRKEICRYLYNHQNEDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  RKWILDHG AT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPYI+PIHP
Sbjct  192   KDGKGAMENGRKWILDHGSATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYILPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNQARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWTSLHKAVEPVLMHWPGKKLREKALKTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI++TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIVSTNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EY S LRK H FI  SQ+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYSSTLRKGHKFIKDSQVLENCPGD-LDDWYRHISKGAWPFSTGDHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++  ++VGE ++ +RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLVLSKIPSEIVGEPLDANRLYDAVNVILSLQNGDGGFATYELTRSYRWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+R +EIE CI K + FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALASFKKLYPGHRPREIEQCIKKGVEFIEKIQESDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+K YTN+
Sbjct  611   GVCFTYGTWFGVKGLVAAGMNYNNSSSIRKACDFLLSKQLDSGGWAESYLSCQNKEYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             +GN+ H+VNT WAMLALI+AGQ 
Sbjct  671   KGNRSHVVNTGWAMLALIDAGQA  693



>gb|ABY60426.1| cycloartenol synthase [Panax notoginseng]
Length=758

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/684 (67%), Positives = 555/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLRS+N+H+GRQ WEFDP LG+ EE   ++K R  F K+RF+ KHSSDLLMR+QF  E
Sbjct  11    NPWLRSLNDHVGRQTWEFDPKLGSPEELADIEKARETFRKHRFEKKHSSDLLMRIQFSNE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   E+IS+  V  TL+R + F+ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NRGSILLPQVKVKDTEDISDAKVTVTLKRAINFHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL +EH+ EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLSKEHKHEMCRYLYNHQNRDGGWGLHIEGPSTMFGTALNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K R+WILDHGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WL PYI+P H
Sbjct  191   TNDGQGAMEKGRQWILDHGGATAISSWGKMWLSVLGVFEWSGNNPLPPEIWLFPYILPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  +  ++EP+   WP  KLR+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLIQDILWASIDKVLEPIFMCWPGKKLREKSLRTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+HL R+ D+LWLAEDGMKM GYNGSQLWD  FAVQAII+T L
Sbjct  371   VLNMLCCWAEDPNSEAFKLHLPRLNDFLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTKL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+G  LRKAH+FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE  
Sbjct  431   TDEFGPTLRKAHMFIKNSQVLDDCPGD-LNFWYRHISKGAWPFSTVDHGWPISDCTAEGF  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS+++ ++VGE ++  RLYDAV++ILSLQN+ GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAVLLLSKLSSELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYSWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+P +RR+EI+ CI KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALSAFKKLYPDHRREEIQLCIEKAALFIEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  G T+ SC  I KACDFLLSKQL SGGWGESYLSCQ+K YTN
Sbjct  610   WGVCFTYGTWFGVKGLVAAGRTFSSCSSIHKACDFLLSKQLASGGWGESYLSCQNKEYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WA+LALI+AGQ 
Sbjct  670   LEGNRSHVVNTGWALLALIDAGQA  693



>gb|AAS83469.1| cycloartenol synthase [Bupleurum kaoi]
Length=757

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/684 (66%), Positives = 553/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+VN+H+GRQ WEFDP LG+ EE  +V+K R  F  +RF+ KHSSDLLMR+QF  E
Sbjct  11    NPWLRTVNDHVGRQVWEFDPKLGSPEELAEVEKARDNFRIHRFEKKHSSDLLMRLQFANE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV S E+I+E+ V  TL+R + F+++IQA DGHWP DYGGP+FL+P LVI
Sbjct  71    NPSREMLTQVKVKSTEDITEDTVTTTLKRAVSFHASIQACDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL +EH+ E+ RYIYNHQN DGGWGLHIEG STMF T LNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLSKEHKHEICRYIYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K R+WILD GGAT I SWGK+WLSVLGV+EWSGNNPLPPE WL+PYI+P H
Sbjct  191   ANDGQGAMEKGRQWILDRGGATKITSWGKMWLSVLGVFEWSGNNPLPPETWLVPYILPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI   I+SLR+EL+   YH+IDW+ ARNQCAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPIIISLRKELFTIPYHEIDWNQARNQCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+WD L  + EP+   WP  K R+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLLQDILWDSLDKVWEPIFMHWPAKKFREKSLCTVMEHIHYEDENTQYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL R+ D+LW+AEDGMKM GYNGSQLW+  FAVQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLPRLDDFLWVAEDGMKMQGYNGSQLWNTAFAVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              ++YG  L+KAHLFI  SQ+  D+    L++WYRH +KG WPFST D+GWP+SDCTAE  
Sbjct  431   IEQYGPTLKKAHLFIKNSQVL-DNCPGDLKTWYRHISKGAWPFSTADHGWPISDCTAEGF  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS +  +VVGE ++  RL+DAV++ILSLQN  G +ATYELTRSY WLE +NP+ET
Sbjct  490   KAALLLSELPSEVVGEPLDTKRLHDAVNVILSLQNMDGSYATYELTRSYGWLESINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F KL+PG+RR+EI+  I KA +FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALSVFSKLYPGHRREEIQHAIEKAASFIEKIQESDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFGI+GL+  G T+ +C  IRKAC+FLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGIKGLISSGRTFSTCSSIRKACEFLLSKQLVSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNTAW+M+ALI+AGQ 
Sbjct  670   LEGNRSHVVNTAWSMMALIDAGQA  693



>ref|XP_006362808.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362809.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Solanum tuberosum]
Length=757

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/684 (65%), Positives = 552/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+ NNH+GR+ WEF+P+LG+ E+R +++K R  F K+R + KHS+DLLMR Q  KE
Sbjct  11    SPWLRTTNNHVGREVWEFEPDLGSPEDRAEIEKFREHFTKHRLEQKHSADLLMRYQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVK+   E I+E++V  TLRR L FYST+Q HDGHW  DYGGP+FL+P ++I
Sbjct  71    NQGISILPQVKIHDNEVITEDSVATTLRRALSFYSTLQNHDGHWAGDYGGPMFLMPGMII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAV   EH++EM+RY+YNHQN DGGWGLHIE HSTMF +AL+YVTLR+LGE 
Sbjct  131   ALSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHSTMFGSALSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K RKWILDHG AT I SWGK+WLSVLGV++WSGNNPLPPE+WLLPYI+PIH
Sbjct  191   ANDGDGAMEKGRKWILDHGSATAITSWGKMWLSVLGVFDWSGNNPLPPEIWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM YLYGKR+VGPI  T+LSLR+EL+   YH++DWD ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMCYLYGKRFVGPITPTVLSLRKELFTVPYHEVDWDKARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+K+L   M+HI +EDE T YVCIGPVNK
Sbjct  311   YYPHPLVQDIMWATLHKVVEPILMHWPGKRLREKSLRTVMEHIHYEDENTRYVCIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             ++NM+C W+E+P+S A K+HL RI DY+W+AEDGMKM GYNGSQ WD  FAVQAIIAT  
Sbjct  371   IINMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKMKGYNGSQSWDTSFAVQAIIATGF  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYGS LRKAH F++ +Q+  D+    L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   GEEYGSTLRKAHSFLSNTQVL-DNCPGDLDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VG  +E  RLYDAV+++LSLQN+ GGFATYEL+RSYPWLE++NP+ET
Sbjct  490   KAVLLLSKLPSEIVGNPLEAKRLYDAVNVLLSLQNSGGGFATYELSRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVERCIAKAAAFIESIQETDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y +   IRKAC FLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVLGLLAAGRNYNNSSSIRKACTFLLSKQVSSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNTAWAML LI AGQ 
Sbjct  670   LEGNRSHVVNTAWAMLTLIAAGQA  693



>gb|AEO27878.1| cycloartenol synthases [Fritillaria thunbergii]
Length=756

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/684 (67%), Positives = 559/684 (82%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR++N+H+GRQ WEFDPN GT +E   V+  R EF  +RF++KHSSDLLMRMQF KE
Sbjct  11    SPWLRTINSHVGRQTWEFDPNAGTADEIAAVENARKEFRNHRFEMKHSSDLLMRMQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+  Q +K+   EE++EEAV  TLR  +  YST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  71    NPLELNHQCIKLEENEEVTEEAVTATLRGAISRYSTLQAHDGHWPGDYGGPMFLMPGLII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L+V  A+NAVL  EHQ+EM RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGEE
Sbjct  131   TLTVTGALNAVLSPEHQREMCRYLYNHQNEDGGWGLHIEGQSTMFGSVLTYVTLRLLGEE  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DGG+GAM+K R WI+DHGGATFI SWGK WL+VLGV++WSGNNPLPPE+WLLPYIVP+H
Sbjct  191   ADGGDGAMQKGRLWIIDHGGATFITSWGKFWLTVLGVFDWSGNNPLPPEMWLLPYIVPLH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+VG I  T+L+LR+EL++  Y QIDW+ AR++CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGKRFVGSITPTVLALRKELFDQAYDQIDWNQARSRCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP +KLR+KA+  AM H+ +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILMHWPGSKLREKAVDTAMQHVHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+T L
Sbjct  371   VLNMLCCWVEDPNSEASKLHLPRIFDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIISTGL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+KAH +I  SQ+  D+    L +WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   YEEFGPALKKAHEYIKKSQVL-DNCYGDLSAWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L L++++ +VVG+ IE  RLY+AV++ILSL N+ GGFATYELTRSY WLE++NP+ET
Sbjct  490   KASLCLAQISPEVVGKPIEAKRLYEAVNVILSLMNSDGGFATYELTRSYAWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+R++EIE CI KA +FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALASFKKLYPGHRKEEIETCIRKAASFIESIQKADGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYG WFG++GL+  G TY S   IRKAC+FLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGIWFGVKGLLTAGRTYNSSPAIRKACNFLLSKQLSSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H VNT WAML LI+AGQ 
Sbjct  670   LEGNRSHAVNTGWAMLTLIDAGQA  693



>sp|Q9SLP9.1|CAS1_LUFAE RecName: Full=Cycloartenol synthase; Short=LcCAS1 [Luffa aegyptiaca]
 dbj|BAA85266.1| cycloartenol synthase [Luffa aegyptiaca]
Length=765

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/681 (67%), Positives = 554/681 (81%), Gaps = 1/681 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL S+NNH+GRQ W F P LGT E+ QQ+Q  R  F  +RF+ KHS+DLLMRMQF K   
Sbjct  21    WLSSLNNHVGRQVWHFHPELGTPEDLQQIQHARQRFSDHRFEKKHSADLLMRMQFAKNNS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E+++EEAV RTLRR + FYSTIQ  DGHWP DYGGP+FL+P LVI L
Sbjct  81    SFVNLPQIKVKDKEDVTEEAVSRTLRRAINFYSTIQGDDGHWPGDYGGPMFLIPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + LNYV+LR+LGEE +
Sbjct  141   SITGALNAVLSTEHQREICRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVSLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GA+ KARKWILDHGGA+ I SWGK+WLSVLGVYEW+GNNPLPPELWLLPY++P HPG
Sbjct  201   DGQGAVDKARKWILDHGGASAITSWGKMWLSVLGVYEWAGNNPLPPELWLLPYLLPFHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH++DW+ ARN+CAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEVDWNKARNECAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDIVW  LH++ EPL  +WP  +LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVQDIVWASLHHVYEPLFMRWPAKRLREKALQCVMQHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI++T L +
Sbjct  381   NMLCCWVEDPHSEAFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIMSTKLAE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG+ LRKAH +I  SQ+ ED   + L+SWYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYGTTLRKAHKYIKDSQVLEDCPGD-LQSWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG++I+  ++YDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ETFG
Sbjct  500   VLLLSKLPSEIVGKSIDEEQIYDAVNVILSLQNTDGGFATYELTRSYPWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL+PG+RR EI+ C+ KA  FI++IQ  DGSWYGSWG
Sbjct  560   DIVIDYTYVECTSAAIQALVAFKKLYPGHRRDEIDNCVAKAADFIESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGIRGLV  G  Y++C  +RKACDFLLSK+L SGGWGESYLS Q+KVYTNI+
Sbjct  620   VCFTYGGWFGIRGLVAAGRRYDNCSSLRKACDFLLSKELASGGWGESYLSGQNKVYTNIK  679

Query  239   GNKWHIVNTAWAMLALIEAGQ  177
              ++ HIVNT WAML+LI+AGQ
Sbjct  680   DDRPHIVNTGWAMLSLIDAGQ  700



>gb|AFS49705.1| cycloartenol synthase [Paris polyphylla var. yunnanensis]
Length=760

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/682 (67%), Positives = 552/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLR+ N H+GRQ WEFDPNLGT EE + V+K R EF + RF+ KHS+DLLMRM+F KE  
Sbjct  13    WLRTNNKHVGRQTWEFDPNLGTPEEIEAVEKARREFTEYRFEKKHSADLLMRMRFAKENP  72

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
              E+ L  +K+   +++SEEAV+ TLRR +  +ST+QAHDGHWP DYGGP+FL+P L+I L
Sbjct  73    VEINLPHIKLEEHDDVSEEAVLTTLRRAITRHSTLQAHDGHWPGDYGGPMFLMPGLIIAL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V+ AIN VL  EH++E+ RY+YNHQN DGGWGLHIEG STMF ++L YVTLR+LGE  +
Sbjct  133   YVIGAINTVLSLEHRREICRYLYNHQNKDGGWGLHIEGQSTMFGSSLTYVTLRLLGEGAE  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G+GAM+K RKWILDHGGAT I SWGK WLSVLGV++WSGNNPLPPE+WLLPY +P+HPG
Sbjct  193   CGDGAMQKGRKWILDHGGATAITSWGKFWLSVLGVFDWSGNNPLPPEMWLLPYFLPVHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TIL LR+E++   Y++IDW+LARN+CAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGKRFVGPITPTILELRKEIFIQPYNKIDWNLARNECAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQDI+W  LH + EP+L  WP +KLR+KALT A+ HI +EDE T YVCIGPVNKVL
Sbjct  313   PHPIIQDILWASLHKVAEPILLHWPGSKLREKALTTAIQHIHYEDENTRYVCIGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  F VQAII TNL +
Sbjct  373   NMLCCWAEDPNSEAFKLHLPRIFDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIIPTNLSE  432

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E+G  LR AH +I  +Q+  D+    L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  433   EFGPTLRNAHEYIKNTQVL-DNCPGDLSFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  491

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LSR++   VG+ I+   LY+AV++ILSL N  GGFATYE TRSY WLE++NP+ETFG
Sbjct  492   ALLLSRISPKSVGDPIDAKWLYEAVNVILSLMNKDGGFATYEFTRSYAWLELINPAETFG  551

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSA+I  L  F+KL+PG+RR+EIE+CI +A  FI++IQ PDGSWYGSW 
Sbjct  552   DIVIDYPYVECTSASIQALTSFKKLYPGHRREEIESCIKRAAHFIESIQRPDGSWYGSWA  611

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFG+ GL+  G TY++    RKACDFLLSKQLPSGGWGESYLSCQDKVYTN+E
Sbjct  612   VCFTYGIWFGVLGLIAAGRTYKNSSTTRKACDFLLSKQLPSGGWGESYLSCQDKVYTNLE  671

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             GN++H VNT WAML LI+AGQ 
Sbjct  672   GNRYHAVNTGWAMLTLIDAGQA  693



>ref|XP_008462186.1| PREDICTED: cycloartenol synthase [Cucumis melo]
Length=765

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/682 (67%), Positives = 553/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++NNH+GRQ W F P LG+ E+ QQ+Q  R  F+ +RF+ KHSSD+LMRMQF KE  
Sbjct  21    WLSTLNNHVGRQVWHFHPELGSPEDLQQIQNARQHFYDHRFEKKHSSDILMRMQFAKENS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E++ EEAV +TLRR + FYSTIQA DGHWP DYGGP+FLLP LVI L
Sbjct  81    SFVNLPQIKVKEKEDVVEEAVTQTLRRAMNFYSTIQADDGHWPGDYGGPMFLLPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + L+YVTLR+LGEE +
Sbjct  141   SITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPSTMFGSVLSYVTLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G G ++ ARKWILDHGGAT I SWGK+WLSVLGVYEW+GNNPLPPELWLLPY++P HPG
Sbjct  201   DGQGGVENARKWILDHGGATAITSWGKMWLSVLGVYEWAGNNPLPPELWLLPYLLPFHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH+IDW+ ARNQCAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEIDWNEARNQCAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH++ EPL  +WP  +LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVQDVLWASLHHVYEPLFMRWPAKRLREKALRTVMQHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  FAVQAI++T L +
Sbjct  381   NMLCCWVEDPHSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIMSTKLVE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG+ LRKAH +I  SQ+ ED   + L+SWYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYGTTLRKAHKYIKDSQVLEDCPGD-LQSWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              ++LS++  ++VG+ ++  R+YDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  500   VVLLSKLPSEIVGKPVDEERMYDAVNVILSLQNTDGGFATYELTRSYRWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  FRKL+PG+R  EI  CI KA  FI++IQ  DGSWYGSWG
Sbjct  560   DIVIDYPYVECTSAAIQALAAFRKLYPGHRSNEIGNCIAKAADFIESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGI+GLV  G  YE+   +RKACD+LLSK+LP+GGWGESYLSCQDKVYTNI+
Sbjct  620   VCFTYGGWFGIKGLVAAGRRYENSSSLRKACDYLLSKELPAGGWGESYLSCQDKVYTNIK  679

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              ++ H+VNTAWAML+LI+AGQ 
Sbjct  680   DDRPHLVNTAWAMLSLIDAGQA  701



>ref|XP_010906067.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
 ref|XP_010906068.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
Length=759

 Score =   961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/682 (67%), Positives = 553/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLR+VNNH+GRQ WEF+PNLGT EE   V+K R  F ++RF++KHS+DLLMR+QF KE  
Sbjct  13    WLRTVNNHVGRQLWEFEPNLGTDEEIAAVEKARELFREHRFEMKHSTDLLMRLQFAKESP  72

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
              E+    +K+   E+++EE V+ +LRR +  YST+QAHDGHWP DYGGP+FL+P L+I L
Sbjct  73    LEINFPCIKLEDHEDVTEEVVLTSLRRAISCYSTLQAHDGHWPGDYGGPMFLMPGLIIAL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             SV  A+N VL  EH++E+ RY+YNHQN DGGWGLHIEGHSTMF + L YVTLR+LGE  D
Sbjct  133   SVTGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHSTMFGSVLTYVTLRLLGEGSD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G+GAM+KAR WILDHGGAT I SWGK WLSVLGV+EWSGNNPLPPE+WLLPY + +HPG
Sbjct  193   DGDGAMQKARTWILDHGGATTITSWGKFWLSVLGVFEWSGNNPLPPEMWLLPYFLSVHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSY+YGKR+VGPI  T+LSLR+ELY   Y QIDW+ ARN+CAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYIYGKRFVGPITPTVLSLRKELYGCPYQQIDWNRARNECAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQDI+W  L+ +VEP+L   P +KLR+KAL  AM HI +EDE T Y+CIGPVNKVL
Sbjct  313   PHPLIQDIIWALLYKVVEPVLMHSPGSKLREKALHAAMQHIHYEDENTRYICIGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+  WIE+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  F VQAII+T+L +
Sbjct  373   NMLSCWIEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIISTDLFE  432

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  L++AH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  433   EYGPTLKRAHDYIKNSQVLEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  491

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             +L+LS+++ ++VGE +   R+YDAV++ILSL N  GGFATYELTRSY WLEI+NP+ETFG
Sbjct  492   SLLLSKISPEIVGEPLCAGRIYDAVNVILSLMNKDGGFATYELTRSYAWLEIINPAETFG  551

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWYGSW 
Sbjct  552   DIVIDYPYVECTSAAIQALTSFKKLYPGHRRDDIENCIRKAANFIEMIQQPDGSWYGSWA  611

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYGTWFG++GL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+N+E
Sbjct  612   VCFTYGTWFGVKGLIASGRTYKNSPCIRKACQFLLSKQLASGGWGESYLSCQNKVYSNLE  671

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              N+ H VNTAWAMLALI+AGQ 
Sbjct  672   DNRCHSVNTAWAMLALIDAGQA  693



>gb|AGC82085.1| cycloartenol synthase protein [Azadirachta indica]
Length=758

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/684 (67%), Positives = 556/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLR+ NNH+GRQ WEFDP LG+ +E  +++K R  F+ +R++ KHS+DLLMR+QF KE
Sbjct  11    NAWLRTTNNHVGRQVWEFDPKLGSPQELAEIEKARENFYNHRYEQKHSADLLMRIQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV   E+++EE V  TLRR + ++ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPGFTVLPQVKVKDAEDVTEEMVTNTLRRAVSYHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              +S+  A+NAVL EEH+KEM RY+YNHQN DGGWGLHIEG STMF + L+YVTLR+LGE 
Sbjct  131   TMSITGALNAVLSEEHKKEMCRYLYNHQNRDGGWGLHIEGPSTMFGSVLSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G  AM++ RKWILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++P H
Sbjct  191   ANDGQEAMERGRKWILDHGGATTITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH+I+WD ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEINWDEARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  L  +VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDVLWASLKKVVEPILMHWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  F VQAII+TNL
Sbjct  371   VLNMLCCWVEDPNSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG+ L+KAH+ I  +Q+ ED   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   AEEYGTTLKKAHMCIKNTQVLEDCPGN-LEFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  +VVGE +E  RLYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  490   KAALLLSKLPSEVVGEPVETKRLYDAVNVILSLQNADGGFATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F++L+PG+RR EI+ CI KA  FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALTSFKELYPGHRRDEIDQCIKKAAMFIEKIQQPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G  Y +C  IRKACDFLLSKQ PSGGWGESYLSCQ+KVY+N
Sbjct  610   WAVCFTYGTWFGVKALVAAGMNYSNCSSIRKACDFLLSKQRPSGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG++ H+VNT WAMLALI+A Q 
Sbjct  670   LEGDRSHVVNTGWAMLALIDAEQA  693



>ref|XP_006340479.1| PREDICTED: cycloartenol Synthase-like [Solanum tuberosum]
Length=757

 Score =   961 bits (2483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/682 (66%), Positives = 555/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++N HIGRQ WEFDPNLG+ ++ ++++K RAEF+KNRF+ KHSSDLLMR QF KE 
Sbjct  12    PWLRTLNGHIGRQVWEFDPNLGSPKDLEEIEKFRAEFYKNRFETKHSSDLLMRYQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L +V+V    +I+E+ V  TLRR + FYST+QAHDGHW AD GGP+FLLP LVI 
Sbjct  72    PVGTILPRVQVKDIGDITEDNVATTLRRAISFYSTLQAHDGHWAADCGGPMFLLPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LSV  A+NAVL EEH++E+ RY+YNHQN DGGWGLHIE HSTMF + L+YVTLR+LGE+ 
Sbjct  132   LSVTGALNAVLSEEHKREICRYLYNHQNCDGGWGLHIESHSTMFGSVLSYVTLRLLGEKA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             +GG GAM+K RKWILDHG AT I SWGK+WLSVLG+++WSGNNPLPPE+WLLPYI+P HP
Sbjct  192   NGGEGAMEKGRKWILDHGTATAITSWGKMWLSVLGLFDWSGNNPLPPEMWLLPYILPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+I+W+ ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHKINWNKARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  L  ++EPL   WP  KLR+KAL+  MDHI +EDE T Y+C+GPVNKV
Sbjct  312   YPHPLLQDILWTSLDKLIEPLFMHWPGKKLREKALSTVMDHIHYEDENTRYICLGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+  S A K+HL R+ DYLW+AEDGMK+ GYNGSQ WD  FA+QAII+TNL 
Sbjct  372   LNMLCCWVEDSSSEAFKLHLPRLYDYLWIAEDGMKIQGYNGSQSWDTSFAIQAIISTNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH F+  SQ+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHKFMKNSQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LS++  ++VGE ++ +RLYDAV+++LSLQN  GG  TYEL+RSYPWLEI+NP+ETF
Sbjct  491   ACLLLSKLPVEIVGEPLKANRLYDAVNVMLSLQNPDGGIGTYELSRSYPWLEIINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA I  L  F+KL+PGYR++++E CI K   FI+ IQ  DGSWYG W
Sbjct  551   GDIVIDYPYVECTSAIIQALAAFKKLYPGYRKEDVERCIEKGAAFIEKIQEADGSWYGCW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GL+  G  + + + IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGTWFGVKGLLDAGRNFNNSYNIRKACDFLLSKQVVSGGWGESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQ  177
             +GNK H V TAWAMLALIEAGQ
Sbjct  671   KGNKSHSVCTAWAMLALIEAGQ  692



>ref|XP_010927167.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
Length=759

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/684 (66%), Positives = 553/684 (81%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+ NNH+GRQ WEF+PN+GT E+   V+K R  F ++RF++KHS+DLLM++QF KE
Sbjct  11    SPWLRTTNNHVGRQLWEFEPNMGTVEQIAAVEKARELFREHRFEMKHSADLLMQLQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+    +K+   ++++EE V+ +LRR +  YST+QAHDGHWP DYGGP+FL+P L++
Sbjct  71    NPLEINFPHIKLEDHQDVTEEVVLTSLRRAISCYSTLQAHDGHWPGDYGGPMFLMPGLIV  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+N VL  EH++E+ RY+YNHQN DGGWGLHIEGHSTMF +AL YVTLR+LGE 
Sbjct  131   ALSITGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHSTMFGSALTYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+KAR WILDHGGAT I SWGK WLSVLGV+EWSGNNPLPPE+WLLPY +P+H
Sbjct  191   PDDGDGAMQKARTWILDHGGATTITSWGKFWLSVLGVFEWSGNNPLPPEMWLLPYFLPVH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+VGPI  T+LSLR+ELY   Y QIDW+ ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGKRFVGPITPTVLSLRKELYGCPYRQIDWNRARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH +VEP+L   P +KLR+KAL  AM HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLIQDIIWASLHKVVEPILMHLPGSKLREKALHTAMQHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  F VQAII+T+L
Sbjct  371   VLNMLSCWIEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIISTDL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LR+AH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCT+E L
Sbjct  431   SEEYGPTLRRAHDYIKNSQVLEDCPGD-LSFWYRHISKGAWPFSTADHGWPISDCTSEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +   R+YDAV++ILSL N  GGFATYEL RSY WLEI+NP+ET
Sbjct  490   KASLLLSKISPEIVGEPLCAGRIYDAVNVILSLMNKDGGFATYELARSYAWLEIINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY  VECTSAAI  L  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYPCVECTSAAIQALTSFKKLYPGHRRDDIENCIRKAAKFIEMIQQPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+N
Sbjct  610   WAVCFTYGTWFGVKGLIAAGRTYQNSSSIRKACQFLLSKQLASGGWGESYLSCQNKVYSN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG++ H  NTAWA+LALI+AGQ 
Sbjct  670   LEGDRCHAANTAWAILALIDAGQA  693



>ref|XP_009102615.1| PREDICTED: cycloartenol synthase-like [Brassica rapa]
Length=758

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/685 (66%), Positives = 553/685 (81%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D PWLR+ N H+GRQ WEFDP LGT EE   +++ R  F +NRF  KHSSDLLMR+QF  
Sbjct  10    DSPWLRTTNKHVGRQTWEFDPLLGTPEELAAIEEARNSFTQNRFSNKHSSDLLMRLQFSG  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVK+   ++++++ V  +L+RGL F+ST+QAHDGHWP DY GP+FLLP L+
Sbjct  70    ENLINSVLPQVKLEESDDVTDKIVENSLKRGLDFFSTLQAHDGHWPGDYAGPMFLLPGLI  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+N VL E+H+ EM RY+YNHQN DGGWGLHIEGHSTMF + LNYVTLR+LG+
Sbjct  130   ITLSITGAMNTVLSEQHKLEMCRYLYNHQNEDGGWGLHIEGHSTMFMSVLNYVTLRLLGQ  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               D G+GAM+K R WIL+HGGAT I SWGKLWLSVLG +EWSGNNPLPPE+WLLPY +PI
Sbjct  190   GPDDGDGAMEKGRDWILNHGGATHITSWGKLWLSVLGAFEWSGNNPLPPEIWLLPYFLPI  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI ST+L+LR+EL++  Y  IDW+ AR  CAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLALRKELFSVPYEDIDWNQARTLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH +VEP+L++WP   LR+KAL   ++HI +EDE T Y+CIGPVN
Sbjct  310   LYYPHPLVQDILWASLHKVVEPVLSRWPGTILREKALRTTLEHIHYEDENTRYICIGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD GFAVQAI+ATN
Sbjct  370   KVLNMLCCWVEDPNSEAFKLHLPRIHDYLWLAEDGMKMQGYNGSQLWDAGFAVQAILATN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
               +EYG +L+KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  430   FVEEYGPVLKKAHSFVKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  ++VGE ++ +R+YDAV++++SLQN  GG ATYELTRSYPWLE++NPSE
Sbjct  489   LKATLLLSKVPKEIVGEPLDTNRIYDAVNVLISLQNADGGVATYELTRSYPWLELINPSE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI KA+ FI++ Q  DGSWYG
Sbjct  549   TFGDIVIDYPYVECTSAAIQALVAFRKLYPGHRKKDVDECIEKAVKFIESSQATDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SW VC+TYG WFG++GL   G T ++   + KAC+FLLSKQLPSGGWGESYLSCQDKVYT
Sbjct  609   SWAVCFTYGAWFGVKGLEAVGKTLKNSPAVAKACEFLLSKQLPSGGWGESYLSCQDKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
              I+GNK H+VNT+WA+LALI AGQ 
Sbjct  669   GIKGNKSHVVNTSWALLALIGAGQA  693



>ref|XP_008228021.1| PREDICTED: cycloartenol synthase [Prunus mume]
Length=762

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/682 (68%), Positives = 551/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF+P LG+ EE Q+++  R  F  NRF+ +HSSDLLMR+QFEKE  
Sbjct  18    WLKSVNNHLGRQVWEFNPELGSPEELQRIEDARKAFWDNRFERRHSSDLLMRIQFEKENP  77

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L Q+KV  EEE++EE V  TLRR + FYSTIQAHDGHWP DYGGP+FLLP LVI L
Sbjct  78    CVTNLPQLKVKDEEEVTEELVKTTLRRAISFYSTIQAHDGHWPGDYGGPMFLLPGLVITL  137

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  D
Sbjct  138   SITGALNAVLSKEHQHEMCRYLYNHQNKDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAD  197

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GAM+ ARKWILDHGG T I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P HPG
Sbjct  198   DGQGAMELARKWILDHGGVTKISSWGKMWLSVLGTYEWSGNNPLPPEVWLCPYSLPFHPG  257

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY+  YH++DW+ ARN CAKEDLYY
Sbjct  258   RMWCHCRMVYLPMSYLYGKRFVGPITPTIWSLRKELYSVPYHEVDWNQARNLCAKEDLYY  317

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH + EP+  +WP  +LR+ AL   M HI +EDE T Y+CIGPVNKVL
Sbjct  318   PHPMVQDILWASLHYVYEPVFTRWPAKELRENALQTVMQHIHYEDENTRYICIGPVNKVL  377

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL +
Sbjct  378   NMLCCWAEDPNSDAFKLHLPRIPDYLWVAEDGMKMQGYNGSQLWDTSFAVQAIISTNLAE  437

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E+G  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  438   EFGPTLRKAHEYIKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  496

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++   +VGE+++  RLYDAV++ LSLQN+ GGFATYELTRSY WLE++NP+ETFG
Sbjct  497   ALLLSKLPTGIVGESLDMKRLYDAVNVTLSLQNDDGGFATYELTRSYQWLELINPAETFG  556

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F KL+PG+RR+EIE+CI +A  FI+ IQ  DGSWYGSWG
Sbjct  557   DIVIDYPYVECTSAAIQALTMFGKLYPGHRREEIESCIARAAKFIEKIQATDGSWYGSWG  616

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFG++GL   G TY+ C  IRKACDFLLSK+LPSGGWGESYLSCQ+KVYTN++
Sbjct  617   VCFTYAGWFGLKGLAAAGRTYKDCSSIRKACDFLLSKELPSGGWGESYLSCQNKVYTNLK  676

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              N+ HIV+TAWAMLALI AGQ 
Sbjct  677   DNRPHIVHTAWAMLALIGAGQA  698



>gb|AEM42981.1| cycloartenol synthase [Siraitia grosvenorii]
Length=765

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/681 (67%), Positives = 549/681 (81%), Gaps = 1/681 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++NNH+GRQ W F P LGT E+ QQ+Q     F  +RF+ KHS+DLLMRMQF KE  
Sbjct  21    WLSTLNNHVGRQVWHFHPELGTPEDLQQIQHAHQRFSDHRFEKKHSADLLMRMQFAKENS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E++ EEAV  TLRR + FYSTIQA DGHWP DYGGP+FL+P LVI L
Sbjct  81    SFVNLPQIKVKDKEDVKEEAVTGTLRRAINFYSTIQADDGHWPGDYGGPMFLIPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGEE +
Sbjct  141   SITGALNAVLSTEHQHEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVTLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GA+ KARKWILDHGGAT I SWGK+WLSVLGVYEW+GNNPLPPELWL PY++P HPG
Sbjct  201   DGQGAVDKARKWILDHGGATAITSWGKMWLSVLGVYEWTGNNPLPPELWLWPYLLPCHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH+IDW+ ARNQCAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEIDWNKARNQCAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP ++D++W  LH + EPL  +WP  +LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVRDVLWTSLHYVYEPLFMRWPAKRLREKALQSVMQHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI++T L +
Sbjct  381   NMLCCWVEDPHSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIMSTKLAE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG+ LRKAH +I  SQ+ ED   + L+ WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYGTTLRKAHKYIKDSQVVEDCPGD-LQIWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG++I+  R+YDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  500   VLLLSKLPSELVGKSIDEERIYDAVNVILSLQNTDGGFATYELTRSYRWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL+PG+RR EI+ CI KA  F+++IQ  DGSWYGSWG
Sbjct  560   DIVIDYPYVECTSAAIQALAMFKKLYPGHRRDEIDNCIAKAADFLESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGIRGLV  G  Y++C  +RKACDFLLSK+L +GGWGESYLSCQ+KVYTN++
Sbjct  620   VCFTYGGWFGIRGLVAAGRRYDNCSSLRKACDFLLSKELAAGGWGESYLSCQNKVYTNLK  679

Query  239   GNKWHIVNTAWAMLALIEAGQ  177
              ++ HIVNT WAML+LI+AGQ
Sbjct  680   DDRPHIVNTGWAMLSLIDAGQ  700



>ref|XP_011019951.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Populus 
euphratica]
Length=769

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/694 (66%), Positives = 558/694 (80%), Gaps = 11/694 (2%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ N+HIGRQ WEFDP L  +  E  +++  R  F KNRFQ KHS+DL+MR+QFEK
Sbjct  11    NPWLRTKNDHIGRQIWEFDPKLTISPAEISEIESARQNFTKNRFQFKHSADLIMRIQFEK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVK+   E+++EEAV  TL+RGL +YS+IQAHDGHWP DYGGPLFL+P LV
Sbjct  71    ENPVSEVLPQVKLKESEKVTEEAVTTTLKRGLDYYSSIQAHDGHWPGDYGGPLFLMPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A++AVL +EH+KE++RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE
Sbjct  131   ITLSITGALHAVLSDEHKKEIIRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GAM+KAR WIL+HGGAT I SWGK+WLSVLGV+EWSGNNP+PPE+WLLPY++P+
Sbjct  191   GPNDGEGAMEKARDWILNHGGATMITSWGKMWLSVLGVFEWSGNNPMPPEMWLLPYLLPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  TILSLR+EL+   YH+I+W+ AR  CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTILSLRKELFTVPYHEIEWNQARTLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNI---------VEPLLNKWPFNKLRKKALTLAMDHIQHEDETT  1176
             LYYPHP +QD++W  L             EP+L  WP  KLR+KAL  A++HI +EDE T
Sbjct  311   LYYPHPLVQDVLWAFLDKAAEXXXXXXXAEPVLMHWPGKKLREKALCTAIEHIHYEDENT  370

Query  1175  NYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGF  996
              Y+CIGPVNKVLNM+C W+E+P+S A K+H+ RI+DYLWLAEDGMKM GYNGSQLWD  F
Sbjct  371   RYLCIGPVNKVLNMLCCWVEDPNSEAFKLHIPRIQDYLWLAEDGMKMQGYNGSQLWDTAF  430

Query  995   AVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGW  816
             AVQAII+TNL +EY   L+KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GW
Sbjct  431   AVQAIISTNLVEEYSPTLKKAHAFVKNSQVLEDCPGD-LHYWYRHISKGAWPFSTADHGW  489

Query  815   PVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYP  636
             P+SDCTAE LKAAL+LS++  ++VGE +  ++ YDAV++ILSLQN  GGFATYELTRSY 
Sbjct  490   PISDCTAEGLKAALLLSKIPSEIVGEPLVANQFYDAVNVILSLQNGDGGFATYELTRSYS  549

Query  635   WLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTI  456
             WLE++NP+ETFG+I+IDY YVECTSAAI  L  F+KL+PG+R +EIE+CI KA  FI++I
Sbjct  550   WLELINPAETFGDIVIDYPYVECTSAAIQALTSFKKLYPGHRSEEIESCIRKATMFIESI  609

Query  455   QLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESY  276
             Q  DGSWYGSWGVC+TYG WFGI+GLV  G  + +   IRKACDFLLSKQ  SGGWGESY
Sbjct  610   QEKDGSWYGSWGVCFTYGIWFGIKGLVAAGKNFNNSSSIRKACDFLLSKQCSSGGWGESY  669

Query  275   LSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             LSCQ+K+Y+NIEGN+ H+VNTAWAML+LI+AGQ 
Sbjct  670   LSCQNKIYSNIEGNRAHVVNTAWAMLSLIDAGQA  703



>dbj|BAB83253.1| cycloartenol synthase [Costus speciosus]
Length=759

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/682 (66%), Positives = 552/682 (81%), Gaps = 1/682 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GRQ WEFDP+LGT EE  +V+++R  F + RF+ KHS+DLLMR+QF KE 
Sbjct  12    PWLRTKNNHVGRQVWEFDPSLGTPEEIAEVERVREAFRETRFEKKHSADLLMRLQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               EM    +K+   E+++EE VV +LR+ +   ST+QAHDGHWP DYGGP+FL+P L+I 
Sbjct  72    PLEMNYPIIKIEEHEDVTEELVVTSLRKAISRVSTLQAHDGHWPGDYGGPMFLMPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV LR+LGE  
Sbjct  132   LYVTGALNTVLTSEHQKEIRRYLYNHQNEDGGWGLHIEGESTMFGSALTYVILRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             D G+GAM+K RKWILDHG AT I SWGK+WLSVLGV++WSGNNPLPPE+WLLPY +P+HP
Sbjct  192   DDGDGAMEKGRKWILDHGSATAITSWGKMWLSVLGVFDWSGNNPLPPEMWLLPYFLPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSY+YGKR+ GPI   ILSLR+EL+N  + Q+DW+ ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYIYGKRFTGPITPLILSLRKELFNLPFDQLDWNKARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP IQD++W  LH  VEP+L  WP +KLR+KA+  AM H+ +EDE T Y+CIGPVNKV
Sbjct  312   YPHPFIQDVLWASLHKFVEPILMHWPGSKLREKAVNTAMQHVHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C WIE+P+S A K+HL R+ DYLWLAEDGMKM GYNGSQLWD  F VQAII+T+L 
Sbjct  372   LNMLCCWIEDPNSEAFKLHLPRVMDYLWLAEDGMKMRGYNGSQLWDTAFTVQAIISTDLF  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  L KAH FI  +Q+ ED   + L  WYRH +KG WPFST D+GWP+SDCT+E LK
Sbjct  432   EEFGLALTKAHEFIKKTQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTSEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS+++ ++VG+ ++   LYDAV++ILSL NN GGFATYELTRSY WLEI+NP+ETF
Sbjct  491   AALLLSKISPEIVGDPLDGKSLYDAVNVILSLMNNDGGFATYELTRSYAWLEIINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+K +PG+RR+EI+ CI K+  FI+ IQL DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALTLFKKTYPGHRREEIDNCIRKSARFIEKIQLADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYG WFG++GL+  G TYE+   IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYTN+
Sbjct  611   GVCFTYGIWFGMKGLLAAGRTYETSSCIRKACDFLLSKQVASGGWGESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQ  177
             EGN+ H VNT WAMLALI+AGQ
Sbjct  671   EGNRAHAVNTGWAMLALIDAGQ  692



>ref|XP_010067807.1| PREDICTED: cycloartenol synthase 2-like isoform X1 [Eucalyptus 
grandis]
Length=769

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/694 (67%), Positives = 564/694 (81%), Gaps = 9/694 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DD  +RS+ +++GRQYWEF+ N GT +E   ++++R  F +NR ++K SSDLLMR+QF K
Sbjct  10    DDLEVRSMYDNLGRQYWEFESNSGTPDELAMIERMRQAFTQNRHRVKQSSDLLMRLQFAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             EK +   +++V+VG EE+ISEEAVV TL+R +RFYST+QA DGHWP DYGGPLFLLP LV
Sbjct  70    EKSRAEEVEKVRVGEEEDISEEAVVNTLKRTIRFYSTLQAEDGHWPGDYGGPLFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGL +   +++VL  EH+KEM+RY+YNHQN DGGWG+HIEG STMF T L+YVTLR+LG+
Sbjct  130   IGLYITGDLHSVLSSEHRKEMIRYLYNHQNEDGGWGIHIEGKSTMFGTGLSYVTLRLLGQ  189

Query  1688  ERDGGNGA-MKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
             + +GG GA M +AR WILD GG T IPSWGKLWLSVLGVY+W GNNPLPPE+WLLPYI+P
Sbjct  190   DANGGEGAAMDRARAWILDRGGVTSIPSWGKLWLSVLGVYDWRGNNPLPPEIWLLPYILP  249

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             +HPGRMWCHCRMVYLPMSYLYGKR+V P++  +LSLR+ELY   Y+Q  WD  RN CAKE
Sbjct  250   LHPGRMWCHCRMVYLPMSYLYGKRFVAPLSPLVLSLRKELYVQPYNQTYWDHTRNLCAKE  309

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP IQD+ W  L  +VEPLL +WPF KLRK AL+  M+HI +EDET++Y+CIGPV
Sbjct  310   DLYYPHPWIQDMFWSCLSKVVEPLLARWPFYKLRKIALSTVMEHIHYEDETSHYICIGPV  369

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
             NKVLNM+C +IE P+S A K HLS+IKDYLW+AEDGMKM GYNGSQLWDV F+VQA++AT
Sbjct  370   NKVLNMVCCYIENPNSKAYKHHLSKIKDYLWVAEDGMKMQGYNGSQLWDVAFSVQALLAT  429

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DE  S L+KAH F+  SQI+ DS  + L +WYRH  KGGWPFSTP++GW +SDCTAE
Sbjct  430   NLVDECHSTLKKAHEFVKNSQIRADSSRD-LANWYRHIGKGGWPFSTPEHGWIISDCTAE  488

Query  791   ALK-------AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPW  633
             ALK        AL+L+ M   +VG AI   +LYDAV++ILSLQN +GGFATYE TRSYPW
Sbjct  489   ALKVIFFMIHVALLLAEMQPSIVGNAIAVDQLYDAVNVILSLQNQNGGFATYEQTRSYPW  548

Query  632   LEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQ  453
             LE +NPSETFG+IIIDY YVECTSAAI  LK F +L+P +R KEIEAC+ KA+ +I++IQ
Sbjct  549   LETINPSETFGDIIIDYPYVECTSAAIQSLKAFIRLYPHHRTKEIEACVLKAIEYIESIQ  608

Query  452   LPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYL  273
             LPDGSWYGSWGVCYTYGTWFGI GLV GG TY+S   IR+ACDFLLSKQL SGGWGESYL
Sbjct  609   LPDGSWYGSWGVCYTYGTWFGINGLVAGGRTYQSSESIRRACDFLLSKQLDSGGWGESYL  668

Query  272   SCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQVI  171
             S Q K YTN+EGN+ H+VNT+WAMLALIE GQ +
Sbjct  669   SSQIKRYTNLEGNRMHLVNTSWAMLALIECGQDV  702



>sp|Q6BE25.1|CAS1_CUCPE RecName: Full=Cycloartenol synthase [Cucurbita pepo]
 dbj|BAD34644.1| cycloartenol synthase [Cucurbita pepo]
Length=766

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/681 (67%), Positives = 552/681 (81%), Gaps = 1/681 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++NNH+GRQ W F P LG+ E+ QQ+Q+ R  F  +RF+ KHS+DLLMRMQF KE  
Sbjct  21    WLSTLNNHVGRQVWHFHPELGSPEDLQQIQQARQHFSDHRFEKKHSADLLMRMQFAKENS  80

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L QVKV  +E+++EEAV RTLRR + FYSTIQA DGHWP DYGGP+FL+P LVI L
Sbjct  81    SFVNLPQVKVKDKEDVTEEAVTRTLRRAINFYSTIQADDGHWPGDYGGPMFLIPGLVITL  140

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGEE +
Sbjct  141   SITGALNAVLSTEHQREICRYLYNHQNKDGGWGLHIEGPSTMFGSVLNYVTLRLLGEEAE  200

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GA+ KARKWILDHGGA  I SWGK+WLSVLGVYEW+GNNPLPPELWLLPY++P HPG
Sbjct  201   DGQGAVDKARKWILDHGGAAAITSWGKMWLSVLGVYEWAGNNPLPPELWLLPYLLPCHPG  260

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPM YLYGKR+VGPI   I SLR+ELY   YH++DW+ ARNQCAKEDLYY
Sbjct  261   RMWCHCRMVYLPMCYLYGKRFVGPITPIIRSLRKELYLVPYHEVDWNKARNQCAKEDLYY  320

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH++ EPL   WP  +LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  321   PHPLVQDILWATLHHVYEPLFMHWPAKRLREKALQSVMQHIHYEDENTRYICIGPVNKVL  380

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+T L +
Sbjct  381   NMLCCWAEDPHSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTELAE  440

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EY + LRKAH +I  SQ+ ED   + L+SWYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  441   EYETTLRKAHKYIKDSQVLEDCPGD-LQSWYRHISKGAWPFSTADHGWPISDCTAEGLKA  499

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG++I+  +LY+AV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  500   VLLLSKLPSEIVGKSIDEQQLYNAVNVILSLQNTDGGFATYELTRSYRWLELMNPAETFG  559

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVEC+SAAI  L  F+KL+PG+RR EI+ CI +A  FI++IQ  DGSWYGSWG
Sbjct  560   DIVIDYPYVECSSAAIQALAAFKKLYPGHRRDEIDNCIAEAADFIESIQATDGSWYGSWG  619

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFGIRGLV  G  Y +C  +RKACDFLLSK+L +GGWGESYLSCQ+KVYTNI+
Sbjct  620   VCFTYGGWFGIRGLVAAGRRYNNCSSLRKACDFLLSKELAAGGWGESYLSCQNKVYTNIK  679

Query  239   GNKWHIVNTAWAMLALIEAGQ  177
              ++ HIVNT WAML+LI+AGQ
Sbjct  680   DDRPHIVNTGWAMLSLIDAGQ  700



>dbj|BAF73929.1| cycloartenol synthase [Rhizophora stylosa]
Length=758

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/685 (66%), Positives = 550/685 (80%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DPWLR++NNH+GRQ WEFDP+L G+ E+   ++  R  F  NRF  +HS+DLLMR+QF K
Sbjct  11    DPWLRTINNHVGRQVWEFDPSLVGSPEDIADIENARRNFTINRFHHRHSADLLMRLQFAK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L +V V  +E+++E+AV  TLRR L ++STIQAHDGHWP DYGGP+FL+P LV
Sbjct  71    ENRLPPVLPKVAVKDDEDVTEQAVTVTLRRALDYFSTIQAHDGHWPGDYGGPMFLMPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LSV  A+NA+L  EHQ+E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR++GE
Sbjct  131   IALSVTGALNAILSREHQREICRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLIGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GAM++ R WIL+HGGAT I SWGK+WLSVLGV+EW GNNPLPPE W LPY++P+
Sbjct  191   GANDGEGAMERGRNWILNHGGATHITSWGKMWLSVLGVFEWRGNNPLPPETWPLPYLLPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH IDW+ ARN CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHDIDWNDARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  L   +EP L +WP  KLR++A    M+H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDLLWAFLDKAIEPFLMRWPGKKLRERAFQSVMEHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD+ FAVQAI ATN
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRIHDYLWIAEDGMKMQGYNGSQLWDLSFAVQAIAATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  L+KAH F+  SQ+ ED     L SWYRH +KG WP ST D+GWP+SDCTAE 
Sbjct  431   LVEEYGPTLKKAHSFVKSSQVPEDCP-GVLNSWYRHISKGAWPSSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAA +LS+++  +VGE +  +RLYDAV+++LSLQN  GG+ATYELTRSY WLE++NP+E
Sbjct  490   LKAARLLSKISSVIVGEPLSANRLYDAVNILLSLQNVDGGYATYELTRSYSWLEVINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTS+AI GL  F+K +PG+RR+EIE CI KA TFI++IQ  DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSSAIQGLVSFKKSYPGHRREEIERCIRKAATFIESIQKADGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TY TWFGI+GLV  G  + +C  IRKACDFLLS+Q  SGGWGESYLSCQ+KVY+
Sbjct  610   SWGVCFTYATWFGIKGLVAAGKNFNNCSSIRKACDFLLSRQCASGGWGESYLSCQEKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGN+ HIVNTAWAMLALI AGQ 
Sbjct  670   NLEGNRSHIVNTAWAMLALIGAGQA  694



>ref|XP_011017592.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Populus 
euphratica]
Length=756

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/685 (67%), Positives = 549/685 (80%), Gaps = 6/685 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ NNHIGRQ WEFDP L  +  E ++++  R  F +NRF+ KHS+DL+MRMQFEK
Sbjct  11    NPWLRTTNNHIGRQVWEFDPTLTLSPREMEEIENARRNFTENRFRFKHSADLIMRMQFEK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV   EE++EEAV  TL+R L FYS+IQAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPVPEVLPQVKVNESEEVTEEAVAATLKRALNFYSSIQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NAVL +EH+KEM+RY+YNHQN DGGWGLHIEG STMF + L+Y+TLR+LGE
Sbjct  131   ITLSITGALNAVLSDEHKKEMIRYLYNHQNRDGGWGLHIEGPSTMFGSVLSYITLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G+GAM K   WIL+      I SWGK+WLSVLGV+EWSGNNP+PPE+WLLPY++P+
Sbjct  191   GPNDGDGAMDKGHDWILN----XMITSWGKMWLSVLGVFEWSGNNPMPPEMWLLPYLLPV  246

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+EL+   YH+IDW+ ARN CAKED
Sbjct  247   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPIVLSLRKELFTVPYHEIDWNQARNLCAKED  306

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD +W  L    EP+L  WP  KLR++AL  AM+HI +EDE T Y+CIGPVN
Sbjct  307   LYYPHPLVQDALWALLDKAAEPVLMHWPGKKLREQALHTAMEHIHYEDENTRYICIGPVN  366

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI+DYLWLAEDGMKM GYNGSQLWD  FAVQAII+T 
Sbjct  367   KVLNMLCCWVEDPNSEAFKLHLPRIQDYLWLAEDGMKMQGYNGSQLWDTSFAVQAIISTK  426

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  427   LVEEYGPTLRKAHAYIKNSQVLEDCPGD-LSLWYRHISKGAWPFSTADHGWPISDCTAEG  485

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS++  ++VGE +  +R YDAV++ILSLQN  GGFATYELTRSY WLE++NP+E
Sbjct  486   LKAALLLSKITPEIVGEPLAANRFYDAVNVILSLQNGDGGFATYELTRSYSWLELINPAE  545

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+R++EIE CI KA  FI++IQ  DGSWYG
Sbjct  546   TFGDIVIDYPYVECTSAAIQALVSFKKLYPGHRQEEIERCIRKATKFIESIQEKDGSWYG  605

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI GLV  GN +     IRKACDFLLSKQ  SGGWGESY SCQ+KVY+
Sbjct  606   SWGVCFTYGTWFGINGLVAAGNVFNDNSSIRKACDFLLSKQCSSGGWGESYFSCQNKVYS  665

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNTAWAMLALIEAGQ 
Sbjct  666   NLEGNKSHVVNTAWAMLALIEAGQA  690



>ref|NP_001233784.1| cycloartenol synthase [Solanum lycopersicum]
 ref|XP_010320043.1| PREDICTED: cycloartenol synthase isoform X1 [Solanum lycopersicum]
 gb|ACA28830.1| cycloartenol synthase [Solanum lycopersicum]
Length=757

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/684 (65%), Positives = 549/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWLR+ NNH+GR+ WEF+ + G+ E+R Q++K R  F K+R + KHS+DLLMR Q  KE
Sbjct  11    SPWLRTTNNHVGREVWEFEADFGSPEDRAQIEKFREHFTKHRLEQKHSADLLMRYQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVK+   E I+E+ V  TLRR L FYST+Q +DGHW  DYGGP+FL+P ++I
Sbjct  71    NQGISILPQVKINDNEVITEDNVATTLRRALSFYSTLQNNDGHWAGDYGGPMFLMPGMII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAV   EH++EM+RY+YNHQN DGGWGLHIE HSTMF +AL+YVTLR+LGE 
Sbjct  131   ALSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHSTMFGSALSYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K RKWILDHG AT I SWGK+WLSVLGV++WSGNNPLPPE+WLLPYI+PIH
Sbjct  191   ANDGDGAMEKGRKWILDHGSATAITSWGKMWLSVLGVFDWSGNNPLPPEIWLLPYILPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM YLYGKR+VGPI  T+LSLR+EL+   YH++DWD ARN+CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMCYLYGKRFVGPITPTVLSLRKELFTVPYHEVDWDKARNECAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDIMWATLHKVVEPILMHWPGKRLREKALRTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             ++NM+C W+E+P+S A K+HL RI DY+W+AEDGMKM GYNGSQ WD  FAVQAIIAT  
Sbjct  371   IINMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKMKGYNGSQCWDTSFAVQAIIATGF  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYGS LRKAH F+  +Q+  D+    L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   GEEYGSTLRKAHSFLTNTQVL-DNCPGDLDFWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VG  +E  RLYDAV+++LSLQN+ GGFATYEL+RSYPWLE++NP+ET
Sbjct  490   KAVLLLSKLPSEMVGNPLEAKRLYDAVNVLLSLQNSGGGFATYELSRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI++IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVERCIAKAAAFIESIQETDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y +   IRKAC FLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  610   WAVCFTYGTWFGVLGLLAAGRNYNNSSSIRKACTFLLSKQVSSGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNTAWAMLALI AGQ 
Sbjct  670   LEGNRSHVVNTAWAMLALIAAGQA  693



>ref|XP_006381170.1| hypothetical protein POPTR_0006s07870g [Populus trichocarpa]
 gb|ERP58967.1| hypothetical protein POPTR_0006s07870g [Populus trichocarpa]
Length=738

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/685 (67%), Positives = 542/685 (79%), Gaps = 19/685 (3%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPWL+SVNNH+GRQ+WEFDP+LGT EER QV+  R EF K+RF  KHSSDLLMR QF +
Sbjct  10    NDPWLKSVNNHVGRQFWEFDPHLGTPEERAQVENYRNEFTKSRFLTKHSSDLLMRFQFAR  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E   EM L   KV SEEEI++E V  TLRR LRFYST+QA DG WP DYGGP+FLLP LV
Sbjct  70    ENPCEMKLPMAKVRSEEEITKEVVDTTLRRSLRFYSTLQAEDGFWPGDYGGPMFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V  A+N +L  +H++EM RY+YNHQN+DGGWGLHIEG STMFCT L+YVTLR+LGE
Sbjct  130   ICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHIEGSSTMFCTVLSYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             E DGG+G+M KARKW+LDHGGAT IPSWGK+WLSVLGVYEWSGNNPL PELWLLPY+ P 
Sbjct  190   EMDGGDGSMGKARKWVLDHGGATHIPSWGKMWLSVLGVYEWSGNNPLLPELWLLPYLFPA  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGR+WC CRMVYLPMSYLYGK++V    S +LS+RRE+Y   YHQIDWD  RN CAKED
Sbjct  250   HPGRLWCQCRMVYLPMSYLYGKKFVCSTTSLVLSIRREIYTIPYHQIDWDQTRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPH  +QDIVW  +H  VEPLL +WP +KLR++AL   M  + +EDETT YVC+GPVN
Sbjct  310   LYYPHSLLQDIVWACIHKAVEPLLTRWPVSKLRQRALDSVMQRVHYEDETTQYVCLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K HL+RI DYLW+AEDGMKM GYNGSQLWDV FAVQAI+ATN
Sbjct  370   KVLNMLCCWVEDPNSEAYKCHLARINDYLWVAEDGMKMQGYNGSQLWDVSFAVQAILATN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
               DE+  ML+KAH F+  +Q++ +S  ++   W RH +KG WPFST DNGWPVSDCTAE 
Sbjct  430   FADEFAPMLKKAHNFLKNTQMRTNSSDDF-NDWNRHISKGAWPFSTLDNGWPVSDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA ++LSR+  D+VGEAI     YDAV++ILSLQNN+GGFA+YELTRSY W        
Sbjct  489   LKAGILLSRLPSDMVGEAIPADWFYDAVNVILSLQNNNGGFASYELTRSYAW--------  540

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
                       YVECTSA I GLK F+K +PG+R+KEIEAC+ KA+ FI+  Q PDGSWYG
Sbjct  541   ----------YVECTSAVIQGLKSFKKSYPGHRKKEIEACMVKAIDFIERTQQPDGSWYG  590

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI+GLV GG TY++   IR AC+FLLSKQL SGGWGESYLS QDKVYT
Sbjct  591   SWGVCFTYGTWFGIKGLVAGGRTYQNSSSIRIACEFLLSKQLVSGGWGESYLSSQDKVYT  650

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G K H+VNT WAMLALIEAGQ 
Sbjct  651   NLGGGKSHLVNTGWAMLALIEAGQA  675



>ref|XP_004303790.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/685 (68%), Positives = 546/685 (80%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D  WLRSVNNH+GRQ WE+ P LGT EE QQ++  R  F  NRF+ KHSSDLLMR+QF K
Sbjct  16    DHQWLRSVNNHLGRQVWEYHPELGTPEELQQIEDARKAFWDNRFETKHSSDLLMRIQFAK  75

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRR + FYSTIQAHDGHWP DYGGP+FLLP LV
Sbjct  76    ENPCVTDLPQLKVKDAEEVTEEVVTTTLRRAIDFYSTIQAHDGHWPGDYGGPMFLLPGLV  135

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NAVL  EHQ+EM RY+YNHQN DGGWGLHIEG STMF TALNYV+LR+LGE
Sbjct  136   ITLSITGALNAVLSIEHQREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVSLRLLGE  195

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               D G GAM  ARKWILDHGG T I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P+
Sbjct  196   GADDGKGAMGLARKWILDHGGVTAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYSLPV  255

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY   YH++DW+ ARN CAKED
Sbjct  256   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTIQSLRKELYTVPYHEVDWNEARNLCAKED  315

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH ++EP+  +WP  +LR+KAL   M HI +EDE T Y+CIGPVN
Sbjct  316   LYYPHPMVQDILWASLHYVLEPVFKRWPAKRLREKALDTVMQHIHYEDENTRYICIGPVN  375

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W E+P+S A K+HL R+ DYLW+AEDGMKM GYNGSQ WD  FAVQAII+TN
Sbjct  376   KVLNMLCCWSEDPNSEAFKLHLPRLYDYLWIAEDGMKMQGYNGSQAWDTSFAVQAIISTN  435

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L  EYG  LRKAH++I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  436   LAKEYGPTLRKAHVYIKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEG  494

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS +  + VGE+++  +LYDAV++ LSLQN+ GGFATYELTRSY WLE++NP+E
Sbjct  495   LKAALLLSTLPTETVGESLDRKKLYDAVNVTLSLQNDDGGFATYELTRSYRWLELINPAE  554

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI +A  FI+ IQ  DGSWYG
Sbjct  555   TFGDIVIDYPYVECTSAAIQALTLFKKLYPGHRREEIENCIARAAEFIEKIQATDGSWYG  614

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TY  WFGI+GL+  G TYE C  I KACDFLLSK+L SGGWGESYLSCQ+K Y+
Sbjct  615   SWGVCFTYAGWFGIKGLIAAGRTYEDCSSISKACDFLLSKELASGGWGESYLSCQNKEYS  674

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N++ N+ HIVNTAWAMLAL+ AGQ 
Sbjct  675   NLKDNRPHIVNTAWAMLALLGAGQA  699



>ref|XP_010927166.1| PREDICTED: cycloartenol synthase-like isoform X3 [Elaeis guineensis]
Length=799

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/683 (65%), Positives = 550/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              P LR+ NNH+GRQ WEF+PN+GT EE   V+K R  F ++RF++KHS+DLL+R+QF KE
Sbjct  63    SPRLRTTNNHVGRQLWEFEPNMGTAEEIAAVEKARELFREHRFEMKHSADLLVRLQFAKE  122

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+    +K+   ++++EE V+ +LRR +  YST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  123   NPLEINFPHIKLEDHQDVTEEVVLTSLRRAISCYSTLQAHDGHWPGDYGGPMFLMPILII  182

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS++ A+N VL  EH++E+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV LR+LGE 
Sbjct  183   ALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHSTMFGSALAYVALRLLGEG  242

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+KAR WILDHGGAT I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY +P+H
Sbjct  243   PDDGDGAMQKARTWILDHGGATTITSWGKFWLSVLGVFEWSGNNPIPPEMWLLPYFLPVH  302

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRM+CHCRM+YLPMSY+YGKR+VGPI  T+LSLR+ELY   Y QIDW+ ARN+CAKEDL
Sbjct  303   PGRMYCHCRMIYLPMSYIYGKRFVGPITPTVLSLRKELYGCPYQQIDWNRARNECAKEDL  362

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L   P +KLRKKAL  AM HI +EDE T Y+CIGPVNK
Sbjct  363   YYPHPLVQDIIWASLHKVVEPVLMHSPGSKLRKKALHTAMQHIHYEDENTRYICIGPVNK  422

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+HL RI D+LWLAEDGMKM  YNGSQLWD   AVQAII+T+L
Sbjct  423   VLNMLSCWIEDPNSEAFKLHLPRIYDFLWLAEDGMKMQSYNGSQLWDTALAVQAIISTDL  482

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY   LR+AH FI  SQI ED   + L  WYRH +KG W FST D GWPVSDCTAE L
Sbjct  483   SEEYLPTLRRAHDFIKNSQILEDCPGD-LSFWYRHISKGAWTFSTADQGWPVSDCTAEGL  541

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +   R+YDAV+++LSL N  GGFATYELTRSY WLEI+NP+ET
Sbjct  542   KASLLLSKISPEIVGEPLCAGRIYDAVNVLLSLMNKDGGFATYELTRSYAWLEIINPAET  601

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTS+AI+ L  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWY  
Sbjct  602   FGDIVIDYPYVECTSSAILALTSFKKLYPGHRRDDIENCIRKAANFIEMIQQPDGSWYSY  661

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+N
Sbjct  662   WAVCFTYGTWFGVKGLIATGRTYQNSSSIRKACQFLLSKQLASGGWGESYLSCQNKVYSN  721

Query  245   IEGNKWHIVNTAWAMLALIEAGQ  177
             +EGN+ H VNTAWA+LALI+AGQ
Sbjct  722   LEGNRCHAVNTAWAILALIDAGQ  744



>ref|XP_008348400.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Malus 
domestica]
Length=763

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/682 (68%), Positives = 543/682 (80%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF P +GT EE QQ++  R  F KNRF+ +HSSDLLMR+QF KE  
Sbjct  19    WLKSVNNHLGRQVWEFHPEIGTPEELQQIEDARKAFWKNRFERRHSSDLLMRIQFAKENP  78

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L Q+KV  +EE+ EEAV  TLRR L FYSTIQAHDGHW  DYGGP+FLLP L+I L
Sbjct  79    XATNLPQLKVKDQEEVKEEAVATTLRRALSFYSTIQAHDGHWAGDYGGPMFLLPGLIITL  138

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  D
Sbjct  139   SITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAD  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GA++ ARKWILDHGG T I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P HPG
Sbjct  199   DGQGAIELARKWILDHGGVTAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYSLPFHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGK +VGPI  TI SLR+ELY   YH++DW+ ARN CAKEDLYY
Sbjct  259   RMWCHCRMVYLPMSYLYGKXFVGPITPTIRSLRKELYTAPYHEVDWNKARNLCAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH + EP+  +WP  +LR  AL   M HI +EDE T Y+CIGPVNKVL
Sbjct  319   PHPMVQDVLWGSLHYVYEPVFTRWPAKELRDSALKTVMQHIHYEDENTRYICIGPVNKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQ WD  FA+QAII+TNL +
Sbjct  379   NMLCCWAEDPNSEAFKLHLPRIPDYLWIAEDGMKMQGYNGSQAWDTSFAIQAIISTNLVE  438

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  439   EYGPTLRKAHQYIKDSQVVEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLKA  497

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++  + VGE+++  R YDAV++ LSLQN+ GGFATYELTRSY WLE++NP+ETFG
Sbjct  498   ALLLSKLPTETVGESLDIKRFYDAVNVTLSLQNDDGGFATYELTRSYQWLELINPAETFG  557

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F++L P +R  EIE CI +A  FI+TIQ  DGSWYGSWG
Sbjct  558   DIVIDYPYVECTSAAIQALALFKRLCPAHRSDEIENCIARAAKFIETIQATDGSWYGSWG  617

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GLV  G TYE C  IRKACDFLLSK+LPSGGWGESYLSCQ+KVYTN++
Sbjct  618   VCFTYAGWFGIKGLVAAGRTYEDCSSIRKACDFLLSKELPSGGWGESYLSCQNKVYTNLK  677

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              N+ HIV+TAWAMLALI AGQ 
Sbjct  678   DNRPHIVHTAWAMLALIGAGQA  699



>gb|AFC67276.1| cycloartenol synthase [Eleutherococcus senticosus]
Length=758

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/684 (65%), Positives = 550/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++N+H+GRQ WEFDP +G+ EE  ++  +R  F K RF+ KHSSDLLMR+QF  E
Sbjct  11    NPWLRTLNDHVGRQIWEFDPKIGSPEELAEIDNVRDTFRKYRFEKKHSSDLLMRIQFANE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L QVKV   ++IS++ V  TL+R + FYST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPGSVVLPQVKVKDADDISKDKVTVTLKRAMSFYSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NAVL +EH++E+ RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K R+WILDHGGA  I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPYI+P  
Sbjct  191   ANDGQGAMEKGRQWILDHGGAATITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYILPFP  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  +  ++EP+  +WP  KLR+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLIQDILWASIDKVLEPIFMRWPGKKLREKSLRTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+HL R+ D+LWLAEDGMKM GYNGSQLWD  FAVQAII+T L
Sbjct  371   VLNMLCCWAEDPNSEAFKLHLPRLNDFLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTKL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+G  LRKAH+FI  SQ+ +D   + +  WYRH +KG  PFST D+GWP SDC AE  
Sbjct  431   TDEFGPTLRKAHMFIKNSQVLDDCPGD-IDFWYRHISKGARPFSTADHGWPTSDCAAEGF  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VGE ++  RLYDAV++ILSLQN+ GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAVLLLSKLPSELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYSWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+  +RR+EI+  I KA  F++ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYVECTSAAIQALSAFKKLYHDHRREEIQLSIEKAALFVEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  G T+ SC  IRKACDFLLSKQL S GWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGVKGLVAAGRTFSSCSSIRKACDFLLSKQLASAGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WA+LALI+AGQ 
Sbjct  670   LEGNRSHVVNTGWALLALIDAGQA  693



>gb|AAS01524.1| cycloartenol synthase [Centella asiatica]
Length=757

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/684 (66%), Positives = 550/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+VNNH+GRQ WEFDP LG+ EE  +++K R  FH +RF+ +HSSDLLMR+QF  E
Sbjct  11    NPWLRTVNNHVGRQIWEFDPKLGSPEELAEIEKARENFHNHRFEKQHSSDLLMRLQFANE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
               +   L QVKV    +ISE+ V  TL+R L FYST+QA+DGHW  DYGGP+FL+P LVI
Sbjct  71    NPRHEVLPQVKVKDIGDISEDKVTITLKRALSFYSTLQANDGHWAGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+ EA+NA+L +EH++E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE 
Sbjct  131   TLSITEALNAILSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
                G GAM+K R+WILDHGGAT I SWG++WLSVLGV+EWSGNNPLPPE+WL PY +P H
Sbjct  191   TKDGQGAMEKGRQWILDHGGATAITSWGRMWLSVLGVFEWSGNNPLPPEIWLFPYNLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHEIDWNQARNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  +  ++EP+L +WP  KLR+KAL   M+HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPLVQDILWASIDKVLEPILMRWPGKKLREKALRTVMEHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+HL R+ D+LWLAEDGMKM GYNGSQLWD  FAVQAII+T+L
Sbjct  371   VLNMLCCWAEDPNSEAFKLHLPRLYDFLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTSL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +  G  LRKAH F+  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE  
Sbjct  431   TEYCGPTLRKAHTFMKDSQVLDDCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEGF  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS+   ++VGE ++  RLYDAV++ILSLQN+ GG+ATYELTRSY WLE++NP+ET
Sbjct  490   KAVLLLSKFPAELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYRWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY Y ECTSAAI  L  F+KL+PG+RR+EI+  I KA  FI+ IQ  DGSWYGS
Sbjct  550   FGDIVIDYPYAECTSAAIQALSAFKKLYPGHRREEIQCSIEKAADFIEKIQASDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GL+  G T+ +C  IRKAC FLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGVKGLISAGRTFSNCSSIRKACYFLLSKQLASGGWGESYLSCQNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG + H+VNT WAMLALIEAGQ 
Sbjct  670   LEGERSHVVNTGWAMLALIEAGQA  693



>ref|XP_010927164.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Elaeis guineensis]
Length=811

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/684 (65%), Positives = 550/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              P LR+ NNH+GRQ WEF+PN+GT EE   V+K R  F ++RF++KHS+DLL+R+QF KE
Sbjct  63    SPRLRTTNNHVGRQLWEFEPNMGTAEEIAAVEKARELFREHRFEMKHSADLLVRLQFAKE  122

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+    +K+   ++++EE V+ +LRR +  YST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  123   NPLEINFPHIKLEDHQDVTEEVVLTSLRRAISCYSTLQAHDGHWPGDYGGPMFLMPILII  182

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS++ A+N VL  EH++E+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV LR+LGE 
Sbjct  183   ALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHSTMFGSALAYVALRLLGEG  242

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+KAR WILDHGGAT I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY +P+H
Sbjct  243   PDDGDGAMQKARTWILDHGGATTITSWGKFWLSVLGVFEWSGNNPIPPEMWLLPYFLPVH  302

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRM+CHCRM+YLPMSY+YGKR+VGPI  T+LSLR+ELY   Y QIDW+ ARN+CAKEDL
Sbjct  303   PGRMYCHCRMIYLPMSYIYGKRFVGPITPTVLSLRKELYGCPYQQIDWNRARNECAKEDL  362

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L   P +KLRKKAL  AM HI +EDE T Y+CIGPVNK
Sbjct  363   YYPHPLVQDIIWASLHKVVEPVLMHSPGSKLRKKALHTAMQHIHYEDENTRYICIGPVNK  422

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+HL RI D+LWLAEDGMKM  YNGSQLWD   AVQAII+T+L
Sbjct  423   VLNMLSCWIEDPNSEAFKLHLPRIYDFLWLAEDGMKMQSYNGSQLWDTALAVQAIISTDL  482

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY   LR+AH FI  SQI ED   + L  WYRH +KG W FST D GWPVSDCTAE L
Sbjct  483   SEEYLPTLRRAHDFIKNSQILEDCPGD-LSFWYRHISKGAWTFSTADQGWPVSDCTAEGL  541

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +   R+YDAV+++LSL N  GGFATYELTRSY WLEI+NP+ET
Sbjct  542   KASLLLSKISPEIVGEPLCAGRIYDAVNVLLSLMNKDGGFATYELTRSYAWLEIINPAET  601

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTS+AI+ L  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWY  
Sbjct  602   FGDIVIDYPYVECTSSAILALTSFKKLYPGHRRDDIENCIRKAANFIEMIQQPDGSWYSY  661

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+N
Sbjct  662   WAVCFTYGTWFGVKGLIATGRTYQNSSSIRKACQFLLSKQLASGGWGESYLSCQNKVYSN  721

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H VNTAWA+LALI+AGQ 
Sbjct  722   LEGNRCHAVNTAWAILALIDAGQA  745



>ref|XP_008809071.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008809072.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008809073.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
Length=736

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/683 (66%), Positives = 557/683 (82%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL++ NNH+GRQ WEFDPN+GT EE   VQK+R  F ++RF++KHS+DLLMR+QF K+ 
Sbjct  12    PWLKTTNNHVGRQVWEFDPNMGTAEEIAAVQKVRELFREHRFEMKHSADLLMRLQFAKDN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               E+ L  +K+   ++++EE V+ ++RR +  YST+QAHDGHWP D+GGP+FL+P L+I 
Sbjct  72    PLEINLPNIKLEDHDDVTEEVVLTSVRRAISCYSTLQAHDGHWPGDFGGPMFLMPGLIIV  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LSV  A+N VL  EHQ+E+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV+LR+LGE  
Sbjct  132   LSVTGALNTVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHSTMFGSALTYVSLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             D G+GAM+ AR WILDHGGAT I SWGK WLSVLGV+EW GNNPLPPE+WLLPY +P+HP
Sbjct  192   DDGDGAMQTARTWILDHGGATAITSWGKFWLSVLGVFEWYGNNPLPPEMWLLPYFLPVHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSY+YGKR+VGPI  T+LSLR+EL+   Y QIDW+ ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYIYGKRFVGPITPTVLSLRKELFACPYQQIDWNRARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP IQDI+W  LH + EP+L   P + LRKKAL  AM HI +EDE+T Y+CIGPVNKV
Sbjct  312   YPHPLIQDIIWASLHKVAEPILMHSPGSMLRKKALHTAMQHIHYEDESTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+  WIE+P S A K+HL RI D+LW+AEDGMKM GYNGSQ+WD+G +VQAII+T+L 
Sbjct  372   LNMLSCWIEDPYSEAFKLHLPRIYDFLWIAEDGMKMKGYNGSQMWDMGLSVQAIISTDLS  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LR+AH FI  SQ+ ED+  + L  W+RH +KGGW FST D+GWPVSDCT+E L 
Sbjct  432   EEYGPTLRRAHDFIKDSQVLEDAPGD-LSFWHRHISKGGWTFSTADHGWPVSDCTSEGLM  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS+++ ++VGE +   R+YDAV++ILSL N +GGFAT+E TRSY WLEI+NPSETF
Sbjct  491   ASLLLSKISPEIVGEPLCAGRIYDAVNVILSLMNKNGGFATFEPTRSYAWLEIINPSETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAA+ GL  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAMQGLSSFKKLYPGHRRDDIENCIRKASNFIEMIQRPDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+T+GTWFG+RGL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+++
Sbjct  611   AVCFTHGTWFGVRGLIAAGRTYQNSPCIRKACQFLLSKQLASGGWGESYLSCQNKVYSSL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGN+ H VNTAWAMLALI+AGQ 
Sbjct  671   EGNRCHAVNTAWAMLALIDAGQA  693



>sp|Q2XPU6.1|CAS1_RICCO RecName: Full=Cycloartenol synthase; Short=RcCAS [Ricinus communis]
 gb|ABB76767.1| cycloartenol synthase [Ricinus communis]
Length=759

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/685 (66%), Positives = 552/685 (81%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPN-LGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ N+HIGRQ WEFD + +G+ EE  Q++  R  F KNRF  KHSSDLLMR+QF K
Sbjct  12    NPWLRTTNDHIGRQVWEFDSSKIGSPEELSQIENARQNFTKNRFIHKHSSDLLMRIQFSK  71

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV   E+++EE V  TLRR L +YS+IQA DGHWP DYGGP+FL+P L+
Sbjct  72    ENPICEVLPQVKVKESEQVTEEKVKITLRRALNYYSSIQADDGHWPGDYGGPMFLMPGLI  131

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NA+L EEH++EM RY+YNHQN DGGWGLHIEG STMF + L YV+LR+LGE
Sbjct  132   IALSITGALNAILSEEHKREMCRYLYNHQNRDGGWGLHIEGPSTMFGSVLCYVSLRLLGE  191

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GA+++ R WIL HGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WLLPYI+P+
Sbjct  192   GPNEGEGAVERGRNWILKHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEMWLLPYILPV  251

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH+IDW+ ARNQCAKED
Sbjct  252   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEIDWNQARNQCAKED  311

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  LH  VEP+L  WP  +LR+KA+  A++HI +EDE T Y+CIGPVN
Sbjct  312   LYYPHPMLQDVLWATLHKFVEPILMHWPGKRLREKAIQTAIEHIHYEDENTRYICIGPVN  371

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL R+ DYLWLAEDGMKM GYNGSQLWD  FAVQAI++TN
Sbjct  372   KVLNMLCCWVEDPNSEAFKLHLPRLYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIVSTN  431

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  L+KAH FI   Q+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  432   LIEEYGPTLKKAHSFIKKMQVLENCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEG  490

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             +KA ++LS++  ++VGE +  +RLYDAV+++LSLQN  GGF TYEL+RSY WLE +NP+E
Sbjct  491   IKALMLLSKIPSEIVGEGLNANRLYDAVNVVLSLQNGDGGFPTYELSRSYSWLEFINPAE  550

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  FRK +P ++R+EIE CI KA  F++ IQ+ DGSWYG
Sbjct  551   TFGDIVIDYPYVECTSAAIQALTSFRKSYPEHQREEIECCIKKAAKFMEKIQISDGSWYG  610

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI+GLV  G ++ +C  IRKACDFLLSKQ PSGGWGESYLSCQ KVY+
Sbjct  611   SWGVCFTYGTWFGIKGLVAAGKSFGNCSSIRKACDFLLSKQCPSGGWGESYLSCQKKVYS  670

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EG++ H+VNTAWAML+LI+AGQ 
Sbjct  671   NLEGDRSHVVNTAWAMLSLIDAGQA  695



>ref|XP_010927163.1| PREDICTED: cycloartenol synthase-like isoform X1 [Elaeis guineensis]
Length=813

 Score =   955 bits (2468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/684 (65%), Positives = 550/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              P LR+ NNH+GRQ WEF+PN+GT EE   V+K R  F ++RF++KHS+DLL+R+QF KE
Sbjct  63    SPRLRTTNNHVGRQLWEFEPNMGTAEEIAAVEKARELFREHRFEMKHSADLLVRLQFAKE  122

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+    +K+   ++++EE V+ +LRR +  YST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  123   NPLEINFPHIKLEDHQDVTEEVVLTSLRRAISCYSTLQAHDGHWPGDYGGPMFLMPILII  182

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS++ A+N VL  EH++E+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV LR+LGE 
Sbjct  183   ALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHSTMFGSALAYVALRLLGEG  242

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+KAR WILDHGGAT I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY +P+H
Sbjct  243   PDDGDGAMQKARTWILDHGGATTITSWGKFWLSVLGVFEWSGNNPIPPEMWLLPYFLPVH  302

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRM+CHCRM+YLPMSY+YGKR+VGPI  T+LSLR+ELY   Y QIDW+ ARN+CAKEDL
Sbjct  303   PGRMYCHCRMIYLPMSYIYGKRFVGPITPTVLSLRKELYGCPYQQIDWNRARNECAKEDL  362

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L   P +KLRKKAL  AM HI +EDE T Y+CIGPVNK
Sbjct  363   YYPHPLVQDIIWASLHKVVEPVLMHSPGSKLRKKALHTAMQHIHYEDENTRYICIGPVNK  422

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+HL RI D+LWLAEDGMKM  YNGSQLWD   AVQAII+T+L
Sbjct  423   VLNMLSCWIEDPNSEAFKLHLPRIYDFLWLAEDGMKMQSYNGSQLWDTALAVQAIISTDL  482

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY   LR+AH FI  SQI ED   + L  WYRH +KG W FST D GWPVSDCTAE L
Sbjct  483   SEEYLPTLRRAHDFIKNSQILEDCPGD-LSFWYRHISKGAWTFSTADQGWPVSDCTAEGL  541

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +   R+YDAV+++LSL N  GGFATYELTRSY WLEI+NP+ET
Sbjct  542   KASLLLSKISPEIVGEPLCAGRIYDAVNVLLSLMNKDGGFATYELTRSYAWLEIINPAET  601

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTS+AI+ L  F+KL+PG+RR +IE CI KA  FI+ IQ PDGSWY  
Sbjct  602   FGDIVIDYPYVECTSSAILALTSFKKLYPGHRRDDIENCIRKAANFIEMIQQPDGSWYSY  661

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G TY++   IRKAC FLLSKQL SGGWGESYLSCQ+KVY+N
Sbjct  662   WAVCFTYGTWFGVKGLIATGRTYQNSSSIRKACQFLLSKQLASGGWGESYLSCQNKVYSN  721

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H VNTAWA+LALI+AGQ 
Sbjct  722   LEGNRCHAVNTAWAILALIDAGQA  745



>ref|XP_007214976.1| hypothetical protein PRUPE_ppa001806mg [Prunus persica]
 gb|EMJ16175.1| hypothetical protein PRUPE_ppa001806mg [Prunus persica]
Length=762

 Score =   955 bits (2468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/682 (68%), Positives = 547/682 (80%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF+P LG+ EE Q+++  R  F  NRF+ +HSSDLLMR+QFEKE  
Sbjct  18    WLKSVNNHLGRQVWEFNPELGSPEELQRIEDARKAFWNNRFERRHSSDLLMRIQFEKENP  77

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L Q+KV  EEE++EE V  TLRR + FYSTIQAHDGHWP DYGGP+FLLP LVI L
Sbjct  78    CVTNLPQLKVKDEEEVTEEVVKTTLRRAISFYSTIQAHDGHWPGDYGGPMFLLPGLVITL  137

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ EM RY+YNHQN DGGWGLHIEG STMF TALNYV+LR+LGE  D
Sbjct  138   SITGALNAVLSKEHQHEMCRYLYNHQNKDGGWGLHIEGPSTMFGTALNYVSLRLLGEGAD  197

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GAM+ ARKWILDHGG T I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P HPG
Sbjct  198   DGQGAMELARKWILDHGGVTKITSWGKMWLSVLGTYEWSGNNPLPPEVWLCPYSLPFHPG  257

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY+  YH++DW+ ARN CAKEDLYY
Sbjct  258   RMWCHCRMVYLPMSYLYGKRFVGPITPTIRSLRKELYSVPYHEVDWNQARNLCAKEDLYY  317

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH + EP+   WP  +LR+ AL   M HI +EDE T Y+CIGPVNKVL
Sbjct  318   PHPMVQDILWASLHYVYEPVFAHWPAKELRENALQTVMQHIHYEDENTRYICIGPVNKVL  377

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQ WD  FAVQAII+TNL +
Sbjct  378   NMLCCWAEDPNSDAFKLHLPRIPDYLWVAEDGMKMQGYNGSQSWDTSFAVQAIISTNLAE  437

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E+G  LRKAH +I  SQ+ ED   + L+ WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  438   EFGPTLRKAHEYIKDSQVLEDCPGD-LKFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  496

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++    VGE+++  RLYDAV++ LSLQN+ GGFATYELTRSY WLE++NP+ETFG
Sbjct  497   VLLLSKLPTGTVGESLDMKRLYDAVNVTLSLQNDDGGFATYELTRSYQWLELINPAETFG  556

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F KL+PG+RR+EIE+CI +A  FI+ IQ  DGSWYGSWG
Sbjct  557   DIVIDYPYVECTSAAIQALAMFGKLYPGHRREEIESCIARAAKFIEKIQATDGSWYGSWG  616

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GL   G TY  C  IRKACDFLLSK+LPSGGWGESYLSCQ+KVYTN++
Sbjct  617   VCFTYAGWFGIKGLAAAGRTYNDCSSIRKACDFLLSKELPSGGWGESYLSCQNKVYTNLK  676

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              N+ HIV+TAWAMLALI AGQ 
Sbjct  677   DNRPHIVHTAWAMLALIGAGQA  698



>dbj|BAE95410.1| lanosterol synthase [Lotus japonicus]
Length=767

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/685 (67%), Positives = 553/685 (81%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +D  +RSVNNH+GRQ+WEFDP+LGT++ER QV++ R EF++NRF+ K+SSDLLMR+QFE+
Sbjct  11    EDELIRSVNNHVGRQFWEFDPDLGTEQERAQVEQARKEFNQNRFKTKNSSDLLMRLQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E G  M ++ V +  EE+I+EE V  TL+R LR YST+QA DG WP DY G +F+LP LV
Sbjct  71    ENGVNMKVKNVNIQKEEDITEEVVEDTLKRALRCYSTLQAQDGFWPGDYAGAMFMLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGLSV  A+NA L  EHQ EM RY+ NHQN DGGWGLHIEG +TMF T LNYV +R+LGE
Sbjct  131   IGLSVTGALNAALSPEHQSEMKRYVLNHQNEDGGWGLHIEGPTTMFGTVLNYVAMRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             + DGG+GAMKKARKWILD GGAT IPSWGK WLSVLGVYEW G NP+PPELWLLPY +P 
Sbjct  191   DIDGGDGAMKKARKWILDRGGATSIPSWGKFWLSVLGVYEWRGINPMPPELWLLPYSLPS  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCH R+VYL MSYLYG+R+VGP N+ +LSLR+ELY   YH +DW+ ARN CAKED
Sbjct  251   HPGRMWCHTRLVYLSMSYLYGRRFVGPFNALVLSLRKELYTLPYHLLDWNEARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             L +P P IQ+I+W  LH++ EPLL    F++LR+KAL   M+HI +EDE +NY+CIGPVN
Sbjct  311   LSHPRPGIQNILWGLLHHVGEPLLTHKLFSRLRQKALHHVMEHIHNEDEASNYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNMIC W+E+P+S A K H+SRIKDYLW+AEDGMKM GY GSQLWDV F+VQAI+ATN
Sbjct  371   KVLNMICCWLEDPNSQAFKYHISRIKDYLWVAEDGMKMQGYGGSQLWDVAFSVQAILATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L DEYGSML++A+ FI  SQI  +S  N   +WYRH +KG W FSTPDNGWPVSDCTAE 
Sbjct  431   LDDEYGSMLKRANEFIKCSQITTNSSSN-PSAWYRHISKGSWGFSTPDNGWPVSDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAA++LS    + VG+A+E  +LYDAV  +LS+QN +GGFA+YELTRSY WLE +NP E
Sbjct  490   LKAAILLSNFPSETVGKAMETEKLYDAVSWVLSMQNENGGFASYELTRSYAWLEKINPVE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TF +I+IDYQYVECTSAAI GL  F + +P YRR+EI++CI KA  +I++ QL DGSWYG
Sbjct  550   TFRDIMIDYQYVECTSAAIQGLALFTQRYPEYRRREIDSCIAKAARYIESTQLADGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+CYTY TWFGI+GL+    +Y+    IR+AC+FLLSKQL SGGWGESYLSC+ KVYT
Sbjct  610   SWGICYTYATWFGIKGLIAASKSYQESKSIRRACEFLLSKQLLSGGWGESYLSCELKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNTAWAMLALIE GQ 
Sbjct  670   NLEGNKSHLVNTAWAMLALIEGGQA  694



>sp|Q8W3Z4.1|CAS1_BETPL RecName: Full=Cycloartenol synthase [Betula platyphylla]
 dbj|BAB83085.1| cycloartenol synthase [Betula platyphylla]
Length=767

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/684 (68%), Positives = 546/684 (80%), Gaps = 2/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLRS+NNH+GRQ WEF P LGTQEE QQ+   R  F + RF+ +HSSDLLMR+QF KE
Sbjct  22    ETWLRSLNNHLGRQIWEFHPELGTQEELQQIDDARRRFWERRFERRHSSDLLMRIQFAKE  81

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   + QVK+   EE+ EEAV  TLRR + FYSTIQA DGHWP DYGGP+FL+P LVI
Sbjct  82    NPSSANIPQVKIKDTEEVREEAVGMTLRRAINFYSTIQADDGHWPGDYGGPMFLIPGLVI  141

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+   +NA L +EHQ E+ RY+YNHQN DGGWGLHIEG STMF TALNY+TLR+LGE 
Sbjct  142   TLSITGTLNAFLSKEHQCEICRYLYNHQNEDGGWGLHIEGPSTMFGTALNYITLRLLGEP  201

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG  GA++KARKWILDHGGAT I SWGK+WLSVLGVYEWSGNNPLPPE+WL PY++P H
Sbjct  202   EDG-MGAVEKARKWILDHGGATAITSWGKMWLSVLGVYEWSGNNPLPPEVWLCPYLLPCH  260

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI STI SLR+ELY   YH+IDW+ ARN CAKEDL
Sbjct  261   PGRMWCHCRMVYLPMSYLYGKRFVGPITSTIQSLRKELYTVPYHEIDWNKARNDCAKEDL  320

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  L+   EP+   WP  +LR+KAL   M HI +EDE T Y+CIGPVNK
Sbjct  321   YYPHPLVQDILWASLYYAYEPIFMYWPAKRLREKALDTVMQHIHYEDENTRYICIGPVNK  380

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN+
Sbjct  381   VLNMLCCWAEDPNSEAFKLHLPRILDYLWIAEDGMKMQGYNGSQLWDTTFAVQAIISTNI  440

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  441   AEEYGQTLRKAHEYIKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGL  499

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA ++LS+   + VG++++  RLYDAV +ILSLQN  GGFATYELTRSY WLE++NP+ET
Sbjct  500   KAVILLSQFPSETVGKSVDVKRLYDAVHVILSLQNTDGGFATYELTRSYHWLELINPAET  559

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KLHPG+RR+EIE CI KA  FI+ IQ  DGSWYGS
Sbjct  560   FGDIVIDYPYVECTSAAIQALTLFKKLHPGHRREEIENCIAKAAEFIENIQASDGSWYGS  619

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TY  WFGI+GLV  G TY++C  I KACD+LLSK+L SGGWGESYLSCQDKVYTN
Sbjct  620   WGVCFTYAGWFGIKGLVAAGRTYKNCSSIHKACDYLLSKELASGGWGESYLSCQDKVYTN  679

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++ N+ HIVNT WAMLALI+AGQ 
Sbjct  680   LKDNRPHIVNTGWAMLALIDAGQA  703



>ref|XP_010068963.1| PREDICTED: cycloartenol Synthase-like [Eucalyptus grandis]
 gb|KCW66033.1| hypothetical protein EUGRSUZ_G03323 [Eucalyptus grandis]
Length=758

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/685 (67%), Positives = 554/685 (81%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DD  +RS+ ++IGRQ+WEF PN GT +E   ++K+R EF +NR+ +K SSDLLMR+Q  K
Sbjct  10    DDLEVRSIYDNIGRQFWEFTPNAGTPDELAIIKKMRQEFTQNRYHVKQSSDLLMRLQLAK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             EK +   +++V +G+EE+ISEEAVV TL+R ++FYST+QA DGHWP DYGGPLFLLP LV
Sbjct  70    EKSRVEEIEKVSMGAEEDISEEAVVNTLKRAIKFYSTLQAEDGHWPGDYGGPLFLLPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGL +   +++VL  EH KEM+RY+YNHQN DGGWGLHIEG STMF T L+YV LR+LGE
Sbjct  130   IGLYITRDLHSVLSSEHCKEMIRYLYNHQNEDGGWGLHIEGKSTMFGTGLSYVALRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             +  G + AM KAR WILD GG T IPSWGKLWLS+LGVY+W GNNPLPPE+WLLP+I+PI
Sbjct  190   DTTGSDRAMVKARAWILDRGGVTSIPSWGKLWLSMLGVYDWRGNNPLPPEIWLLPHILPI  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+V  ++  +LSLR+ELY   Y+QI+WD  RN CAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVASLSPLVLSLRKELYVQPYNQIEWDQTRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY PHP IQD++W  LHN+VEPLL +WPF+KLR+ AL+ AMDHI +EDE T+Y+C+GPVN
Sbjct  310   LYCPHPWIQDMLWSCLHNVVEPLLAQWPFSKLRQIALSTAMDHIHYEDENTHYICLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E P+S   K HLSRIKDYLW+AEDGMKM GYNGSQLWD  F+VQA++AT+
Sbjct  370   KVLNMVCCWVENPNSKEYKHHLSRIKDYLWVAEDGMKMQGYNGSQLWDAAFSVQALLATD  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +E G  L+KAH FI  SQI+ +S  N L  WYR   KGGWPFSTP+NGW VSDCTAEA
Sbjct  430   LAEECGLTLKKAHEFIKNSQIRANSNGN-LDHWYRDVRKGGWPFSTPENGWIVSDCTAEA  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAA++LS M   +VG AI   +L+DAV+LIL+ QN +GGFA+YE TRSY WLE +NPSE
Sbjct  489   LKAAVLLSEMESSIVGNAIAVEQLFDAVNLILTNQNQNGGFASYEPTRSYAWLETINPSE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDYQYVEC SA I  LK F KL+  +RRKEIE  I KA  FI++IQLPDG WYG
Sbjct  549   TFGDIVIDYQYVECKSAVIQCLKVFAKLYRSHRRKEIEDSILKATEFIESIQLPDGCWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVCYTYGTWFGI GLV GG TY+S   IR+AC FLLSKQL SGGWGESYLS Q+K YT
Sbjct  609   SWGVCYTYGTWFGINGLVAGGRTYQSSESIRRACHFLLSKQLESGGWGESYLSSQNKEYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNT+WAMLALIE+GQ 
Sbjct  669   NLEGNKTHLVNTSWAMLALIESGQA  693



>ref|XP_009764017.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol Synthase-like [Nicotiana 
sylvestris]
Length=757

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/684 (65%), Positives = 549/684 (80%), Gaps = 1/684 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D+PWLRS+NNH+GRQ WEFD N+G++E+  +++K R EF  NRF+ KHSSDLLMR QF K
Sbjct  10    DNPWLRSLNNHVGRQVWEFDSNIGSEEDLAEIEKFREEFRNNRFETKHSSDLLMRYQFSK  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QV+V    +++E+ V  TL+R L FYST+QAHDGHW  DYGGP+FL+P LV
Sbjct  70    ENPSGTILPQVQVIDIGDVTEDNVATTLKRALSFYSTLQAHDGHWAGDYGGPMFLMPGLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LSV  A++AVL EEH++E+ RY+YNHQN DGGWGLH+E  STMF + L+YVTLR+LGE
Sbjct  130   IALSVTGALSAVLSEEHKREICRYLYNHQNSDGGWGLHVESPSTMFGSVLSYVTLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               +GG GAM+K RKWILDHG AT I SWGK+WLSVLG++EWSGNNPLPPE+WLLPYI+P 
Sbjct  190   GTNGGEGAMEKGRKWILDHGSATAITSWGKMWLSVLGIFEWSGNNPLPPEIWLLPYILPF  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+ S+R EL+   YH+I+W+ ARN+CAKED
Sbjct  250   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVSSVRNELFTVPYHEINWNKARNECAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  L  +VEP+   WP  KL +KAL   MDHI +EDE T Y+CIGPVN
Sbjct  310   LYYPHPLVQDILWASLDKLVEPIFMHWPGKKLXEKALRTVMDHIHYEDENTRYICIGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W E+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQ WD  FA+QAII+TN
Sbjct  370   KVLNMLCCWAEDPNSEAFKLHIPRLYDYLWIAEDGMKMQGYNGSQSWDTSFAIQAIISTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L ++YG  LRKAH ++  +Q+ ED   N L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  430   LGEDYGPTLRKAHTYMKDTQVLEDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK  L LS++  ++VGE +E  RLYDAV+++LSL N  GG ATYEL+RSYPWLEI+NP+E
Sbjct  489   LKVCLQLSKLPMEIVGEPLEAKRLYDAVNVMLSLLNPDGGIATYELSRSYPWLEIVNPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSA I  L  F+KL+PGYR++E++ CI K  ++I+ IQ  DGSWYG
Sbjct  549   TFGDIVIDYPYVECTSAVIQALAAFKKLYPGYRKEEVDHCIRKGASYIEKIQAADGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFG++GL+    ++ +   IRKACDFLLSKQ+ SGGWGESYLSCQ+KVYT
Sbjct  609   SWGVCFTYGTWFGVKGLLAAWRSFNNSSSIRKACDFLLSKQVLSGGWGESYLSCQNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQ  177
             N+EGN+ HIVNTAWAMLALIEAGQ
Sbjct  669   NLEGNRSHIVNTAWAMLALIEAGQ  692



>gb|EYU25760.1| hypothetical protein MIMGU_mgv1a001797mg [Erythranthe guttata]
Length=757

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/701 (64%), Positives = 559/701 (80%), Gaps = 4/701 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLRS+N HIGRQ WEFDP+LG+ E+  +++KLR +F K+RF+ KHS+DLLMR+QF KE 
Sbjct  12    PWLRSLNGHIGRQIWEFDPSLGSSEDLAEIEKLREQFTKHRFEQKHSADLLMRLQFTKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   +EI+E+ V  TLRR + F+ST+QAHDGHW  DYGGP+FL+P LVI 
Sbjct  72    PNTTILPQVKVKDIDEITEDKVTDTLRRAISFHSTLQAHDGHWAGDYGGPMFLMPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NA L +EH++E+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNATLSKEHKREICRYLYNHQNSDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+K R WIL+HGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPYIVP HP
Sbjct  192   NEGDGAMEKGRDWILNHGGATAITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYIVPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY+  YH+IDWD ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYSVPYHEIDWDKARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH   EP+   WP  KLR KAL   M+H+ +EDE T Y+CIGPVNKV
Sbjct  312   YPHPVVQDILWASLHKFAEPVFMNWPGKKLRDKALRTVMEHVHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQ WD  FAVQAI++T L 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWVAEDGMKMQGYNGSQAWDTSFAVQAILSTELV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  L+KAH +I  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGPTLKKAHTYIKNSQVLDDCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS++   ++GE ++  R YDAV+++LSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   ASLLLSKLPAQIIGEPLDAKRFYDAVNVVLSLQNAEGGFATYELTRSYSWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+R++E+E CI K   F++ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSAAIQALTSFKKLYPGHRKEEVERCIEKGAKFMEKIQATDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G +Y +C  IRKACDFLLSKQLP GGWGESYLSCQ+KVY+N+
Sbjct  611   AVCFTYGTWFGVKGLVAAGRSYSNCSAIRKACDFLLSKQLPCGGWGESYLSCQNKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFINNH  129
             EG++ H+VNT WA+L LI+AGQ     L +    K+ IN+ 
Sbjct  671   EGDRSHVVNTGWALLTLIDAGQAERDPLPLHRAAKVLINSQ  711



>dbj|BAE95409.1| oxidosqualene cyclase [Lotus japonicus]
Length=761

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/685 (66%), Positives = 544/685 (79%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             ++  ++SVNNH+GRQ+WEFDPNLGT++ER QV++ R EF++NRFQ KHSSDLLMR QFE+
Sbjct  11    EEELVKSVNNHVGRQFWEFDPNLGTEQERAQVEQARKEFNQNRFQTKHSSDLLMRFQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E G  M +++V +   E+ISEE V  TL+R L  YST+Q  DG WP DYGGP+FLLP LV
Sbjct  71    ENGINMKIKKVNIQKVEDISEEVVRATLKRALTCYSTLQTQDGFWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGLSV   +N VL  +HQ EM RY+ NHQN DGGWGLHIEG +TMF T LNYVT+R+LG 
Sbjct  131   IGLSVTGTLNTVLSPQHQSEMKRYVLNHQNEDGGWGLHIEGPTTMFGTVLNYVTMRLLGV  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               +GG+GAM KAR+WIL  GGAT IPSWGK WLSVLGVYEWSG NP+ PELWLLPY  P+
Sbjct  191   GIEGGDGAMHKARRWILSRGGATSIPSWGKFWLSVLGVYEWSGINPINPELWLLPYFFPL  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCH R VYLPMSYLY +R+VGP N+ +LSLR+ELY   YH +DWD ARN CAKED
Sbjct  251   HPGRMWCHTRHVYLPMSYLYSRRFVGPFNALVLSLRKELYTLPYHLLDWDQARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY+P P IQ ++W  LH+  EPLL  WPF+KLRKK L   M HI +E++ +NY CIGPVN
Sbjct  311   LYHPRPGIQKVLWGFLHHFGEPLLTHWPFSKLRKKGLNHVMQHIHYENQNSNYTCIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLN++C W+E P+S A K H+SRIKDYLW+AEDGMKM GY GSQ+WDV F+VQAI+ATN
Sbjct  371   KVLNLVCCWLENPNSEAFKCHISRIKDYLWVAEDGMKMQGYGGSQIWDVAFSVQAILATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L DEYGSMLRKA+ F+  SQ+ ++S  N    WYRH +KGGW  ST DNGW VSDCTAE 
Sbjct  431   LVDEYGSMLRKANNFLKCSQVTKNSSGN-PSHWYRHISKGGWTLSTADNGWVVSDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK +L+LS +  + VG+A+E  +L DAV+LILSLQN +GGFA+YELTRSY WLE +NP E
Sbjct  490   LKVSLLLSNLPSETVGKAMETEQLCDAVNLILSLQNRNGGFASYELTRSYAWLEKINPVE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TF EI+ID+QYVECTSAAI GL  F + +P +RR EIE CI KA  +I++IQL DGSWYG
Sbjct  550   TFEEIMIDFQYVECTSAAIQGLALFTERYPEHRRIEIETCIAKAANYIESIQLADGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+CYTYGTWFGI+GL+  G +Y+  H IR+AC+FLLSKQ  SGGWGESY+SCQ  VYT
Sbjct  610   SWGICYTYGTWFGIKGLIAAGKSYQDSHSIRRACEFLLSKQQISGGWGESYISCQQNVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNTAWAMLALIEAGQ 
Sbjct  670   NLEGNKSHLVNTAWAMLALIEAGQA  694



>ref|XP_008453521.1| PREDICTED: probable oxidosqualene cyclase [Cucumis melo]
Length=765

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/686 (68%), Positives = 559/686 (81%), Gaps = 7/686 (1%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE--KG  2040
             S NNHIGRQYW+FD NL  ++EE+ Q+QK   EF++NRFQ+KHSSDLLMR Q  KE  K 
Sbjct  13    SENNHIGRQYWKFDTNLIPSEEEKAQIQKFYNEFYRNRFQVKHSSDLLMRFQMRKENNKD  72

Query  2039  QEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
              E+ L  Q+K+ SEEEI+EEA+ +TLRRG+RFYST+Q  DG WP DYGGPLFLLP LVIG
Sbjct  73    DEVKLPTQIKITSEEEINEEAIEKTLRRGIRFYSTLQTQDGFWPGDYGGPLFLLPALVIG  132

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V +A++  L   H+ EM RY+YNHQN DGGWGLHIEG+STM CT L+YV+LR+LGEE 
Sbjct  133   LRVTKALDIALSHHHRHEMCRYLYNHQNEDGGWGLHIEGNSTMLCTVLSYVSLRLLGEEM  192

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             DG +GA++KAR+WILD GGAT+IPSWGK WLSVLGVYEW GNNPLPPE+WLLPY +P+HP
Sbjct  193   DGRDGALQKARRWILDRGGATYIPSWGKTWLSVLGVYEWEGNNPLPPEIWLLPYSLPLHP  252

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCH RM+YL MSYLYGKR+VGPI+S I+SLRRELY   YH IDW+L+RN CAKEDLY
Sbjct  253   GRMWCHSRMIYLSMSYLYGKRFVGPISSIIISLRRELYTCSYHTIDWNLSRNLCAKEDLY  312

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
              PH  IQDI+W+ +H   EPLL KWP +KLR+KAL   + HI +EDE T+Y+C+GPV+KV
Sbjct  313   TPHSKIQDILWNSIHKFGEPLLKKWPLSKLRRKALDFVIQHIHYEDENTHYLCLGPVSKV  372

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+ +S A + H+ RIKDYLWLAEDGMKM GYNGSQLWDV FAVQAI+AT+  
Sbjct  373   LNMVCCWAEDANSEAFRRHIPRIKDYLWLAEDGMKMQGYNGSQLWDVVFAVQAILATDHV  432

Query  962   DEYGSMLRKAHLFINVSQIKEDSGI---NYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             DEYGS+L+KAH FI  SQ+K +  +   N    WYRH +KGGWPFSTPDN WPVSDCTAE
Sbjct  433   DEYGSVLKKAHDFIKNSQMKRNGIMKDHNNPSVWYRHISKGGWPFSTPDNAWPVSDCTAE  492

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
             ALK A++LS+M   +VGE I+   LYDAVDLILSLQN++GGFA+YELTRSYPWLE+LNP+
Sbjct  493   ALKVAILLSQMPTTMVGEPIDVHNLYDAVDLILSLQNSNGGFASYELTRSYPWLEMLNPA  552

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             E FG+++IDYQYVECTSA I GLK F KLHPGYR+K+I+ CI+KA  FI+TIQL DGSWY
Sbjct  553   EIFGDVMIDYQYVECTSAVIQGLKAFMKLHPGYRKKDIQTCISKAAHFIETIQLSDGSWY  612

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             GSWG+CYTYGTWFGI+GLV  G TY +   IRKA  +LLSKQL SGGWGESYLS   KVY
Sbjct  613   GSWGICYTYGTWFGIKGLVASGKTYANSESIRKATQYLLSKQLKSGGWGESYLSAHHKVY  672

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQV  174
             T+++  + HIVNT+WA+LALI+A Q 
Sbjct  673   TDLKDGRSHIVNTSWALLALIQADQA  698



>dbj|BAF73930.1| cycloartenol synthase [Kandelia candel]
Length=758

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/685 (66%), Positives = 550/685 (80%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DPWLR++NNH+GRQ WEFDP+L G+ E+   ++  R  F  NRF+ +HS+DLLMR+QF K
Sbjct  11    DPWLRTINNHVGRQAWEFDPSLVGSPEDIADIENARRNFTINRFRHRHSADLLMRLQFAK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L +V V  +E ++E+AV   LRR L ++STIQAHDGHWP DYGGP+FL+P LV
Sbjct  71    ENRLPEVLPKVTVKDDERVTEQAVTVALRRTLDYFSTIQAHDGHWPGDYGGPMFLMPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LSV  A+NA+L  EHQ E+ RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE
Sbjct  131   ITLSVAGALNAILSREHQGEICRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GAM++ R WIL HGGAT I SWGK+WLSVLGV+EW GN+PLPPE+WLLPY++P+
Sbjct  191   GANDGEGAMERRRNWILTHGGATHITSWGKMWLSVLGVFEWRGNHPLPPEIWLLPYLLPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH IDW+ ARN CAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHDIDWNEARNLCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  L   +EP+L  WP  KLR+KAL   M+H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDLLWAFLDKAIEPILMHWPGKKLREKALQSVMEHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQLWD+ FAVQAI ATN
Sbjct  371   KVLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDLSFAVQAITATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  L+KAH F+  SQ+ ED   + L SWYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  431   LVEEYGPTLKKAHSFVKNSQVLEDCPGD-LNSWYRHISKGAWPFSTADHGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS+++ ++VGE +  ++LYDAV+++LSLQN  G +ATYELTRSY WLE++NP+E
Sbjct  490   LKAALLLSKISSEIVGEPLSENQLYDAVNVLLSLQNGDGSYATYELTRSYSWLEVINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+K +PG+RR+EIE CI KA  FI++IQ  DGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALVSFKKSYPGHRREEIERCIRKAAMFIESIQRADGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SW VC+TY TWFGI+GLV  G  + +C  IRKACDFLLS+Q  SGGWGESYLSCQ+KVY+
Sbjct  610   SWAVCFTYATWFGIKGLVATGKNFNNCSSIRKACDFLLSRQCASGGWGESYLSCQEKVYS  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGN+ H+VNTAWAMLALI AGQ 
Sbjct  670   NLEGNRSHVVNTAWAMLALIGAGQT  694



>gb|KHG12373.1| Cycloartenol synthase 2 [Gossypium arboreum]
Length=742

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/684 (66%), Positives = 547/684 (80%), Gaps = 19/684 (3%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR+VNNH+GRQ WEFDPNLG+ EE  +++K R  F +NRF+ KHSSDLLMR QF KE
Sbjct  11    NPWLRTVNNHVGRQIWEFDPNLGSPEELMEIEKARLNFTENRFRKKHSSDLLMRFQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L  VKV   E ++EE V  TLRR + F+S++QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPLPVVLPPVKVKESENVTEEMVTNTLRRAISFHSSVQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LS+  A+NA                  N DGGWGLHIEG STMF TAL+YVTLR+LGE 
Sbjct  131   TLSITGALNA------------------NEDGGWGLHIEGPSTMFGTALSYVTLRLLGEG  172

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM++ R WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++P+H
Sbjct  173   PNDGKGAMERGRDWILNHGGATEITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPVH  232

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+L+LR+ELY   YH+IDW+ ARN CAKEDL
Sbjct  233   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLALRKELYTIPYHEIDWNRARNACAKEDL  292

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH IVEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  293   YYPHPLVQDILWASLHKIVEPILMCWPGKKLREKALQTAIEHIHYEDENTRYICIGPVNK  352

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI++TNL
Sbjct  353   VLNMLCCWVEDPNSEAFKLHLPRLYDYLWVAEDGMKMQGYNGSQLWDTAFAVQAILSTNL  412

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY S LRKA++++  +Q+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  413   TEEYSSTLRKANMYLRNTQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGL  471

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  ++VGE +E  +LYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  472   KAVLLLSKIPPEIVGEPLEAKQLYDAVNVILSLQNGDGGFATYELTRSYPWLELINPAET  531

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRK HPG+R++EI+ CI KA  FI+ IQ PDGSWYGS
Sbjct  532   FGDIVIDYSYVECTSAAIQALVSFRKSHPGHRQEEIDQCIKKATKFIENIQAPDGSWYGS  591

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG++GLV  G  + +   I+KAC+FLLSKQLPSGGWGESYLSCQ+KVY+N
Sbjct  592   WGVCFTYGTWFGVKGLVAAGKNFNNSSSIQKACNFLLSKQLPSGGWGESYLSCQNKVYSN  651

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGNK H+VNT WAMLALI+AGQ 
Sbjct  652   VEGNKPHMVNTGWAMLALIDAGQA  675



>emb|CDX77512.1| BnaA07g06500D [Brassica napus]
Length=777

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/703 (64%), Positives = 553/703 (79%), Gaps = 19/703 (3%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D PWLR+ N H+GRQ WEFDP LGT EE   +++ R  F +NRF  KHSSDLLMR+QF  
Sbjct  10    DSPWLRTTNKHVGRQTWEFDPLLGTPEELAAIEEARNSFTQNRFSNKHSSDLLMRLQFSG  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVK+   ++++++ V  +L+RGL F+ST+QAHDGHWP DY GP+FLLP L+
Sbjct  70    ENLINSVLPQVKLEESDDVTDKIVENSLKRGLDFFSTLQAHDGHWPGDYAGPMFLLPGLI  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQ------------------NIDGGWGLHIEGH  1743
             I LS+  A+N VL E+H+ EM RY+YNHQ                  N DGGWGLHIEGH
Sbjct  130   ITLSITGAMNTVLSEQHKLEMCRYLYNHQARHGIFPFLFYLLSHIIYNEDGGWGLHIEGH  189

Query  1742  STMFCTALNYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWS  1563
             STMF + LNYVTLR+LG+  D G+GAM+K R WIL+HGGAT I SWGKLWLSVLG +EWS
Sbjct  190   STMFMSVLNYVTLRLLGQGPDDGDGAMEKGRDWILNHGGATHITSWGKLWLSVLGAFEWS  249

Query  1562  GNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNH  1383
             GNNPLPPE+WLLPY +PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI ST+L+LR+EL++ 
Sbjct  250   GNNPLPPEIWLLPYFLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLALRKELFSV  309

Query  1382  DYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMD  1203
              Y  IDW+ AR  CAKEDLYYPHP +QDI+W  LH +VEP+L++WP   LR+KAL   ++
Sbjct  310   PYEDIDWNQARTLCAKEDLYYPHPLVQDILWASLHKVVEPVLSRWPGTILREKALRTTLE  369

Query  1202  HIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYN  1023
             HI +EDE T Y+CIGPVNKVLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYN
Sbjct  370   HIHYEDENTRYICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRIHDYLWLAEDGMKMQGYN  429

Query  1022  GSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGW  843
             GSQLWD GFAVQAI+ATN  +EYG +L+KAH F+  SQ+ ED   + L  WYRH +KG W
Sbjct  430   GSQLWDAGFAVQAILATNFVEEYGPVLKKAHSFVKNSQVLEDCPGD-LSYWYRHISKGAW  488

Query  842   PFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFA  663
             PFST D+GWP+SDCTAE LKA L+LS++  ++VGE ++ +R+YDAV++++SLQN  GG A
Sbjct  489   PFSTADHGWPISDCTAEGLKATLLLSKVPKEIVGEPLDTNRIYDAVNVLISLQNADGGVA  548

Query  662   TYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACIN  483
             TYELTRSYPWLE++NPSETFG+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI 
Sbjct  549   TYELTRSYPWLELINPSETFGDIVIDYPYVECTSAAIQALVAFRKLYPGHRKKDVDECIE  608

Query  482   KALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQL  303
             KA+ FI++ Q  DGSWYGSW VC+TYG WFG++GL   G T ++   + KAC+FLLSKQL
Sbjct  609   KAVKFIESSQATDGSWYGSWAVCFTYGAWFGVKGLEAVGKTLKNSPAVAKACEFLLSKQL  668

Query  302   PSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             PSGGWGESYLSCQDKVYT I+GNK H+VNT+WA+LALI AGQ 
Sbjct  669   PSGGWGESYLSCQDKVYTGIKGNKSHVVNTSWALLALIGAGQA  711



>sp|E2IUB0.1|CASS_KALDA RecName: Full=Cycloartenol synthase; Short=KdCAS [Kalanchoe daigremontiana]
 gb|ADK35127.1| cycloartenol synthase [Kalanchoe daigremontiana]
Length=764

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/682 (66%), Positives = 544/682 (80%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLRSVNNHIGRQ W+FDP LG+ EE  Q++  R  F ++RF  KHS+DLLMR Q  KE  
Sbjct  14    WLRSVNNHIGRQIWDFDPALGSPEELAQIEDARDNFARHRFDKKHSADLLMRFQLTKENP  73

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
             Q   L +V +G  E+I+E+AV  TLRR + F+ST QAHDGHWP DYGGPLFL+P LVI L
Sbjct  74    QSDLLPKVNIGKIEDITEDAVTNTLRRAINFHSTTQAHDGHWPGDYGGPLFLMPGLVITL  133

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EH+KEM RY+YNHQN DGGWGLHIEG STMF + LNYVTLR+LGE+ +
Sbjct  134   SITGALNAVLSKEHKKEMCRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEDVN  193

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+G +++ARKWILDHGGAT I SWGK+WLSVLGV+EW GNNPLPPE+WL PY +P+HPG
Sbjct  194   GGDGEIERARKWILDHGGATAITSWGKMWLSVLGVFEWCGNNPLPPEMWLFPYYLPVHPG  253

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ AR+ CAKEDLYY
Sbjct  254   RMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTVPYHEIDWNEARSLCAKEDLYY  313

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH +VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKVL
Sbjct  314   PHPVVQDILWATLHKVVEPVLLNWPGKKLREKALCSAIEHIHYEDENTRYICIGPVNKVL  373

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F+VQAI+AT L +
Sbjct  374   NMLCCWVEDPNSEAFKLHIPRLYDYLWIAEDGMKMQGYNGSQLWDTAFSVQAIVATKLVE  433

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E+ S + KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK 
Sbjct  434   EFSSTISKAHEFMKNSQVLEDYPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGLKV  492

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L LS+   ++VG  +    +Y+AV++ILSLQN  GGFATYELTRSY W+E+LNP+ETFG
Sbjct  493   VLKLSQFPAELVGAPLSAKLVYNAVNVILSLQNIDGGFATYELTRSYSWMELLNPAETFG  552

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAA+  L  F+KLHP +R++E+E CI KA  FI+ IQ  DGSWYGSW 
Sbjct  553   DIVIDYPYVECTSAALQSLVLFKKLHPEHRKEEVELCIKKAAAFIEKIQESDGSWYGSWA  612

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYGTWFG+ GLV  G  Y++   IRKACDFLLSKQL SGGWGESYLSCQ+KVYTNI 
Sbjct  613   VCFTYGTWFGVLGLVAAGRNYKNSPSIRKACDFLLSKQLASGGWGESYLSCQNKVYTNIP  672

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             G + H+VNT WAMLALI AGQ 
Sbjct  673   GGRSHVVNTGWAMLALIGAGQA  694



>gb|AGF87141.1| cycloartenol synthase [Paris polyphylla var. yunnanensis]
Length=759

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/682 (66%), Positives = 549/682 (80%), Gaps = 2/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLR+ N H+GRQ WEFDPNLGT EE + V+K R EF ++RF+ KHS+DLLMRMQ  KE  
Sbjct  13    WLRTNNKHVGRQTWEFDPNLGTPEEIEAVEKARREFTEHRFEKKHSADLLMRMQLAKENP  72

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
              E+ L + K    E+++EEAV+ TLRR +  +ST+QAHDGHWP DYGGP+FL+P L+I L
Sbjct  73    VEINLPRTKFEEHEDVTEEAVLTTLRRAITRHSTLQAHDGHWPGDYGGPMFLMPGLIIAL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              VM AIN VL  EH++E+ RYIYNHQN DGGWGLHIEG STMF ++L YVTLR+LGE  +
Sbjct  133   YVMGAINTVLSLEHRREICRYIYNHQNKDGGWGLHIEGQSTMFGSSLTYVTLRLLGEGAE  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G+GA++K RKWILDHGGAT I SWGK WLSVLGV++WSGNNPLPPE+WLLPY +P+HPG
Sbjct  193   CGDGALZKGRKWILDHGGATAITSWGKFWLSVLGVFDWSGNNPLPPEMWLLPYFLPVHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKRYVGPI  TIL LR+E++   Y++IDW+LARN+CAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGKRYVGPITPTILELRKEIFIQPYNKIDWNLARNECAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQDI+W  LH + EP+L  WP +KLR KALT A+ HI +EDE T Y+CIG VNKVL
Sbjct  313   PHPMIQDILWASLHKVAEPILLHWPGSKLRGKALTTAIQHIHYEDENTRYICIGAVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P+S   K+HL RI DYLW+AEDGMKM GYNGSQLWD  F V AI+AT+L +
Sbjct  373   NMLCCWVEDPNSETFKLHLPRIFDYLWIAEDGMKMQGYNGSQLWDTAFTV-AILATDLSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E+G  L+KAH +I  +Q+  D+    L  WYRH +KG WPFST D+GWPVSDCTAE LKA
Sbjct  432   EFGPPLKKAHDYIKNTQVL-DNCPGDLSFWYRHISKGAWPFSTADHGWPVSDCTAEGLKA  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LSR++   VG+ I+   L +AV+ ILSL N  GGF+ YELTRSY WLE++NP+ETFG
Sbjct  491   ALLLSRISPKSVGDPIDAKWLNEAVNAILSLMNKDGGFSPYELTRSYAWLELINPAETFG  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSA+I  L  F+KL+PG+RR+EIE+CI KA  FI++IQ PDGSWYGSW 
Sbjct  551   DIVIDYPYVECTSASIQALTSFKKLYPGHRREEIESCIKKAAHFIESIQRPDGSWYGSWA  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFG+ GL+  G TY++   IRKACDFLLSKQLPSGGWGESYLSCQDKVYTN+E
Sbjct  611   VCFTYGIWFGVLGLIAAGRTYKNSSTIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNLE  670

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             GN++H VNT WAML LI+AGQ 
Sbjct  671   GNRYHAVNTGWAMLTLIDAGQA  692



>ref|XP_006403308.1| hypothetical protein EUTSA_v10003155mg [Eutrema salsugineum]
 gb|ESQ44761.1| hypothetical protein EUTSA_v10003155mg [Eutrema salsugineum]
Length=759

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/683 (66%), Positives = 552/683 (81%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNHIGRQ+WEFDP LGT EE   +++ R  F +NR   KHSSDLLMR+QF +  
Sbjct  12    PWLRTTNNHIGRQFWEFDPKLGTPEELADIEEARKSFTENRLVKKHSSDLLMRLQFSRVH  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QV +   ++++E+ V  TL+RG+ FYSTIQA DGHWP DYGGP+FLLP L+I 
Sbjct  72    LVSPALPQVIIKDSDDVTEKMVENTLKRGVDFYSTIQADDGHWPGDYGGPMFLLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+N VL E+H++EM RYIYNHQN DGGWGLHIEGHSTMF + LNYVTLR+LGE  
Sbjct  132   LSITGALNTVLSEQHKQEMRRYIYNHQNEDGGWGLHIEGHSTMFGSVLNYVTLRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G+GAM+K R+WIL+HGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +PIHP
Sbjct  192   NDGDGAMEKGREWILNHGGATNITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI ST+LSLR+EL+   YH+I+WD ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITSTVLSLRKELFTVPYHEINWDEARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH IVEP+L +WP  KLR+KA+   ++HI +EDE T Y+CIGP+NKV
Sbjct  312   YPHPLVQDILWGSLHKIVEPVLMRWPGAKLREKAVRTTLEHIHYEDENTRYICIGPLNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  +AVQA++ATNL 
Sbjct  372   LNMLCCWVEDPNSEAYKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTSYAVQALLATNLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EY  +L+KAH ++  SQ+ ED   + L  WY H +KGGWPFST D+GW V DCTAE LK
Sbjct  432   EEYVPVLKKAHSYVKNSQVLEDFPGD-LSYWYHHISKGGWPFSTADHGWHVPDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
              AL+LS+   ++VGE ++ +RLYDAV++++SLQN  GG  TYELTRSYPWLE++NP+ETF
Sbjct  491   VALLLSKFPKEIVGEPLDSNRLYDAVNVLISLQNADGGLGTYELTRSYPWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY Y+ECTSAA+  L  FRKL+PG+R+K+I+  I KA+ FI++ Q  DGSWYGSW
Sbjct  551   GDIVIDYPYMECTSAAVQALVAFRKLYPGHRKKDIDEFIEKAVKFIESNQAADGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYGTWFG++GLV  G T ++   + KAC+FLLSKQL SGGWGE YLSCQDKVY+N+
Sbjct  611   GVCFTYGTWFGVKGLVAVGKTLKNSPNVAKACEFLLSKQLLSGGWGEIYLSCQDKVYSNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             EGNK HIVNTAWA+LALI AGQ 
Sbjct  671   EGNKSHIVNTAWALLALIGAGQA  693



>ref|XP_004166391.1| PREDICTED: LOW QUALITY PROTEIN: probable oxidosqualene cyclase-like 
[Cucumis sativus]
Length=760

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/688 (67%), Positives = 561/688 (82%), Gaps = 6/688 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             W  S N+H+GRQYW+FD NL  ++EE+ Q+QK   EF++NRF+ KHSSDLLMR Q  KE 
Sbjct  10    WETSENDHVGRQYWKFDTNLTPSEEEKAQIQKFCNEFYRNRFRAKHSSDLLMRFQLRKEN  69

Query  2042  -GQEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
              G E+ L +Q+K+ SEEEI+EEA+ +TLRRG+RFYST+Q  DG WP DYGGPLFLLP LV
Sbjct  70    NGDEVKLPRQIKLRSEEEINEEAIEKTLRRGIRFYSTLQTQDGFWPGDYGGPLFLLPALV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGLSV +A++  +   H+ EM RY+YNHQN DGGWGLHIEG+STM CTAL+YV+LR+LGE
Sbjct  130   IGLSVTKALDVAISCHHRYEMCRYLYNHQNEDGGWGLHIEGNSTMLCTALSYVSLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             + DG +GA+ KAR+WILD GGAT IPSWGK WLSVLGVYEW GNNPLPPE+WL PY +P+
Sbjct  190   KMDGRDGALLKARRWILDRGGATSIPSWGKTWLSVLGVYEWEGNNPLPPEMWLFPYSLPL  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCH RM+YLPMSYLYGKR+VG I+S ILSLRRELY   YH+IDW+L+RN CAKED
Sbjct  250   HPGRMWCHSRMIYLPMSYLYGKRFVGSISSIILSLRRELYTCPYHKIDWNLSRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY PH  IQD++W+ +H   EPLL KWP +KLR+KAL   + HI +EDE T+Y+C+GPV+
Sbjct  310   LYTPHSKIQDVLWNSIHKFGEPLLKKWPLSKLRQKALDFVIQHIHYEDENTHYLCLGPVS  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A + H+ R+KDYLWLAEDGMKM GYNGSQLWDV FAVQAI+AT+
Sbjct  370   KVLNMVCCWVEDPNSEAFRRHIPRVKDYLWLAEDGMKMQGYNGSQLWDVVFAVQAILATD  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGI---NYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             L DEYGS+L+KAH FI  + +++ +GI   N    WYRH +KGGWPFSTPDN WPVSDCT
Sbjct  430   LVDEYGSVLKKAHNFIKFTSMRKRNGIKDDNNPSIWYRHISKGGWPFSTPDNAWPVSDCT  489

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AEALK A++LS+M   +VGE I+   LYDAVDLILSLQN++GGFA+YELTRSYPWLE+LN
Sbjct  490   AEALKVAILLSQMPTTMVGEPIDVHNLYDAVDLILSLQNSNGGFASYELTRSYPWLEMLN  549

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+E F +++IDYQYVECTSA I GLK F KLHPGYR+K+I+ CI+KA  FI+TIQL DGS
Sbjct  550   PAEIFADVMIDYQYVECTSAVIQGLKAFMKLHPGYRKKDIQTCISKAAHFIETIQLSDGS  609

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWG+CYTYGTWFGI+GLV  G TY +   IRKA  FLLSKQL SGGWGESYLS   K
Sbjct  610   WYGSWGICYTYGTWFGIKGLVASGRTYANSECIRKATQFLLSKQLKSGGWGESYLSAHHK  669

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYT+++  K HIVNT+W +LALI+  Q 
Sbjct  670   VYTDLKDGKSHIVNTSWVLLALIQTDQA  697



>sp|Q6BE23.1|OXSC_CUCPE RecName: Full=Probable oxidosqualene cyclase [Cucurbita pepo]
 dbj|BAD34646.1| putative oxidosqualene cyclase [Cucurbita pepo]
Length=759

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/685 (67%), Positives = 563/685 (82%), Gaps = 3/685 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             W  S N H+GRQ+WEFDPNL  + EE+ +V  +  +F+ +RFQ KHSSDLLMR+Q +K  
Sbjct  10    WETSDNAHLGRQFWEFDPNLQPSLEEQARVHNVCNDFYTHRFQAKHSSDLLMRLQLKKAN  69

Query  2042  GQEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
             G E+ L  QVK+ SEEE+SEEAV  TLRR +RFYST+Q  DG WP DY GPLFLLP LVI
Sbjct  70    GSEVKLPTQVKLRSEEEMSEEAVETTLRRAIRFYSTMQTQDGFWPGDYAGPLFLLPGLVI  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
             GLSV +A++ VL   HQ+EM RY+YNHQN DGGWGLHIEG+STM CTAL+YV+LR+LGEE
Sbjct  130   GLSVTKALDTVLSRHHQQEMRRYLYNHQNEDGGWGLHIEGNSTMLCTALSYVSLRLLGEE  189

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG +GA+++AR+WILD GGAT IPSWGKLWLSVLGVYEW GNNPLPPE+WLLPY +P+H
Sbjct  190   MDGCDGALRQARRWILDRGGATSIPSWGKLWLSVLGVYEWEGNNPLPPEIWLLPYFLPLH  249

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCH RMVYLPMSYLYGKR+VGPI+  I SLR+ELY   YH IDW+L+R+ CAKEDL
Sbjct  250   PGRMWCHSRMVYLPMSYLYGKRFVGPISPIITSLRQELYTSPYHMIDWNLSRSLCAKEDL  309

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             Y PH  IQD++WD +H + EPLL KWP +KLR+KAL   + HI +EDE T+Y+C+GPV+K
Sbjct  310   YTPHSKIQDMLWDSIHKLGEPLLKKWPLSKLRQKALDFVIKHIHYEDENTHYLCLGPVSK  369

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             V+NM+C W E+P+S A   H+SRIKDYLWLAEDGMKM GY+GSQLWDV FA+QAI+AT+L
Sbjct  370   VVNMVCCWDEDPNSEAFTRHISRIKDYLWLAEDGMKMQGYHGSQLWDVAFAIQAIVATDL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDS-GINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
              +EYGS+L+KAH F+  SQ++ +  G +    WYRH++KGGWPFSTPDN WPVSDCT+EA
Sbjct  430   VEEYGSVLKKAHDFVKNSQVRRNGFGDDDPSDWYRHNSKGGWPFSTPDNAWPVSDCTSEA  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK A+M+S+M   +VGE ++  +LYDAVDLILSLQN++GGFA+YELTRS+PWLE LNP+E
Sbjct  490   LKVAIMMSQMPPTMVGEPMDIRKLYDAVDLILSLQNSNGGFASYELTRSHPWLETLNPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
              FG+++IDYQYVEC+SAAI  LK F KLHP YR+KEI+AC+ KA  FI+TIQ PDGSWYG
Sbjct  550   IFGDVMIDYQYVECSSAAIERLKAFMKLHPSYRKKEIQACMAKAADFIETIQQPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+CYTYGTWFGI+GLV  G TYE+   +RKA  FLLSKQL SGGWGESYLS  +KVYT
Sbjct  610   SWGICYTYGTWFGIKGLVACGRTYENSKTLRKATHFLLSKQLKSGGWGESYLSAHNKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             +++  K HIVNT+WA+LALI+AGQ 
Sbjct  670   DLKNGKSHIVNTSWALLALIKAGQA  694



>ref|XP_006474653.1| PREDICTED: cycloartenol Synthase-like [Citrus sinensis]
Length=727

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/687 (69%), Positives = 547/687 (80%), Gaps = 43/687 (6%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWL S+NNHIGRQ+WEFDPNLGT EERQQV KLR +F +NRF  KHSSDLLMR+QF KE
Sbjct  14    DPWLTSLNNHIGRQFWEFDPNLGTPEERQQVNKLRNDFTENRFLTKHSSDLLMRLQFAKE  73

Query  2045  KGQEMG-LQQVKVGSEEEISEEAVVRT-LRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
                EM  L QVKV  +EEIS+E VV T LRR LRFYS++QA DG WP DYGGPLFLLP L
Sbjct  74    NACEMKQLPQVKVKDDEEISDEQVVSTTLRRALRFYSSLQAEDGFWPGDYGGPLFLLPGL  133

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             V+GL V  A+NA+L  EH++EM+RY+YNHQN DGGWGLHIEG STMFCTAL+YVTLR+LG
Sbjct  134   VMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCSTMFCTALSYVTLRLLG  193

Query  1691  EERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             E  DGG+ GAM+KARKWILD GG T IPSWGK+WLSVLGVYEWSGNNPLPPE+WLLPY +
Sbjct  194   ETMDGGDDGAMEKARKWILDRGGVTSIPSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYFL  253

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P HPG                       P                   IDWD ARN CAK
Sbjct  254   PFHPG---------------------CSP------------------DIDWDHARNLCAK  274

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP IQDI+W  LH I EPL+ KWPF+KLR  AL   M HI +EDE T Y+CIGP
Sbjct  275   EDLYYPHPMIQDILWGCLHKIGEPLVMKWPFSKLRHNALKTVMQHIHYEDENTQYICIGP  334

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNMIC W+E+P+S A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV FAVQAI+A
Sbjct  335   VNKVLNMICCWVEDPNSEAYKRHLSRIKDYLWIAEDGMKMQGYNGSQLWDVTFAVQAILA  394

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             T+L DEYGS L KA  F+  +Q++ED   + L  WYRH +KGGWPFSTPDNGWPVSDCTA
Sbjct  395   TDLVDEYGSTLVKAFSFLKNTQVREDCTGD-LNYWYRHISKGGWPFSTPDNGWPVSDCTA  453

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LKAA++LS++  D+VG AI+ ++LYDAV++ILSLQN++GGFA+YELTRSYPWLE++NP
Sbjct  454   EGLKAAILLSQLPSDIVGVAIQENQLYDAVNVILSLQNSTGGFASYELTRSYPWLEMINP  513

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETFG+IIIDYQYVECTSAAI GLK F K +PG+RRKEIEA I KA+ FI++ Q PDGSW
Sbjct  514   AETFGDIIIDYQYVECTSAAIQGLKSFMKSYPGHRRKEIEASIEKAIEFIESKQQPDGSW  573

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVC+TYGTWFGI+GLV  G TYE+ + IRKACDFLLSKQL SGGWGESYLSCQ+KV
Sbjct  574   YGSWGVCFTYGTWFGIKGLVACGMTYENSNSIRKACDFLLSKQLDSGGWGESYLSCQNKV  633

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN+EGNK H+VNTAWAM++LIEAGQ 
Sbjct  634   YTNLEGNKSHLVNTAWAMISLIEAGQA  660



>ref|XP_002877385.1| hypothetical protein ARALYDRAFT_905658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53644.1| hypothetical protein ARALYDRAFT_905658 [Arabidopsis lyrata subsp. 
lyrata]
Length=758

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/701 (67%), Positives = 546/701 (78%), Gaps = 9/701 (1%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ-E  2034
             SVN H+GRQ+WE+D   GT EER  +  LR  F  NRF  KHSSDLL R Q  KE+G+ +
Sbjct  13    SVNQHVGRQFWEYDNQFGTSEERHHIADLRGNFTLNRFSSKHSSDLLYRFQCWKEEGKGK  72

Query  2033  MGLQQVKVGSEEEISEEAVVR--TLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               L QVKV    E      V   TLRR LRFYST+Q+ DG WP DYGGPLFL P LVI L
Sbjct  73    ERLPQVKVKEGGEGEINEEVVNVTLRRSLRFYSTLQSQDGFWPGDYGGPLFLSPALVISL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V E ++A L  +HQ E+ RY+YNHQN DGGWGLHIEG STMFCTAL+YV LR++GEE D
Sbjct  133   YVTEVLDATLTAQHQMEIRRYLYNHQNKDGGWGLHIEGSSTMFCTALSYVALRLMGEEMD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+GAM+ AR WI   GGATF+PSWGK WLSVLG YEWSGNNPLPPELWLLPY +P HPG
Sbjct  193   GGDGAMESARLWIHHRGGATFVPSWGKFWLSVLGAYEWSGNNPLPPELWLLPYSLPFHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+V   N TILSLRRELY   YH IDWD ARNQCAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGRRFVCRTNGTILSLRRELYTVPYHHIDWDTARNQCAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  L+   EPLL +WP NKLR +AL   M HIQ+ED+ ++Y+CIGPVNKVL
Sbjct  313   PHPKIQDVLWSCLNKFGEPLLERWPLNKLRSRALQTVMQHIQYEDQNSHYICIGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             N++C W++  +S A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ATNL D
Sbjct  373   NLLCCWVDSSNSEAFKSHLSRIKDYLWVAEDGMKMQGYNGSQLWDVTLAVQAILATNLVD  432

Query  959   EYGSMLRKAHLFINVSQIKEDS-GINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             EY  ML++AH +I  +QI++D+ G   L  WYRH  KGGW FST DN WPVSDCTAEALK
Sbjct  433   EYDLMLKRAHNYIKNTQIRKDTCGDPGL--WYRHPCKGGWGFSTADNPWPVSDCTAEALK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS++  D+VGEA+    L+DAVD ILSLQNN+GGFA+YELTRSYP LE++NPSETF
Sbjct  491   ASLLLSQIPVDLVGEAMPEEHLFDAVDFILSLQNNNGGFASYELTRSYPALEVINPSETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+IIIDYQYVECTSAAI GL  F  ++P Y+RKEI  CINKA+ FI+  QLPDGSWYGSW
Sbjct  551   GDIIIDYQYVECTSAAIQGLALFTTINPTYKRKEILICINKAVEFIEKTQLPDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TY TWFGI+G++  G TYE+   IRKAC FLLSKQL  GGWGESYLSCQ+KVYTN+
Sbjct  611   GVCFTYATWFGIKGMLAAGKTYETSLCIRKACGFLLSKQLCCGGWGESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFINNH  129
              GNK HIVNT+WA+LALIEAGQ    ++ +  G K  IN+ 
Sbjct  671   PGNKSHIVNTSWAVLALIEAGQANRDLMPLHRGAKSLINSQ  711



>ref|XP_010655242.1| PREDICTED: cycloartenol synthase-like [Vitis vinifera]
Length=758

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/685 (68%), Positives = 546/685 (80%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFDP+ GT +ER +V+  R  F KNRFQ+K SSDLL RMQF +
Sbjct  11    NDPYIDSTNNFVGRQIWEFDPDYGTPDERAEVEAARENFWKNRFQVKLSSDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRRGL FYSTIQAHDGHWP D GGP+FLLP LV
Sbjct  71    ENPCVTNLPQIKVQDLEEVTEEVVTTTLRRGLNFYSTIQAHDGHWPGDCGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V  A++ VL  E Q+EM RY+ NHQN DGGWGLHIEG STMF T LNYVTLR+LGE
Sbjct  131   ITLYVTGALHVVLSIEQQREMCRYLCNHQNEDGGWGLHIEGPSTMFGTVLNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+K +KWILDHGGAT I SWGK+WLSVLG YEW G NPLPPE+WL PYI+P+
Sbjct  191   ADFGAKGAMEKGQKWILDHGGATAITSWGKMWLSVLGAYEWFGTNPLPPEMWLCPYILPV  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGK++VGPI STI+SLR+ELY   YH++DW+ ARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYLYGKKFVGPITSTIISLRKELYIVPYHEVDWNQARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH ++EP+L  WP N LR+KAL   M H+ +EDE T Y+C+GPVN
Sbjct  311   LYYPHPLVQDILWASLHKVLEPILGHWPGNNLREKALCTVMQHVHYEDENTRYICLGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM GY+GSQLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIFDYLWIAEDGMKMQGYSGSQLWDTSFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KG WPFST D GWP+SDCTAE 
Sbjct  431   LGEEYGLTLRKAHEFIKNSQVLEDCPGD-LKFWYRHISKGAWPFSTADQGWPISDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  + VGE ++   L DAV++ILSLQN  GGFATYELTRSY W+E++NP+E
Sbjct  490   LKAVLLLSKLPVETVGEPLDMKHLSDAVNVILSLQNADGGFATYELTRSYRWVELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALTSFKKLYPEHRRHEIENCISKAAKFIEEIQAPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
              WGVC+TYG WFGI GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ+KVYT
Sbjct  610   CWGVCFTYGGWFGITGLIAAGNTYSNCPCIRKACDYLLSKELASGGWGESYLSCQNKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G+K HIVNTAWAMLALIEAGQ 
Sbjct  670   NLPGDKPHIVNTAWAMLALIEAGQA  694



>ref|XP_010520562.1| PREDICTED: lanosterol synthase isoform X2 [Tarenaya hassleriana]
Length=761

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/698 (66%), Positives = 552/698 (79%), Gaps = 5/698 (1%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQEM  2031
             SVN ++GRQ+WEFD   G+ ++ + + +LR  F   RF+ KHSSDLL R Q  +EKG+ M
Sbjct  15    SVNGNLGRQFWEFDERFGSPQDIKHISELRRNFTIGRFRSKHSSDLLFRFQMLREKGKPM  74

Query  2030  -GLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLSV  1854
               L QV+V  E   +EE V   LR  LR+YS +Q+ DG WP DYGGPLFLLP L+IGL V
Sbjct  75    EKLPQVRVKEEGAGNEEVVSVALRGALRYYSALQSDDGFWPGDYGGPLFLLPPLIIGLYV  134

Query  1853  MEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGG  1674
               A++  L ++HQ EM RY+YNHQN DGGWGLHIEG+STMFCT L+YV LR++GEE DGG
Sbjct  135   TGALDKTLTQQHQMEMRRYLYNHQNEDGGWGLHIEGNSTMFCTVLSYVALRLMGEEMDGG  194

Query  1673  NGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRM  1494
             +GAM+ +R+WI  HGGAT++PSWGKLWLSVLGVYEWSGNNPLPPELWLLP ++P HPGRM
Sbjct  195   DGAMEMSRRWIHGHGGATYVPSWGKLWLSVLGVYEWSGNNPLPPELWLLPDLLPFHPGRM  254

Query  1493  WCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPH  1314
             WCHCRMVYLPMSYLYGKRYV  +N  +LSLRRELY   YH IDWD+ARN CAKEDLYYPH
Sbjct  255   WCHCRMVYLPMSYLYGKRYVCRVNGVVLSLRRELYTVPYHHIDWDIARNLCAKEDLYYPH  314

Query  1313  PAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNM  1134
             P IQD++W  L NI EPLL +WP +KLR +AL   MDHI++ED  T Y+C+GPV+KVLNM
Sbjct  315   PMIQDMLWWSLKNITEPLLGRWPLSKLRNRALQTVMDHIRYEDRNTRYICLGPVSKVLNM  374

Query  1133  ICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEY  954
             +C W+E+P S   K HLSR+KDYLW+AEDGMKM GYNGSQLWDV FAVQAI+ATNL DEY
Sbjct  375   VCCWVEDPSSEEFKRHLSRVKDYLWIAEDGMKMQGYNGSQLWDVAFAVQAILATNLVDEY  434

Query  953   GSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAAL  774
             GS LRK++ +I  +QI+E++  N   +WYRH  KGGW FST DN WPVSDCTAEALK+AL
Sbjct  435   GSTLRKSNEYIKNTQIRENTYGN-PAAWYRHPCKGGWGFSTADNPWPVSDCTAEALKSAL  493

Query  773   MLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGEI  594
             +L +M   +VGEA+     +DAV+ ILSLQN++GGFA+YELTRSYPWLE++NPSETFG+I
Sbjct  494   LLWKMPRQLVGEAMAEEHFFDAVNFILSLQNSNGGFASYELTRSYPWLEVINPSETFGDI  553

Query  593   IIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVC  414
             IIDYQYVECTSAAI GL+ F KL PGYR+ EIE CI KA+ FI+  QLPDGSWYGSWGVC
Sbjct  554   IIDYQYVECTSAAIQGLELFTKLFPGYRKMEIEKCIRKAVEFIEKTQLPDGSWYGSWGVC  613

Query  413   YTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGN  234
             +TY TWFGI+ L+  G  YE+ + IRKAC FLLS+QL SGGWGESYLSCQ+K YTN+ GN
Sbjct  614   FTYATWFGIKALLAAGKVYETSNCIRKACRFLLSRQLSSGGWGESYLSCQNKEYTNLPGN  673

Query  233   KWHIVNTAWAMLALIEAGQVI---L*IKVGDKIFINNH  129
             + H+VNT+WAMLALIEAGQ       +  G K+ IN+ 
Sbjct  674   RPHLVNTSWAMLALIEAGQASRDWTPLHRGAKLLINSQ  711



>ref|XP_006408625.1| hypothetical protein EUTSA_v10001913mg [Eutrema salsugineum]
 gb|ESQ50078.1| hypothetical protein EUTSA_v10001913mg [Eutrema salsugineum]
Length=759

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/705 (67%), Positives = 551/705 (78%), Gaps = 16/705 (2%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ-E  2034
             SVN H+GRQ+WE+D   GT EER  +  LRA F  NRF+ KHSSDLL R Q  KE G+ +
Sbjct  13    SVNQHVGRQFWEYDDKFGTSEERHHISDLRANFTLNRFRFKHSSDLLYRFQCSKENGRGK  72

Query  2033  MGLQQVKVGSEEEISEEAVVR---TLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               L QVKV   +E  E +      TL+R LRFYST+Q+ DG WP DYGGPLFLLP LVIG
Sbjct  73    ERLPQVKVKEGKEEEETSEEVVNETLKRSLRFYSTLQSKDGFWPGDYGGPLFLLPDLVIG  132

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V EA++A L  +HQ E+ RY+YNHQN DGGWGLHIEG STMFCTAL+YV LR++GEE 
Sbjct  133   LYVTEALDATLTTQHQIEIRRYLYNHQNKDGGWGLHIEGSSTMFCTALSYVALRLMGEEM  192

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             DGGNGAM  AR WI  HGGATF PSWGKLWLSVLGVYEWSGNNPLPPELWLLPY +  HP
Sbjct  193   DGGNGAMDTARGWIHHHGGATFTPSWGKLWLSVLGVYEWSGNNPLPPELWLLPYTLLFHP  252

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYG+R+V  IN TILS+RRELY   YH IDWD ARNQCAKEDLY
Sbjct  253   GRMWCHCRMVYLPMSYLYGRRFVCRINGTILSIRRELYIVPYHHIDWDTARNQCAKEDLY  312

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP IQDI+W  L    EPLL +WPF+KLR +AL   M HI +ED+ ++Y+CIGPVNKV
Sbjct  313   YPHPKIQDIMWSCLKKFGEPLLERWPFSKLRNRALQTVMQHIHYEDQNSHYICIGPVNKV  372

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E PDS A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ATNL 
Sbjct  373   LNMVCCWVEAPDSNAFKCHLSRIKDYLWVAEDGMKMQGYNGSQLWDVTLAVQAILATNLV  432

Query  962   DEYGSMLRKAHLFINVSQIKE----DSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             DEYG ML KAH +I  SQ+++    D G+     WYRH +KGGW FST DN WPVSDCTA
Sbjct  433   DEYGMMLNKAHTYIKNSQLRKNTCGDPGL-----WYRHPSKGGWGFSTADNPWPVSDCTA  487

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             EALKA L+L ++  ++VGEA+    L+DAV+ ILSLQN++GGFA+YELTRSYPWLE++NP
Sbjct  488   EALKATLLLMQLPVNMVGEAMPEEHLFDAVNFILSLQNDNGGFASYELTRSYPWLEVINP  547

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             SETFG+IIIDYQYVECTSAAI GL  F K++  Y+ KEI  CINKA+ FI+  QLPDGSW
Sbjct  548   SETFGDIIIDYQYVECTSAAIQGLALFTKINSRYKTKEILRCINKAVGFIEKTQLPDGSW  607

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YGSWGVC+TY TWFGI+G++  G TY++   IRKAC+F LSKQL  GGWGESYLSCQ+KV
Sbjct  608   YGSWGVCFTYATWFGIKGMLAAGKTYKTNICIRKACEFFLSKQLSCGGWGESYLSCQNKV  667

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQVI---L*IKVGDKIFINNH  129
             YTN+ GN+ +IVNT+WA+LALIEAGQ     + +  G K+ IN+ 
Sbjct  668   YTNLPGNRSNIVNTSWAVLALIEAGQATRDPIPLHRGAKLLINSQ  712



>ref|XP_002310905.1| hypothetical protein POPTR_0007s15200g [Populus trichocarpa]
 gb|EEE91355.1| hypothetical protein POPTR_0007s15200g [Populus trichocarpa]
Length=763

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/682 (67%), Positives = 547/682 (80%), Gaps = 2/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF P LG+ +E  Q+Q +R  F   RF  KHS+DLLMR QFEKE  
Sbjct  20    WLKSVNNHLGRQVWEFCPQLGSPDELLQLQNVRLSFQAQRFDKKHSADLLMRFQFEKENP  79

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E+++EEAV  TLRR + FY  IQAHDGHWP DYGGP+FLLP L+I L
Sbjct  80    C-VNLPQIKVKDDEDVTEEAVTTTLRRAVNFYRKIQAHDGHWPGDYGGPMFLLPGLIITL  138

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE  +
Sbjct  139   SITGALNAVLSKEHQREMCRYLYNHQNRDGGWGLHIEGPSTMFGTCLNYVTLRLLGEGAE  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+G M+K RKWILDHGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WL PY++P+HPG
Sbjct  199   GGDGEMEKGRKWILDHGGATEITSWGKMWLSVLGVHEWSGNNPLPPEVWLCPYLLPMHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+E+Y   YH++DW+ ARN CAKEDLYY
Sbjct  259   RMWCHCRMVYLPMSYLYGKRFVGPITPTIQSLRKEIYTVPYHEVDWNTARNTCAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH   EP+L +WP N+LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  319   PHPLVQDILWASLHYAYEPILTRWPLNRLREKALHKVMQHIHYEDENTQYICIGPVNKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+HL R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI++TNL +
Sbjct  379   NMLCCWVEDPHSEAFKLHLPRVFDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIVSTNLAE  438

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EY   LRKAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  439   EYSGTLRKAHKYLKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  497

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG+ +   RL DAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  498   VLLLSKLPTEMVGDPLGVERLRDAVNVILSLQNADGGFATYELTRSYQWLELINPAETFG  557

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL+PG+RR+EI+ CI +A  FI+ IQ  DGSWYGSWG
Sbjct  558   DIVIDYPYVECTSAAIQALASFKKLYPGHRREEIDNCIAEAANFIEKIQATDGSWYGSWG  617

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GLV  G TY S   IRKACD++LSK+L  GGWGESYLSCQ+KVYTN++
Sbjct  618   VCFTYAGWFGIKGLVAAGMTYNSSSSIRKACDYMLSKELAGGGWGESYLSCQNKVYTNLK  677

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              ++ HIVNT WAMLALIEAGQ 
Sbjct  678   DDRPHIVNTGWAMLALIEAGQA  699



>dbj|BAA84603.1| oxidosqualene cyclase [Allium macrostemon]
Length=762

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/685 (65%), Positives = 544/685 (79%), Gaps = 2/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLR+ NNH GRQ WEFDPNLGT EE + V+  R  + KNRF++KHSSDLLMR+QF KE
Sbjct  12    NQWLRTTNNHAGRQIWEFDPNLGTPEEIEAVENAREIYRKNRFKMKHSSDLLMRLQFAKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+GL QVK+   E I+EEA   TLRR +  YST+QAHDG WP DYGGP+FL+P L+I
Sbjct  72    NPAEIGLPQVKLAENENITEEAAAITLRRAMNRYSTLQAHDGQWPGDYGGPMFLMPGLII  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              LSV  A+N VL  EHQ E+ RY+YNHQN DGGWGLHIEGHSTMF + L YVTLR+LGE 
Sbjct  132   ALSVTGALNTVLSVEHQHEIRRYLYNHQNEDGGWGLHIEGHSTMFGSVLAYVTLRLLGEG  191

Query  1685  RDGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
              DGG+  AM+K RKWILDHG AT I SWGK WLSVLGV++WSGNNPLPPE++LLPY++P+
Sbjct  192   ADGGDDQAMQKGRKWILDHGSATAITSWGKFWLSVLGVFDWSGNNPLPPEMYLLPYVLPV  251

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRM+YLPMSY+YGKR+VGP+  TI+SLR+EL+N  Y Q+DW+ ARNQCAKED
Sbjct  252   HPGRMWCHCRMIYLPMSYIYGKRFVGPVTQTIISLRKELFNVPYDQVDWNAARNQCAKED  311

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP IQDI+W  LH  VEP+L +WP  KLR KAL   M+H+ +EDE T Y+C+G  +
Sbjct  312   LYYPHPLIQDILWTTLHKCVEPILMRWPGGKLRGKALKTVMEHVHYEDENTRYICLGHFS  371

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+ +S A K+HL R+ DYLW+AEDGMK+ GYNGSQLWD  +AVQAIIAT 
Sbjct  372   KVLNMLCCWVEDQNSEAFKLHLPRLNDYLWIAEDGMKIQGYNGSQLWDTAYAVQAIIATG  431

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
               +E+G+ L+KA+ ++  SQ+ ED   + L  W+RH +KG WPFST D GW VSDCTAE 
Sbjct  432   FSNEFGTTLKKAYKYVKDSQVLEDCPGD-LSYWHRHISKGSWPFSTADQGWLVSDCTAEG  490

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAAL+LS+++ ++VG+ I  +RLYDAV++ILSL+N  GGFA+ ELTRSY WLEI+NP+E
Sbjct  491   LKAALLLSKISPEIVGDPIVANRLYDAVNVILSLKNPGGGFASIELTRSYAWLEIINPAE  550

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             +FG+I+IDY   E TSA I  L  FR L+PG+RR EIE CI K + FI+  Q  DGSWYG
Sbjct  551   SFGDIVIDYPTAESTSACIQALASFRMLYPGHRRDEIEKCITKGVQFIEKTQEHDGSWYG  610

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SW VCYT GTW+G++GL+ GG  YE+ H IRKACDFLLSKQL SGGWGESYLSCQ+KVYT
Sbjct  611   SWAVCYTNGTWYGVKGLISGGKCYENSHSIRKACDFLLSKQLKSGGWGESYLSCQEKVYT  670

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGN+ H VNT+WAMLALI+AGQ 
Sbjct  671   NLEGNRAHAVNTSWAMLALIDAGQA  695



>ref|XP_002262960.1| PREDICTED: cycloartenol Synthase-like [Vitis vinifera]
Length=758

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/685 (66%), Positives = 543/685 (79%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFD + GT EER +V+  R  F KNRF +K S DLL RMQF +
Sbjct  11    NDPYIYSTNNFVGRQIWEFDADYGTPEERAEVEAARENFWKNRFPVKPSCDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++E+ V  TL+R L FYST+QAHDGHWP D GGP+FLLP LV
Sbjct  71    ENPCAANLPQIKVQDLEEVTEKVVTTTLQRSLNFYSTMQAHDGHWPGDNGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ+EM RY++N+QN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  131   ITLHITGALNIVLSIEHQREMCRYLFNNQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+K RKWILDHGGAT I SWGK+WLSVLG YEW GNNPLPPE+WL PYI+PI
Sbjct  191   GGFGVEGAMEKGRKWILDHGGATAITSWGKMWLSVLGAYEWYGNNPLPPEVWLCPYILPI  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSY+YGKR+VGPI  TI+SLR ELY   Y ++DW+ ARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYIYGKRFVGPITPTIISLRNELYIVPYQEVDWNQARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W+ LH ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWESLHKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI  YLW+AEDGMKM G NG+QLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIFYYLWIAEDGMKMQGSNGTQLWDTCFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             LC+EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KG WPFST D+GW VSDCTAE 
Sbjct  431   LCEEYGLTLRKAHQFIKNSQVLEDCPGD-LKFWYRHISKGAWPFSTADHGWAVSDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  + VGE ++  +L+DAV++ILSLQN  GGFA+YELTRSY W+E++NP+E
Sbjct  490   LKAVLLLSKLPLETVGEPLDMEKLFDAVNVILSLQNADGGFASYELTRSYRWVELINPTE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+++IDY  VECTSAAI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSWYG
Sbjct  550   TFGDVVIDYPCVECTSAAIQALTSFKKLYPEHRRHEIENCISKAAKFIEDIQAPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ+KVYT
Sbjct  610   SWGVCFTYGAWFGIKGLIAAGNTYSNCPCIRKACDYLLSKELASGGWGESYLSCQNKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+  +K H VNTAWAML LI+AGQ 
Sbjct  670   NLPEDKPHNVNTAWAMLVLIDAGQA  694



>ref|XP_004137362.1| PREDICTED: probable oxidosqualene cyclase-like [Cucumis sativus]
Length=759

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/688 (67%), Positives = 559/688 (81%), Gaps = 7/688 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLG-TQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             W  S N+H+GRQYW+FD NL  ++EE+ Q+QK   EF++NRF+ KHSSDLLMR Q  KE 
Sbjct  10    WETSENDHVGRQYWKFDTNLTPSEEEKAQIQKFCNEFYRNRFRAKHSSDLLMRFQLRKEN  69

Query  2042  -GQEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
              G E+ L +Q+K+ SEEEI+EEA+ +TLRRG+RFYST+Q  DG WP DYGGPLFLLP LV
Sbjct  70    NGDEVKLPRQIKITSEEEINEEAIEKTLRRGIRFYSTLQTQDGFWPGDYGGPLFLLPALV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGLSV +A++  +   H+ EM RY+YNHQN +GGWGLHIEG+STM CTAL+YV+LR+LGE
Sbjct  130   IGLSVTKALDVAISCHHRYEMCRYLYNHQNQNGGWGLHIEGNSTMLCTALSYVSLRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             + DG +GA+ KAR+WILD GGAT IPSWGK WLSVLGVYEW GNNPLPPE+WL PY +P+
Sbjct  190   KMDGRDGALLKARRWILDRGGATSIPSWGKTWLSVLGVYEWEGNNPLPPEMWLFPYSLPL  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCH RM+YLPMSYLYGKR+VG I+S ILSLRRELY   YH+IDW+L+RN CAKED
Sbjct  250   HPGRMWCHSRMIYLPMSYLYGKRFVGSISSIILSLRRELYTCPYHKIDWNLSRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY PH  IQD++W+ +H   EPLL KWP +KLR+KAL   + HI +EDE T+Y+C+GPV+
Sbjct  310   LYTPHSKIQDVLWNSIHKFGEPLLKKWPLSKLRQKALDFVIQHIHYEDENTHYLCLGPVS  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A + H+ R+KDYLWLAEDGMKM GYNGSQLWDV FAVQAI+AT+
Sbjct  370   KVLNMVCCWVEDPNSEAFRRHIPRVKDYLWLAEDGMKMQGYNGSQLWDVVFAVQAILATD  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGI---NYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             L DEYGS+L+KAH FI  SQ K + GI   N    WYR  +KGGWPFSTPDN WPVSDCT
Sbjct  430   LVDEYGSVLKKAHNFIKNSQRKRN-GIKDDNNPSIWYRLISKGGWPFSTPDNAWPVSDCT  488

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AEALK A++LS+M   +VGE I+   LYDAVDLILSLQN++GGFA+YELTRSYPWLE+LN
Sbjct  489   AEALKVAILLSQMPTTMVGEPIDVHNLYDAVDLILSLQNSNGGFASYELTRSYPWLEMLN  548

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+E F +++IDYQYVECTSA I GLK F KLHPGYR+K+I+ CI+KA  FI+TIQL DGS
Sbjct  549   PAEIFADVMIDYQYVECTSAVIQGLKAFMKLHPGYRKKDIQTCISKAAHFIETIQLSDGS  608

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWG+CYTYGTWFGI+GLV  G TY +   IRKA  FLLSKQL SGGWGESYLS   K
Sbjct  609   WYGSWGICYTYGTWFGIKGLVASGRTYANSECIRKATQFLLSKQLKSGGWGESYLSAHHK  668

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYT+++  K HIVNT+W +LALI+  Q 
Sbjct  669   VYTDLKDGKSHIVNTSWVLLALIQTDQA  696



>gb|AAG44096.1|AF216755_1 cycloartenol synthase [Abies magnifica]
Length=756

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/685 (65%), Positives = 542/685 (79%), Gaps = 1/685 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
              PWL+++NNH+GRQ WEFDP  GT E+   V+K R +F+  RF   HS+DLLMR+Q   E
Sbjct  11    SPWLQTLNNHVGRQVWEFDPKAGTSEDHLAVEKARVDFYNKRFIQHHSADLLMRLQCGGE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                     QVK+ S  +I+EE +  TL R +RFY+TIQAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPLSPLPAQVKLESANDITEEVIQTTLVRAIRFYATIQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+NAVL E H+KE+ RY+YNHQN DGGWGLHIEGHSTMF T LNYVTLR+LG+ 
Sbjct  131   ALYVTGALNAVLSEMHKKEICRYLYNHQNEDGGWGLHIEGHSTMFGTVLNYVTLRLLGQA  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DGG GAM+K   WILDHGGAT IPSWGK+WLSVLGV++W+GNNPLPPE+WLLPY +P H
Sbjct  191   PDGGQGAMEKGCAWILDHGGATAIPSWGKMWLSVLGVFDWTGNNPLPPEMWLLPYFLPTH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YG+R+VGP+   ++SLR ELY   Y +IDW+ AR+ CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYIYGRRFVGPLTGIVMSLREELYTVPYEKIDWNQARSMCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP L  WP + LR++AL   M HI +EDE T Y+CIGPVNK
Sbjct  311   YYPHPFLQDILWGTLHKVVEPALMHWPGSMLRERALQSVMKHIHYEDENTRYICIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+ +S A K HL+R+ DYLW+AEDGMKM GYNGSQLWD  FA QA+I+TNL
Sbjct  371   VLNMLCCWVEDSNSEAFKRHLARVVDYLWVAEDGMKMQGYNGSQLWDTAFATQALISTNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              D+ G +L+KAH++I  SQ++ED   + L  WYRH + G WPFST D+GWP+SDC++E L
Sbjct  431   LDDCGPLLKKAHIYIERSQVQEDCPGD-LNFWYRHISNGAWPFSTRDHGWPISDCSSEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL LS++  D+VG+ I   R++D V+L+LS+QN+ GGFATYELTRSYPWLE +NP+ET
Sbjct  490   KAALALSQLPQDIVGKPIPSQRIFDCVNLMLSMQNSDGGFATYELTRSYPWLEKINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSA    L  F+KL+P +R KEIE CI KA  +I+ IQ PDGSWYGS
Sbjct  550   FGDIVIDYSYVECTSAITQALVSFKKLYPEHRHKEIETCILKATRYIENIQRPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG+ GL   G TY++C  IRKAC+FLLSKQLPSGGWGESYLSCQ+KVYT+
Sbjct  610   WGVCFTYGTWFGVLGLAAAGKTYQNCSNIRKACEFLLSKQLPSGGWGESYLSCQEKVYTH  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQVI  171
             +EG + HIV+TAWAMLALI AGQ +
Sbjct  670   LEGGRSHIVSTAWAMLALIYAGQAL  694



>ref|XP_006646871.1| PREDICTED: cycloartenol synthase-like [Oryza brachyantha]
Length=759

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/699 (63%), Positives = 547/699 (78%), Gaps = 4/699 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR  N H+GRQ WEFDP     EE   V+  R  F   R + KHS+DLLMR+QF K  
Sbjct  13    PWLRPKNGHVGRQVWEFDPAADDPEELAAVEDARRGFAARRHEFKHSADLLMRIQFAKAN  72

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               ++ L  +K+   E ++ EAV+ +L+R +  YST QAHDGHWP DYGGP+FL+P L+I 
Sbjct  73    PLKLDLPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYGGPMFLMPGLIIT  132

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V  A+N  L  EHQKEM RY+YNHQN DGGWGLHIEGHSTMF +AL YV+LR+LGE  
Sbjct  133   LYVSGALNTALSSEHQKEMRRYLYNHQNEDGGWGLHIEGHSTMFGSALTYVSLRLLGEGP  192

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             D G+GAM+K RKWILDHGGAT+I SWGK WLSVLGV++WSGNNP+PPE+WLLPY +PIHP
Sbjct  193   DSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPEIWLLPYCLPIHP  252

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPM Y+YGKR+ GP+   +L LR+ELY   Y ++DWD ARNQCAKEDLY
Sbjct  253   GRMWCHCRMVYLPMCYIYGKRFSGPVTPIVLELRKELYEVPYSEVDWDKARNQCAKEDLY  312

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QD++W  LH  VEP++ +WP +KLR+KAL   M HI +EDE T Y+CIGPVNKV
Sbjct  313   YPHPFVQDVLWATLHKFVEPVMLRWPGSKLREKALDTVMQHIHYEDENTRYICIGPVNKV  372

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+  WIE+P+S + K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F VQAI+AT L 
Sbjct  373   LNMLACWIEDPNSESFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTAFTVQAIVATGLI  432

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+G  L+ AH +I  +Q+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  433   EEFGPTLKLAHDYIKKTQVIDDCPGD-LSQWYRHISKGAWPFSTADHGWPISDCTAEGLK  491

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A+L+LS+++ D+VGEA+E +RLYD+V+ ++S  N++GGFATYELTRSY WLE++NP+ETF
Sbjct  492   ASLLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYAWLELINPAETF  551

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSAAI  L  F+KL+PG+RR EI++CI+KA +FI +IQ  DGSWYGSW
Sbjct  552   GDIVIDYPYVECTSAAIQALTAFKKLYPGHRRTEIDSCISKAASFIDSIQKSDGSWYGSW  611

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
              VC+TYGTWFG++GLV  G T++S   IRKACDFLLSK+LPSGGWGESYLS QD+VYTN+
Sbjct  612   AVCFTYGTWFGVKGLVAAGRTFKSSPAIRKACDFLLSKELPSGGWGESYLSSQDQVYTNL  671

Query  242   EGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFIN  135
             EG + H VNT WAMLALI+AGQ     + +  G K+ IN
Sbjct  672   EGKQVHAVNTGWAMLALIDAGQAERDPMPLHRGAKVLIN  710



>ref|XP_002453283.1| hypothetical protein SORBIDRAFT_04g003200 [Sorghum bicolor]
 gb|EES06259.1| hypothetical protein SORBIDRAFT_04g003200 [Sorghum bicolor]
Length=757

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/684 (64%), Positives = 544/684 (80%), Gaps = 4/684 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD      +    V   R  F   R Q+KHS+DLLMR+QF KE
Sbjct  12    DPWLRTKNAHVGRQVWEFD---AAADPDPAVDAARRAFVDTRRQLKHSADLLMRIQFAKE  68

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L  +K+G  E+++EEAV  TL+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  69    NPLELDLPAIKLGEHEDVTEEAVSTTLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLII  128

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV LR+LGE 
Sbjct  129   TLYVTGALNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVILRLLGEG  188

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY++P H
Sbjct  189   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVPPEVWLLPYLLPFH  248

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   +L LR+EL+   Y++IDWD ARN CAKEDL
Sbjct  249   PGRMWCHCRMVYLPMCYIYGKRFVGRITPLLLELRKELFKEPYNKIDWDKARNLCAKEDL  308

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP++  WP +KLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  309   YYPHPFVQDVLWATLHKFVEPVMMHWPGSKLREKALETVMQHVHYEDENTRYICIGPVNK  368

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLWLAEDGMKM GYNGSQLWD  FAVQAI+ATNL
Sbjct  369   VLNMLACWIEDPNSEAFKLHIPRVYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIVATNL  428

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+ AH +I  SQ+ +D   + L  WYRH++KG WPFST D+GWP+SDCTAE L
Sbjct  429   IEEFGPTLKLAHNYIKNSQVLDDCPGD-LDDWYRHTSKGAWPFSTADHGWPISDCTAEGL  487

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++  +VGE +E +R YDAV  ++S  N++GGFATYELTRSYPWLE++NP+ET
Sbjct  488   KASLLLSKISPKIVGEPVEANRFYDAVSCLMSYMNDNGGFATYELTRSYPWLELINPAET  547

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRKE+++CI+KA  FI++IQ  DGSWYGS
Sbjct  548   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKEVDSCISKASNFIESIQKSDGSWYGS  607

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G T+E+   IRKACDFLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  608   WAVCFTYGTWFGVKGLIAAGRTFENSPAIRKACDFLLSKELPSGGWGESYLSSQDQVYTN  667

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++GN+ H VNT+WAMLALI+AGQ 
Sbjct  668   LKGNRPHAVNTSWAMLALIDAGQA  691



>gb|KHG27893.1| Cycloartenol synthase [Gossypium arboreum]
Length=767

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/688 (66%), Positives = 537/688 (78%), Gaps = 7/688 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLRS+NNH GRQ WEF P  GT EE  +V+  R  F  NRF  KHSSDLLMR+QF +EK 
Sbjct  17    WLRSLNNHDGRQVWEFCPESGTPEELSKVEMARQSFRDNRFHKKHSSDLLMRIQFAEEKQ  76

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L Q K+   E++ EEAV+ TLR  L FYSTIQA DGHWP DYGGP+FLLP LVI L
Sbjct  77    SVTNLPQTKLEEFEDVKEEAVMTTLRGALDFYSTIQADDGHWPGDYGGPMFLLPGLVITL  136

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQ------NIDGGWGLHIEGHSTMFCTALNYVTLRI  1698
              V  A+N VL +EHQ EM RY+YNHQ      N DGGWGLHIEG STMF T LNYV+LR+
Sbjct  137   YVTGALNTVLSKEHQYEMCRYLYNHQASNVHCNRDGGWGLHIEGPSTMFGTVLNYVSLRL  196

Query  1697  LGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             LGE  +G  GA++KAR+WIL+HG AT I SWGK+WLSVLG YEWSGNNPLPPE+WL PY 
Sbjct  197   LGEGAEGVQGAIEKAREWILEHGSATAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYF  256

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             +PIHPGRMWCHCRMVYLPMSYLYGK++VGPI  TILSLR+ELY   YH++DW+ ARN CA
Sbjct  257   LPIHPGRMWCHCRMVYLPMSYLYGKKFVGPITPTILSLRKELYTVPYHEVDWNKARNACA  316

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLYYPHP +QDI+W  LH + EP+L  WP   LR+KAL   M HI +EDE T Y+CIG
Sbjct  317   KEDLYYPHPLVQDILWASLHYLYEPMLKYWPCKSLREKALQTVMQHIHYEDENTRYICIG  376

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNM+C W+E+P S + K+HL RI DYLW+AEDGMKM GYNGSQLWD  FA+QAII
Sbjct  377   PVNKVLNMLCCWVEDPYSESFKLHLPRILDYLWIAEDGMKMQGYNGSQLWDTAFAIQAII  436

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             +T+L DEYGS+LRKAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCT
Sbjct  437   STSLADEYGSVLRKAHGFLKYSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCT  495

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             +E LKAAL+LS +     GE +   RLYDAV++ILSLQN  GGFATYELTRSY WLE++N
Sbjct  496   SEGLKAALLLSTLPAATAGEPLNVIRLYDAVNVILSLQNADGGFATYELTRSYQWLELIN  555

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+ETFG+I+IDY YVECTSAAI  L  F+KL+P YR +EI+ CI +A+ FI+ +Q  DGS
Sbjct  556   PAETFGDIVIDYPYVECTSAAIQALASFKKLYPEYRTEEIQNCIGRAVEFIEKMQAEDGS  615

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWG+C++Y  WFGI+GL   G TY++   IRKACDF LSK+L +GGWGESYLSCQ+K
Sbjct  616   WYGSWGICFSYAGWFGIKGLSAAGRTYKNSSHIRKACDFFLSKELATGGWGESYLSCQNK  675

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYTN+EGN+ HIVNT+W MLALIEAGQ 
Sbjct  676   VYTNLEGNRPHIVNTSWTMLALIEAGQA  703



>ref|XP_006484812.1| PREDICTED: cycloartenol synthase 2-like [Citrus sinensis]
Length=764

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/690 (66%), Positives = 557/690 (81%), Gaps = 7/690 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLR++NNH+GRQ WEFDP LG+ EE  +++K R  FH +RF+ KHS+DLLMR+QF KE
Sbjct  11    NAWLRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHNHRFEKKHSADLLMRLQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QVKV   E+++E+ V  TLRR L ++ST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPGVRVLPQVKVKDTEDVTEDIVTNTLRRALSYHSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-  1689
              LS+  A+NAVL EEH+KEM RYIYNHQN DGGWGLHIEG STMF + LNYVTLR+LGE 
Sbjct  131   TLSITGALNAVLLEEHKKEMCRYIYNHQNRDGGWGLHIEGPSTMFGSVLNYVTLRLLGEG  190

Query  1688  ERDG-----GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
               DG     G GAM++ R WIL+HGGAT + SWGK+WLSVLG +EWSGNNPLPPE+WLLP
Sbjct  191   ANDGRGANDGRGAMERGRSWILEHGGATALTSWGKMWLSVLGAFEWSGNNPLPPEIWLLP  250

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             YI+P HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+L+LR+EL+   YH+IDW+ ARN 
Sbjct  251   YILPFHPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLALRKELFTVPYHEIDWNEARNL  310

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPHP IQD++W  L  +VEPLL  WP  KLR+KAL  A+ HI +EDE T Y+C
Sbjct  311   CAKEDLYYPHPLIQDVLWATLDKVVEPLLMHWPGKKLREKALRNAIKHIHYEDENTRYLC  370

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             IGPVNKVLNM+C W+E+P+S A K+H+ R+ DYLW+AEDGMK+ GYNGSQLWD  FAVQA
Sbjct  371   IGPVNKVLNMLCCWVEDPNSEAFKLHIPRVNDYLWIAEDGMKVQGYNGSQLWDTAFAVQA  430

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             II+TNL +EYG+ L+KAH +I  SQ+ ED   N L  WYRH +KG WPFST D+GWP+SD
Sbjct  431   IISTNLVEEYGATLKKAHKYIKDSQVLEDCPGN-LDFWYRHISKGAWPFSTADHGWPISD  489

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CT+E LKA+L+LS+++  +VGE IE  RLYD+V++I SLQN  GGFATYEL RSYPWLE+
Sbjct  490   CTSEGLKASLLLSKLSSAIVGEPIETKRLYDSVNVIFSLQNADGGFATYELMRSYPWLEV  549

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             LNP+ETFG+I+IDY  VECTSA+I  L  F+KL+PG+ +++++ CI +A+ FI+ IQ  D
Sbjct  550   LNPAETFGDIVIDYPCVECTSASIQALTSFKKLYPGHWQEDVDHCIKRAVKFIEKIQELD  609

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSWGVC+TYGTWFG++GLV  G  Y +   IRKAC+FLLSKQ PSGGWGESYLSCQ
Sbjct  610   GSWYGSWGVCFTYGTWFGVKGLVAAGMNYSNSSTIRKACEFLLSKQRPSGGWGESYLSCQ  669

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
              KVY+N+EG++ H+VNTAWAMLALI+AGQ 
Sbjct  670   KKVYSNLEGDRSHVVNTAWAMLALIDAGQA  699



>ref|XP_003632939.1| PREDICTED: cycloartenol synthase-like [Vitis vinifera]
Length=758

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/685 (67%), Positives = 545/685 (80%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFD + GT EER +V+  R  F KNRF +K S DLL RMQF +
Sbjct  11    NDPYMYSTNNFVGRQIWEFDADYGTPEERAEVEAARENFWKNRFPVKPSCDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   +E++EE V+ TLRRGL FYSTIQAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCVANLPQIKVQDLKEVTEEVVMTTLRRGLNFYSTIQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ+EM RY++NHQN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  131   ITLYITGALNVVLSIEHQREMCRYLFNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+K RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WL PYI+PI
Sbjct  191   GGFGAEGAMEKGRKWILDHGGATSITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYILPI  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRM C CRMVYLPMSY+YGKR+VGPI  TI+SLR ELY   Y ++DW+ ARNQCAKED
Sbjct  251   HPGRMNCPCRMVYLPMSYIYGKRFVGPITPTIISLRNELYIVPYQEVDWNQARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWASLHKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTCFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KG WPFST DNGWP SDCTAE 
Sbjct  431   LGEEYGLTLRKAHQFIKNSQVLEDCPGD-LKFWYRHISKGAWPFSTADNGWPTSDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  + VGE ++  +L+DAV++ILSLQN  GGFATYELTRSY W+E++NP+E
Sbjct  490   LKAILLLSKLPLETVGEPLDMEQLFDAVNVILSLQNADGGFATYELTRSYRWVELINPTE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+++IDY  VECTSAAI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSWYG
Sbjct  550   TFGDVVIDYPCVECTSAAIQALISFKKLYPEHRRHEIENCISKAAKFIEDIQAPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ KVYT
Sbjct  610   SWGVCFTYGGWFGIKGLIAAGNTYSNCPCIRKACDYLLSKELASGGWGESYLSCQSKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+  +K + VNTAWAMLALI+AGQ 
Sbjct  670   NLPEDKPNNVNTAWAMLALIDAGQA  694



>ref|XP_007023625.1| Cycloartenol synthase 1 [Theobroma cacao]
 gb|EOY26247.1| Cycloartenol synthase 1 [Theobroma cacao]
Length=761

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/682 (67%), Positives = 532/682 (78%), Gaps = 1/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLRS N+H+GRQ WEF P  GT EE  +V+  R  F  +R   KHSSDLLMR+Q+ KE  
Sbjct  17    WLRSSNDHVGRQVWEFCPESGTPEELSKVEMARQSFSTDRLLKKHSSDLLMRIQYAKENQ  76

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                   QVK+   E++ EEA + TLRR L FYSTIQA DGHWP DYGGP+FLLP LVI L
Sbjct  77    FVTNFPQVKLKEFEDVKEEATLTTLRRALNFYSTIQADDGHWPGDYGGPMFLLPGLVITL  136

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             SV  A+NAVL +EHQ EM RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE  +
Sbjct  137   SVTGALNAVLSKEHQYEMCRYLYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEGPE  196

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG GA++KA +WIL+HG AT I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +PIHPG
Sbjct  197   GGQGAVEKACEWILEHGSATAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYFLPIHPG  256

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI   ILSLR+ELY   YH++DW+ ARN CAKEDLYY
Sbjct  257   RMWCHCRMVYLPMSYLYGKRFVGPITPIILSLRKELYAVPYHEVDWNKARNTCAKEDLYY  316

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH + EP+  +WP   LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  317   PHPLVQDILWASLHYLYEPIFTRWPCKSLREKALRTVMQHIHYEDENTRYICIGPVNKVL  376

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+  W+E+P S + K+HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+T L D
Sbjct  377   NMLSCWVEDPYSESFKLHLPRILDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIISTGLAD  436

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG +LRKAH FI  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCT+E LKA
Sbjct  437   EYGPILRKAHDFIKYSQVLEDCPGD-LNFWYRHISKGAWPFSTVDHGWPISDCTSEGLKA  495

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS +  + VGE +   RLYDAV++ILSLQN  GGF TYELTRSY WLE++NP+ETFG
Sbjct  496   VLLLSTLPSESVGEPLHMMRLYDAVNVILSLQNVDGGFPTYELTRSYQWLELINPAETFG  555

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL P +R +EIE CI +A+ FI+ IQ  DGSWYGSWG
Sbjct  556   DIVIDYPYVECTSAAIQALISFKKLFPEHRMEEIENCIGRAVEFIEKIQAADGSWYGSWG  615

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GL   G TY +   IRKACDFLLSK+L +GGWGESYLSCQ+KVYTN+E
Sbjct  616   VCFTYAGWFGIKGLSAAGRTYNNSSNIRKACDFLLSKELATGGWGESYLSCQNKVYTNLE  675

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             G + HIVNT+WA+LALIEAGQ 
Sbjct  676   GARPHIVNTSWALLALIEAGQA  697



>ref|XP_010520561.1| PREDICTED: lanosterol synthase isoform X1 [Tarenaya hassleriana]
Length=769

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/706 (65%), Positives = 552/706 (78%), Gaps = 13/706 (2%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQEM  2031
             SVN ++GRQ+WEFD   G+ ++ + + +LR  F   RF+ KHSSDLL R Q  +EKG+ M
Sbjct  15    SVNGNLGRQFWEFDERFGSPQDIKHISELRRNFTIGRFRSKHSSDLLFRFQMLREKGKPM  74

Query  2030  -GLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLSV  1854
               L QV+V  E   +EE V   LR  LR+YS +Q+ DG WP DYGGPLFLLP L+IGL V
Sbjct  75    EKLPQVRVKEEGAGNEEVVSVALRGALRYYSALQSDDGFWPGDYGGPLFLLPPLIIGLYV  134

Query  1853  MEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGG  1674
               A++  L ++HQ EM RY+YNHQN DGGWGLHIEG+STMFCT L+YV LR++GEE DGG
Sbjct  135   TGALDKTLTQQHQMEMRRYLYNHQNEDGGWGLHIEGNSTMFCTVLSYVALRLMGEEMDGG  194

Query  1673  NGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRM  1494
             +GAM+ +R+WI  HGGAT++PSWGKLWLSVLGVYEWSGNNPLPPELWLLP ++P HPGRM
Sbjct  195   DGAMEMSRRWIHGHGGATYVPSWGKLWLSVLGVYEWSGNNPLPPELWLLPDLLPFHPGRM  254

Query  1493  WCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPH  1314
             WCHCRMVYLPMSYLYGKRYV  +N  +LSLRRELY   YH IDWD+ARN CAKEDLYYPH
Sbjct  255   WCHCRMVYLPMSYLYGKRYVCRVNGVVLSLRRELYTVPYHHIDWDIARNLCAKEDLYYPH  314

Query  1313  PAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNM  1134
             P IQD++W  L NI EPLL +WP +KLR +AL   MDHI++ED  T Y+C+GPV+KVLNM
Sbjct  315   PMIQDMLWWSLKNITEPLLGRWPLSKLRNRALQTVMDHIRYEDRNTRYICLGPVSKVLNM  374

Query  1133  ICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEY  954
             +C W+E+P S   K HLSR+KDYLW+AEDGMKM GYNGSQLWDV FAVQAI+ATNL DEY
Sbjct  375   VCCWVEDPSSEEFKRHLSRVKDYLWIAEDGMKMQGYNGSQLWDVAFAVQAILATNLVDEY  434

Query  953   GSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAAL  774
             GS LRK++ +I  +QI+E++  N   +WYRH  KGGW FST DN WPVSDCTAEALK+AL
Sbjct  435   GSTLRKSNEYIKNTQIRENTYGN-PAAWYRHPCKGGWGFSTADNPWPVSDCTAEALKSAL  493

Query  773   MLSRMADDVVGEAIEPSRLYDAVDLILSL--------QNNSGGFATYELTRSYPWLEILN  618
             +L +M   +VGEA+     +DAV+ ILSL        QN++GGFA+YELTRSYPWLE++N
Sbjct  494   LLWKMPRQLVGEAMAEEHFFDAVNFILSLQLCSLYLFQNSNGGFASYELTRSYPWLEVIN  553

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             PSETFG+IIIDYQYVECTSAAI GL+ F KL PGYR+ EIE CI KA+ FI+  QLPDGS
Sbjct  554   PSETFGDIIIDYQYVECTSAAIQGLELFTKLFPGYRKMEIEKCIRKAVEFIEKTQLPDGS  613

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWGVC+TY TWFGI+ L+  G  YE+ + IRKAC FLLS+QL SGGWGESYLSCQ+K
Sbjct  614   WYGSWGVCFTYATWFGIKALLAAGKVYETSNCIRKACRFLLSRQLSSGGWGESYLSCQNK  673

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQVI---L*IKVGDKIFINNH  129
              YTN+ GN+ H+VNT+WAMLALIEAGQ       +  G K+ IN+ 
Sbjct  674   EYTNLPGNRPHLVNTSWAMLALIEAGQASRDWTPLHRGAKLLINSQ  719



>gb|KFK33925.1| hypothetical protein AALP_AA5G078800 [Arabis alpina]
Length=758

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/681 (68%), Positives = 548/681 (80%), Gaps = 4/681 (1%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ-E  2034
             S+  H+GRQ WE+D   GT +ER  + +LR  F  NRF  KHSSDLL R Q  KEKG  +
Sbjct  13    SLYEHVGRQVWEYDSQFGTSQERLHISQLRTNFTLNRFSSKHSSDLLYRFQCLKEKGSGK  72

Query  2033  MGLQQVKVGSEEE--ISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               L QVKV  EEE  I+ E V  TLRR LRFYST+Q+ DG WPADYGGPLFLLP LVIGL
Sbjct  73    EKLPQVKVNGEEEGEINVEVVNVTLRRSLRFYSTLQSQDGFWPADYGGPLFLLPALVIGL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
                E ++A L  +HQ E+ RY+YNHQN DGGWGLHIEG STMFCT L+YV LR++GEE +
Sbjct  133   YATEVLDATLSAQHQIEIRRYLYNHQNKDGGWGLHIEGSSTMFCTVLSYVALRLMGEEMN  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+GAM+ AR++I   GGATFIPSWGKLWLSVLGVYEWSGNNPLPPELWLLPY +P HPG
Sbjct  193   GGDGAMEAARRFIHHLGGATFIPSWGKLWLSVLGVYEWSGNNPLPPELWLLPYSLPFHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+V PIN TILSLRRELY   Y  IDWD ARNQCAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGKRFVCPINGTILSLRRELYTVTYRHIDWDTARNQCAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD +W  L  + EPLL +WPF+KLR +AL   M HI +ED+T++Y+C+GPVNKVL
Sbjct  313   PHPKIQDFMWSCLKKVGEPLLERWPFSKLRDRALQTVMQHIHYEDQTSHYICLGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+++PDS A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQ+++ATNL D
Sbjct  373   NMVCCWLDDPDSKAFKNHLSRIKDYLWVAEDGMKMQGYNGSQLWDVILAVQSMLATNLVD  432

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG ML++AH FI  +QI+ ++  +  + WYRH +KGGW FS+ D+ WPVSDCTAEALKA
Sbjct  433   EYGLMLKRAHNFIKNTQIRRNTCGDPGK-WYRHQSKGGWSFSSADHPWPVSDCTAEALKA  491

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++   +VGEA+    L+DAV+ ILSLQN +GGFATYELTRSYPWLE++NPSETFG
Sbjct  492   ALLLSQLPVTLVGEAMPDEHLFDAVNFILSLQNKNGGFATYELTRSYPWLEVINPSETFG  551

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +IIIDYQYVECTSAAI GL+ F +++  Y+RKEI  CI KA+ FI+  QLPDGSWYGSWG
Sbjct  552   DIIIDYQYVECTSAAIQGLELFTRINSTYKRKEILKCIKKAVEFIEKTQLPDGSWYGSWG  611

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY TWFGI+GL+  G T+E+   I+KACDF LSKQL  GGWGESYLSCQ+KVYTN+ 
Sbjct  612   VCFTYATWFGIKGLLAAGKTFETSVCIKKACDFFLSKQLSCGGWGESYLSCQNKVYTNLP  671

Query  239   GNKWHIVNTAWAMLALIEAGQ  177
             GN+ HIVNT+WA+LALIEAGQ
Sbjct  672   GNRSHIVNTSWALLALIEAGQ  692



>gb|ADG60271.1| cycloartenol synthase [Withania somnifera]
Length=758

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/684 (64%), Positives = 545/684 (80%), Gaps = 2/684 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+ NNH+GR+ WEFDPNLG+ E+R +++K R  F  +R + KHS+DL+MR Q  KE 
Sbjct  12    PWLRTTNNHVGREVWEFDPNLGSPEDRAEIEKFREHFSMHRLEQKHSADLIMRYQLSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+I+ + V  TLRR L FYST+Q  DGHW  DYGGP+FL+P L+I 
Sbjct  72    QGISILPQVKVQDNEDITVDDVATTLRRALSFYSTLQNQDGHWAGDYGGPMFLMPGLIIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAV   EH++EM+RY+YNHQN DGGWGLHIE HSTMF + L+YVTLR+LGE  
Sbjct  132   LSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHSTMFGSVLSYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G GAM+K RKWILDHG AT I SWGK+WL+VLG ++WSGNNPLPPE+WLLPYI+PIHP
Sbjct  192   NDGEGAMEKGRKWILDHGSATAITSWGKMWLTVLGAFDWSGNNPLPPEIWLLPYILPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPM YLYGKR+VGPI  T+LSLR+EL+   YH++DWD ARN+CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMCYLYGKRFVGPITPTVLSLRKELFTVPYHEVDWDKARNECAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QD++W  LH +VEP+L  WP  +LR+K L   M+H+ +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDVLWASLHKVVEPILMHWPGKRLREKLLRTVMEHVHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DY+W+AEDGMKM GYNGSQ WD  FA+QAIIAT L 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIHDYMWVAEDGMKMKGYNGSQSWDTSFAIQAIIATGLG  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKAH FI  +Q+ +D   N L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGPTLRKAHSFIKNTQVLDDCPGN-LDFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNN-SGGFATYELTRSYPWLEILNPSET  606
               L+LS++  ++VG+ +E  RLYDAV+++LSLQN+ SGGFATYELTRSYPWLE++NP+ET
Sbjct  491   VVLLLSKLPSEIVGDPLEAKRLYDAVNVLLSLQNSGSGGFATYELTRSYPWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVEC+SAAI  L  F+KL+PG+R++E+E CI KA  FI+ IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECSSAAIQALTAFKKLYPGHRKEEVEHCIAKAAAFIEKIQEADGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG+ GL+  G  Y     IRKAC+FLLSKQ+ SGGWGESYLSCQ+KVYTN
Sbjct  611   WAVCFTYGTWFGVLGLLAAGRNYNDSSSIRKACNFLLSKQVSSGGWGESYLSCQNKVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++GN+ H+VNTAWAML LI +GQ 
Sbjct  671   LKGNRSHVVNTAWAMLTLIASGQA  694



>emb|CDX85104.1| BnaC07g08020D [Brassica napus]
Length=764

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/690 (64%), Positives = 551/690 (80%), Gaps = 6/690 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D PWLR+ NNH+GRQ WEF+P LGT EE   +++ R  F +NRF  KHSSDLLMR+QF  
Sbjct  10    DSPWLRTTNNHVGRQTWEFNPLLGTPEELAAIEEARNSFTQNRFSNKHSSDLLMRLQFSG  69

Query  2048  EKGQEMGLQQVKVGS-EEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             E      L QVK+   +++++++ V  +L+RGL F+ST+QAHDGHWP DY GP+FLLP L
Sbjct  70    ENLISSVLPQVKLEDIDDDVTDKIVENSLKRGLDFFSTLQAHDGHWPGDYAGPMFLLPGL  129

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYN----HQNIDGGWGLHIEGHSTMFCTALNYVTL  1704
             +I LS+  A+N VL E+H+ E+     +     QN DGGWGLHIEGHSTMF + LNYVTL
Sbjct  130   IITLSITGALNTVLSEQHKHEIHIICPSTYCMFQNEDGGWGLHIEGHSTMFMSVLNYVTL  189

Query  1703  RILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
             R+LG+  D G+GAM+K R WIL+HGGAT I SWGKLWLSVLG +EWSGNNPLPPE+WLLP
Sbjct  190   RLLGQGPDAGDGAMEKGRDWILNHGGATHITSWGKLWLSVLGAFEWSGNNPLPPEIWLLP  249

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             Y +PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI ST+L+LR+EL++  Y  IDW+ AR  
Sbjct  250   YFLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITSTVLALRKELFSVPYEDIDWNQARTL  309

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPHP +QDI+W  LH +VEP+L++WP   LR+KAL   ++HI +EDE T Y+C
Sbjct  310   CAKEDLYYPHPLVQDILWASLHKVVEPVLSRWPGTILREKALRTTLEHIHYEDENTRYLC  369

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             IGPVNKVLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD GFAVQA
Sbjct  370   IGPVNKVLNMLCCWVEDPNSEAFKLHLPRIHDYLWLAEDGMKMQGYNGSQLWDAGFAVQA  429

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             I+ATN  +EYG +L+KAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SD
Sbjct  430   ILATNFVEEYGPVLKKAHSFVKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISD  488

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CTAE LKA L+LS+++ ++VGE ++ +RLYDAV++++SLQN  GG ATYELTRSYPWLE+
Sbjct  489   CTAEGLKATLLLSKVSKEIVGEPLDTNRLYDAVNVLISLQNADGGVATYELTRSYPWLEL  548

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             +NPSETFG+I+IDY YVECTSAAI  L  FRKL+PG+R+K+++ CI KA+ FI++ Q  D
Sbjct  549   INPSETFGDIVIDYPYVECTSAAIQALVAFRKLYPGHRKKDVDECIEKAVKFIESSQARD  608

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSW VC+TYG WFG++GL   G T ++   + KAC+FLLSKQLPSGGWGESYLSCQ
Sbjct  609   GSWYGSWAVCFTYGAWFGVKGLEAVGKTLKNSPAVAKACEFLLSKQLPSGGWGESYLSCQ  668

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             DKVYT I+GNK H+VNT+WA+LALI AGQ 
Sbjct  669   DKVYTGIKGNKSHVVNTSWALLALIGAGQA  698



>ref|XP_007134028.1| hypothetical protein PHAVU_010G013200g [Phaseolus vulgaris]
 gb|ESW06022.1| hypothetical protein PHAVU_010G013200g [Phaseolus vulgaris]
Length=756

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/685 (65%), Positives = 536/685 (78%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             + PWLR+ NNH+GRQ WEFDP     ++  Q++  R  FH NR   K S+DLL+RMQF +
Sbjct  10    ESPWLRTRNNHLGRQVWEFDPTPQPPQQLLQIENARHSFHHNRSTQKQSADLLLRMQFAE  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L +V+V   E+++EE V RTLRR   F ST+Q+HDGHWP DYGGP+F++P L+
Sbjct  70    ENPMHEVLPKVEVEGTEDVTEEVVTRTLRRATSFLSTLQSHDGHWPGDYGGPMFMIPSLI  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N+VL EEH+KE+ R+IYNHQN DGGWGLHIEG STMF + L YV LR+LGE
Sbjct  130   IALYISGAVNSVLTEEHRKEIRRFIYNHQNEDGGWGLHIEGSSTMFGSVLTYVALRLLGE  189

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G    M  AR WI  HGGATFI SWGK+WLSVLGVYEWSGNNPLPPE+WLLPY++P 
Sbjct  190   GASGAQREMTIARDWIQRHGGATFITSWGKMWLSVLGVYEWSGNNPLPPEVWLLPYMLPF  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMW HCRMVYLPMSYLY KR+VG I   +LSLR+ELY   Y  IDWD ARN CAKED
Sbjct  250   HPGRMWNHCRMVYLPMSYLYAKRFVGSITPMVLSLRKELYTIPYADIDWDQARNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPH  +QDI+W  LHNI+EP+L  +P NKLR+KAL   M+ I +EDET++Y+C+GPVN
Sbjct  310   LYYPHSHVQDILWGTLHNIIEPILMHFPGNKLREKALRNVMERIHYEDETSHYICLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL RI DYLW+AEDG+KM GYNGSQLWD  F VQAII+TN
Sbjct  370   KVLNMLCCWVEDPNSEAFKLHLPRIHDYLWIAEDGLKMKGYNGSQLWDTAFIVQAIISTN  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH +I  SQI ED   + L  W+RH +KG WPFST DNGWP+SDCTAE 
Sbjct  430   LAEEYGPTLRKAHTYIKNSQILEDCPGD-LNKWFRHISKGSWPFSTVDNGWPISDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS+MA ++VGE ++ +RLYDAV+++LSLQN  GGF TYELTRSY W+EI+NPSE
Sbjct  489   LKAVLLLSKMAPEIVGEPLDANRLYDAVNILLSLQNKDGGFPTYELTRSYSWMEIINPSE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+II+DY YVECTSA+I  L  FRKL+P +R +EI+ C+ KA+ FIQ  Q  DGSWYG
Sbjct  549   TFGDIILDYPYVECTSASIEALTLFRKLYPEHRPQEIQGCVEKAVAFIQKTQSSDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+C+TYGTWFG++GLV  G ++  C  IRKA +FLLSKQLPSGGWGESYLS Q+KVYT
Sbjct  609   SWGICFTYGTWFGVKGLVSSGRSFSDCSNIRKASEFLLSKQLPSGGWGESYLSSQNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK H+VNT WAMLALIEAGQ 
Sbjct  669   NLEGNKPHVVNTGWAMLALIEAGQA  693



>ref|XP_008679954.1| PREDICTED: cycloartenol synthase isoform X1 [Zea mays]
 gb|AFW66542.1| hypothetical protein ZEAMMB73_213979 [Zea mays]
Length=757

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/684 (64%), Positives = 540/684 (79%), Gaps = 4/684 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD    + +    V   R  F  +R  +KHS+DLLMR+QF KE
Sbjct  12    DPWLRTKNAHVGRQVWEFD---ASADPDPAVDAARRAFAGSRGHLKHSADLLMRIQFAKE  68

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L  +K+G  E+++EEAV  TLRR +   ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  69    NPLELDLPAIKLGEHEDVTEEAVSTTLRRAISRLSTLQAHDGHWPGDYGGPMFLMPGLII  128

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YVTLR+LGE 
Sbjct  129   TLYVTGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVTLRLLGEG  188

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY++P H
Sbjct  189   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVPPEVWLLPYLLPFH  248

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   +L LR+EL+   Y +IDWD ARN CAKEDL
Sbjct  249   PGRMWCHCRMVYLPMCYIYGKRFVGRITPLVLELRKELFKDPYSKIDWDKARNLCAKEDL  308

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP++  WP +KLR+KAL  AM H+ +EDE T Y+CIGPVNK
Sbjct  309   YYPHPFVQDVLWATLHKFVEPVMMSWPGSKLREKALETAMQHVHYEDENTRYICIGPVNK  368

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLWLAEDGMKM GYNGSQLWD  F VQAI+ATNL
Sbjct  369   VLNMLACWIEDPNSEAFKLHIPRVYDYLWLAEDGMKMQGYNGSQLWDTAFIVQAIVATNL  428

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+ AH +I  SQ+ +D   + L  WYRH++KG WPFST D+GWP+SDCTAE L
Sbjct  429   TEEFGPTLKLAHNYIKKSQVLDDCPGD-LNDWYRHTSKGAWPFSTADHGWPISDCTAEGL  487

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VG  IE +R YDAV  ++S  N++GGFATYELTRSY WLE++NP+ET
Sbjct  488   KASLLLSKISPEIVGGPIEANRFYDAVSCLMSYMNDNGGFATYELTRSYAWLELINPAET  547

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+RRKE+++CI+KA  FI++IQ  DGSWYGS
Sbjct  548   FGDIVIDYPYVECTSAAIQALTSFRKLYPGHRRKEVDSCISKAANFIESIQKSDGSWYGS  607

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G T+ES   IRKAC FLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  608   WAVCFTYGTWFGVKGLIAAGRTFESSPAIRKACGFLLSKELPSGGWGESYLSSQDQVYTN  667

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++GN+ H  NT WAMLALI+AGQ 
Sbjct  668   LKGNRAHAANTGWAMLALIDAGQA  691



>gb|AAF03375.1|AF169966_1 putative cycloartenol synthase [Oryza sativa]
Length=757

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/684 (64%), Positives = 543/684 (79%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  +E   V+  R  F   R ++KHSSDLLMRMQF K 
Sbjct  10    DPWLRTKNGHVGRQVWEFDPAAGDPDELAAVEAARRGFAARRHELKHSSDLLMRMQFAKA  69

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ +  +K+   E ++ EAV+ +L+R +  YST QAHDGHWP DYGGP+FL+P L+I
Sbjct  70    NPLKLDIPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYGGPMFLMPGLII  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N  L  EHQKE+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV+LR+LGE 
Sbjct  130   TLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHSTMFGSALTYVSLRLLGEG  189

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K RKWILDHGGAT+I SWGK WLSVLGV++WSGNNP+PPE+WLLPY +PIH
Sbjct  190   PDSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPEIWLLPYFLPIH  249

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VGP+   IL LR+ELY   Y+++DWD ARN CAKEDL
Sbjct  250   PGRMWCHCRMVYLPMCYIYGKRFVGPVTPIILELRKELYEVPYNEVDWDKARNLCAKEDL  309

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP + +WP NKLR+KAL   M HI +EDE T Y+CIGPVNK
Sbjct  310   YYPHPFVQDVLWATLHKFVEPAMLRWPGNKLREKALDTVMQHIHYEDENTRYICIGPVNK  369

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F VQAI+AT L
Sbjct  370   VLNMLACWIEDPNSEAFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTAFTVQAIVATGL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+ AH +I  +Q+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  430   IEEFGPTLKLAHGYIKKTQVIDDCPGD-LSQWYRHISKGAWPFSTADHGWPISDCTAEGL  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ D+VGEA+E +RLYD+V+ ++S  N++GGFATYELTRSY WLE++NP+ET
Sbjct  489   KAALLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYAWLELINPAET  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+R+ EI+ CI+KA +FI+ IQ  DGSWYGS
Sbjct  549   FGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKSEIDNCISKAASFIEGIQKSDGSWYGS  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G T+++   IRKACDFLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  609   WAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLLSKELPSGGWGESYLSSQDQVYTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG + H VNT WAMLALI+AGQ 
Sbjct  669   LEGKRPHAVNTGWAMLALIDAGQA  692



>ref|NP_001045848.1| Os02g0139700 [Oryza sativa Japonica Group]
 sp|Q6Z2X6.1|CAS_ORYSJ RecName: Full=Cycloartenol synthase [Oryza sativa Japonica Group]
 dbj|BAD10254.1| putative cycloartenol synthase [Oryza sativa Japonica Group]
 dbj|BAF07762.1| Os02g0139700 [Oryza sativa Japonica Group]
 dbj|BAH00370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=759

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/684 (64%), Positives = 543/684 (79%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  +E   V+  R  F   R ++KHSSDLLMRMQF K 
Sbjct  12    DPWLRTKNGHVGRQVWEFDPAAGDPDELAAVEAARRGFAARRHELKHSSDLLMRMQFAKA  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ +  +K+   E ++ EAV+ +L+R +  YST QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDIPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYGGPMFLMPGLII  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N  L  EHQKE+ RY+YNHQN DGGWGLHIEGHSTMF +AL YV+LR+LGE 
Sbjct  132   TLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K RKWILDHGGAT+I SWGK WLSVLGV++WSGNNP+PPE+WLLPY +PIH
Sbjct  192   PDSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPEIWLLPYFLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VGP+   IL LR+ELY   Y+++DWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYIYGKRFVGPVTPIILELRKELYEVPYNEVDWDKARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP + +WP NKLR+KAL   M HI +EDE T Y+CIGPVNK
Sbjct  312   YYPHPFVQDVLWATLHKFVEPAMLRWPGNKLREKALDTVMQHIHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F VQAI+AT L
Sbjct  372   VLNMLACWIEDPNSEAFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTAFTVQAIVATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+ AH +I  +Q+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IEEFGPTLKLAHGYIKKTQVIDDCPGD-LSQWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ D+VGEA+E +RLYD+V+ ++S  N++GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+R+ EI+ CI+KA +FI+ IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKSEIDNCISKAASFIEGIQKSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G T+++   IRKACDFLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  611   WAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLLSKELPSGGWGESYLSSQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG + H VNT WAMLALI+AGQ 
Sbjct  671   LEGKRPHAVNTGWAMLALIDAGQA  694



>gb|AAT38891.1| cycloartenol synthase [Avena strigosa]
Length=759

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/684 (64%), Positives = 539/684 (79%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHS+D LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPEALAAVEAARRDFAAGRHRLKHSADRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLSAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+NAVL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGALNAVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PESGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGKITPLILELRNELYKTPYSEIDWDSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKALNHVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRVHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAITATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  FI++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANFIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G T++S   IRKAC+FL+SK+LP GGWGESYLSCQD+VYTN
Sbjct  611   WAVCFTYGTWFGVKALVAAGRTFKSSPAIRKACEFLMSKELPFGGWGESYLSCQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>ref|XP_011031251.1| PREDICTED: cycloartenol synthase-like [Populus euphratica]
Length=763

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/682 (66%), Positives = 544/682 (80%), Gaps = 2/682 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WLRSVNNH+GRQ WEF P LG+ +E  Q+Q     F   RF  KHS+DLLMR QFEKE  
Sbjct  20    WLRSVNNHLGRQVWEFCPQLGSPDELLQLQNACLSFQAQRFDKKHSADLLMRFQFEKENP  79

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               + L Q+KV  +E++++EAV  TLRR + FY  IQAHDGHWP DYGGP+FLLP L+I L
Sbjct  80    C-VNLPQIKVKDDEDVTDEAVTTTLRRAVNFYRKIQAHDGHWPGDYGGPMFLLPGLIITL  138

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF T LNYVTLR+LGE  +
Sbjct  139   SITGALNAVLSKEHQREMCRYLYNHQNRDGGWGLHIEGPSTMFGTCLNYVTLRLLGEGAE  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+G M+K R WILDHGGAT I SWGK+WLSVLGVYEW GNNPLPPE+WL PY++P+HPG
Sbjct  199   GGDGEMEKGRMWILDHGGATEITSWGKMWLSVLGVYEWPGNNPLPPEVWLCPYLLPMHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+E+Y   YH++DW+ ARN CAKEDLYY
Sbjct  259   RMWCHCRMVYLPMSYLYGKRFVGPITPTIQSLRKEIYIVPYHEVDWNTARNTCAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QDI+W  LH   EP+L +WP N+LR+KAL   M HI +EDE T Y+CIGPVNKVL
Sbjct  319   PHPLVQDILWASLHYAYEPILTRWPLNRLREKALHKVMQHIHYEDENTRYICIGPVNKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E+P S A K+HL R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI++TNL +
Sbjct  379   NMLCCWVEDPHSEAFKLHLPRVLDYLWIAEDGMKMQGYNGSQLWDTAFAVQAIVSTNLAE  438

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EY + LRKAH ++  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  439   EYSATLRKAHKYLKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGLKA  497

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LS++  ++VG+ +   RL DAV++ILSLQN  GGFATYELTRSY WLE++NP+ETFG
Sbjct  498   VLLLSKLPTEMVGDPLGVERLRDAVNVILSLQNADGGFATYELTRSYQWLELINPAETFG  557

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F+KL+PG+RR+EI+ CI +A  FI+ IQ  DGSWYGSWG
Sbjct  558   DIVIDYPYVECTSAAIQALASFKKLYPGHRREEIDNCIAEAANFIEKIQATDGSWYGSWG  617

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GLV  G TY S   IRKAC+++LSK+L  GGWGESYLSCQ+KVYTN++
Sbjct  618   VCFTYAGWFGIKGLVAAGMTYNSSSSIRKACNYMLSKELAGGGWGESYLSCQNKVYTNLK  677

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
              ++ HIVNT WAMLALIEAGQ 
Sbjct  678   DDRPHIVNTGWAMLALIEAGQA  699



>ref|NP_001168640.1| hypothetical protein [Zea mays]
 gb|ACN28975.1| unknown [Zea mays]
 gb|AFW70111.1| hypothetical protein ZEAMMB73_823385 [Zea mays]
Length=759

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/684 (64%), Positives = 541/684 (79%), Gaps = 4/684 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD      +    V   R  F   R  +KHS+DLLMR+QF KE
Sbjct  12    DPWLRTKNAHVGRQVWEFD---AAADPDPAVDAARRAFVATRGHLKHSADLLMRIQFAKE  68

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                E+ L  +K+G  E+++EEAV+ TL+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  69    NSIELHLPGIKLGEHEDVTEEAVLTTLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLII  128

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV LR+LGE 
Sbjct  129   TLYVTGALNTVLSLEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVILRLLGEG  188

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY++P H
Sbjct  189   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVPPEVWLLPYLLPFH  248

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   +L LR+EL+   Y +IDWD ARN CAKEDL
Sbjct  249   PGRMWCHCRMVYLPMCYIYGKRFVGRITPLLLELRKELFKDPYSKIDWDKARNLCAKEDL  308

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP++  WP +KLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  309   YYPHPFVQDVLWATLHKFVEPVMMHWPGSKLREKALETVMQHVHYEDENTRYICIGPVNK  368

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLWLAEDGMKM GYNGSQLWD  F VQAI+ATNL
Sbjct  369   VLNMLACWIEDPNSEAFKLHIPRVYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIVATNL  428

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+ AH +I  SQ+ +D   + L  WYRH++KG WPFST D+GWP+SDCTAE L
Sbjct  429   IEEFGPTLKLAHNYIKNSQVLDDCPGD-LNDWYRHTSKGAWPFSTADHGWPISDCTAEGL  487

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LSR++  +VGE +E +R YDAV  ++S  N++GGFATYELTRSYPWLE++NP+ET
Sbjct  488   KASLLLSRISPKIVGEPMEANRFYDAVSCLMSYMNDNGGFATYELTRSYPWLELINPAET  547

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRKE++ CI+KA  FI++IQ  DGSWYGS
Sbjct  548   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKEVDNCISKASNFIESIQKSDGSWYGS  607

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G T+E+   IRKACDFLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  608   WAVCFTYGTWFGVKGLIAAGRTFENSPAIRKACDFLLSKELPSGGWGESYLSSQDQVYTN  667

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++GN+ H VNT+WAMLALI+AGQ 
Sbjct  668   LKGNRPHAVNTSWAMLALIDAGQA  691



>ref|XP_002269889.1| PREDICTED: cycloartenol Synthase-like [Vitis vinifera]
 ref|XP_010655254.1| PREDICTED: cycloartenol Synthase-like [Vitis vinifera]
 ref|XP_010655255.1| PREDICTED: cycloartenol Synthase-like [Vitis vinifera]
Length=758

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/685 (67%), Positives = 546/685 (80%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFDP+ GT EER +V+  R  F KNRF +K SSDLL RMQF +
Sbjct  11    NDPYMYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFRKNRFPVKPSSDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRRGL FYST+QAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCASNLPQIKVQDLEEVTEEVVTTTLRRGLNFYSTMQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ+EM +Y++NHQN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  131   ITLYITGALNVVLSIEHQREMCKYLFNHQNKDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+K RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WL PYI+PI
Sbjct  191   GGFGVEGAMEKGRKWILDHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYILPI  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSY+YGKR+VGPI  TI+ LR+ELY   Y ++DW+ ARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYIYGKRFVGPITPTIIYLRKELYIVPYQEVDWNKARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWASLHKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTCFAVQAIISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KG WPFST DNGWP SDCTAE 
Sbjct  431   LGEEYGLTLRKAHQFIKNSQVLEDCPGD-LKFWYRHISKGAWPFSTADNGWPTSDCTAEG  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK  L+L ++  + VGE ++  +L+DAV+++LSLQN  GGFATYELTRSY W E++NP+E
Sbjct  490   LKVVLLLCKLPLETVGEPLDMEQLFDAVNVVLSLQNADGGFATYELTRSYRWFELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  F+KL+P +RR EIE CI+KA  FI+  Q PDGSWYG
Sbjct  550   TFGDIVIDYPYVECTSAAIQALTSFKKLYPEHRRHEIENCISKAAKFIEDRQAPDGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ+KVYT
Sbjct  610   SWGVCFTYGGWFGIKGLIAAGNTYSNCPCIRKACDYLLSKELGSGGWGESYLSCQNKVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+  +K H VNTAWAMLALI+AGQ 
Sbjct  670   NLPEDKPHNVNTAWAMLALIDAGQA  694



>emb|CAC84559.1| cycloartenol synthase [Avena strigosa]
 gb|ADB83310.1| cycloartenol synthase [Avena strigosa]
Length=759

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/684 (64%), Positives = 538/684 (79%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHSSD LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPEALAAVEAARRDFAAGRHRLKHSSDRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PESGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGKITPLILELRNELYKTPYSKIDWDSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKALNHVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRVHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAITATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  FI++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANFIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G T++S   IRKAC+FL+SK+LP GGWG+SYLSCQD+VYTN
Sbjct  611   WAVCFTYGTWFGVKALVAAGRTFKSSPAIRKACEFLMSKELPFGGWGKSYLSCQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>ref|XP_004951930.1| PREDICTED: cycloartenol synthase-like [Setaria italica]
Length=757

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/684 (64%), Positives = 544/684 (80%), Gaps = 4/684 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD      E    V   R  F + R  +KHS+DL MR+QF KE
Sbjct  12    DPWLRTKNGHVGRQVWEFD---AAAEPDPAVDAARRAFAERRHDLKHSADLPMRIQFAKE  68

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  TL+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  69    NPLKLDLPAIKLDENEDVTEEAVSTTLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLII  128

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  129   TLYVSGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  188

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WLSVLGV+EWSGNNP+PPE+WLLPY++P H
Sbjct  189   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVPPEVWLLPYLLPFH  248

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   +L LR+EL+   Y +IDWD+ARNQCAKEDL
Sbjct  249   PGRMWCHCRMVYLPMCYIYGKRFVGRITPLVLELRKELFKDPYSKIDWDMARNQCAKEDL  308

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH  VEP++  WP +KLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  309   YYPHPFVQDVLWATLHKFVEPVMLHWPGSKLREKALETVMQHVHYEDENTRYICIGPVNK  368

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  F VQAI+ATNL
Sbjct  369   VLNMLACWIEDPNSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAIVATNL  428

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G+ L+ AH F+  SQ+++D   N L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  429   IEEFGTTLKLAHNFLKNSQVRDDCPGN-LDDWYRHKSKGAWPFSTADHGWPISDCTAEGL  487

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE++E ++ YDAV  ++S  N++GGFATYELTRSYPWLE++NP+ET
Sbjct  488   KASLLLSKISPEIVGESLEANQFYDAVSCLMSYMNDNGGFATYELTRSYPWLELINPAET  547

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FRKL+PG+RRKE+++CI+KA +FI++IQ  DGSWYGS
Sbjct  548   FGDIVIDYPYVECTSAAIQALTSFRKLYPGHRRKEVDSCISKAASFIESIQKSDGSWYGS  607

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G T+ES   IRKAC+FLLSK+LPSGGWGESYLS QD+VYTN
Sbjct  608   WAVCFTYGTWFGVKGLVAAGRTFESSPAIRKACEFLLSKELPSGGWGESYLSSQDQVYTN  667

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             ++G + H VNT WAMLALI AGQ 
Sbjct  668   LKGKRAHAVNTGWAMLALIGAGQA  691



>gb|AAT38889.1| cycloartenol synthase [Avena longiglumis]
Length=759

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/684 (64%), Positives = 537/684 (79%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHSSD LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPETLAAVEAARRDFAAGRHRLKHSSDRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PESGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+ G I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFFGKITPLILELRNELYKTPYSKIDWDSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKALNHVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRVHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAITATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  FI++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANFIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G T++S   IRKAC+FL+SK+LP GGWGESYLSCQD+VYTN
Sbjct  611   WAVCFTYGTWFGVKALVAAGRTFKSSPAIRKACEFLMSKELPFGGWGESYLSCQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>ref|XP_009379198.1| PREDICTED: cycloartenol synthase-like [Pyrus x bretschneideri]
Length=768

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/687 (67%), Positives = 539/687 (78%), Gaps = 6/687 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF P +G+ EE QQ++  R  F  NRF+ +HSSDLLMR+Q  KE  
Sbjct  19    WLKSVNNHLGRQVWEFHPEIGSPEELQQIEDARKAFWNNRFERQHSSDLLMRIQLAKENP  78

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
             +   L Q+KV  +E + EEAV  TLRR L FYS IQAHDGHW  D+GGP+FLLP LVI L
Sbjct  79    RATNLPQLKVKDQEGVKEEAVATTLRRALSFYSAIQAHDGHWAGDFGGPMFLLPGLVITL  138

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  D
Sbjct  139   SITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAD  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G GA++ ARKWILD GG T I SWGK+WLSVLG YEWSGNNPLPPELWL PY +P HPG
Sbjct  199   DGQGAIELARKWILDRGGVTAITSWGKVWLSVLGAYEWSGNNPLPPELWLCPYSLPFHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY   YH++DW+ ARN CAKEDLYY
Sbjct  259   RMWCHCRMVYLPMSYLYGKRFVGPITPTIRSLRKELYTVPYHEVDWNKARNLCAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             P P +QD++W  LH + EP+  +WP  +LR+ AL   M HI +EDE T Y+CIGPVNKVL
Sbjct  319   PRPMVQDVLWGSLHYVYEPVFTRWPAKELRESALKTVMQHIHYEDENTRYICIGPVNKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQ WD   A+QAII+TNL +
Sbjct  379   NMLCCWAEDPNSEAFKLHLPRIPDYLWIAEDGMKMQGYNGSQAWDTSLAIQAIISTNLVE  438

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG W FST D+GWPVSDCTAE LKA
Sbjct  439   EYGPTLRKAHQYIKDSQVLEDCPGD-LDYWYRHISKGAWSFSTADHGWPVSDCTAEGLKA  497

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++  + VGE+++  R YDAV++ILSLQN+ GGF+TYELTRSY WLE++NP+ETFG
Sbjct  498   ALLLSKLPTETVGESLDMKRFYDAVNVILSLQNDDGGFSTYELTRSYQWLELINPAETFG  557

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW---YG  429
             +I+IDY YVECTSAAI  L  FR+L PG+R  EIE CI +A  FI+TIQ  DGSW   YG
Sbjct  558   DIVIDYPYVECTSAAIQALALFRRLCPGHRSDEIENCIARAAKFIETIQAADGSWFVLYG  617

Query  428   SWGVCYTYGTWFGIR--GLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             SWGVC+TY  WFGI+  GLV  G TYE C  IRKACDFLLSK+LPSGGWGESYLSCQ+KV
Sbjct  618   SWGVCFTYAGWFGIKGLGLVTAGRTYEDCSSIRKACDFLLSKELPSGGWGESYLSCQNKV  677

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQV  174
             YTN++ N+ HIV TAWAMLALI AGQ 
Sbjct  678   YTNLKDNRPHIVQTAWAMLALIGAGQA  704



>ref|NP_190099.3| lanosterol synthase 1 [Arabidopsis thaliana]
 sp|Q1G1A4.1|LAS1_ARATH RecName: Full=Lanosterol synthase [Arabidopsis thaliana]
 gb|ABF57670.1| lanosterol synthase [Arabidopsis thaliana]
 dbj|BAE95408.1| lanosterol synthase [Arabidopsis thaliana]
 gb|AEE77996.1| lanosterol synthase 1 [Arabidopsis thaliana]
Length=756

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/683 (69%), Positives = 538/683 (79%), Gaps = 6/683 (1%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQEM  2031
             SVN H+GRQ+WE+D   GT EER  +  LR+ F  NRF  KHSSDLL R Q  KEKG+ M
Sbjct  13    SVNQHVGRQFWEYDNQFGTSEERHHINHLRSNFTLNRFSSKHSSDLLYRFQCWKEKGKGM  72

Query  2030  G-LQQVKV--GSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               L QVKV  G E  I+EE V  TLRR LRFYS +Q+ DG WP DYGGPLFLLP LVIGL
Sbjct  73    ERLPQVKVKEGEERLINEEVVNVTLRRSLRFYSILQSQDGFWPGDYGGPLFLLPALVIGL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V E ++  L  +HQ E+ RY+YNHQN DGGWGLH+EG+STMFCT L+YV LR++GEE D
Sbjct  133   YVTEVLDGTLTAQHQIEIRRYLYNHQNKDGGWGLHVEGNSTMFCTVLSYVALRLMGEELD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+GAM+ AR WI  HGGATFIPSWGK WLSVLG YEWSGNNPLPPELWLLPY +P HPG
Sbjct  193   GGDGAMESARSWIHHHGGATFIPSWGKFWLSVLGAYEWSGNNPLPPELWLLPYSLPFHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+V   N TILSLRRELY   YH IDWD ARNQCAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGRRFVCRTNGTILSLRRELYTIPYHHIDWDTARNQCAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  L+   EPLL +WP N LR  AL   M HI +ED+ ++Y+CIGPVNKVL
Sbjct  313   PHPKIQDVLWSCLNKFGEPLLERWPLNNLRNHALQTVMQHIHYEDQNSHYICIGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E  +S A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ATNL D
Sbjct  373   NMLCCWVESSNSEAFKSHLSRIKDYLWVAEDGMKMQGYNGSQLWDVTLAVQAILATNLVD  432

Query  959   EYGSMLRKAHLFINVSQIKED-SGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +YG ML+KAH +I  +QI++D SG   L  WYRH  KGGW FST DN WPVSDCTAEALK
Sbjct  433   DYGLMLKKAHNYIKNTQIRKDTSGDPGL--WYRHPCKGGWGFSTGDNPWPVSDCTAEALK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS+M  ++VGE +    L DAV+ ILSLQN +GGFA+YELTRSYP LE++NPSETF
Sbjct  491   AALLLSQMPVNLVGEPMPEEHLVDAVNFILSLQNKNGGFASYELTRSYPELEVINPSETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+IIIDYQYVECTSAAI GL  F  L+  Y+RKEI   INKA+ FI+  QLPDGSWYGSW
Sbjct  551   GDIIIDYQYVECTSAAIQGLVLFTTLNSSYKRKEIVGSINKAVEFIEKTQLPDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TY TWFGI+G++  G TYES   IRKAC FLLSKQL  GGWGESYLSCQ+KVYTN+
Sbjct  611   GVCFTYATWFGIKGMLASGKTYESSLCIRKACGFLLSKQLCCGGWGESYLSCQNKVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
              GNK HIVNT+WA+LALIEAGQ 
Sbjct  671   PGNKSHIVNTSWALLALIEAGQA  693



>ref|XP_008391431.1| PREDICTED: cycloartenol synthase isoform X2 [Malus domestica]
Length=708

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/682 (65%), Positives = 540/682 (79%), Gaps = 5/682 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++ N++GRQ WEFDP LGT EE  ++++ R  +  NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLXNNVGRQVWEFDPKLGTPEELLEIERARENYXNNRFVKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++E+ V  TL+RG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PVPAVLPQVKVKDTEDVTEKTVTNTLKRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL +EH+KE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+LGE  
Sbjct  132   LSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLTYVTLRLLGEGN  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILMHWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSTLRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++ +RLYDAV++ILSLQNN GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDANRLYDAVNVILSLQNNDGGFATYELTRSYSWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDY YVECTSA+I  L+ F+KL+P +RR+EIE CI +A+ FI+ IQ  DGSWYGSW
Sbjct  551   GDIVIDYPYVECTSASIQALESFKKLYPCHRREEIEHCIKRAVEFIEKIQASDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN-  246
             GVC+TYGTWFG++GLV  G  Y +   IRKACDFLLSKQL SGGW ESYLSCQ+K     
Sbjct  611   GVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLTSGGWSESYLSCQNKARCTQ  670

Query  245   ---IEGNKWHIVNTAWAMLALI  189
                + G  W I++    +L ++
Sbjct  671   ILRVIGLTWSILDGPCWLLLMV  692



>gb|AAT38888.1| cycloartenol synthase [Avena longiglumis]
Length=759

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/684 (64%), Positives = 536/684 (78%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHSSD LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPETLAAVEAARRDFAAGRHRLKHSSDRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PESGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+ G I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFFGKITPLILELRNELYKTPYSKIDWDSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKALNHVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRVHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAITATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  FI++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANFIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G T++S   IRKAC+FL+SK+LP GGWGESYLSCQD+VYTN
Sbjct  611   WAVCFTYGTWFGVKALVAAGRTFKSSPAIRKACEFLMSKELPFGGWGESYLSCQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML  I+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTQIDAGQA  694



>gb|AAT38890.1| cycloartenol synthase [Avena prostrata]
Length=759

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/684 (64%), Positives = 536/684 (78%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHS+D LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPEALAAVEAARRDFAAGRHRLKHSADRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                +  L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKSDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PESGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGKITPLILELRSELYKTPYSKIDWDSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL     H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKALNHVTQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRVHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAITATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  FI++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANFIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++ LV  G T++S   IRKAC+FL+SK+LP GGWGESYLSCQD+VYTN
Sbjct  611   WAVCFTYGTWFGVKALVAAGRTFKSSPAIRKACEFLMSKELPFGGWGESYLSCQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>ref|XP_010106929.1| hypothetical protein L484_008202 [Morus notabilis]
 gb|EXC12811.1| hypothetical protein L484_008202 [Morus notabilis]
Length=775

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/722 (63%), Positives = 541/722 (75%), Gaps = 61/722 (8%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++NNH+GRQ WEFDP+LG+ EE  +++K R  F   RFQ KHSSDLLMR+Q  KE
Sbjct  11    NPWLRTLNNHVGRQIWEFDPDLGSPEELAEIEKARQTFSSTRFQTKHSSDLLMRIQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                   L QV V   E+++EE V  TL+R L FYST+QAHDGHWP DYGGP+FL+P LVI
Sbjct  71    NPCSPLLPQVNVRDTEDVTEETVTNTLKRALNFYSTLQAHDGHWPGDYGGPMFLMPGLVI  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQ------------------------NIDGGWGL  1758
              LS+  A+NAVL EEH+KE+ RY+YNHQ                        N DGGWGL
Sbjct  131   TLSITGALNAVLSEEHKKEIRRYLYNHQARINFFGPLQFLTPFYDPITIIIFNKDGGWGL  190

Query  1757  HIEGHSTMFCTALNYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLG  1578
             HIEG STMF + L+YVTLR+LGEE + G GAM++                       VLG
Sbjct  191   HIEGPSTMFGSVLSYVTLRLLGEEANDGQGAMERG----------------------VLG  228

Query  1577  VYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRR  1398
             V+EWSGNNPLPPE+WLLPY VP+HPGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+
Sbjct  229   VFEWSGNNPLPPEIWLLPYFVPVHPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRK  288

Query  1397  ELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKAL  1218
             EL+   YH+I+WD ARN CAKEDLYYPHP IQDI+W  LH  VEP+L +WP  KLR+KAL
Sbjct  289   ELFTVPYHEINWDEARNLCAKEDLYYPHPLIQDILWASLHRGVEPILMRWPGKKLREKAL  348

Query  1217  TLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMK  1038
               AM+HI +EDE T Y+CIGPVNKVLNM+C W+E+P+S A K+H+ RI DYLW+AEDGMK
Sbjct  349   RTAMEHIHYEDENTRYICIGPVNKVLNMLCCWVEDPNSEAFKLHIPRIYDYLWIAEDGMK  408

Query  1037  MTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHS  858
             M GYNGSQLWD  FAVQAII+TNL +EYGS LRKAH FI  SQ+ ED   N L  WYRH 
Sbjct  409   MQGYNGSQLWDASFAVQAIISTNLINEYGSTLRKAHTFIKNSQVSEDCPGN-LDFWYRHI  467

Query  857   TKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNN  678
             +KG WPFST D+GWP+SDC +E LKA L+LS++  D+VGE IE  +LYDAV+++LSLQN 
Sbjct  468   SKGAWPFSTADHGWPISDCASEGLKAVLILSKLPSDIVGEPIESKQLYDAVNVVLSLQNG  527

Query  677   SGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEI  498
              GGFATYELTRSY WLE++NP+ETFG+I+IDY YVECTSA+I  L  F+KL+P +RR+EI
Sbjct  528   DGGFATYELTRSYAWLELVNPAETFGDIVIDYPYVECTSASIQALASFKKLYPEHRREEI  587

Query  497   EACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFL  318
             E CI KA  FI+ IQ  DGSWYGSWGVCYTYGTWFGI+GLV  G +YE+   IRKAC+FL
Sbjct  588   EQCIKKATAFIEKIQGSDGSWYGSWGVCYTYGTWFGIKGLVAAGKSYENSASIRKACNFL  647

Query  317   LSKQLPSGGWGESYLSCQDK--------------VYTNIEGNKWHIVNTAWAMLALIEAG  180
             LSKQLPSGGWGESYLSCQ+K              VY+N+EGN+ H+VNT WA+LALI+AG
Sbjct  648   LSKQLPSGGWGESYLSCQNKVDLVVNVNMSFSVQVYSNLEGNRSHVVNTGWAVLALIDAG  707

Query  179   QV  174
             Q 
Sbjct  708   QA  709



>ref|XP_009346737.1| PREDICTED: cycloartenol synthase-like [Pyrus x bretschneideri]
Length=765

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/684 (66%), Positives = 536/684 (78%), Gaps = 6/684 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL+SVNNH+GRQ WEF P +GT EE QQ++  R  F  NRF+ ++SSDLLMR+QF KE  
Sbjct  19    WLKSVNNHLGRQVWEFHPEIGTPEELQQIEDARKAFWNNRFERQNSSDLLMRIQFAKENP  78

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                 L Q+KV  +E + EEAV  TLRR L FYSTIQAHDGHW  DYGGP+FLLP LVI L
Sbjct  79    HATNLPQLKVKDQEGVKEEAVATTLRRALSFYSTIQAHDGHWAGDYGGPMFLLPGLVITL  138

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
             S+  AINAVL +EH++EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE  D
Sbjct  139   SITGAINAVLSKEHKREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAD  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
              G  A++ ARKWI DHGG T I SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P HPG
Sbjct  199   DGQVAIELARKWIFDHGGVTAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYSLPFHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY   YH++DW+ ARN CAKEDLYY
Sbjct  259   RMWCHCRMVYLPMSYLYGKRFVGPITPTIRSLRKELYTVPYHEVDWNKARNLCAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP +QD++W  LH + EP+  +WP  +LR+ AL   M HI +EDE T Y+CIGPVNKVL
Sbjct  319   PHPMVQDVLWGSLHYVYEPVFTRWPAKQLRESALKTVMQHIHYEDENTRYICIGPVNKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K+HL RI DYLW+AEDGMKM GYNGSQ WD  FA+QAII+TNL +
Sbjct  379   NMLCCWAEDPNSEAFKLHLPRIPDYLWIAEDGMKMQGYNGSQAWDTSFAIQAIISTNLVE  438

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKA
Sbjct  439   EYGPTLRKAHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLKA  497

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS++    VGE+++  R YDAV++ LSLQN+ GGFATYELTRSY WLE++NP+ETFG
Sbjct  498   ALLLSKLPTQTVGESLDMKRFYDAVNVTLSLQNDDGGFATYELTRSYQWLELINPAETFG  557

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I+IDY YVECTSAAI  L  F++L PG+R  EIE CI +A  FI+TIQ  DGSWYGSWG
Sbjct  558   DIVIDYPYVECTSAAIQALALFKRLCPGHRSDEIENCIARAAKFIETIQAADGSWYGSWG  617

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TY  WFGI+GLV  G TYE C  IRKACDFLLSK+LPSGGWGESYLSCQ+KVYTN++
Sbjct  618   VCFTYAGWFGIKGLVAAGRTYEDCSSIRKACDFLLSKELPSGGWGESYLSCQNKVYTNLK  677

Query  239   GNKWHIVNTAWAM--LALIEAGQV  174
              N+    N+++ M  + LI+ G V
Sbjct  678   DNR---PNSSYCMSYVDLIDIGPV  698



>gb|AAT38887.1| cycloartenol synthase [Avena clauda]
Length=759

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/684 (63%), Positives = 534/684 (78%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R EF   R ++KHS+D LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPEALAAVEAARREFAAGRHRLKHSADRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+L Y +PIH
Sbjct  192   PESGDGAMAKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEVWMLSYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGKITPLILELRNELYKTPYSKIDWDNARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMIHWPGNKLREKALNYVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRIHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIAATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  +I++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANYIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TY TWFG++ LV  G  ++S   IRKAC+FL+SK+LP GGWGESYLSC+D+VYTN
Sbjct  611   WAVCFTYATWFGVKALVAAGRPFKSSPAIRKACEFLMSKELPFGGWGESYLSCRDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>gb|AAT38892.1| cycloartenol synthase [Avena ventricosa]
Length=759

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/684 (63%), Positives = 534/684 (78%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFDP  G  E    V+  R +F   R ++KHSSD LMR+QFEKE
Sbjct  12    DPWLRTKNAHVGRQVWEFDPEAGDPETLAAVEAARRDFAAGRHRLKHSSDRLMRIQFEKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEENEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   TLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G+GAM K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+L Y +PIH
Sbjct  192   PESGDGAMAKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEVWMLSYRLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR ELY   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGKITPLILELRNELYKTPYSKIDWDNARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMIHWPGNKLREKALNYVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRIHDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIAATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IDEFAPTLKLAHNFIKNSQVLDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+++ ++VGE +E +RLYDAV+ ++S  NN+GGFATYELTRSY WLE++NP+ET
Sbjct  491   KAALLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNNNGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  +I++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANYIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TY TWFG++ LV  G  ++S   IRKAC+FL+SK+LP GGWGESYLSC+D+VYTN
Sbjct  611   WAVCFTYATWFGVKALVAAGRPFKSSPAIRKACEFLMSKELPFGGWGESYLSCRDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLTLIDAGQA  694



>gb|KEH27284.1| cycloartenol synthase [Medicago truncatula]
Length=775

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/697 (65%), Positives = 549/697 (79%), Gaps = 17/697 (2%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG-  2040
             +RSVN +IGRQ+WE+DPNLG ++ER QV+  R +FH NRF+ K+SSDLLMR+QFE+EKG 
Sbjct  17    VRSVNKNIGRQFWEYDPNLGNEQERAQVEHARKQFHVNRFKTKNSSDLLMRLQFEREKGV  76

Query  2039  ----QEMGLQQVKVGSEEE--ISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLP  1878
                  E    +VK+  EE   ISEE V +TL+R LR YST+Q  DG WP DYGGPLFLLP
Sbjct  77    LNMKSEKNNNKVKMEKEEGYIISEEKVGKTLKRALRCYSTLQTEDGFWPGDYGGPLFLLP  136

Query  1877  FLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRI  1698
              LVIGL V  A+NAVL  EHQ EM RY++NHQN DGGWGLHIEG STMF TA++YVTLR+
Sbjct  137   SLVIGLWVTGAVNAVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGPSTMFGTAMSYVTLRL  196

Query  1697  LGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             LGE+ D G+GAM+KARKWILD GGAT IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY 
Sbjct  197   LGEDIDSGDGAMQKARKWILDRGGATSIPSWGKLWLSVLGVYEWSGMKAIPPEIWLLPYF  256

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             VP+HPGRMWCH R+VYLPMSYLYG+R+VGP ++ +LS+RRE+Y   YH ++WD A+  CA
Sbjct  257   VPLHPGRMWCHTRLVYLPMSYLYGRRFVGPFSAIVLSIRREIYTLPYHILNWDHAKYHCA  316

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLY+P P IQ+I+W  L N+ EPLL  WP++KLR KAL   M HI +EDE TNY+C+G
Sbjct  317   KEDLYHPCPMIQNILWGFLDNVGEPLLMHWPYSKLRNKALNHVMKHIHYEDENTNYICLG  376

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNM+C W+E P+S A K H+ RIKDYLWLAEDGMKM GYNGSQ WDV  +VQAI+
Sbjct  377   PVNKVLNMVCCWLENPNSEAFKCHILRIKDYLWLAEDGMKMQGYNGSQCWDVALSVQAIL  436

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             ATNL DEYGSML+KA+ FI +SQ+  +   N    WYRH +KGGWPFST DNGWPVSDCT
Sbjct  437   ATNLDDEYGSMLKKANNFIKLSQVTMNRSGN-TSCWYRHISKGGWPFSTQDNGWPVSDCT  495

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AE LKAA++LS +  + VG+A+E  +L +AV+LILSLQN +GGFA+YELTRSY WLE +N
Sbjct  496   AEGLKAAILLSNLPIESVGKAVETEQLCNAVNLILSLQNRNGGFASYELTRSYTWLEKIN  555

Query  617   PSETFGEIIIDYQYV--------ECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQ  462
             P+ETF +I IDYQYV        ECTSAAI GL  F + +P +R+ EI+ CI K   +I+
Sbjct  556   PTETFEDITIDYQYVPDIDMFPLECTSAAIQGLALFTQQNPRHRKMEIDICIVKTANYIE  615

Query  461   TIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWG  285
             +IQ  DGSWYGSWG+C+TYGTWFGI+GL+  G +Y+    IRK C+FLLSKQ   SGGWG
Sbjct  616   SIQWADGSWYGSWGICFTYGTWFGIKGLIAAGKSYKDSISIRKGCEFLLSKQHKLSGGWG  675

Query  284   ESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             ESYLSCQ KVYTN+EGNK ++VNTAWAMLALIEAGQ 
Sbjct  676   ESYLSCQHKVYTNLEGNKSNVVNTAWAMLALIEAGQA  712



>gb|AEM42982.1| cucurbitadienol synthase [Siraitia grosvenorii]
Length=759

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/685 (64%), Positives = 535/685 (78%), Gaps = 3/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D+ WL+S++NH+GRQ WEF P+ GTQ++  QV K R  FH +RF  K SSDL + +Q+ K
Sbjct  15    DEKWLKSISNHLGRQVWEFCPDAGTQQQLLQVHKARKAFHDDRFHRKQSSDLFITIQYGK  74

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E         VK+   EE+ +EAV  +L R L FYS+IQ  DG+W +D GGP+FLLP LV
Sbjct  75    EVENGGKTAGVKLKEGEEVRKEAVESSLERALSFYSSIQTSDGNWASDLGGPMFLLPGLV  134

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V   +N+VL + H++EM RY+YNHQN DGGWGLHIEG STMF +ALNYV LR+LGE
Sbjct  135   IALYVTGVLNSVLSKHHRQEMCRYVYNHQNEDGGWGLHIEGPSTMFGSALNYVALRLLGE  194

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               D   GAM KAR WILDHGGAT I SWGKLWLSVLGVYEWSGNNPLPPE WL PY +P 
Sbjct  195   --DANAGAMPKARAWILDHGGATGITSWGKLWLSVLGVYEWSGNNPLPPEFWLFPYFLPF  252

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+ELY   YH+IDW+ +RN CAKED
Sbjct  253   HPGRMWCHCRMVYLPMSYLYGKRFVGPITPIVLSLRKELYAVPYHEIDWNKSRNTCAKED  312

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LH++ EPL  +WP  +LR+KAL  AM HI +EDE T Y+C+GPVN
Sbjct  313   LYYPHPKMQDILWGSLHHVYEPLFTRWPAKRLREKALQTAMQHIHYEDENTRYICLGPVN  372

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLN++C W+E+P S A K+HL R+ DYLW+AEDGMKM GYNGSQLWD  F++QAI++T 
Sbjct  373   KVLNLLCCWVEDPYSDAFKLHLQRVHDYLWVAEDGMKMQGYNGSQLWDTAFSIQAIVSTK  432

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L D YG  LRKAH F+  SQI++D   +    WYRH  KG WPFST D+GW +SDCTAE 
Sbjct  433   LVDNYGPTLRKAHDFVKSSQIQQDCPGD-PNVWYRHIHKGAWPFSTRDHGWLISDCTAEG  491

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAALMLS++  + VGE++E +RL DAV+++LSLQN++GGFA+YELTRSYPWLE++NP+E
Sbjct  492   LKAALMLSKLPSETVGESLERNRLCDAVNVLLSLQNDNGGFASYELTRSYPWLELINPAE  551

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSA +  L  F+KLHPG+R KEI+  I +A  F++ +Q  DGSWYG
Sbjct  552   TFGDIVIDYPYVECTSATMEALTLFKKLHPGHRTKEIDTAIVRAANFLENMQRTDGSWYG  611

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
              WGVC+TY  WFGI+GLV  G TY +C  IRKACDFLLSK+LP GGWGESYLSCQ+KVYT
Sbjct  612   CWGVCFTYAGWFGIKGLVAAGRTYNNCLAIRKACDFLLSKELPGGGWGESYLSCQNKVYT  671

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGN+ H+VNTAW ++ALIEAGQ 
Sbjct  672   NLEGNRPHLVNTAWVLMALIEAGQA  696



>gb|KEH22896.1| cycloartenol synthase [Medicago truncatula]
Length=777

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/697 (66%), Positives = 544/697 (78%), Gaps = 14/697 (2%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +D  +RSVN HIGRQ+WEFDP+LGT++ER QV++ R +F++NRF  K+SSDLLMR+QFE+
Sbjct  11    EDELIRSVNKHIGRQFWEFDPHLGTEQERAQVEQARKQFNQNRFNNKNSSDLLMRLQFER  70

Query  2048  EKGQEMGLQQVKVGS----------EEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYG  1899
             EKG +M L      +          E+ ISEE V RTL+R LR YST+Q  DG WP DYG
Sbjct  71    EKGSKMKLLLDNSNNNNKVKVKKELEDVISEEIVRRTLKRALRNYSTLQVEDGFWPGDYG  130

Query  1898  GPLFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTAL  1719
             GPLFLLP LVIGL V  +INAVL  EHQ EM RY++N QN DGGWGLHIEG STMF TA+
Sbjct  131   GPLFLLPSLVIGLWVTGSINAVLTPEHQTEMRRYLFNQQNKDGGWGLHIEGPSTMFGTAM  190

Query  1718  NYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppe  1539
             +YVTLR+LGE+ D G+GAM+ AR WIL+ GGAT IPSWGKLWL+VLGVYEWSG   +PPE
Sbjct  191   SYVTLRLLGEDTDSGDGAMQNARMWILNRGGATSIPSWGKLWLAVLGVYEWSGMKAIPPE  250

Query  1538  lwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWD  1359
             +WLLP  VP HPG+MWCH R+VYLPMSYLYG+R+VGP +S +LSLRRELY   YH +DWD
Sbjct  251   MWLLPDFVPFHPGKMWCHSRLVYLPMSYLYGRRFVGPFSSIVLSLRRELYTIPYHLVDWD  310

Query  1358  LARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDET  1179
              A++QCAKEDLY+P P IQ+I+W  L N+ EPLL  WP++KLR KAL   M HI +ED+ 
Sbjct  311   SAKHQCAKEDLYHPCPTIQNILWAFLDNVGEPLLMHWPYSKLRNKALDHVMKHIHYEDQN  370

Query  1178  TNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVG  999
             TNY+C+GPVNKVLNM+C W+E PDS A K HLSRIKDYLWLAEDGMKM GYNGSQ WDV 
Sbjct  371   TNYICLGPVNKVLNMVCCWVENPDSEAFKYHLSRIKDYLWLAEDGMKMQGYNGSQCWDVA  430

Query  998   FAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSW-YRHSTKGGWPFSTPDN  822
              +VQAI+AT L DEYGSML+KA+ FI  SQI  D   N   SW YRH  KGGWPFST D+
Sbjct  431   LSVQAILATKLDDEYGSMLKKANNFIKSSQIAMDMSGN--SSWCYRHINKGGWPFSTQDH  488

Query  821   GWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRS  642
             GWPVSDCTAE LKAA++LS +  + VG+ +E  +L DAV+LILSLQN +GGFA+YELTRS
Sbjct  489   GWPVSDCTAEGLKAAILLSNLPFESVGKTVEIEQLCDAVNLILSLQNRNGGFASYELTRS  548

Query  641   YPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQ  462
             Y W+E +NPSETF +I IDYQYVECTSA I GL  F + +P +RR EIE CI KA  +I+
Sbjct  549   YAWMEKINPSETFEDITIDYQYVECTSAVIQGLALFTQRYPHHRRMEIETCIAKAAKYIE  608

Query  461   TIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWG  285
             +IQ  DGSWYGSWG+C+TYGTWFGI+GL+  G  Y+    IR AC+FLLSKQ   SGGWG
Sbjct  609   SIQSDDGSWYGSWGICFTYGTWFGIKGLIAAGRRYKDNKSIRMACEFLLSKQHKLSGGWG  668

Query  284   ESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             ESYLS Q+KVYTN+EGNK H+VNTAWAM+ LIE GQ 
Sbjct  669   ESYLSAQNKVYTNLEGNKSHVVNTAWAMMGLIEGGQA  705



>ref|XP_010655252.1| PREDICTED: cycloartenol Synthase isoform X1 [Vitis vinifera]
 emb|CBI18411.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/685 (67%), Positives = 545/685 (80%), Gaps = 2/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ + NN +GRQ WEFDP+ GT EER +V+  R  F KNRF +K SSDLL RMQF +
Sbjct  11    NDPYIYTTNNFVGRQIWEFDPDYGTPEERAEVEAARENFRKNRFPVKPSSDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRRGL FYST+QAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCVANLPQIKVQDLEEVTEEVVTTTLRRGLNFYSTMQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ EM RY++NHQN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  131   ITLHITGALNVVLSIEHQHEMCRYLFNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+  RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLP E+WL PYI+PI
Sbjct  191   GGFGVEGAMENGRKWILDHGGATAITSWGKMWLSVLGAYEWSGNNPLPTEVWLCPYILPI  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSY+YGKR+VGPI  TI+SLR ELY   Y ++DW+ ARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYIYGKRFVGPITPTIISLRNELYIVPYQEVDWNQARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LHN++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWASLHNVIEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM G NGSQLWD  FAVQA I+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIIDYLWIAEDGMKMQGCNGSQLWDTCFAVQAFISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KGGWPFST DNGW  SDCTAEA
Sbjct  431   LGEEYGLTLRKAHQFIKNSQVLEDCPGD-LKFWYRHISKGGWPFSTADNGWTTSDCTAEA  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  + VGE ++  +L+DAV++ILSLQN  GGFATYELTRSY W+E++NP+E
Sbjct  490   LKAVLLLSKLLLETVGEPLDMGQLFDAVNVILSLQNEDGGFATYELTRSYRWVELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTS+AI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSW+ 
Sbjct  550   TFGDIVIDYPYVECTSSAIQALTSFKKLYPEHRRHEIENCISKAAMFIEDIQAPDGSWF-  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             +WGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSC +KVYT
Sbjct  609   AWGVCFTYGGWFGIKGLIAAGNTYNNCPCIRKACDYLLSKELASGGWGESYLSCPNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G+K H  NTAWAMLALI+AGQ 
Sbjct  669   NLPGDKPHNCNTAWAMLALIDAGQA  693



>ref|XP_003620644.1| Lanosterol synthase [Medicago truncatula]
 gb|AES76862.1| cycloartenol synthase [Medicago truncatula]
Length=741

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/682 (66%), Positives = 541/682 (79%), Gaps = 21/682 (3%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             +RSVN +IGRQ+WE+DPNLGT+++R QV++ R +FH+NRF+ K+SSDLLMR+Q + EK  
Sbjct  17    VRSVNKNIGRQFWEYDPNLGTEQKRAQVEQARKQFHENRFKTKNSSDLLMRLQVKMEK--  74

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                              E V +TL+R LRFYST+Q  DG WP DYGGPLFLLP LVIGL 
Sbjct  75    -----------------EEVGKTLKRALRFYSTLQTEDGFWPGDYGGPLFLLPSLVIGLW  117

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
             V  A+NAVL  EHQ EM RY++NHQN DGGWGLHIEG STMF TA++YVTLR+LGE+ D 
Sbjct  118   VTGAVNAVLTPEHQSEMRRYVFNHQNEDGGWGLHIEGPSTMFGTAMSYVTLRLLGEDIDS  177

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
             G+GAM+KARKWILD GGAT IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY VP+HPGR
Sbjct  178   GDGAMQKARKWILDRGGATSIPSWGKLWLSVLGVYEWSGMKAIPPEIWLLPYFVPLHPGR  237

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCH R+VYLPMSYLYG+R+VGP ++ +LS+RRE+Y   YH ++WD A+  CAKEDLY+P
Sbjct  238   MWCHTRLVYLPMSYLYGRRFVGPFSAIVLSIRREIYTLPYHILNWDHAKYHCAKEDLYHP  297

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
              P IQ+I+W  L N+ EPLL  WP++KLR KAL   M HI +EDE TNY+C+GPVNKVLN
Sbjct  298   CPMIQNILWGFLDNVGEPLLMHWPYSKLRNKALNHVMKHIHYEDENTNYICLGPVNKVLN  357

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+C W+E P+S A K H+ RIKDYLWLAEDGMKM GYNGSQ WDV  +VQAI+ATNL DE
Sbjct  358   MVCCWLENPNSEAFKCHILRIKDYLWLAEDGMKMQGYNGSQCWDVALSVQAILATNLDDE  417

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
             YGSML+KA+ FI +SQ+  +S  N    WYRH +KGGWPFST DNGWPVSDCTAE LKAA
Sbjct  418   YGSMLKKANNFIKLSQVTMNSSGN-TSCWYRHISKGGWPFSTQDNGWPVSDCTAEGLKAA  476

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             ++LS +  + VG+A+E  +L +AV+LILSLQN +GGFA+YELTRSY WLE +NP+ETF +
Sbjct  477   ILLSNLPIESVGKAVETEQLCNAVNLILSLQNRNGGFASYELTRSYTWLEKINPTETFED  536

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I IDYQYVECTSAAI GL  F + +P +R+ EI+ CI K   +I++IQ  DGSWYGSWG+
Sbjct  537   ITIDYQYVECTSAAIQGLALFTQQNPRHRKMEIDICIVKTANYIESIQWADGSWYGSWGI  596

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWGESYLSCQDKVYTNIE  240
             C+TYGTWFGI+GL+  G +Y+    IRK C+FLLSKQ   SGGWGESYLSCQ KVYTN+E
Sbjct  597   CFTYGTWFGIKGLIAAGKSYKDSVSIRKGCEFLLSKQHKLSGGWGESYLSCQHKVYTNLE  656

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             GNK H+VNTAWAMLALIEAGQ 
Sbjct  657   GNKSHVVNTAWAMLALIEAGQA  678



>dbj|BAA85267.1| oxidosqualene cyclase [Luffa aegyptiaca]
Length=760

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/685 (67%), Positives = 559/685 (82%), Gaps = 4/685 (1%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNL-GTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             W  S N+H+GRQYWEFDPNL  ++EER +++ +  EFHKNRF +K SSDLLMR+Q  KE 
Sbjct  10    WETSENDHVGRQYWEFDPNLEPSEEERAEIENVCNEFHKNRFHVKQSSDLLMRLQLRKEN  69

Query  2042  GQEMGL-QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                + L  Q+KV SEEEISEEAV  TLRR +RFYST+Q  DG WP DYGGPLFLLP LVI
Sbjct  70    ASNVKLLTQIKVASEEEISEEAVETTLRRAIRFYSTMQTQDGFWPGDYGGPLFLLPGLVI  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
             GLSV  A+N  L   H+++M RY+YNHQN DGGWGLHIEG+STM CTAL+YV+LR++GEE
Sbjct  130   GLSVTNALNVALSCNHRQQMCRYLYNHQNEDGGWGLHIEGNSTMLCTALSYVSLRLMGEE  189

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY-IVPI  1509
              DG +GA+ KAR+WILD GGAT IPSWGK+WLSVLGVYEW GNNPL PE+WLLPY I+P 
Sbjct  190   MDGHDGALPKARRWILDRGGATSIPSWGKIWLSVLGVYEWEGNNPLLPEIWLLPYNILPF  249

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCH RMVYLPMSYLYGKR+VG I+  ++SLRRELY   YH +DW+ +RN CAKED
Sbjct  250   HPGRMWCHSRMVYLPMSYLYGKRFVGSISPIVMSLRRELYKCPYHMVDWNSSRNLCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LY PH  IQD++WD ++   EP + KWP +KLR++AL L + HI +EDE T+Y+C+GPVN
Sbjct  310   LYTPHSKIQDMLWDSINKFGEPFMKKWPLSKLRQRALDLVIQHIHYEDENTHYLCLGPVN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+ +S A + H+SRIKDYLWLAEDGMKM GYNGSQLWDV FAVQA++A +
Sbjct  370   KVLNMVCCWVEDQNSEAFRRHISRIKDYLWLAEDGMKMQGYNGSQLWDVAFAVQAVVAAD  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYGS+L+KAH F+  SQ++ + G+     WYRH +KGGWPFSTPDNGWPVSDCT+EA
Sbjct  430   LVEEYGSVLKKAHDFVKNSQVRRN-GLGDSSDWYRHISKGGWPFSTPDNGWPVSDCTSEA  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK A++LS+M   +VGE I+  +LYDAV+LILSLQN +GGFA+YELTRSYPWLE+ NP+E
Sbjct  489   LKVAILLSKMPSTMVGEPIDVDKLYDAVNLILSLQNPNGGFASYELTRSYPWLEMFNPAE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
              FG+++IDYQYVECTSAAI GLK F +LHPG+R+KEI+ CI KA  FI++IQ  DGSWYG
Sbjct  549   IFGDVMIDYQYVECTSAAIQGLKAFMQLHPGHRKKEIQKCIAKAANFIESIQQTDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWG+CYTYGTWFGI+GLV  G TY++   IRKA +FLLSKQL SGGWGESYLS   KVYT
Sbjct  609   SWGICYTYGTWFGIKGLVACGRTYDNSKSIRKATEFLLSKQLKSGGWGESYLSAHHKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N++G K HIVNT+WA+LALI+AGQ 
Sbjct  669   NLKGCKSHIVNTSWALLALIKAGQA  693



>emb|CBI18419.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/729 (63%), Positives = 545/729 (75%), Gaps = 45/729 (6%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFD + GT EER +V+  R  F KNRF +K S DLL RMQF +
Sbjct  11    NDPYMYSTNNFVGRQIWEFDADYGTPEERAEVEAARENFWKNRFPVKPSCDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   +E++EE V+ TLRRGL FYSTIQAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCVANLPQIKVQDLKEVTEEVVMTTLRRGLNFYSTIQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQ-------------------------------  1782
             I L +  A+N VL  EHQ+EM RY++NHQ                               
Sbjct  131   ITLYITGALNVVLSIEHQREMCRYLFNHQARLFSYILALLKYYGLLLLLTVTSLSFYRIQ  190

Query  1781  -------------NIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGGNGAMKKARKWI  1641
                          N DGGWGLHIEG STMF T L+YVTLR+LGE   G  GAM+K RKWI
Sbjct  191   DSDDRDININYYVNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGEGGFGAEGAMEKGRKWI  250

Query  1640  LDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPM  1461
             LDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WL PYI+PIHPGRM C CRMVYLPM
Sbjct  251   LDHGGATSITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYILPIHPGRMNCPCRMVYLPM  310

Query  1460  SYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGL  1281
             SY+YGKR+VGPI  TI+SLR ELY   Y ++DW+ ARNQCAKEDLYYPHP +QDI+W  L
Sbjct  311   SYIYGKRFVGPITPTIISLRNELYIVPYQEVDWNQARNQCAKEDLYYPHPLVQDILWASL  370

Query  1280  HNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSI  1101
             H ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNKVLNM+C WIE+P+S 
Sbjct  371   HKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVNKVLNMLCCWIEDPNSE  430

Query  1100  AVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFI  921
             A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL +EYG  LRKAH FI
Sbjct  431   AFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTCFAVQAIISTNLGEEYGLTLRKAHQFI  490

Query  920   NVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVG  741
               SQ+ ED   + L+ WYRH +KG WPFST DNGWP SDCTAE LKA L+LS++  + VG
Sbjct  491   KNSQVLEDCPGD-LKFWYRHISKGAWPFSTADNGWPTSDCTAEGLKAILLLSKLPLETVG  549

Query  740   EAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTS  561
             E ++  +L+DAV++ILSLQN  GGFATYELTRSY W+E++NP+ETFG+++IDY  VECTS
Sbjct  550   EPLDMEQLFDAVNVILSLQNADGGFATYELTRSYRWVELINPTETFGDVVIDYPCVECTS  609

Query  560   AAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRG  381
             AAI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSWYGSWGVC+TYG WFGI+G
Sbjct  610   AAIQALISFKKLYPEHRRHEIENCISKAAKFIEDIQAPDGSWYGSWGVCFTYGGWFGIKG  669

Query  380   LVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAM  201
             L+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ KVYTN+  +K + VNTAWAM
Sbjct  670   LIAAGNTYSNCPCIRKACDYLLSKELASGGWGESYLSCQSKVYTNLPEDKPNNVNTAWAM  729

Query  200   LALIEAGQV  174
             LALI+AGQ 
Sbjct  730   LALIDAGQA  738



>ref|XP_010655253.1| PREDICTED: cycloartenol Synthase isoform X2 [Vitis vinifera]
Length=757

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/685 (67%), Positives = 543/685 (79%), Gaps = 2/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFD + GT EER +V+  R  F KNRF +K S DLL RMQF +
Sbjct  11    NDPYMYSTNNFVGRQIWEFDADYGTPEERAEVEAARENFWKNRFPVKPSCDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRRGL FYST+QAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCVANLPQIKVQDLEEVTEEVVTTTLRRGLNFYSTMQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A+N VL  EHQ EM RY++NHQN DGGWGLHIEG STMF T L+YVTLR+LGE
Sbjct  131   ITLHITGALNVVLSIEHQHEMCRYLFNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
                G  GAM+  RKWILDHGGAT I SWGK+WLSVLG YEWSGNNPLP E+WL PYI+PI
Sbjct  191   GGFGVEGAMENGRKWILDHGGATAITSWGKMWLSVLGAYEWSGNNPLPTEVWLCPYILPI  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGRMWCHCRMVYLPMSY+YGKR+VGPI  TI+SLR ELY   Y ++DW+ ARNQCAKED
Sbjct  251   HPGRMWCHCRMVYLPMSYIYGKRFVGPITPTIISLRNELYIVPYQEVDWNQARNQCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QDI+W  LHN++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVN
Sbjct  311   LYYPHPLVQDILWASLHNVIEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVN  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C WIE+P+S A K+H+ RI DYLW+AEDGMKM G NGSQLWD  FAVQA I+TN
Sbjct  371   KVLNMLCCWIEDPNSEAFKLHIPRIIDYLWIAEDGMKMQGCNGSQLWDTCFAVQAFISTN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  LRKAH FI  SQ+ ED   + L+ WYRH +KGGWPFST DNGW  SDCTAEA
Sbjct  431   LGEEYGLTLRKAHQFIKNSQVLEDCPGD-LKFWYRHISKGGWPFSTADNGWTTSDCTAEA  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKA L+LS++  + VGE ++  +L+DAV++ILSLQN  GGFATYELTRSY W+E++NP+E
Sbjct  490   LKAVLLLSKLLLETVGEPLDMGQLFDAVNVILSLQNEDGGFATYELTRSYRWVELINPAE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTS+AI  L  F+KL+P +RR EIE CI+KA  FI+ IQ PDGSW+ 
Sbjct  550   TFGDIVIDYPYVECTSSAIQALTSFKKLYPEHRRHEIENCISKAAMFIEDIQAPDGSWF-  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             +WGVC+TYG WFGI+GL+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSC +KVYT
Sbjct  609   AWGVCFTYGGWFGIKGLIAAGNTYNNCPCIRKACDYLLSKELASGGWGESYLSCPNKVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+ G+K H  NTAWAMLALI+AGQ 
Sbjct  669   NLPGDKPHNCNTAWAMLALIDAGQA  693



>ref|XP_006453177.1| hypothetical protein CICLE_v10007530mg [Citrus clementina]
 gb|ESR66417.1| hypothetical protein CICLE_v10007530mg [Citrus clementina]
Length=767

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/690 (65%), Positives = 537/690 (78%), Gaps = 5/690 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             ++PW+RS+NNH+GRQ WEF+P+LGT EE  QV+KLR +F KNRFQ+KHSSDLLMR+QF K
Sbjct  11    NEPWVRSLNNHVGRQVWEFEPSLGTPEELAQVEKLRNDFTKNRFQMKHSSDLLMRLQFVK  70

Query  2048  EKGQEMGLQ--QVKVGSEEEISEEAVVR--TLRRGLRFYSTIQAHDGHWPADYGGPLFLL  1881
             E   +M  Q  QVKV    E          TLRR LRFYST+Q+ DG WP DY GPLFLL
Sbjct  71    ENPCDMKRQLPQVKVEENSEEEVNEEAVNTTLRRALRFYSTLQSEDGFWPGDYAGPLFLL  130

Query  1880  PFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLR  1701
             P LVIGL +   +N +LQ E+++EMLRY+YNHQN DGGWGLHIEG STM  T L+YV LR
Sbjct  131   PCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGESTMLNTVLSYVGLR  190

Query  1700  ILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY  1521
             +LGE  DGG+GA++KARKWIL  GGAT+IPSWGK+WLSVLGVY+WSGNNP+PPE WLLP 
Sbjct  191   LLGERMDGGDGAIEKARKWILGRGGATYIPSWGKIWLSVLGVYDWSGNNPIPPETWLLPD  250

Query  1520  IVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQC  1341
              +P HPGRMWCH R+V LP SYLYGKR+VG INS +L LR ELY   Y +IDW+ AR  C
Sbjct  251   FLPTHPGRMWCHTRLVLLPTSYLYGKRFVGKINSLVLCLREELYTRPYEKIDWNRARFLC  310

Query  1340  AKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCI  1161
             A+EDLY  HP  QD++W+  H + EPLL KWPF+K+R+ AL   M HI +EDE T Y+CI
Sbjct  311   AQEDLYRQHPMFQDMLWNFSHKVAEPLLKKWPFSKIRQIALDTVMKHIHYEDENTQYICI  370

Query  1160  GPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAI  981
               VNKVLNM+CRW+E+P+S A K HL+RIKDYLW+AEDGMKM  YNGSQLWD  FAV AI
Sbjct  371   AGVNKVLNMLCRWVEDPNSEAYKHHLARIKDYLWVAEDGMKMQAYNGSQLWDTAFAVHAI  430

Query  980   IATNLCDEYGSMLRKAHLFINVSQ-IKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             ++TNL DEYGSML+KA+ +I  +Q I     ++YL  WYRH  + GWPFS+ DNGW  +D
Sbjct  431   LSTNLVDEYGSMLKKANNYIKTTQVINSLPNLSYLSCWYRHEFQEGWPFSSLDNGWIATD  490

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
              TAE L  +++LS M+ D+VGEAI  +RL++AV+++LSLQN+SGG A+YE TRSY W+E+
Sbjct  491   TTAEGLNVSVLLSEMSYDLVGEAIPLNRLFEAVNVVLSLQNSSGGVASYERTRSYAWMEM  550

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             LNP E FGE IIDYQYVECTS+ I  LK F K +P +RR+EIE  I K   FI++IQ PD
Sbjct  551   LNPVENFGESIIDYQYVECTSSTIQCLKSFTKHYPKHRRREIEEFIAKGANFIESIQRPD  610

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSWGVC+TYGTWFGI+GLV  G  YE+   IRKACDFLLSKQL SGGWGESYLSC 
Sbjct  611   GSWYGSWGVCFTYGTWFGIKGLVDSGRKYENSQSIRKACDFLLSKQLDSGGWGESYLSCV  670

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             D+VYTN+EGNK H VNTAWAMLALIEAGQ 
Sbjct  671   DRVYTNLEGNKAHNVNTAWAMLALIEAGQA  700



>gb|KHN10150.1| Cycloartenol synthase [Glycine soja]
Length=760

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/685 (64%), Positives = 548/685 (80%), Gaps = 1/685 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +D  +RSVNNHIGR +WEFDP+LG +EER +V+++R E++KNRF+ KHSSDLLMR+QFE+
Sbjct  11    EDECVRSVNNHIGRHFWEFDPDLGNEEERAEVERVRKEYNKNRFKYKHSSDLLMRLQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             EKG +M L +++  SEE+I+ E V   L+R LR  S +QA DG WP DY GPLFLLP LV
Sbjct  71    EKGLKMKLSKMENQSEEDITVELVETRLKRALRSLSILQAEDGFWPNDYSGPLFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             IGLSV+ A+N +L  EHQ E+ RY++NHQN DGGWG+HIEG S MF +ALNYVTLR+LGE
Sbjct  131   IGLSVIGALNEILTPEHQSEIRRYLFNHQNEDGGWGMHIEGSSIMFTSALNYVTLRLLGE  190

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
             + +GG GA++KAR WILDHGGAT+IPSWGKLWLSVLGVYEWSG  P+PPE+WL PY VP 
Sbjct  191   DINGGEGAIQKARTWILDHGGATYIPSWGKLWLSVLGVYEWSGMKPIPPEIWLFPYFVPF  250

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPGR+W H R VYLPMSYLYGKR++GPIN+ +LSLRRELY   Y+ +DW+ A+N CAKED
Sbjct  251   HPGRIWSHARQVYLPMSYLYGKRFIGPINALVLSLRRELYTLPYNLLDWNQAKNSCAKED  310

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             + +P   IQ+I+WD  H+I EPLL  WPF+KLR++AL   M+HI +EDE TNY+C+ P++
Sbjct  311   MSHPSSMIQNILWDSFHSIGEPLLMHWPFSKLRQEALCHVMEHIHYEDENTNYICLAPIS  370

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E P+S   K H+ RIKDYLW+AEDGMKM  Y GSQLWD  F++QAI+ATN
Sbjct  371   KVLNMVCCWLENPNSQTFKRHIPRIKDYLWVAEDGMKMQAYGGSQLWDTVFSIQAILATN  430

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L DEYGSML+KA+ FI  SQI  +S       WYRH +KGGW FST DNGWPVSDCT EA
Sbjct  431   LKDEYGSMLKKANNFIKCSQITTNSS-GTPSDWYRHISKGGWTFSTADNGWPVSDCTGEA  489

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LKAA++LS M+ D+V  A+E  +LYD V+ ILS+QN +GGFA +ELTRSY WLE LNP+E
Sbjct  490   LKAAILLSNMSFDIVDRAMEVEQLYDGVNWILSMQNKNGGFAGFELTRSYAWLEKLNPTE  549

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TF +++ID Q+VECT++AI GL  F + +PG+R+KEIE CI KA  +I+++QL DGSWYG
Sbjct  550   TFEDVMIDRQFVECTTSAIGGLALFTQRYPGHRKKEIEICIAKAANYIESMQLADGSWYG  609

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVCYTYGTWFGI+GL+  G +Y+    IR+ C+FLLSKQ   GGWGESY++CQ  VYT
Sbjct  610   SWGVCYTYGTWFGIKGLIVAGKSYQDSQSIRRGCEFLLSKQQLCGGWGESYITCQTMVYT  669

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EGNK ++VNTAWAMLALIEAGQ 
Sbjct  670   NLEGNKSNVVNTAWAMLALIEAGQA  694



>ref|XP_004513136.1| PREDICTED: cycloartenol synthase-like [Cicer arietinum]
Length=769

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/688 (65%), Positives = 540/688 (78%), Gaps = 4/688 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D+  +RSVN HIGRQ+WEFDPNLGTQ+ER QV++ R EFH NRF     SDLLMR QFE+
Sbjct  11    DEELVRSVNKHIGRQFWEFDPNLGTQQERAQVEQARNEFHHNRFITNTISDLLMRFQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRT--LRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             EKG +M     KV  ++E      V    L+R LR  S +QA DG WP DYGGPLFL+P 
Sbjct  71    EKGLKMKDSDYKVKMKKEEEVTEEVVEMTLKRALRNVSMMQADDGFWPGDYGGPLFLMPS  130

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LVIGL V  A+NAVL  +HQ EM RY++NHQN DGGWGLHI G STMF TAL+YVTLR+L
Sbjct  131   LVIGLWVTGALNAVLSPDHQTEMRRYLFNHQNKDGGWGLHIAGPSTMFGTALSYVTLRLL  190

Query  1694  GEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             GEE DGGNG+M+KAR+WILD GGAT IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY V
Sbjct  191   GEEMDGGNGSMQKARRWILDRGGATSIPSWGKLWLSVLGVYEWSGMKSIPPEIWLLPYFV  250

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P HPG+MWCH R+VYLPMSYLYG R+VGP    I SLR ELY   YH + WD A+  CAK
Sbjct  251   PFHPGKMWCHTRLVYLPMSYLYGTRFVGPFTPIISSLRTELYTIPYHLLQWDQAKYLCAK  310

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLY+P   I +I+W  L N+ EPLL  WP++KLR+KAL   M+HI +ED+ TNY+C+GP
Sbjct  311   EDLYHPCSMIHNILWAFLDNVGEPLLMHWPYSKLRQKALNHVMEHIHYEDQNTNYLCLGP  370

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNM+C W+E+P+S A K H+SR+KDYLW+AEDGMKM GYNGSQ WDV  +VQAI++
Sbjct  371   VNKVLNMVCCWLEDPNSEAFKYHISRVKDYLWVAEDGMKMQGYNGSQSWDVALSVQAILS  430

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             TNL D YGS+L+KA+ FI  SQ++ +   N   SWYRH  KGGWPFST DNGW VSDCTA
Sbjct  431   TNLDDVYGSILKKANSFIKYSQVRMNMYGNS-SSWYRHILKGGWPFSTQDNGWTVSDCTA  489

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             EALKAA++LS +  ++VG+A+E  +L +AV+L+LS+QN +GGFA+YELTRSY WLE +NP
Sbjct  490   EALKAAILLSNLPFEIVGKAMETEQLCNAVNLLLSMQNRNGGFASYELTRSYAWLEKINP  549

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETF +IIIDYQYVECTS+AI GL  F +  PG+RR EIE CI KA  +I++ QLPDGSW
Sbjct  550   TETFEDIIIDYQYVECTSSAIQGLALFVQQFPGHRRMEIETCIAKAANYIESTQLPDGSW  609

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWGESYLSCQDK  258
             YGSWG+C+TYGTWFG++GL+  G +Y++   IRKAC FLLSKQ   SGGWGESYLS Q+K
Sbjct  610   YGSWGICFTYGTWFGVKGLIAAGKSYQNSQSIRKACQFLLSKQQKLSGGWGESYLSSQNK  669

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYTN+EGNK H+VNTAWAMLALI+AGQ 
Sbjct  670   VYTNLEGNKSHVVNTAWAMLALIDAGQA  697



>ref|XP_004513122.1| PREDICTED: cycloartenol synthase-like [Cicer arietinum]
Length=769

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/688 (65%), Positives = 538/688 (78%), Gaps = 4/688 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             D+  +RSVN HIGRQ+WEFDPNLGTQ+ER QV++ R EFH NRF     SDLLMR QFE+
Sbjct  11    DEELVRSVNKHIGRQFWEFDPNLGTQQERAQVEQARNEFHHNRFITNTISDLLMRFQFER  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRT--LRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             EKG +M     KV  ++E      V    L+R LR  S +QA DG WP DYGGPLFL+P 
Sbjct  71    EKGLKMKDSDYKVKMKKEEEVTEEVVEMTLKRALRNVSMMQADDGFWPGDYGGPLFLMPS  130

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LVIGL V  A+NAVL  +HQ EM RY++NHQN DGGWGLHI G STMF TAL+YVTLR+L
Sbjct  131   LVIGLWVTGALNAVLSPDHQTEMRRYLFNHQNKDGGWGLHIAGPSTMFGTALSYVTLRLL  190

Query  1694  GEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             GEE DGGNG+M+KAR+WILD GGAT IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY V
Sbjct  191   GEEMDGGNGSMQKARRWILDRGGATSIPSWGKLWLSVLGVYEWSGMKSIPPEIWLLPYFV  250

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             P HPG+MWCH R+VYLPMSYLYG R+VGP    I SLR ELY   YH + WD A+  CAK
Sbjct  251   PFHPGKMWCHTRLVYLPMSYLYGTRFVGPFTPIISSLRTELYTIPYHLLQWDQAKYLCAK  310

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLY+P   I +I+W  L N+ EPLL  WP++KLR+KAL   M+HI +ED+ TNY+C+GP
Sbjct  311   EDLYHPCSMIHNILWAFLDNVGEPLLMHWPYSKLRQKALNHVMEHIHYEDQNTNYLCLGP  370

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             VNKVLNM+C W+E+P+S A K H+SR+KDYLW+AEDGMKM GYNGSQ WDV   VQAI++
Sbjct  371   VNKVLNMVCCWLEDPNSEAFKYHISRVKDYLWVAEDGMKMQGYNGSQSWDVALFVQAILS  430

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             T L DEYGS+L+KA+ FI  SQ++ +   N   SWYRH +KGGW FSTP++GW VSDCTA
Sbjct  431   TKLDDEYGSILKKANSFIKYSQVRTNVSGNS-SSWYRHISKGGWTFSTPESGWTVSDCTA  489

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             EALKAA++LS +  ++VG+A+E   L +AV+L+LS+QN +GGFA+YELTRSY WLE +NP
Sbjct  490   EALKAAILLSNLPFEIVGKAMETEELCNAVNLLLSMQNKNGGFASYELTRSYAWLEKINP  549

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +ETF +IIIDYQYVECTS+AI GL  F +  PG+RR EIE CI KA  +I++ QLPDGSW
Sbjct  550   TETFEDIIIDYQYVECTSSAIQGLALFMQQFPGHRRMEIETCIAKAANYIESTQLPDGSW  609

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWGESYLSCQDK  258
             YGSWG+C+TYGTWFG++GL+  G +Y++   IRKAC FLLSKQ   SGGW ESYLS Q+K
Sbjct  610   YGSWGICFTYGTWFGVKGLITAGKSYQNSQSIRKACQFLLSKQQKLSGGWSESYLSSQNK  669

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYTN+EGNK H+VNTAWAM+ALI+AGQ 
Sbjct  670   VYTNLEGNKSHVVNTAWAMMALIDAGQA  697



>emb|CAB72151.1| oxidosqualene cyclase-like protein [Arabidopsis thaliana]
Length=742

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/683 (68%), Positives = 531/683 (78%), Gaps = 14/683 (2%)
 Frame = -3

Query  2210  SVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQEM  2031
             SVN H+GRQ+WE+D   GT EER  +  LR+ F  NRF  KHSSDLL R Q  KEKG+ M
Sbjct  13    SVNQHVGRQFWEYDNQFGTSEERHHINHLRSNFTLNRFSSKHSSDLLYRFQCWKEKGKGM  72

Query  2030  G-LQQVKV--GSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
               L QVKV  G E  I+EE V  TLRR LRFYS +Q+ DG WP DYGGPLFLLP LVIGL
Sbjct  73    ERLPQVKVKEGEERLINEEVVNVTLRRSLRFYSILQSQDGFWPGDYGGPLFLLPALVIGL  132

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V E ++  L  +HQ E+ RY+YNHQN DGGWGLH+EG+STMFCT L+YV LR++GEE D
Sbjct  133   YVTEVLDGTLTAQHQIEIRRYLYNHQNKDGGWGLHVEGNSTMFCTVLSYVALRLMGEELD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             GG+GAM+ AR WI  HGGATFIPSWGK WLSVLG YEWSGNNPLPPELWLLPY +P HPG
Sbjct  193   GGDGAMESARSWIHHHGGATFIPSWGKFWLSVLGAYEWSGNNPLPPELWLLPYSLPFHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+V   N TILSLRRELY   YH IDWD ARNQCAKEDLYY
Sbjct  253   RMWCHCRMVYLPMSYLYGRRFVCRTNGTILSLRRELYTIPYHHIDWDTARNQCAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  L+   EPLL +WP N LR  AL   M HI +ED+ ++Y+CIGPVNKVL
Sbjct  313   PHPKIQDVLWSCLNKFGEPLLERWPLNNLRNHALQTVMQHIHYEDQNSHYICIGPVNKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W+E  +S A K HLSRIKDYLW+AEDGMKM GYNGSQLWDV  AVQAI+ATNL D
Sbjct  373   NMLCCWVESSNSEAFKSHLSRIKDYLWVAEDGMKMQGYNGSQLWDVTLAVQAILATNLVD  432

Query  959   EYGSMLRKAHLFINVSQIKED-SGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +YG ML+KAH +I  +QI++D SG   L  WYRH  KGGW FST DN WPVSDCTAEALK
Sbjct  433   DYGLMLKKAHNYIKNTQIRKDTSGDPGL--WYRHPCKGGWGFSTGDNPWPVSDCTAEALK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS+M  ++VGE +    L DA        N +GGFA+YELTRSYP LE++NPSETF
Sbjct  491   AALLLSQMPVNLVGEPMPEEHLVDA--------NKNGGFASYELTRSYPELEVINPSETF  542

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+IIIDYQYVECTSAAI GL  F  L+  Y+RKEI   INKA+ FI+  QLPDGSWYGSW
Sbjct  543   GDIIIDYQYVECTSAAIQGLVLFTTLNSSYKRKEIVGSINKAVEFIEKTQLPDGSWYGSW  602

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TY TWFGI+G++  G TYES   IRKAC FLLSKQL  GGWGESYLSCQ+KVYTN+
Sbjct  603   GVCFTYATWFGIKGMLASGKTYESSLCIRKACGFLLSKQLCCGGWGESYLSCQNKVYTNL  662

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
              GNK HIVNT+WA+LALIEAGQ 
Sbjct  663   PGNKSHIVNTSWALLALIEAGQA  685



>ref|XP_003574426.1| PREDICTED: cycloartenol synthase [Brachypodium distachyon]
Length=760

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/684 (63%), Positives = 530/684 (77%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLRS N H+GRQ WEFDP     +    V   R +F   R + KHS+D LMR+QF KE
Sbjct  12    DPWLRSKNAHVGRQVWEFDPRADDPDALAAVDAARRDFAAGRLRHKHSADRLMRIQFAKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+   E+++EEAV  +L+R +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLEEHEDVTEEAVSTSLKRAISRFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  ++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV LR+LGE 
Sbjct  132   TLYVTGSLNTVLSSEHQKEICRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVCLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE+W+LPY +PIH
Sbjct  192   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPEIWMLPYCLPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR+EL+   Y +IDWD ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGRITPIILELRKELFKVPYSEIDWDKARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP+L  WP NKLR+KAL L M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVLTHWPGNKLREKALNLVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  F VQAI AT L
Sbjct  372   VLNMLTCWIEDPNSEAFKLHIPRIYDYLWVAEDGMKMQGYNGSQLWDTAFTVQAIAATGL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+   L+ AH +I  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IEEFAPTLKLAHDYIKNSQVIDDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ + VGE +E +RLYDAV+ ++S  N +GGFATYELTRSY WLE++NP+ET
Sbjct  491   KASLVLSKISPEFVGEPVEVNRLYDAVNCLMSWMNENGGFATYELTRSYAWLELINPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+ RK+++ CINKA  +I++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHCRKDVDNCINKAANYIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYG WFG++GLV  G T+++   IRKACDFL SK+LP GGWGESYLS QD+VYTN
Sbjct  611   WAVCFTYGIWFGVKGLVAAGRTFKNSPAIRKACDFLKSKELPFGGWGESYLSSQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAMLALI+AGQ 
Sbjct  671   LEGKHAHAVNTGWAMLALIDAGQA  694



>ref|XP_006474650.1| PREDICTED: cycloartenol synthase 2-like [Citrus sinensis]
Length=765

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/689 (65%), Positives = 535/689 (78%), Gaps = 5/689 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             ++PW+RS+NNH+GRQ WEF+P+LGT EE  QV+KLR +F KNRFQ+KHSSDLLMR+QF K
Sbjct  11    NEPWVRSLNNHVGRQVWEFEPSLGTPEELAQVEKLRNDFTKNRFQMKHSSDLLMRLQFVK  70

Query  2048  EKGQEMGLQ--QVKVGSEEEISEEAVVR--TLRRGLRFYSTIQAHDGHWPADYGGPLFLL  1881
             E   +M  Q  QVKV    E          TLRR LRFYST+Q+ DG WP DY GPLFLL
Sbjct  71    ENPCDMKRQLPQVKVEENSEEEVNEEAVNTTLRRALRFYSTLQSEDGFWPGDYAGPLFLL  130

Query  1880  PFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLR  1701
             P LVIGL +   +N +LQ E+++EMLRY+YNHQN DGGWGLHIEG STM  T L+YV LR
Sbjct  131   PCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGESTMLNTVLSYVGLR  190

Query  1700  ILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY  1521
             +LGE  DGG+GA++KARKWIL  GGAT+IPSWGK+WLSVLGVY+WSGNNP+PPE WLLP 
Sbjct  191   LLGERMDGGDGAIEKARKWILGRGGATYIPSWGKIWLSVLGVYDWSGNNPIPPETWLLPD  250

Query  1520  IVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQC  1341
              +P HPGRMWCH R+V LP SYLYGKR+VG INS +L LR ELY   Y +IDW+ AR  C
Sbjct  251   FLPTHPGRMWCHTRLVLLPTSYLYGKRFVGKINSLVLCLREELYTRPYEKIDWNRARFLC  310

Query  1340  AKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCI  1161
             A+EDLY  HP  QD++W+  H + EPLL KWPF+K+R+ AL   M HI +EDE T Y+CI
Sbjct  311   AQEDLYRQHPMFQDMLWNFSHKVAEPLLKKWPFSKIRQIALDTVMKHIHYEDENTQYICI  370

Query  1160  GPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAI  981
               VNKVLNM+CRW+E+P+S A K HL+RIKDYLW+AEDGMKM  YNGSQLWD  FAV AI
Sbjct  371   AGVNKVLNMLCRWVEDPNSEAYKHHLARIKDYLWVAEDGMKMQAYNGSQLWDTAFAVHAI  430

Query  980   IATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDC  801
             ++TNL DEYGSML+KA+ +I  +Q++  S       WYRH  + GWPFS+ DNGW  +D 
Sbjct  431   LSTNLVDEYGSMLKKANNYIKTTQVRTKS-FEDPSCWYRHEFQEGWPFSSLDNGWIATDT  489

Query  800   TAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEIL  621
             TAE L  +++LS M+ D+VGEAI  +RL++AV+++LSLQN+SGG A+YE TRSY W+E+L
Sbjct  490   TAEGLNVSVLLSEMSYDLVGEAIPLNRLFEAVNVVLSLQNSSGGVASYERTRSYAWMEML  549

Query  620   NPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDG  441
             NP E FGE IIDYQYVECTS+ I  LK F K +P +RR+EIE  I K   FI++IQ PDG
Sbjct  550   NPVENFGESIIDYQYVECTSSTIQCLKSFTKHYPKHRRREIEEFIAKGANFIESIQRPDG  609

Query  440   SWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQD  261
             SWYGSWGVC+TYGTWFGI+GLV  G  YE+   IRKACDFLLSKQL SGGWGESYLSC D
Sbjct  610   SWYGSWGVCFTYGTWFGIKGLVDSGRKYENSQSIRKACDFLLSKQLDSGGWGESYLSCVD  669

Query  260   KVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             +VYTN+EGNK H VNTAWAMLALIEAGQ 
Sbjct  670   RVYTNLEGNKAHNVNTAWAMLALIEAGQA  698



>emb|CBI18420.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/729 (63%), Positives = 545/729 (75%), Gaps = 45/729 (6%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DP++ S NN +GRQ WEFDP+ GT EER +V+  R  F KNRF +K SSDLL RMQF +
Sbjct  11    NDPYMYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFRKNRFPVKPSSDLLWRMQFAR  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L Q+KV   EE++EE V  TLRRGL FYST+QAHDGHWP DYGGP+FLLP LV
Sbjct  71    ENPCASNLPQIKVQDLEEVTEEVVTTTLRRGLNFYSTMQAHDGHWPGDYGGPMFLLPGLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQN------------------------------  1779
             I L +  A+N VL  EHQ+EM +Y++NHQ                               
Sbjct  131   ITLYITGALNVVLSIEHQREMCKYLFNHQARFFWVKRYLIVTSLSFYRIQESDDRDIKIN  190

Query  1778  --------------IDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGGNGAMKKARKWI  1641
                            +GGWGLHIEG STMF T L+YVTLR+LGE   G  GAM+K RKWI
Sbjct  191   YCVPFTIYLASSGIANGGWGLHIEGPSTMFGTVLSYVTLRLLGEGGFGVEGAMEKGRKWI  250

Query  1640  LDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPM  1461
             LDHGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WL PYI+PIHPGRMWCHCRMVYLPM
Sbjct  251   LDHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEVWLCPYILPIHPGRMWCHCRMVYLPM  310

Query  1460  SYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGL  1281
             SY+YGKR+VGPI  TI+ LR+ELY   Y ++DW+ ARNQCAKEDLYYPHP +QDI+W  L
Sbjct  311   SYIYGKRFVGPITPTIIYLRKELYIVPYQEVDWNKARNQCAKEDLYYPHPLVQDILWASL  370

Query  1280  HNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSI  1101
             H ++EP+L  WP NKLR+KAL   M H+ +EDE T Y+CIGPVNKVLNM+C WIE+P+S 
Sbjct  371   HKVLEPILGHWPGNKLREKALCTVMQHVHYEDENTRYICIGPVNKVLNMLCCWIEDPNSE  430

Query  1100  AVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFI  921
             A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAII+TNL +EYG  LRKAH FI
Sbjct  431   AFKLHIPRIFDYLWIAEDGMKMQGYNGSQLWDTCFAVQAIISTNLGEEYGLTLRKAHQFI  490

Query  920   NVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVG  741
               SQ+ ED   + L+ WYRH +KG WPFST DNGWP SDCTAE LK  L+L ++  + VG
Sbjct  491   KNSQVLEDCPGD-LKFWYRHISKGAWPFSTADNGWPTSDCTAEGLKVVLLLCKLPLETVG  549

Query  740   EAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTS  561
             E ++  +L+DAV+++LSLQN  GGFATYELTRSY W E++NP+ETFG+I+IDY YVECTS
Sbjct  550   EPLDMEQLFDAVNVVLSLQNADGGFATYELTRSYRWFELINPAETFGDIVIDYPYVECTS  609

Query  560   AAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRG  381
             AAI  L  F+KL+P +RR EIE CI+KA  FI+  Q PDGSWYGSWGVC+TYG WFGI+G
Sbjct  610   AAIQALTSFKKLYPEHRRHEIENCISKAAKFIEDRQAPDGSWYGSWGVCFTYGGWFGIKG  669

Query  380   LVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAM  201
             L+  GNTY +C  IRKACD+LLSK+L SGGWGESYLSCQ+KVYTN+  +K H VNTAWAM
Sbjct  670   LIAAGNTYSNCPCIRKACDYLLSKELGSGGWGESYLSCQNKVYTNLPEDKPHNVNTAWAM  729

Query  200   LALIEAGQV  174
             LALI+AGQ 
Sbjct  730   LALIDAGQA  738



>ref|XP_009618437.1| PREDICTED: cycloartenol synthase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=641

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/570 (77%), Positives = 493/570 (86%), Gaps = 4/570 (1%)
 Frame = -3

Query  1883  LPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTL  1704
             L  +VI L +M  +NAVL EEHQKE+LRY+YNHQN+DGGWGLHIEGHSTMFCTALNYVTL
Sbjct  5     LLIMVISLYIMGVVNAVLSEEHQKEILRYLYNHQNVDGGWGLHIEGHSTMFCTALNYVTL  64

Query  1703  RILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
             R+LGE  D  + AM+KARKWIL+HGG TFIPSWGKLWLS LGVYEWSGNNPLPPELWLLP
Sbjct  65    RLLGE--DINDEAMEKARKWILEHGGLTFIPSWGKLWLSALGVYEWSGNNPLPPELWLLP  122

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             Y +PIHPGRMWCHCRMVYL MSYLYG RYVGPINSTILSLRRELY   YH IDWDLARNQ
Sbjct  123   YFLPIHPGRMWCHCRMVYLAMSYLYGTRYVGPINSTILSLRRELYTCPYHHIDWDLARNQ  182

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPHP +QDI+W+ LHN  EPLL +WP +KLRKKAL   M+HI +EDE TNY+C
Sbjct  183   CAKEDLYYPHPLVQDILWESLHNFAEPLLMQWPLSKLRKKALNTVMEHIHYEDENTNYIC  242

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             IGPVNKVLNM+C W+E+P+S A+K+HLSRIKDYLWLAEDGMKM GYNGSQLWDV F VQA
Sbjct  243   IGPVNKVLNMLCCWVEDPESKAIKLHLSRIKDYLWLAEDGMKMKGYNGSQLWDVSFGVQA  302

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             I++TNL +EYG ML+ AH FI  SQ++EDS  + L+ WYR S +GGWPFST DNGW VSD
Sbjct  303   ILSTNLPEEYGLMLKNAHHFIKASQVREDSSGD-LKKWYRQSCRGGWPFSTVDNGWIVSD  361

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CTAEALKAA++LS+M  D+VGEAI    L DAVDL+LSLQN++GGFA+YELTRSY WLE+
Sbjct  362   CTAEALKAAVLLSQMPSDIVGEAIASHNLCDAVDLLLSLQNSNGGFASYELTRSYAWLEM  421

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             +NPSETFG+I IDYQYVECTSAAI  L+ F+KL+P YR K+IEACI KAL FI++IQLPD
Sbjct  422   INPSETFGDITIDYQYVECTSAAIQALQSFKKLYPQYREKDIEACIRKALYFIESIQLPD  481

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQL-PSGGWGESYLSC  267
             GSWYGSWGVCYTYGTWFGI GL+ GG TYESC  IRKAC FLLSKQL PSGGWGESYLS 
Sbjct  482   GSWYGSWGVCYTYGTWFGISGLIAGGKTYESCKSIRKACHFLLSKQLQPSGGWGESYLSS  541

Query  266   QDKVYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             Q KVYTNIEGNK HIVNTAWAMLALIEAGQ
Sbjct  542   QHKVYTNIEGNKSHIVNTAWAMLALIEAGQ  571



>dbj|BAI48072.1| cycloartenol synthase [Polypodiodes niponica]
Length=762

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/684 (63%), Positives = 527/684 (77%), Gaps = 2/684 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLRS+N H+GRQ W FDP+ G+  +R  V+K R +F +NRF  KHS+DLLMRMQ+ +E 
Sbjct  14    PWLRSLNEHVGRQTWHFDPHSGSSTDRLAVEKARKDFTQNRFLKKHSADLLMRMQYAREN  73

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                    QVK+ +  +++E+ V  TL+R   FYSTIQA DGHW  DYGGP+FL+P LVI 
Sbjct  74    LLPPLPDQVKINNHTDVTEDLVANTLKRAALFYSTIQAEDGHWAGDYGGPMFLMPGLVIV  133

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE-  1686
             L V  ++N +L E H++EM+RY+YNHQN DGGWGLHIEGHSTMF + L+YVTLR+LGE+ 
Sbjct  134   LYVTGSLNVILSEAHKEEMIRYLYNHQNKDGGWGLHIEGHSTMFGSVLSYVTLRLLGEDL  193

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
               GG+ AM++ R WIL HGGAT IPSWGK WLSVLGV+E +GNNPLPPE+WLLPY +PIH
Sbjct  194   NSGGDQAMQRGRTWILQHGGATAIPSWGKFWLSVLGVFERTGNNPLPPEIWLLPYFLPIH  253

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+ G I   +LSLR ELY   Y  I+W  ARN+CAKEDL
Sbjct  254   PGRMWCHCRMVYLPMCYIYGKRFTGKITELVLSLREELYGIPYTDINWSKARNECAKEDL  313

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH +VEP L  WP + LR KAL   + H+ +EDE T Y+CIGPVNK
Sbjct  314   YYPHPMLQDVLWGTLHKVVEPALMHWPGSSLRSKALATVIKHVHYEDENTRYICIGPVNK  373

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K HL RI DYLWLAEDGMKM GYNGSQLWDV FAVQA+I+T L
Sbjct  374   VLNMLCCWVEDPNSDAFKCHLPRIYDYLWLAEDGMKMQGYNGSQLWDVSFAVQALISTEL  433

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              D  G ML+KAH FI+ SQ+++D   + L+ WYRH +KG WPFST D+GWP+SDCT+E L
Sbjct  434   LDTCGPMLKKAHAFIDKSQVRDDCPGD-LQFWYRHISKGAWPFSTRDHGWPISDCTSEGL  492

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL LS +  ++VG  I P R YDAV+ +LS QN +GG ATYELTRSY WLE++NP+ET
Sbjct  493   KAALHLSLLPPEIVGGPIPPERFYDAVNTMLSYQNANGGIATYELTRSYAWLELINPAET  552

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDYQYVECTSA I  L  F+KL+P +R +EI  CI  A  FI++IQ  DGSWYGS
Sbjct  553   FGDIVIDYQYVECTSAVIQALATFQKLYPKHRTEEINECIEHAAGFIESIQKEDGSWYGS  612

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TY  WFGI GL+  G +YE    I+ AC F LSK+LPSGGWGESYLSCQDKVYTN
Sbjct  613   WGVCFTYAGWFGILGLIAAGRSYEHSKAIQDACSFFLSKELPSGGWGESYLSCQDKVYTN  672

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +E ++ H+V+T+WAMLAL+ AGQ 
Sbjct  673   LENDRAHVVHTSWAMLALMRAGQA  696



>dbj|BAF93208.1| cycloartenol synthase [Adiantum capillus-veneris]
Length=758

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/683 (63%), Positives = 528/683 (77%), Gaps = 3/683 (0%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKG  2040
             WL ++N H GRQ W FDP+ G+  +   V+  R EF +NRF  KHS+DLLMRMQ+ K   
Sbjct  15    WLHTLNEHTGRQTWHFDPDAGSPSDLLAVENARREFFENRFTKKHSADLLMRMQYAKRNP  74

Query  2039  QEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                    VKV  + ++ E+ VV TL+R + FYSTIQA DGHW  DYGGP+FL+P LVI L
Sbjct  75    LPPLPNPVKVNDQSKLPEQNVVDTLKRAVLFYSTIQAEDGHWAGDYGGPMFLMPGLVIAL  134

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE-R  1683
              V  ++N VL E H+KEM+RY+YNHQN DGGWGLHIEGHSTMF + L+YVTLR+LG+E  
Sbjct  135   YVTGSLNVVLSEAHKKEMVRYLYNHQNKDGGWGLHIEGHSTMFGSVLSYVTLRLLGQELS  194

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             DG + AM++ R WIL HGGAT IPSWGK WLSVLG +EW+GNNPLPPE+WLLPY +PIHP
Sbjct  195   DGEDQAMERGRAWILQHGGATTIPSWGKFWLSVLGTFEWAGNNPLPPEIWLLPYFLPIHP  254

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPM Y+YG R+ G I  T+L+LR+EL+   Y  IDW+ ARN+CAKEDLY
Sbjct  255   GRMWCHCRMVYLPMCYIYGNRFTGKITETVLALRKELFKVPYEDIDWNKARNECAKEDLY  314

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP IQD++W  LH +VEP L  WP + LRKKAL   + H+ +EDE T Y+CIGPVNKV
Sbjct  315   YPHPMIQDVLWATLHKLVEPALMNWPCSSLRKKALDTVIKHVHYEDENTRYICIGPVNKV  374

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C WIE+P+S A K HL RI DYLW+AEDGMKM GYNGSQLWD  FAVQA+I+T L 
Sbjct  375   LNMLCCWIEDPNSEAFKCHLPRIPDYLWVAEDGMKMQGYNGSQLWDTSFAVQALISTGLL  434

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +  G ML+KAH FI+ SQ++ D   + L+ WYRH +KG WPFST D+GWP+SDCTAE  K
Sbjct  435   ETCGPMLKKAHHFIDRSQVRNDCPGD-LQFWYRHISKGAWPFSTRDHGWPISDCTAEGFK  493

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL LS++  D+VGE+++  R YDAV+ +LS QN +GG ATYELTRSYPWLE++NP+ETF
Sbjct  494   AALALSQLPSDIVGESLQAERFYDAVNTMLSYQNGNGGVATYELTRSYPWLELINPAETF  553

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G+I+IDYQYVECTSA I  L  F+KL+P +R +E+ ACI  A  +I++IQ  DGSWYGSW
Sbjct  554   GDIVIDYQYVECTSAVIQALAAFKKLYPKHRTEEVNACIQHAAKYIESIQREDGSWYGSW  613

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TY  WFG+ GL+  G TYES   ++KAC+FLLSK+L SGGWGESYLSCQDKVYTN+
Sbjct  614   GVCFTYAGWFGVIGLLSAGRTYES-ETLKKACNFLLSKKLSSGGWGESYLSCQDKVYTNL  672

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
               ++ H+V+T+WAMLAL+ AGQ 
Sbjct  673   PNDRPHVVHTSWAMLALLYAGQA  695



>gb|KDO62053.1| hypothetical protein CISIN_1g043885mg [Citrus sinensis]
Length=765

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/689 (64%), Positives = 533/689 (77%), Gaps = 5/689 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             ++PW RS+NNH+GRQ WEF+P+LGT EE+ QV+KLR +F KNRFQ+KHSSDLLMR+QF K
Sbjct  11    NEPWGRSLNNHVGRQVWEFEPSLGTPEEQAQVEKLRNDFTKNRFQMKHSSDLLMRLQFVK  70

Query  2048  EKGQEMG--LQQVKVGSEEEISEEAVVR--TLRRGLRFYSTIQAHDGHWPADYGGPLFLL  1881
             E   +M   L QVKV    E          TLRR LRFYST+Q+ DG WP DY GPLFLL
Sbjct  71    ENPCDMKGQLPQVKVEENSEEEVNEEAVNTTLRRALRFYSTLQSEDGFWPGDYAGPLFLL  130

Query  1880  PFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLR  1701
             P LVIGL +   +N +LQ E+++EMLRY+YNHQN DGGWGLHIEG STM  T L+YV LR
Sbjct  131   PCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGESTMLNTVLSYVGLR  190

Query  1700  ILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY  1521
             +LGE  DGG+GA++KARKWIL  GGAT+IPSWGK+WLSVLGVY+WSGNNP+PPE WLLP 
Sbjct  191   LLGERMDGGDGAIEKARKWILGRGGATYIPSWGKIWLSVLGVYDWSGNNPIPPETWLLPD  250

Query  1520  IVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQC  1341
              +P HPGRMWCH R+V LP SYLYGKR+VG INS +L LR ELY   Y +IDW+ AR  C
Sbjct  251   FLPTHPGRMWCHTRLVLLPTSYLYGKRFVGKINSLVLCLREELYTRPYEKIDWNRARFLC  310

Query  1340  AKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCI  1161
             A+EDLY  HP  QD++W+  H + EPLL KWPF+K+R+ AL   M HI  EDE T Y+CI
Sbjct  311   AQEDLYRQHPMFQDMLWNFSHKVAEPLLKKWPFSKIRQIALDTVMKHIHCEDENTQYICI  370

Query  1160  GPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAI  981
               VNKVLNM+CRW+E+P+S A K HL+RIKDYLW+AEDGMKM  YNGSQLWD  FAV AI
Sbjct  371   AGVNKVLNMLCRWVEDPNSEAYKHHLARIKDYLWVAEDGMKMQAYNGSQLWDTAFAVHAI  430

Query  980   IATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDC  801
             ++TNL DEYGSML+KA+ +I  +Q++  S       WYRH  + GWPFS+ DNGW  +D 
Sbjct  431   LSTNLVDEYGSMLKKANNYIKTTQVRTKS-FEDPSCWYRHEFQEGWPFSSLDNGWIATDT  489

Query  800   TAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEIL  621
             TAE L  +++LS M+ D+VGEAI  +RL++AV+++LSLQN+SGG A+YE TRSY W+E+L
Sbjct  490   TAEGLNVSVLLSEMSYDLVGEAIPLNRLFEAVNVVLSLQNSSGGVASYERTRSYAWMEML  549

Query  620   NPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDG  441
             NP E FGE IIDYQYVECTS+ I  LK F K +P +RR+EIE  I K   FI++IQ PDG
Sbjct  550   NPVENFGESIIDYQYVECTSSTIQCLKSFTKHYPKHRRREIEEFIAKGANFIESIQRPDG  609

Query  440   SWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQD  261
              WYGSWGVC+TYGTWFGI+GLV  G  YE+   IRKACDFLLSKQL SGGWGESY+SC D
Sbjct  610   WWYGSWGVCFTYGTWFGIKGLVDSGRKYENSRSIRKACDFLLSKQLDSGGWGESYVSCVD  669

Query  260   KVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             +VYTN+EGNK H VNTAWAMLALIEAGQ 
Sbjct  670   RVYTNLEGNKAHNVNTAWAMLALIEAGQA  698



>ref|XP_002453282.1| hypothetical protein SORBIDRAFT_04g003190 [Sorghum bicolor]
 gb|EES06258.1| hypothetical protein SORBIDRAFT_04g003190 [Sorghum bicolor]
Length=761

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/682 (62%), Positives = 530/682 (78%), Gaps = 5/682 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             LR+ N H+GRQ WEFD      +    V   R  F   R  +KHS+DLLMR+Q  KE   
Sbjct  17    LRTKNGHVGRQVWEFD---AAADPDPAVDAARQAFVDTRHHLKHSADLLMRIQLAKENPL  73

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
             ++ L  +K+   E+++ EAV  TL+R L  +STIQAHDGHWP DYGGP+FL+P LVI L 
Sbjct  74    QLDLLAMKLDEHEDVTVEAVSTTLKRALNRFSTIQAHDGHWPGDYGGPMFLMPGLVITLY  133

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
             V  A+N VL  EHQKE+ RY+YNHQN DGGWG+HIEG STMF +AL+YV LR+LGE  D 
Sbjct  134   VTGALNIVLSPEHQKEIRRYLYNHQNEDGGWGMHIEGPSTMFGSALSYVILRLLGEGPDS  193

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
             G+GAM+  R WILDHGGAT+I SWGK WLS+LGV+EWSGNNP+PPELWLLPY++P HPGR
Sbjct  194   GDGAMENGRNWILDHGGATYIASWGKFWLSILGVFEWSGNNPVPPELWLLPYLLPFHPGR  253

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCHCRM+YLPM Y+YGKR+VG I   +L LR+E++N  Y++IDWD  RN CAKEDLY P
Sbjct  254   MWCHCRMLYLPMCYIYGKRFVGRITPLVLELRKEIFNDPYNEIDWDKVRNICAKEDLYRP  313

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
             HP +QD++W  LH  VEP++  WP  KLR+KAL + M H+ +EDE T Y+CIGPV KVLN
Sbjct  314   HPFVQDVLWASLHKFVEPVMMHWPGCKLREKALEIVMQHVHYEDENTQYICIGPVTKVLN  373

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+  WIE+P+S A K+H+ R+ DYLWLAEDGMKM GYNGSQLWD  FAVQAI+ATNL  E
Sbjct  374   MLACWIEDPNSEAFKLHIPRVYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIVATNLIKE  433

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
             +G  L+ AH +I  SQ+ +D   + L  WYRH++KG WPFST DNGW VSDCTAE LKA+
Sbjct  434   FGPTLKLAHSYIKNSQVLDDCPGD-LNDWYRHTSKGAWPFSTADNGWTVSDCTAEGLKAS  492

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             L+LS+++ ++VGE +E +R YDAV  ++S  N++GGFATYELTRSY WLE++NP+ETFG+
Sbjct  493   LLLSKISPEIVGEPVEANRFYDAVSCLMSYMNDNGGFATYELTRSYAWLELINPTETFGD  552

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I+IDY YVECTSAAI  L  FRKL+PG+RRKE++ CI+KA  FI+ +Q  DGSWYGSW V
Sbjct  553   IMIDYPYVECTSAAIQALTSFRKLYPGHRRKEVDNCISKAANFIEDVQRSDGSWYGSWAV  612

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQ-LPSGGWGESYLSCQDKVYTNIE  240
             C+TYGTWFG++GL+  G T+E+   IRKAC FLLSK+ LPSGGWGESYLS QD+VYTN++
Sbjct  613   CFTYGTWFGVKGLIAAGRTFENSPAIRKACGFLLSKELLPSGGWGESYLSSQDQVYTNLK  672

Query  239   GNKWHIVNTAWAMLALIEAGQV  174
             GN+ H VNT+WAMLALI+AGQ 
Sbjct  673   GNRAHAVNTSWAMLALIDAGQA  694



>ref|XP_004140567.1| PREDICTED: cucurbitadienol synthase-like [Cucumis sativus]
 ref|XP_004157591.1| PREDICTED: cucurbitadienol synthase-like [Cucumis sativus]
Length=766

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/690 (62%), Positives = 535/690 (78%), Gaps = 8/690 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEF--DPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQF  2055
             ++ W++S++NH+GRQ WEF  + +    +E    +  R +F  NRF  K SSDL + +Q+
Sbjct  15    EEKWIKSISNHLGRQVWEFCAENDDDDDDEASSFENARKQFRNNRFHRKQSSDLFLTIQY  74

Query  2054  EKE---KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFL  1884
             EKE    G + G    KV   E++ +EAV  TL R L FYS IQ  DG+W +D GGP+FL
Sbjct  75    EKEIARNGAKNG-GNTKVKEGEDVKKEAVNNTLERALSFYSAIQTSDGNWASDLGGPMFL  133

Query  1883  LPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTL  1704
             LP LVI L V   +N+VL + H++EM RYIYNHQN DGGWGLHIEG STMF +ALNYV L
Sbjct  134   LPGLVIALYVTGVLNSVLSKHHRQEMCRYIYNHQNEDGGWGLHIEGSSTMFGSALNYVAL  193

Query  1703  RILGEERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwll  1527
             R+LGE+ +GG  GAM KAR WIL+ GGAT I SWGKLWLSVLGVYEWSGNNPLPPE WLL
Sbjct  194   RLLGEDANGGECGAMTKARSWILERGGATAITSWGKLWLSVLGVYEWSGNNPLPPEFWLL  253

Query  1526  PYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARN  1347
             PY +P HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+ELY   YH+IDW+ +RN
Sbjct  254   PYSLPFHPGRMWCHCRMVYLPMSYLYGKRFVGPITHMVLSLRKELYTIPYHEIDWNRSRN  313

Query  1346  QCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYV  1167
              CA+EDLYYPHP +QDI+W  ++++ EPL N WP  +LR+KA+ +AM+HI +EDE + Y+
Sbjct  314   TCAQEDLYYPHPKMQDILWGSIYHVYEPLFNGWPGRRLREKAMKIAMEHIHYEDENSRYI  373

Query  1166  CIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQ  987
             C+GPVNKVLNM+C W+E+P S A K HL RI DYLWLAEDGM+M GYNGSQLWD  F++Q
Sbjct  374   CLGPVNKVLNMLCCWVEDPYSDAFKFHLQRIPDYLWLAEDGMRMQGYNGSQLWDTAFSIQ  433

Query  986   AIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVS  807
             AI++T L D +GS LRKAH F+  SQI+ED   +    W+RH  KG WPFST D+GW +S
Sbjct  434   AILSTKLIDTFGSTLRKAHHFVKHSQIQEDCPGD-PNVWFRHIHKGAWPFSTRDHGWLIS  492

Query  806   DCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLE  627
             DCTAE LKA+LMLS++   +VGE +E +RL DAV+++LSLQN +GGFA+YELTRSYPWLE
Sbjct  493   DCTAEGLKASLMLSKLPSKIVGEPLEKNRLCDAVNVLLSLQNENGGFASYELTRSYPWLE  552

Query  626   ILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLP  447
             ++NP+ETFG+I+IDY YVECTSA +  L  F+KLHPG+R KEI+A + KA  F++ +Q  
Sbjct  553   LINPAETFGDIVIDYSYVECTSATMEALALFKKLHPGHRTKEIDAALAKAANFLENMQRT  612

Query  446   DGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSC  267
             DGSWYG WGVC+TY  WFGI+GLV  G TY +C  IRKAC FLLSK+LP GGWGESYLSC
Sbjct  613   DGSWYGCWGVCFTYAGWFGIKGLVAAGRTYNNCVAIRKACHFLLSKELPGGGWGESYLSC  672

Query  266   QDKVYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             Q+KVYTN+EGN+ H+VNTAW ++ALIEAGQ
Sbjct  673   QNKVYTNLEGNRPHLVNTAWVLMALIEAGQ  702



>ref|XP_008459938.1| PREDICTED: cucurbitadienol synthase [Cucumis melo]
Length=774

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/699 (62%), Positives = 534/699 (76%), Gaps = 18/699 (3%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQV----------QKLRAEFHKNRFQIKHSS  2079
             ++ W++S++NH+GRQ WEF       ++ + +          +  R  F  NRF  K SS
Sbjct  15    EEKWIKSISNHLGRQVWEFCSGENENDDDEAIAVANNSASKFENARNHFRNNRFHRKQSS  74

Query  2078  DLLMRMQFEKE----KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWP  1911
             DL + +Q EKE      +  G  +VK G  E++ +EAV  TL R L FYS +Q  DG+W 
Sbjct  75    DLFLAIQCEKEIIRNGAKNEGTTKVKEG--EDVKKEAVKNTLERALSFYSAVQTSDGNWA  132

Query  1910  ADYGGPLFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMF  1731
             +D GGP+FLLP LVI L V   +N+VL + H++EM RYIYNHQN DGGWGLHIEG STMF
Sbjct  133   SDLGGPMFLLPGLVIALYVTGVLNSVLSKHHRQEMCRYIYNHQNEDGGWGLHIEGSSTMF  192

Query  1730  CTALNYVTLRILGEERDGG-NGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNN  1554
              +ALNYV LR+LGE  DGG +GAM KAR WIL+ GGAT I SWGKLWLSVLGVYEWSGNN
Sbjct  193   GSALNYVALRLLGEAADGGEHGAMTKARSWILERGGATAITSWGKLWLSVLGVYEWSGNN  252

Query  1553  plppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYH  1374
             PLPPE WLLPY +P HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+ELY   YH
Sbjct  253   PLPPEFWLLPYSLPFHPGRMWCHCRMVYLPMSYLYGKRFVGPITPIVLSLRKELYTIPYH  312

Query  1373  QIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQ  1194
             +IDW+ +RN CAKEDLYYPHP +QDI+W  ++++ EPL + WP  +LR+KA+ +AM+HI 
Sbjct  313   EIDWNRSRNTCAKEDLYYPHPKMQDILWGSIYHVYEPLFSGWPGKRLREKAMKIAMEHIH  372

Query  1193  HEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQ  1014
             +EDE + Y+C+GPVNKVLNM+C W+E+P S A K HL RI DYLWLAEDGM+M GYNGSQ
Sbjct  373   YEDENSRYICLGPVNKVLNMLCCWVEDPYSDAFKFHLQRIPDYLWLAEDGMRMQGYNGSQ  432

Query  1013  LWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFS  834
             LWD  F++QAII+T L D +G  LRKAH F+  SQI+ED   +    W+RH  KG WPFS
Sbjct  433   LWDTAFSIQAIISTKLIDTFGPTLRKAHHFVKHSQIQEDCPGD-PNVWFRHIHKGAWPFS  491

Query  833   TPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYE  654
             T D+GW +SDCTAE LKA+LMLS++   +VGE +E +RL DAV+++LSLQN +GGFA+YE
Sbjct  492   TRDHGWLISDCTAEGLKASLMLSKLPSKIVGEPLEKNRLCDAVNVLLSLQNENGGFASYE  551

Query  653   LTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKAL  474
             LTRSYPWLE++NP+ETFG+I+IDY YVECTSA +  L  F+KLHPG+R KEI+A I KA 
Sbjct  552   LTRSYPWLELINPAETFGDIVIDYSYVECTSATMEALALFKKLHPGHRTKEIDAAIAKAA  611

Query  473   TFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSG  294
              F++ +Q  DGSWYG WGVC+TY  WFGI+GLV  G TY +C  IRKAC+FLLSK+LP G
Sbjct  612   NFLENMQKTDGSWYGCWGVCFTYAGWFGIKGLVAAGRTYNNCVAIRKACNFLLSKELPGG  671

Query  293   GWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             GWGESYLSCQ+KVYTN+EGNK H+VNTAW M+ALIEAGQ
Sbjct  672   GWGESYLSCQNKVYTNLEGNKPHLVNTAWVMMALIEAGQ  710



>ref|XP_002527812.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF34564.1| Cycloartenol synthase, putative [Ricinus communis]
Length=753

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/685 (63%), Positives = 535/685 (78%), Gaps = 8/685 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPN-LGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +PWLR+ N+HIGRQ WEFD + +G+ EE  Q++  R  F KNRF  KHSSDLLMR+QF K
Sbjct  12    NPWLRTTNDHIGRQVWEFDSSKIGSPEELSQIENARQNFTKNRFIHKHSSDLLMRIQFSK  71

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E      L QVKV   E+++EE V  TLRR L +YS+IQA DGHWP DYGGP+FL+P L+
Sbjct  72    ENPICEVLPQVKVKESEQVTEEKVKITLRRALNYYSSIQADDGHWPGDYGGPMFLMPGLI  131

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I LS+  A+NA+L EEH++EM RY+YNHQN DGGWGLHIEG STMF + L YV+LR+LGE
Sbjct  132   IALSITGALNAILSEEHKREMCRYLYNHQNRDGGWGLHIEGPSTMFGSVLCYVSLRLLGE  191

Query  1688  ERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPI  1509
               + G GA+++ R WIL HGGAT I SWGK+WLSVLG YEWSGNNPLPPE+WLLPYI+P+
Sbjct  192   GPNEGEGAVERGRNWILKHGGATAITSWGKMWLSVLGAYEWSGNNPLPPEMWLLPYILPV  251

Query  1508  HPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKED  1329
             HPG        VYLP  ++Y  +     ++  LSLR+ELY   YH+IDW+ ARNQCAKED
Sbjct  252   HPGSY-----XVYLP-CHIYMGKGCWSNHTNSLSLRKELYTVPYHEIDWNQARNQCAKED  305

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPHP +QD++W  LH  VEP+L  WP  +LR+KA+  A++HI +EDE T Y+CIGPVN
Sbjct  306   LYYPHPMLQDVLWATLHKFVEPILMHWPGKRLREKAIQTAIEHIHYEDENTRYICIGPVN  365

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             KVLNM+C W+E+P+S A K+HL R+ DYLWLAEDGMKM GYNGSQLWD  FAVQAI++TN
Sbjct  366   KVLNMLCCWVEDPNSEAFKLHLPRLYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIVSTN  425

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +EYG  L+KAH FI   Q+ E+   + L  WYRH +KG WPFST D+GWP+SDCTAE 
Sbjct  426   LIEEYGPTLKKAHSFIKKMQVLENCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEG  484

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             +KA ++LS++  ++VGE +  +RLYDAV+++LSLQN  GGF TYEL+RSY WLE +NP+E
Sbjct  485   IKALMLLSKIPSEIVGEGLNANRLYDAVNVVLSLQNGDGGFPTYELSRSYSWLEFINPAE  544

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TFG+I+IDY YVECTSAAI  L  FRK +P ++R+EIE CI KA  F++ IQ+ DGSWYG
Sbjct  545   TFGDIVIDYPYVECTSAAIQALTSFRKSYPEHQREEIECCIKKAAKFMEKIQISDGSWYG  604

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SWGVC+TYGTWFGI+GLV  G ++ +C  IRKACDFLLSKQ PSGGWGESYLSCQ KVY+
Sbjct  605   SWGVCFTYGTWFGIKGLVAAGKSFGNCSSIRKACDFLLSKQCPSGGWGESYLSCQKKVYS  664

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             N+EG++ H+VNTAWAML+LI+AGQ 
Sbjct  665   NLEGDRSHVVNTAWAMLSLIDAGQA  689



>dbj|BAJ91961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=760

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/684 (63%), Positives = 532/684 (78%), Gaps = 1/684 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD      +    V   R EF   R ++KHS+DL MR+Q  KE
Sbjct  12    DPWLRTKNAHVGRQVWEFDAAADDPDALAAVDAARREFAARRHRLKHSADLPMRIQLAKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+G  E+++EEAV  +LRR +  +ST+QAHDGHWP DYGGP+FL+P L+I
Sbjct  72    NPLKLDLPAIKLGENEDVTEEAVSTSLRRAISSFSTLQAHDGHWPGDYGGPMFLMPGLLI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V  A+N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  132   MLHVTGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPELW+LPY +P+H
Sbjct  192   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPELWMLPYCLPVH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR EL+   Y ++DW+ ARN CAKEDL
Sbjct  252   PGRMWCHCRMVYLPMCYVYGKRFVGRITPIILELRNELFKVPYSEVDWNSARNLCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+K+L   M H+ +EDE T Y+CIGPVNK
Sbjct  312   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKSLNHVMQHVHYEDENTRYICIGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLW AEDGMKM GYNGSQLWD  FAVQAI AT+L
Sbjct  372   VLNMLACWIEDPNSEAFKLHIPRIYDYLWFAEDGMKMQGYNGSQLWDTAFAVQAIAATDL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+   L+ AH +I  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  432   IEEFAPTLKLAHDYIKNSQVVDDCPGD-LSYWYRHISKGAWPFSTTDHGWPISDCTAEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE +E +RLYDAV+ ++S  N +GGFATYEL RSY WLE++NP+ET
Sbjct  491   KASLLLSKISPEIVGEPVEVNRLYDAVNCLMSWMNENGGFATYELQRSYAWLELVNPAET  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA  +I++IQ  DGSWYGS
Sbjct  551   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAANYIESIQRSDGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GLV  G T+++   IRKACDFL+SK+LP GGWGESYLS QD+VYTN
Sbjct  611   WAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLMSKELPFGGWGESYLSSQDQVYTN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  671   LEGKHTHAVNTGWAMLTLIDAGQA  694



>ref|XP_011078188.1| PREDICTED: cycloartenol synthase-like isoform X3 [Sesamum indicum]
Length=657

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/595 (73%), Positives = 499/595 (84%), Gaps = 2/595 (0%)
 Frame = -3

Query  1955  LRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNI  1776
             +RFYS++QA DGHWP DYGGPLFLLP L+I LS+M+++N +L EEHQKE+ RY+YNHQN 
Sbjct  1     MRFYSSLQAEDGHWPGDYGGPLFLLPGLIIALSIMDSLNTILPEEHQKEIRRYLYNHQNP  60

Query  1775  DGGWGLHIEGHSTMFCTALNYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKL  1596
             DGGWGLHIEG S+MFCTALNYV+LR+LGE  DGG+GAM KAR WIL+ GGAT+ PSWGK 
Sbjct  61    DGGWGLHIEGRSSMFCTALNYVSLRLLGEGADGGDGAMHKARTWILERGGATYTPSWGKF  120

Query  1595  WLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINST  1416
             WLSVLGVYEW GNNPLPPELWLLPY +PIHPGRMWCHCRMVYLPMSYLYGKR+VGPI   
Sbjct  121   WLSVLGVYEWEGNNPLPPELWLLPYFLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITDI  180

Query  1415  ILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNK  1236
             ILSLR+ELY   YHQIDWDLARNQC+KEDLY+PHP +QDI+W  LH  VEPLL +WP +K
Sbjct  181   ILSLRKELYAQSYHQIDWDLARNQCSKEDLYFPHPLLQDILWKCLHKFVEPLLMQWPLSK  240

Query  1235  LRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWL  1056
             LR +AL+  M HIQ+ED  TNY+C+G V+KVLNM+C WI  P S+AVK HLSRIKDYLW+
Sbjct  241   LRHRALSTVMKHIQYEDVNTNYLCLGAVDKVLNMLCCWINNPSSMAVKRHLSRIKDYLWV  300

Query  1055  AEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLR  876
             AEDGMKM GYNGSQLWDV  AVQAI+ TNL  EYGS L++AH FI  SQ++ DS      
Sbjct  301   AEDGMKMKGYNGSQLWDVTLAVQAIVGTNLPHEYGSTLKRAHEFIKKSQLRNDSP-GTPG  359

Query  875   SWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLI  696
             SWYRH +KGGWPFST DNGWP  DCTAE LK AL+LS +  +V GEA+EP +LY+AVDLI
Sbjct  360   SWYRHGSKGGWPFSTADNGWPALDCTAEGLKTALILSLLPPEVAGEALEPDKLYNAVDLI  419

Query  695   LSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPG  516
             LSLQN+SGGFA+YELTRSY WLE++NP +TFG+I+IDYQ+ ECTSAAI GLK F +LHPG
Sbjct  420   LSLQNSSGGFASYELTRSYAWLEMINPVQTFGDIMIDYQHAECTSAAIQGLKMFNRLHPG  479

Query  515   YRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIR  336
              R K+I+ CI KAL FI++ QL DGSWYGSWGVCYTYGTWFGI GL+ GG TYE+   +R
Sbjct  480   CRGKDIQTCIKKALNFIESTQLSDGSWYGSWGVCYTYGTWFGITGLIAGGKTYENSLSVR  539

Query  335   KACDFLLSKQLPSGGWGESYLSCQDK-VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             KACDFLLSKQLPSGGWGESYLS QDK VYTNI  NK HIVNTAWAMLAL+EAGQ 
Sbjct  540   KACDFLLSKQLPSGGWGESYLSSQDKQVYTNIRNNKSHIVNTAWAMLALLEAGQA  594



>ref|XP_008342985.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Malus 
domestica]
Length=756

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/696 (64%), Positives = 528/696 (76%), Gaps = 1/696 (0%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L+SVN+H+ RQ WEF P  GT  E QQ++  R  F  +RF+ +HSSDLLMR+QF KE   
Sbjct  20    LKSVNSHLVRQVWEFHPETGTPGELQQIEDARKAFWNHRFERRHSSDLLMRIQFAKESPC  79

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                L Q+KV  +EE++EEAV  TL+R + FYSTIQAHDGHW  DYGG +FLLP L+I LS
Sbjct  80    ATNLPQLKVKDQEEVTEEAVTTTLQRAVSFYSTIQAHDGHWAGDYGGSMFLLPGLIITLS  139

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
                A+NAVL +EHQ EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE    
Sbjct  140   XXGALNAVLLKEHQXEMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAXD  199

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
             G GA+  ARKWILDHG  T + SWGK+WLSVLG YEWSGNNPLPPE+WL PY +P HPGR
Sbjct  200   GQGAIXLARKWILDHGXVTAVTSWGKMWLSVLGAYEWSGNNPLPPEVWLXPYSLPFHPGR  259

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCHCRMVYLPMSYLYGKR+VGPI  TI SLR+ELY   YH++DW+ A N  A EDLY  
Sbjct  260   MWCHCRMVYLPMSYLYGKRFVGPITPTIRSLRKELYTVPYHEVDWNNAXNLHAXEDLYXX  319

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
             HP +QDI+W  LH + EP+  +WP  +LR+ AL   M HI +EDE T Y+CIGPVNKVLN
Sbjct  320   HPMVQDILWGSLHXVYEPVFTRWPAKELRESALKTVMQHIHYEDENTXYLCIGPVNKVLN  379

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+  W E+P+S A K+HL RI DYLW+AEDGM M GYNGSQ WD  FA+ AII+TNL ++
Sbjct  380   MLXCWAEDPNSEAFKLHLPRIPDYLWIAEDGMXMQGYNGSQAWDTSFAIXAIISTNLVEK  439

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
             YG  LRKAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LKAA
Sbjct  440   YGPTLRKAHQYIKDSQVLEDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEVLKAA  498

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             L+LS++  + VG++++  R YDAV+  LSLQN+ GGFATYELTRSY WLE++NP+ETFG+
Sbjct  499   LLLSKLPAETVGDSLDIKRFYDAVNXTLSLQNDDGGFATYELTRSYQWLELINPAETFGD  558

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I+IDY YVECTSAAI  L  F+KL PG+R  EIE CI +A  FI+TIQ  DGSWYGSWGV
Sbjct  559   IVIDYPYVECTSAAIQALALFKKLCPGHRSXEIENCIARAXKFIETIQATDGSWYGSWGV  618

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEG  237
             C TY  WFGI+GLV  G T + C  I KACDFLLSK+L SGGWGESYLSCQ+KVYTN++ 
Sbjct  619   CXTYAGWFGIKGLVAAGRTXZDCSSICKACDFLLSKELXSGGWGESYLSCQNKVYTNLKD  678

Query  236   NKWHIVNTAWAMLALIEAGQVIL*IKVGDKIFINNH  129
             N+ HIV+TAWAMLALI A Q    +    ++ IN+ 
Sbjct  679   NRPHIVHTAWAMLALIGAXQRPTPLHRAARVLINSQ  714



>gb|AIT72030.1| oxidosqualene cyclase [Cucumis sativus]
Length=785

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/709 (61%), Positives = 536/709 (76%), Gaps = 27/709 (4%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEF--------------------DPNLGTQEERQQ-VQKLRAEF  2112
             ++ W++S++NH+GRQ WEF                      +L  Q+ RQ   +  R +F
Sbjct  15    EEKWIKSISNHLGRQVWEFCAENDDDDDDEAVIHVVANSSKHLLQQQRRQSSFENARKQF  74

Query  2111  HKNRFQIKHSSDLLMRMQFEKE---KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYS  1941
               NRF  K SSDL + +Q+EKE    G + G    KV   E++ +EAV  TL R L FYS
Sbjct  75    RNNRFHRKQSSDLFLTIQYEKEIARNGAKNG-GNTKVKEGEDVKKEAVNNTLERALSFYS  133

Query  1940  TIQAHDGHWPADYGGPLFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWG  1761
              IQ  DG+W +D GGP+FLLP LVI L V   +N+VL + H++EM RYIYNHQN DGGWG
Sbjct  134   AIQTSDGNWASDLGGPMFLLPGLVIALYVTGVLNSVLSKHHRQEMCRYIYNHQNEDGGWG  193

Query  1760  LHIEGHSTMFCTALNYVTLRILGEERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSV  1584
             LHIEG STMF +ALNYV LR+LGE+ +GG  GAM KAR WIL+ GGAT I SWGKLWLSV
Sbjct  194   LHIEGSSTMFGSALNYVALRLLGEDANGGECGAMTKARSWILERGGATAITSWGKLWLSV  253

Query  1583  LGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSL  1404
             LGVYEWSGNNPLPPE WLLPY +P HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSL
Sbjct  254   LGVYEWSGNNPLPPEFWLLPYSLPFHPGRMWCHCRMVYLPMSYLYGKRFVGPITHMVLSL  313

Query  1403  RRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKK  1224
             R+ELY   YH+IDW+ +RN CA+EDLYYPHP +QDI+W  ++++ EPL N WP  +LR+K
Sbjct  314   RKELYTIPYHEIDWNRSRNTCAQEDLYYPHPKMQDILWGSIYHVYEPLFNGWPGRRLREK  373

Query  1223  ALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDG  1044
             A+ +AM+HI +EDE + Y+ +GPVNKVLNM+C W+E+P S A K HL RI DYLWLAEDG
Sbjct  374   AMKIAMEHIHYEDENSRYIYLGPVNKVLNMLCCWVEDPYSDAFKFHLQRIPDYLWLAEDG  433

Query  1043  MKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYR  864
             M+M GYNGSQLWD  F++QAI++T L D +GS LRKAH F+  SQI+ED   +    W+R
Sbjct  434   MRMQGYNGSQLWDTAFSIQAILSTKLIDTFGSTLRKAHHFVKHSQIQEDCPGD-PNVWFR  492

Query  863   HSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQ  684
             H  KG WPFST D+GW +SDCTAE LKA+LMLS++   +VGE +E +RL DAV+++LSLQ
Sbjct  493   HIHKGAWPFSTRDHGWLISDCTAEGLKASLMLSKLPSKIVGEPLEKNRLCDAVNVLLSLQ  552

Query  683   NNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRK  504
             N +GGFA+YELTRSYPWLE++NP+ETFG+I+IDY YVECTSA +  L  F+KLHPG+R K
Sbjct  553   NENGGFASYELTRSYPWLELINPAETFGDIVIDYSYVECTSATMEALALFKKLHPGHRTK  612

Query  503   EIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACD  324
             EI+A + KA  F++ +Q  DGSWYG WGVC+TY  WFGI+GLV  G TY +C  IRKAC 
Sbjct  613   EIDAALAKAANFLENMQRTDGSWYGCWGVCFTYAGWFGIKGLVAAGRTYNNCVAIRKACH  672

Query  323   FLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             FLLSK+LP GGWGESYLSCQ+KVYTN+EGN+ H+VNTAW ++ALIEAGQ
Sbjct  673   FLLSKELPGGGWGESYLSCQNKVYTNLEGNRPHLVNTAWVLMALIEAGQ  721



>sp|Q6BE24.1|CUCS_CUCPE RecName: Full=Cucurbitadienol synthase [Cucurbita pepo]
 dbj|BAD34645.1| cucurbitadienol synthase [Cucurbita pepo]
Length=764

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/687 (63%), Positives = 531/687 (77%), Gaps = 4/687 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEF--DPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQF  2055
             D+ W++SV+NH+GRQ WEF  D    T  +  Q+Q  R  FH NRF  K SSDL + +Q+
Sbjct  15    DEKWVKSVSNHLGRQVWEFCADAAADTPHQLLQIQNARNHFHHNRFHRKQSSDLFLAIQY  74

Query  2054  EKEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             EKE  +      VKV   EE+ +EAV  TL R L FYS +Q  DG+W +D GGPLFLLP 
Sbjct  75    EKEIAKGAKGGAVKVKEGEEVGKEAVKSTLERALGFYSAVQTRDGNWASDLGGPLFLLPG  134

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             LVI L V   +N+VL + H+ EM RY+YNHQN DGGWGLHIEG STMF +ALNYV LR+L
Sbjct  135   LVIALHVTGVLNSVLSKHHRVEMCRYLYNHQNEDGGWGLHIEGTSTMFGSALNYVALRLL  194

Query  1694  GEERDGGNGA-MKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             GE+ DGG+G  M KAR WIL+ GGAT I SWGKLWLSVLGVYEWSGNNPLPPE WLLPY 
Sbjct  195   GEDADGGDGGAMTKARAWILERGGATAITSWGKLWLSVLGVYEWSGNNPLPPEFWLLPYS  254

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             +P HPGRMWCHCRMVYLPMSYLYGKR+VGPI   +LSLR+ELY   YH+IDW+ +RN CA
Sbjct  255   LPFHPGRMWCHCRMVYLPMSYLYGKRFVGPITPKVLSLRQELYTIPYHEIDWNKSRNTCA  314

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLYYPHP +QDI+W  ++++ EPL  +WP  +LR+KAL  AM HI +EDE + Y+C+G
Sbjct  315   KEDLYYPHPKMQDILWGSIYHVYEPLFTRWPGKRLREKALQAAMKHIHYEDENSRYICLG  374

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNM+C W+E+P S A K+HL R+ DYLW+AEDGM+M GYNGSQLWD  F++QAI+
Sbjct  375   PVNKVLNMLCCWVEDPYSDAFKLHLQRVHDYLWVAEDGMRMQGYNGSQLWDTAFSIQAIV  434

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             AT L D Y   LRKAH F+  SQI+ED   +    W+RH  KG WP ST D+GW +SDCT
Sbjct  435   ATKLVDSYAPTLRKAHDFVKDSQIQEDCPGD-PNVWFRHIHKGAWPLSTRDHGWLISDCT  493

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AE LKA+LMLS++   +VGE +E +RL DAV+++LSLQN++GGFA+YELTRSYPWLE++N
Sbjct  494   AEGLKASLMLSKLPSTMVGEPLEKNRLCDAVNVLLSLQNDNGGFASYELTRSYPWLELIN  553

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+ETFG+I+IDY YVECT+A +  L  F+KLHPG+R KEI+  I KA  F++ +Q  DGS
Sbjct  554   PAETFGDIVIDYPYVECTAATMEALTLFKKLHPGHRTKEIDTAIGKAANFLEKMQRADGS  613

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYG WGVC+TY  WFGI+GLV  G TY SC  IRKAC+FLLSK+LP GGWGESYLSCQ+K
Sbjct  614   WYGCWGVCFTYAGWFGIKGLVAAGRTYNSCLAIRKACEFLLSKELPGGGWGESYLSCQNK  673

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQ  177
             VYTN+EGNK H+VNTAW ++ALIEAGQ
Sbjct  674   VYTNLEGNKPHLVNTAWVLMALIEAGQ  700



>ref|XP_010065704.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase 2-like 
[Eucalyptus grandis]
Length=745

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/684 (63%), Positives = 530/684 (77%), Gaps = 13/684 (2%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLRS+NNH+GRQ WEFDPN G+ EE Q++++ RA F K+RF+ KHSSDL+MR+QF KE
Sbjct  11    NPWLRSLNNHVGRQIWEFDPNCGSPEEIQEIEEARANFLKHRFEKKHSSDLIMRIQFSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L  VKV   +EI+EE V   LRR + F+ST+QAHDGHWP DYGGP+FL+P LV 
Sbjct  71    NTGSVVLPPVKVKDLDEITEETVTHMLRRAISFHSTLQAHDGHWPGDYGGPMFLMPGLV-  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
                   A +A +     + +  ++ +   I    G +   H  + C  L+Y  L ++   
Sbjct  130   -----SAHSACIGVYFGEGIFDHLIDFVKIILXCGCNY--HKIVLC--LSYCVLNLVSA-  179

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+KARKWILDHG AT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIH
Sbjct  180   -NDGQGAMEKARKWILDHGSATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIH  238

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH+IDW+ ARN CAKEDL
Sbjct  239   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYAVPYHEIDWNQARNLCAKEDL  298

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  L+  VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNK
Sbjct  299   YYPHPLVQDMLWATLYKAVEPILLNWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNK  358

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W E+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD  FA QAII+TNL
Sbjct  359   VLNMLCCWAEDPNSEAFKLHIPRIYDYLWLAEDGMKMQGYNGSQLWDTAFATQAIISTNL  418

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+GS L+KAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  419   IEEFGSTLQKAHTYIKNSQVLEDCPGD-LDFWYRHISKGAWPFSTADHGWPISDCTAEGL  477

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS++  ++VG+ +E  R YDAV++ILSLQN  GGFATYELTRSY WLE++NP+ET
Sbjct  478   KAALVLSKIPSEIVGQPLEAKRFYDAVNVILSLQNEDGGFATYELTRSYAWLELINPAET  537

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RR+EIE CI +A  FI+ IQ PDGSWYGS
Sbjct  538   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRREEIEHCIERAAKFIEKIQAPDGSWYGS  597

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFG+ GLV  G  Y S   +RKAC+FLLSKQL SGGWGESYLSCQ+KVYTN
Sbjct  598   WGVCFTYGTWFGVLGLVAAGRNYSSSGSLRKACEFLLSKQLASGGWGESYLSCQNKVYTN  657

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG++ H+VNT+WAMLALI AGQ 
Sbjct  658   VEGDRSHVVNTSWAMLALIGAGQA  681



>ref|XP_001758555.1| predicted protein [Physcomitrella patens]
 gb|EDQ76533.1| predicted protein [Physcomitrella patens]
Length=761

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/683 (61%), Positives = 522/683 (76%), Gaps = 4/683 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPN--LGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             LR++NNH+GRQ WE+D +   G    R  V K R  F +NRF+  HSSDL+MR+QF +E 
Sbjct  17    LRTLNNHVGRQVWEYDEHGAAGDLAHRVAVDKARVAFAENRFEQAHSSDLIMRLQFAREN  76

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                    QVK+ +  ++ EEAV  TLRR +RFYST+QAHDGHWP DYGGP+FL+P LVI 
Sbjct  77    PLPELPTQVKIENLSDLDEEAVTTTLRRSMRFYSTLQAHDGHWPGDYGGPMFLMPGLVIA  136

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V  A+N VL   HQ EM RY+YNHQN DGGWGLHIEGHSTMF + L YVTLRILG+  
Sbjct  137   LYVTGALNTVLTPAHQSEMRRYLYNHQNKDGGWGLHIEGHSTMFGSVLTYVTLRILGDGP  196

Query  1682  DGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG+  A+++ RKWILDHGGAT+I SWGK WL+VLGV+EWSGNNPLPPE W+LPY +P+H
Sbjct  197   EGGDFDALRRGRKWILDHGGATYITSWGKFWLTVLGVFEWSGNNPLPPETWILPYFLPMH  256

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSY+YGKR+ G I   + ++R E++   Y +++W+ ARN CAKEDL
Sbjct  257   PGRMWCHCRMVYLPMSYIYGKRFTGKITELVKAIREEIFVQKYTEVNWNEARNLCAKEDL  316

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQD++W  L  +VEP+L +WP + LRKKAL   M+HI +EDE T Y+CIGPVNK
Sbjct  317   YYPHPWIQDVLWGTLDKVVEPILTRWPGSLLRKKALARTMEHIHYEDENTRYLCIGPVNK  376

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             V+NM+  WIE+P+S A K+HL+R+ DYLW+AEDGMKM GYNGSQLWD  FAVQA+ AT L
Sbjct  377   VMNMLSCWIEDPNSEAFKLHLARVVDYLWVAEDGMKMQGYNGSQLWDTTFAVQALAATKL  436

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              DE  SML+KA+ +I+ SQ++EDS  + +  WYRH +KG WPFS+ D+GWP+SDC++E L
Sbjct  437   PDESMSMLKKANSYIDNSQVREDSPGD-MAYWYRHISKGAWPFSSRDHGWPISDCSSEGL  495

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+L+    ++VG  I   RLYDAV++ILS QN  GG ATYE TRSYPWLE++NP+ET
Sbjct  496   KATLILADFPKELVGNPIAAERLYDAVNVILSYQNEDGGSATYERTRSYPWLEVINPAET  555

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSA +  L  F+K +P +R KEI   I +A  +I++IQ  DGSWYGS
Sbjct  556   FGDIVIDYSYVECTSACMQALASFQKRYPHHRTKEIAKSIQRARKYIESIQKDDGSWYGS  615

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TY  WFG+ GL+  G TYES   IR AC FLLSKQLP GGWGESY SCQDKVY+N
Sbjct  616   WAVCFTYAIWFGVLGLIAAGQTYESSFHIRMACKFLLSKQLPDGGWGESYRSCQDKVYSN  675

Query  245   IEGNKWHIVNTAWAMLALIEAGQ  177
             + G K H+VNT+WAML LI AGQ
Sbjct  676   LPGGKSHVVNTSWAMLTLIAAGQ  698



>dbj|BAB83254.1| multifunctional triterpene synthase [Costus speciosus]
Length=759

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/683 (62%), Positives = 523/683 (77%), Gaps = 2/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLRS NNH+GR+ WEFDP+ GT EE  +V++ R  F  +  +  +S+DL+MR+QFEKE 
Sbjct  12    PWLRSTNNHVGREVWEFDPSGGTPEEIAEVERARETFRDHWVEHTNSADLIMRLQFEKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYG-GPLFLLPFLVI  1866
               EM    +++   E IS+EAV   LR+ +   ST+QAHDGHWP D G GP+FLLP LVI
Sbjct  72    PAEMKYSVIRIQEAENISKEAVDICLRKAVTRISTLQAHDGHWPGDCGAGPMFLLPGLVI  131

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L +  A+N +L  EHQKEM RY+YNHQN+DGGWGL+  G S M  + L+YVTLR+LGE 
Sbjct  132   SLHITGALNTILTPEHQKEMRRYLYNHQNVDGGWGLYSNGPSNMIGSVLHYVTLRLLGEG  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              + G GAM+K RKWILDHG AT   SWGKLWLSVLGVYEW+GNNP+PPE WLLPY VP+H
Sbjct  192   ANDGEGAMEKGRKWILDHGSATATSSWGKLWLSVLGVYEWAGNNPMPPEFWLLPYCVPLH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+MWC  R VYLPMSYLYGKR+VG I   ++SLR+ELYN  Y  IDW+ AR  CAKED 
Sbjct  252   PGKMWCLSRTVYLPMSYLYGKRFVGAITPIVVSLRKELYNVPYDHIDWNKARTDCAKEDQ  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LHN VEP+L +WP +KLR+KAL+  M HI +EDE T Y+C+GPVNK
Sbjct  312   YYPHPLIQDIIWGSLHNFVEPILMRWPGSKLREKALSTVMQHIHYEDENTRYICVGPVNK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
              LNM+C WI++P+S A K+HL R+ DYLWLAEDGMKM  Y+G QLW+  FAVQAI++TNL
Sbjct  372   ALNMLCCWIDDPNSEAFKLHLPRVYDYLWLAEDGMKMKAYDGFQLWEAAFAVQAIVSTNL  431

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+KAH F+  SQI ED   + L  WYRH +KG W FST D GWPVSDCT E L
Sbjct  432   SEEFGPTLKKAHEFVKNSQILEDCPGD-LNYWYRHISKGAWTFSTADEGWPVSDCTGEGL  490

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             +A L+LS ++  +VG+ ++  RLYDAV+L+LSL N +GGFATYELTRSY WLEI+NP++ 
Sbjct  491   EAVLLLSMISPKIVGDPLDERRLYDAVNLLLSLMNKNGGFATYELTRSYAWLEIMNPADV  550

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F  I++D+QYVECTS+AI  L  F+KL+PG+R++EI+ CI KA  FI+  Q  DGSWYGS
Sbjct  551   FINIVVDHQYVECTSSAIQPLALFKKLYPGHRQEEIDNCIMKAARFIERTQRADGSWYGS  610

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TY TWFG++GLV  G TYE+   I+KAC+FLLSKQ  SGGWGES+LSC+ KVY N
Sbjct  611   WGVCFTYATWFGVKGLVAAGRTYENSCYIQKACNFLLSKQEASGGWGESFLSCRKKVYIN  670

Query  245   IEGNKWHIVNTAWAMLALIEAGQ  177
             +EGNK H VNT+WAMLALI AGQ
Sbjct  671   LEGNKTHAVNTSWAMLALIAAGQ  693



>ref|XP_004975971.1| PREDICTED: cycloartenol synthase-like [Setaria italica]
Length=759

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/685 (61%), Positives = 530/685 (77%), Gaps = 5/685 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL S NN  GRQ WEFDP+ GT EER QV++ R  F  +RF+++ S+D LMR+QF K  
Sbjct  12    PWLWSTNNFAGRQVWEFDPDHGTAEERAQVEEARRGFADHRFELRDSADHLMRLQFAKAN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               ++ L   K+  EE+++EEAV  +LRR +   ST+QAHDGHWP DYGGP+FL+P L+I 
Sbjct  72    PLKLDLSATKLEEEEDVTEEAVSTSLRRAISRLSTLQAHDGHWPGDYGGPMFLIPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V EA++AVL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF + LNYV+LR+LGE  
Sbjct  132   LYVTEAMSAVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVSLRLLGESP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
              GG+GAM+K R WIL HGGAT   SWGK WLSVLGV+ WSGNNP+PPE+WLLPY +P HP
Sbjct  192   SGGDGAMEKGRNWILGHGGATLTTSWGKFWLSVLGVFHWSGNNPVPPEVWLLPYCLPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GR+W HCR+V+LPMSY+YGKR+VGPI   +L LR+EL+   Y +I+WD  RNQCAKEDLY
Sbjct  252   GRLWSHCRLVHLPMSYIYGKRFVGPITQVVLDLRKELFRDAYDEINWDKVRNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
              PH  +QDI+W  LH  VEP++  WP +KLRKKAL + M HI +EDE T Y+CIG VNKV
Sbjct  312   CPHSFVQDILWAALHKFVEPVMLDWPGSKLRKKALDIVMQHIHYEDENTRYICIGSVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+  WIE+P+S A K+H+ R+ DYLWLAEDGMKM GYNGSQLWD  F VQAI+A +L 
Sbjct  372   LNMLACWIEDPNSEAFKLHIPRVYDYLWLAEDGMKMQGYNGSQLWDTAFTVQAILAADLI  431

Query  962   DEYGSMLRKAHLFINVSQIKED--SGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             +E+G  L+ AH +I  SQ  +D    +NY   WYRH ++GGWPFST D GWP SDCTAE 
Sbjct  432   EEFGPTLKLAHDYIKNSQFLDDCPGDLNY---WYRHISRGGWPFSTVDQGWPASDCTAEG  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK +L+LS+++ ++ G+ +E +RLYDAV+ ++S  N+ GGFATYELTRSY WLE++NPSE
Sbjct  489   LKTSLLLSKISPEIAGKPVETNRLYDAVNCLMSYMNDDGGFATYELTRSYAWLELINPSE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             TF +I+IDY +VECTS+AI  L  FRKL+PG+ RK+++ CI KA  FI++ Q  DGSWYG
Sbjct  549   TFEDIMIDYPHVECTSSAIQALASFRKLYPGHHRKKVDNCIIKAANFIESAQRSDGSWYG  608

Query  428   SWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYT  249
             SW VC+TYGTWFG++GL   G T+ +   IRKACDFLLSKQLP GGWGESYLS Q++VYT
Sbjct  609   SWAVCFTYGTWFGVKGLTAAGWTFRNSPAIRKACDFLLSKQLPCGGWGESYLSSQNQVYT  668

Query  248   NIEGNKWHIVNTAWAMLALIEAGQV  174
             ++EG + H+VNT+WA+LALI+AGQ 
Sbjct  669   DLEGRRPHLVNTSWALLALIDAGQA  693



>gb|EEE56272.1| hypothetical protein OsJ_05323 [Oryza sativa Japonica Group]
Length=744

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/633 (64%), Positives = 508/633 (80%), Gaps = 1/633 (0%)
 Frame = -3

Query  2072  LMRMQFEKEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGP  1893
             + R QF K    ++ +  +K+   E ++ EAV+ +L+R +  YST QAHDGHWP DYGGP
Sbjct  37    MQRTQFAKANPLKLDIPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYGGP  96

Query  1892  LFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNY  1713
             +FL+P L+I L V  A+N  L  EHQKE+ RY+YNHQN DGGWGLHIEGHSTMF +AL Y
Sbjct  97    MFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHSTMFGSALTY  156

Query  1712  VTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelw  1533
             V+LR+LGE  D G+GAM+K RKWILDHGGAT+I SWGK WLSVLGV++WSGNNP+PPE+W
Sbjct  157   VSLRLLGEGPDSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPEIW  216

Query  1532  llPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLA  1353
             LLPY +PIHPGRMWCHCRMVYLPM Y+YGKR+VGP+   IL LR+ELY   Y+++DWD A
Sbjct  217   LLPYFLPIHPGRMWCHCRMVYLPMCYIYGKRFVGPVTPIILELRKELYEVPYNEVDWDKA  276

Query  1352  RNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTN  1173
             RN CAKEDLYYPHP +QD++W  LH  VEP + +WP NKLR+KAL   M HI +EDE T 
Sbjct  277   RNLCAKEDLYYPHPFVQDVLWATLHKFVEPAMLRWPGNKLREKALDTVMQHIHYEDENTR  336

Query  1172  YVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFA  993
             Y+CIGPVNKVLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F 
Sbjct  337   YICIGPVNKVLNMLACWIEDPNSEAFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTAFT  396

Query  992   VQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWP  813
             VQAI+AT L +E+G  L+ AH +I  +Q+ +D   + L  WYRH +KG WPFST D+GWP
Sbjct  397   VQAIVATGLIEEFGPTLKLAHGYIKKTQVIDDCPGD-LSQWYRHISKGAWPFSTADHGWP  455

Query  812   VSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPW  633
             +SDCTAE LKAAL+LS+++ D+VGEA+E +RLYD+V+ ++S  N++GGFATYELTRSY W
Sbjct  456   ISDCTAEGLKAALLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYAW  515

Query  632   LEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQ  453
             LE++NP+ETFG+I+IDY YVECTSAAI  L  F+KL+PG+R+ EI+ CI+KA +FI+ IQ
Sbjct  516   LELINPAETFGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKSEIDNCISKAASFIEGIQ  575

Query  452   LPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYL  273
               DGSWYGSW VC+TYGTWFG++GLV  G T+++   IRKACDFLLSK+LPSGGWGESYL
Sbjct  576   KSDGSWYGSWAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLLSKELPSGGWGESYL  635

Query  272   SCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             S QD+VYTN+EG + H VNT WAMLALI+AGQ 
Sbjct  636   SSQDQVYTNLEGKRPHAVNTGWAMLALIDAGQA  668



>ref|XP_010111091.1| hypothetical protein L484_015147 [Morus notabilis]
 gb|EXC29953.1| hypothetical protein L484_015147 [Morus notabilis]
Length=720

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/684 (62%), Positives = 519/684 (76%), Gaps = 41/684 (6%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +PWLR++NNH GRQ+WEFDP LGT EE  +++  +  F   RF+ KHSSDLLMR+Q  KE
Sbjct  11    NPWLRTLNNHAGRQFWEFDPKLGTPEELAEIENAQQAFAATRFEKKHSSDLLMRIQLSKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                +  L QVKV   E++SEE V  +L+R L FYSTIQAHDGHWP DYGGP+FLLP L  
Sbjct  71    NPCDTVLPQVKVKDIEDVSEEMVTNSLKRALNFYSTIQAHDGHWPGDYGGPMFLLPGL--  128

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
                                         N DGGWGLHIEG STMF + L+YVTLR+LGEE
Sbjct  129   ----------------------------NKDGGWGLHIEGASTMFGSVLSYVTLRLLGEE  160

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              +GG GAM++ RKWILDHGGAT          +VLGV+EWSGNNPLPPE+WLLPYI+PIH
Sbjct  161   ANGGQGAMERGRKWILDHGGAT----------AVLGVFEWSGNNPLPPEVWLLPYILPIH  210

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGR+WCHCRMVYLPM YLYGK++VG I   +LSLR+EL+   Y++IDW+ ARN C KEDL
Sbjct  211   PGRIWCHCRMVYLPMCYLYGKKFVGSITPMVLSLRKELFTVPYNEIDWNKARNLCEKEDL  270

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHPA+QDI+W  LH  VEP+L +WP  KLR+K+L   M+HI +EDE T Y+CIGPVNK
Sbjct  271   YYPHPAVQDILWAFLHKAVEPILTRWPGKKLREKSLCTVMEHIHYEDENTRYICIGPVNK  330

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI D+LW+AEDGMKM GYNGSQLWD  FA+QAII+TNL
Sbjct  331   VLNMLCCWVEDPNSEAFKLHLPRIYDFLWIAEDGMKMKGYNGSQLWDTAFAIQAIISTNL  390

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EY + LRKAH F+  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  391   IKEYSTTLRKAHEFVKNSQVLEDCPGD-LGFWYRHISKGAWPFSTADHGWPISDCTAEGL  449

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA L+LS++  D+VGE +E + LYDAV+++LSLQN  GGFA+YELTRSY WLE++NP+ET
Sbjct  450   KATLLLSKIPSDIVGEPLEANWLYDAVNVLLSLQNGDGGFASYELTRSYRWLELINPAET  509

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  FR L+P +R++EIE CI KA+ FI+  Q  DGSWYGS
Sbjct  510   FGDIVIDYPYVECTSAAIQALTVFRNLYPEHRQEEIERCIKKAIIFIEKEQASDGSWYGS  569

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TY TWFG++GLV  G  Y +   IRKAC+FLLSKQL SGGWGESYLSCQ+KVY+N
Sbjct  570   WGVCFTYATWFGVKGLVAAGKNYNNDSSIRKACNFLLSKQLASGGWGESYLSCQNKVYSN  629

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EGN+ H+VNT WA++ALI+A Q 
Sbjct  630   LEGNRSHVVNTGWALMALIDAQQA  653



>gb|EEC72452.1| hypothetical protein OsI_05794 [Oryza sativa Indica Group]
Length=767

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/633 (64%), Positives = 508/633 (80%), Gaps = 1/633 (0%)
 Frame = -3

Query  2072  LMRMQFEKEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGP  1893
             + R QF K    ++ +  +K+   E ++ EAV+ +L+R +  YST QAHDGHWP DYGGP
Sbjct  60    MQRTQFAKANPLKLDIPAIKLEEHEAVTGEAVLSSLKRAIARYSTFQAHDGHWPGDYGGP  119

Query  1892  LFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNY  1713
             +FL+P L+I L V  A+N  L  EHQKE+ RY+YNHQN DGGWGLHIEGHSTMF +AL Y
Sbjct  120   MFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHSTMFGSALTY  179

Query  1712  VTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelw  1533
             V+LR+LGE  D G+GAM+K RKWILDHGGAT+I SWGK WLSVLGV++WSGNNP+PPE+W
Sbjct  180   VSLRLLGEGPDSGDGAMEKGRKWILDHGGATYITSWGKFWLSVLGVFDWSGNNPVPPEIW  239

Query  1532  llPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLA  1353
             LLPY +PIHPGRMWCHCRMVYLPM Y+YGKR+VGP+   IL LR+ELY   Y+++DWD A
Sbjct  240   LLPYFLPIHPGRMWCHCRMVYLPMCYIYGKRFVGPVTPIILELRKELYEVPYNEVDWDKA  299

Query  1352  RNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTN  1173
             RN CAKEDLYYPHP +QD++W  LH  VEP + +WP NKLR+KAL   M HI +EDE T 
Sbjct  300   RNLCAKEDLYYPHPFMQDVLWATLHKFVEPAMLRWPGNKLREKALDTVMQHIHYEDENTR  359

Query  1172  YVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFA  993
             Y+CIGPVNKVLNM+  WIE+P+S A K+H+ R+ DYLW+AEDGMKM GYNGSQLWD  F 
Sbjct  360   YICIGPVNKVLNMLACWIEDPNSEAFKLHIPRVHDYLWIAEDGMKMQGYNGSQLWDTAFT  419

Query  992   VQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWP  813
             VQAI+AT L +E+G  L+ AH +I  +Q+ +D   + L  WYRH +KG WPFST D+GWP
Sbjct  420   VQAIVATGLIEEFGPTLKLAHGYIKKTQVIDDCPGD-LSQWYRHISKGAWPFSTADHGWP  478

Query  812   VSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPW  633
             +SDCTAE LKAAL+LS+++ D+VGEA+E +RLYD+V+ ++S  N++GGFATYELTRSY W
Sbjct  479   ISDCTAEGLKAALLLSKISPDIVGEAVEVNRLYDSVNCLMSYMNDNGGFATYELTRSYAW  538

Query  632   LEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQ  453
             LE++NP+ETFG+I+IDY YVECTSAAI  L  F+KL+PG+R+ EI+ CI+KA +FI+ IQ
Sbjct  539   LELINPAETFGDIVIDYPYVECTSAAIQALTAFKKLYPGHRKSEIDNCISKAASFIEGIQ  598

Query  452   LPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYL  273
               DGSWYGSW VC+TYGTWFG++GLV  G T+++   IRKACDFLLSK+LPSGGWGESYL
Sbjct  599   KSDGSWYGSWAVCFTYGTWFGVKGLVAAGRTFKNSPAIRKACDFLLSKELPSGGWGESYL  658

Query  272   SCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             S QD+VYTN+EG + H VNT WAMLALI+AGQ 
Sbjct  659   SSQDQVYTNLEGKRPHAVNTGWAMLALIDAGQA  691



>ref|XP_003620645.1| Lanosterol synthase [Medicago truncatula]
 gb|AES76863.1| cycloartenol synthase [Medicago truncatula]
Length=653

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/656 (65%), Positives = 517/656 (79%), Gaps = 21/656 (3%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             +RSVN +IGRQ+WE+DPNLGT+++R QV++ R +FH+NRF+ K+SSDLLMR+Q + EK  
Sbjct  17    VRSVNKNIGRQFWEYDPNLGTEQKRAQVEQARKQFHENRFKTKNSSDLLMRLQVKMEK--  74

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                              E V +TL+R LRFYST+Q  DG WP DYGGPLFLLP LVIGL 
Sbjct  75    -----------------EEVGKTLKRALRFYSTLQTEDGFWPGDYGGPLFLLPSLVIGLW  117

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
             V  A+NAVL  EHQ EM RY++NHQN DGGWGLHIEG STMF TA++YVTLR+LGE+ D 
Sbjct  118   VTGAVNAVLTPEHQSEMRRYVFNHQNEDGGWGLHIEGPSTMFGTAMSYVTLRLLGEDIDS  177

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
             G+GAM+KARKWILD GGAT IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY VP+HPGR
Sbjct  178   GDGAMQKARKWILDRGGATSIPSWGKLWLSVLGVYEWSGMKAIPPEIWLLPYFVPLHPGR  237

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCH R+VYLPMSYLYG+R+VGP ++ +LS+RRE+Y   YH ++WD A+  CAKEDLY+P
Sbjct  238   MWCHTRLVYLPMSYLYGRRFVGPFSAIVLSIRREIYTLPYHILNWDHAKYHCAKEDLYHP  297

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
              P IQ+I+W  L N+ EPLL  WP++KLR KAL   M HI +EDE TNY+C+GPVNKVLN
Sbjct  298   CPMIQNILWGFLDNVGEPLLMHWPYSKLRNKALNHVMKHIHYEDENTNYICLGPVNKVLN  357

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+C W+E P+S A K H+ RIKDYLWLAEDGMKM GYNGSQ WDV  +VQAI+ATNL DE
Sbjct  358   MVCCWLENPNSEAFKCHILRIKDYLWLAEDGMKMQGYNGSQCWDVALSVQAILATNLDDE  417

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
             YGSML+KA+ FI +SQ+  +S  N    WYRH +KGGWPFST DNGWPVSDCTAE LKAA
Sbjct  418   YGSMLKKANNFIKLSQVTMNSSGN-TSCWYRHISKGGWPFSTQDNGWPVSDCTAEGLKAA  476

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             ++LS +  + VG+A+E  +L +AV+LILSLQN +GGFA+YELTRSY WLE +NP+ETF +
Sbjct  477   ILLSNLPIESVGKAVETEQLCNAVNLILSLQNRNGGFASYELTRSYTWLEKINPTETFED  536

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I IDYQYVECTSAAI GL  F + +P +R+ EI+ CI K   +I++IQ  DGSWYGSWG+
Sbjct  537   ITIDYQYVECTSAAIQGLALFTQQNPRHRKMEIDICIVKTANYIESIQWADGSWYGSWGI  596

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLP-SGGWGESYLSCQDKVY  252
             C+TYGTWFGI+GL+  G +Y+    IRK C+FLLSKQ   SGGWGESYLSCQ KVY
Sbjct  597   CFTYGTWFGIKGLIAAGKSYKDSVSIRKGCEFLLSKQHKLSGGWGESYLSCQHKVY  652



>ref|XP_007160210.1| hypothetical protein PHAVU_002G302200g, partial [Phaseolus vulgaris]
 gb|ESW32204.1| hypothetical protein PHAVU_002G302200g, partial [Phaseolus vulgaris]
Length=751

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/700 (60%), Positives = 544/700 (78%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SVNN IGRQ+WEFDPN GT EER +++++R E+ +NRF  K S DLL+RMQ  KE   
Sbjct  13    LISVNNFIGRQHWEFDPNAGTPEERAEIERVREEYRRNRFCSKQSGDLLLRMQLRKEHTC  72

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                 ++VKV   E ++EEAV+ T+RRG+ FYS+IQAHDGHWPA+  GPLF +  LV+ L 
Sbjct  73    GAIPERVKVRDRENVTEEAVITTMRRGISFYSSIQAHDGHWPAESAGPLFFIQPLVMALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER-D  1680
             +  ++NAVL  EHQKE++RY+YNHQN DGGWGLHIEGHSTMF +AL+Y+ LRILGE R D
Sbjct  133   ITGSLNAVLGPEHQKEIIRYLYNHQNKDGGWGLHIEGHSTMFGSALSYIALRILGEGRED  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G + AM + RKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPELWLLP   PIHPG
Sbjct  193   GEDKAMARCRKWILDHGGLEAIPSWGKFWVTVLGVYEWSGCNPLPPELWLLPKYTPIHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYLYGK++VGPI   I+SLR E+YNH Y QIDW+  R++ AKEDLYY
Sbjct  253   KMLCYCRLVYMPMSYLYGKKFVGPITKLIISLREEMYNHPYDQIDWNKCRSRVAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ EPLLN WPF+ LR+KAL +A+DHI++EDE + Y+CIG V KVL
Sbjct  313   PHPLIQDMLWASLHHVAEPLLNCWPFSMLREKALEVAIDHIRYEDENSRYLCIGSVEKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+  + GSQLWD   A+QAI++ +L +
Sbjct  373   CLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSF-GSQLWDAALAIQAILSCDLSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH F+  SQ+ E+   ++  + +RH +KG W FS  D GW VSDCTAE LKA
Sbjct  432   EYGPTLRKAHHFVKASQVCENPSGDF-EAMHRHISKGAWTFSMHDQGWQVSDCTAEGLKA  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS+M  D++GE +E  R YDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E F 
Sbjct  491   ALLLSQMPVDLIGEKMEDDRFYDAVNVILSLQSSNGGFPAWEPQRAYRWLEKFNPTEIFE  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             + +I+ +YVECTS+A+ GL  FRKL+P +RRKEI +CI+KA+ +I+  Q PDGSW+G WG
Sbjct  551   DTLIEMEYVECTSSALQGLALFRKLYPKHRRKEINSCISKAIHYIEKTQNPDGSWFGCWG  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGTWF ++GL   G TY + H +RKACDFLLSKQLP+GGWGESYLS Q+KVYTN+E
Sbjct  611   ICYTYGTWFSVKGLTDCGKTYRNSHALRKACDFLLSKQLPNGGWGESYLSSQNKVYTNLE  670

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             GN+ ++V T+WA+++LI+AGQV +    ++ G K+ +N+ 
Sbjct  671   GNRANLVQTSWALMSLIDAGQVEIDPTAVERGIKLLMNSQ  710



>gb|EPS63519.1| cycloartenol synthase, partial [Genlisea aurea]
Length=711

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/630 (67%), Positives = 509/630 (81%), Gaps = 1/630 (0%)
 Frame = -3

Query  2060  QFEKEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLL  1881
             QF KE  +   L Q  V   ++I E+ V  TLRR ++F+ST+QA DGHWP DYGGP+FL+
Sbjct  1     QFRKENLEAETLPQEYVEDIQDIREDKVANTLRRAIKFHSTLQADDGHWPGDYGGPMFLV  60

Query  1880  PFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLR  1701
             P L+I LS+  A++ VL  EH++E+ RYIYNHQN DGGWGLHIEG STMF +ALNYVTLR
Sbjct  61    PGLIIALSITGALDVVLSTEHRREICRYIYNHQNRDGGWGLHIEGPSTMFGSALNYVTLR  120

Query  1700  ILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY  1521
             +LGE    G+GAM+K R WILDHGGAT I SWGK+WLSVLGVYEWSGNNPLPPE+WL PY
Sbjct  121   LLGEGAHDGDGAMEKGRDWILDHGGATAITSWGKMWLSVLGVYEWSGNNPLPPEIWLFPY  180

Query  1520  IVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQC  1341
             I+P HPGRMWCHCRMVYLPMSY+YGK++VGPI STILSLR+ELY   YH ++WD AR++C
Sbjct  181   ILPFHPGRMWCHCRMVYLPMSYVYGKKFVGPITSTILSLRKELYTVPYHLVNWDRARSEC  240

Query  1340  AKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCI  1161
             AKEDLYYPHP IQDI+W  LH  VEP+L KWP  KLR KAL   M+HI +EDE T Y+CI
Sbjct  241   AKEDLYYPHPLIQDILWAFLHKGVEPILTKWPGKKLRDKALRTVMEHIHYEDENTRYLCI  300

Query  1160  GPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAI  981
             GPVNKVLNM+C WIE+P S A K+HL+RI DYLWLAEDGMKM GYNGSQLWD  FAVQAI
Sbjct  301   GPVNKVLNMLCCWIEDPKSDAFKLHLARIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAI  360

Query  980   IATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDC  801
             +AT L  E+G  L +AH FI  SQ+ +D   + L  +YRH +KG WPFST D+GWP+SDC
Sbjct  361   VATKLAKEFGPTLSRAHAFIKNSQVLDDCTGD-LDHFYRHISKGAWPFSTGDHGWPISDC  419

Query  800   TAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEIL  621
             TAE LKAAL+LS++ +++VGE I+P  LYDAV++ILSLQN  GGFATYELTRSY W+E++
Sbjct  420   TAEGLKAALLLSKLPEELVGEPIDPKGLYDAVNVILSLQNQGGGFATYELTRSYSWMEMV  479

Query  620   NPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDG  441
             NP+ETFG+I+IDY YVECTSAAI  L  F+K++PG+R+KE+E CI  A  FI+++Q PDG
Sbjct  480   NPAETFGDIVIDYPYVECTSAAIQALTAFKKMYPGHRKKEVENCIESAAKFIESVQAPDG  539

Query  440   SWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQD  261
             SWYGSWGVC+TYG WFG++GLV  G ++ +   IRKAC F+LSKQLP GGWGESYLSCQ+
Sbjct  540   SWYGSWGVCFTYGLWFGVKGLVAAGRSFRNSSAIRKACHFVLSKQLPCGGWGESYLSCQN  599

Query  260   KVYTNIEGNKWHIVNTAWAMLALIEAGQVI  171
             KVY+N+EG K H+VNT+WAML LI+AGQ +
Sbjct  600   KVYSNLEGEKSHVVNTSWAMLTLIDAGQAL  629



>ref|XP_008362456.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Malus 
domestica]
Length=758

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/681 (63%), Positives = 513/681 (75%), Gaps = 6/681 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L+SVN+H+ RQ WEF P  GT  E QQ++  R  F  +RF+ +HSSDLLMR+QF KE   
Sbjct  20    LKSVNSHLVRQVWEFHPETGTPGELQQIEDARKAFWNHRFERRHSSDLLMRIQFAKESPC  79

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                L Q+KV  +EE++EEAV  TL+R + FYSTIQAHDGHW  DYGG +FLLP L+I LS
Sbjct  80    ATNLPQLKVKDQEEVTEEAVTTTLQRAVSFYSTIQAHDGHWAGDYGGXMFLLPGLIITLS  139

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
                A+NAVL +EHQ EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE    
Sbjct  140   SSGALNAVLLKEHQCEMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEGAVD  199

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
             G GA++ ARKWILDHGG T I SWGK+WLSVLG YEWSGNNPL PE+WL PY +P HPGR
Sbjct  200   GQGAIELARKWILDHGGVTAITSWGKMWLSVLGAYEWSGNNPLLPEVWLCPYSLPFHPGR  259

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCH  MVYLPMSYLYGKR+V PI  TI SLR+ELY   YH++DW+ ARN CA EDLYYP
Sbjct  260   MWCHYXMVYLPMSYLYGKRFVEPITPTIRSLRKELYTVPYHEVDWNNARNLCAXEDLYYP  319

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
             HP +QDI+W  LH + EP+  +WP  +LRK +L   M HI +EDE T Y+CIGPVNKVLN
Sbjct  320   HPMVQDILWGSLHYVYEPIFTRWPXKELRKSSLKTVMQHIHYEDENTRYLCIGPVNKVLN  379

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+C W E+P S A K+HL RI D LW+AEDGMK+ GYNGSQ WD  F   AI +T+L +E
Sbjct  380   MLCCWAEDPISEAFKLHLLRIPDCLWIAEDGMKLQGYNGSQAWDTSF---AIXSTDLVEE  436

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
             YG +LRKAH +I   Q+ ED   + L  WYRH +KG    ST D+ WP+SDCTAE LKAA
Sbjct  437   YGPILRKAHQYIKDFQVLEDFPGD-LNFWYRHISKGX--ISTADHEWPISDCTAEGLKAA  493

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             L+LS++  + VG++++    YDAV++ L LQN+ GGFATYELTRSY +  ++NP+ETFG+
Sbjct  494   LLLSKIPAETVGDSLDIKHFYDAVNVTLYLQNDDGGFATYELTRSYHYFYLINPAETFGD  553

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I+IDY YVECTSAAI  L  F+KL PG+R +EIE CI  A  FI+TIQ  DG WYGSWGV
Sbjct  554   IVIDYPYVECTSAAIQALALFKKLCPGHRSEEIENCIASAAXFIETIQATDGXWYGSWGV  613

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEG  237
             C+TY  WFGI+GLV  G TYE C  I KAC+FLL K+LPSGGWGESYL CQ+KVYTN+  
Sbjct  614   CFTYAGWFGIKGLVAAGRTYEDCSSICKACNFLLFKELPSGGWGESYLXCQNKVYTNLMD  673

Query  236   NKWHIVNTAWAMLALIEAGQV  174
             N+ HIV+ AWAMLALI AGQ 
Sbjct  674   NRPHIVHNAWAMLALIGAGQA  694



>dbj|BAA86930.1| lupeol synthase [Olea europaea]
Length=758

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/702 (59%), Positives = 533/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL + NNHIGRQ+WEFDP  GT +ER +V++LR EF KNRF+ K S+DLLMRMQ  KE 
Sbjct  12    PWLTTTNNHIGRQHWEFDPEAGTPDERVEVERLREEFKKNRFRTKQSADLLMRMQLVKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
              +      +K+   E I+EEAV+ TLRR + FYSTIQAHDGHWPA+  GPLF LP LV+ 
Sbjct  72    QRVQIPPAIKIKETEGITEEAVITTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVLA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-E  1686
             L V  AIN VL  EHQKE+ RYIYNHQN DGGWG+HIEGHSTMF + L+Y+TLR+LGE +
Sbjct  132   LYVTGAINVVLSREHQKEITRYIYNHQNEDGGWGIHIEGHSTMFGSVLSYITLRLLGEGQ  191

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG + A+ + RKWILDHGGA  IPSWGK WL+VLGVYEW G NP+PPE WLLP   PIH
Sbjct  192   EDGEDKAVARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWDGCNPMPPEFWLLPNFSPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VGPI   +LSLR+E+Y   YH I+W+ ARN CAKEDL
Sbjct  252   PGKMLCYCRLVYMPMSYLYGKRFVGPITGLVLSLRQEIYTEPYHGINWNRARNTCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH+  EP+L +WPF+KLR+KAL +AM+H+ +ED  + Y+CIG V K
Sbjct  312   YYPHPLAQDMLWGFLHHFAEPVLTRWPFSKLREKALKVAMEHVHYEDMNSRYLCIGCVEK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL +I  W+E+P+S A K H++RI DY W+AEDG+KM  + G Q+WD  FA+QAI+++NL
Sbjct  372   VLCLIACWVEDPNSEAYKRHIARIPDYFWVAEDGLKMQSF-GCQMWDAAFAIQAILSSNL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  L KAH F+  SQ++E+   ++    YRH++KG W FS  D+GW VSDCTAE L
Sbjct  431   AEEYGPTLMKAHNFVKASQVQENPSGDF-NEMYRHTSKGAWTFSMQDHGWQVSDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+ S+M  ++VG  IE   LYDAV++IL+LQ+ SGGF  +E  ++Y WLE LNP+E 
Sbjct  490   KAALLFSQMPIELVGAEIETGHLYDAVNVILTLQSASGGFPAWEPQKAYRWLEKLNPTEF  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+  YVECTS+A+  LK F++LHPG+RRKEI +CI+KA+ +I+  Q PDGSW GS
Sbjct  550   FEDVLIERDYVECTSSAVQALKLFKQLHPGHRRKEIASCISKAIQYIEATQNPDGSWDGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+C+TYGTWF + GLV  G  Y +   +R+AC+FLLSKQLP GGW ESYLS  +KVYTN
Sbjct  610   WGICFTYGTWFAVEGLVACGKNYHNSPTLRRACEFLLSKQLPDGGWSESYLSSSNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++V T+WA+L+LI+AGQV +    I  G K+ +N+ 
Sbjct  670   LEGNRSNLVQTSWALLSLIKAGQVEIDPGPIHRGIKLLVNSQ  711



>ref|XP_002964244.1| hypothetical protein SELMODRAFT_266790 [Selaginella moellendorffii]
 gb|EFJ34577.1| hypothetical protein SELMODRAFT_266790 [Selaginella moellendorffii]
Length=762

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/683 (61%), Positives = 514/683 (75%), Gaps = 8/683 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L ++N+ +GRQ W +D  LG+ E+R +VQ+ R  F KNR   KHSSDLLMRMQ   +   
Sbjct  18    LSTLNDLVGRQIWCYDEALGSDEDRARVQEARDHFAKNRHVHKHSSDLLMRMQPLPQIPP  77

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                   VKV S+ EI +  V  T+RR LRFYSTIQA DGHWP DYGGP+FL+P L+I L 
Sbjct  78    P-----VKVQSDAEIKQSDVETTIRRALRFYSTIQAEDGHWPGDYGGPMFLMPGLIIALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
             V  AIN VL  EH +EM RY +NHQN DGGWGLHIEGHSTMF T L YV+LR+LG+E D 
Sbjct  133   VTGAINVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHSTMFGTVLVYVSLRLLGQEPD-  191

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
                AMK A  WI  HGG   IPSWGK WL+VLGV++WSG NPLPPE++LLPY +P+HPGR
Sbjct  192   -KPAMKSALSWIFGHGGTIAIPSWGKFWLAVLGVFDWSGVNPLPPEMYLLPYAIPLHPGR  250

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCHCRMVYLPMSY+YG+R+ G I   + +LR+EL+N  +  +DW+ ARN CAKEDLYYP
Sbjct  251   MWCHCRMVYLPMSYIYGRRFTGKITPKVEALRKELFNGPFEDVDWNRARNSCAKEDLYYP  310

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
             HP IQD++W  LH  VEPLL +WP + LRKKAL   ++HI +ED  T Y+CIGPVNKV+N
Sbjct  311   HPLIQDVLWGVLHKGVEPLLMRWPGSLLRKKALDTVLEHIHYEDVNTRYICIGPVNKVIN  370

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+C W E+P+S A K HL RI DYLW+AEDG+KM GYNGSQLWD  FAVQAII+T++ +E
Sbjct  371   MLCCWAEDPNSEAFKQHLPRIHDYLWVAEDGLKMQGYNGSQLWDTAFAVQAIISTDMLEE  430

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
                ML+KAH +I  SQ++ED   + L  ++RH + G WPFS  D+GWP+SDCTAE LK+ 
Sbjct  431   SREMLKKAHSYIEKSQVREDCPGD-LDYFHRHISNGAWPFSNRDHGWPISDCTAEGLKSV  489

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             L+LSR++ DVVG+ + P RLYD V++++S QN +GG ATYELTRSY W+E+ NPSETFG+
Sbjct  490   LLLSRISSDVVGKPLSPERLYDCVNMLISYQNANGGVATYELTRSYAWIELFNPSETFGD  549

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I IDY YVECTSA +  L  F +L+P +R KEIE  + K   +I++IQ PDGSWYGSWGV
Sbjct  550   ITIDYSYVECTSACVQALCAFSRLYPDHRSKEIELFVAKGCQYIESIQRPDGSWYGSWGV  609

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEG  237
             C+TYG WFG+ GLV  G +Y+    IRKACDFL+SKQLPSGGWGESYLS Q+KVY N+EG
Sbjct  610   CFTYGIWFGVLGLVAAGKSYKHSAAIRKACDFLVSKQLPSGGWGESYLSSQNKVYMNLEG  669

Query  236   NKWHIVNTAWAMLALIEAGQVIL  168
              K H+VNTAWAMLALI  GQ  L
Sbjct  670   GKHHLVNTAWAMLALIAGGQASL  692



>ref|XP_008655663.1| PREDICTED: cycloartenol synthase-like isoform X2 [Zea mays]
Length=767

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/689 (61%), Positives = 519/689 (75%), Gaps = 7/689 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             P LRS N  +GR  WEF+P+LGT E+R +V+K R +F  +RFQ +HS+D+LMRMQ +  K
Sbjct  14    PLLRSTNRFVGRTVWEFEPDLGTPEQRAEVEKARRDFSDHRFQRRHSADVLMRMQMQYSK  73

Query  2042  GQEMGLQQV---KVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFL  1872
             G  + L      K+G +E+++EEAV  +L+R +   S +QAHDGHWP D  GPLFLLP L
Sbjct  74    GTPLKLDLPAVKKLGEDEDVTEEAVSTSLKRAINRVSALQAHDGHWPGDCSGPLFLLPGL  133

Query  1871  VIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILG  1692
             +I L V  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLH+EGHS M  T LNYV LR++G
Sbjct  134   IITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHSAMLGTTLNYVALRLIG  193

Query  1691  EERDGGN---GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPY  1521
             E  D G     AM++ R WIL  GGAT+  SWGK WL+VLGVY+WSGNNPLPPE+WLLPY
Sbjct  194   EGPDSGGDDGAAMERGRNWILQRGGATYTTSWGKFWLTVLGVYDWSGNNPLPPEMWLLPY  253

Query  1520  IVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQC  1341
              +P HPGRMWCHCR VYLPMSY+YGKR+VG I   +L LR ELY   Y  IDW+ ARNQC
Sbjct  254   HLPFHPGRMWCHCRAVYLPMSYVYGKRFVGRITPLVLELRNELYGDPYSLIDWNKARNQC  313

Query  1340  AKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCI  1161
             AKEDLYYPH  +QD++W  LH  VEP++  WP  K R+ AL  AM HI +EDE+T Y+ +
Sbjct  314   AKEDLYYPHSFLQDVLWATLHKFVEPVMMHWPGIKFREIALRTAMRHIHYEDESTRYINL  373

Query  1160  GPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAI  981
             GPVNKVLNM+  WIE+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD G  V AI
Sbjct  374   GPVNKVLNMLACWIEDPNSEAFKLHVPRIYDYLWLAEDGMKMKGYNGSQLWDAGLTVLAI  433

Query  980   IATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDC  801
             + T+L +E+G  L+ AH F+  SQI  D+ +  L  WYRH +KGGWPFST D+GW VSDC
Sbjct  434   VNTDLIEEFGPTLKLAHAFVKNSQII-DNCLEDLNQWYRHMSKGGWPFSTADHGWCVSDC  492

Query  800   TAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEIL  621
             TA  L+A L+LS ++  +VGEA+E  R+YD V+ ++SL NN+GGFAT+ELTRSY WLE +
Sbjct  493   TATGLEATLLLSTISPQIVGEAMEVGRVYDGVNCLISLMNNNGGFATFELTRSYAWLEHI  552

Query  620   NPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDG  441
             NPSETFG I+IDY YVECTS++I  L  F+KL+P +R +EI++CI+K   FI+++Q  DG
Sbjct  553   NPSETFGGIMIDYPYVECTSSSIQALALFKKLYPRHRTEEIDSCISKGANFIESMQRNDG  612

Query  440   SWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQD  261
             SWYGSWGVC+TY TWF + GL   G T+E    I+KAC+FLLSK+LPSGGWGESYLSCQD
Sbjct  613   SWYGSWGVCFTYATWFAVFGLACAGRTFEDSPAIKKACEFLLSKELPSGGWGESYLSCQD  672

Query  260   KVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             KVYTN+EG + H VNT+WAMLALI  GQ 
Sbjct  673   KVYTNLEGMRPHAVNTSWAMLALIRVGQA  701



>ref|XP_003573825.1| PREDICTED: cycloartenol synthase-like isoform X1 [Brachypodium 
distachyon]
Length=760

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/685 (61%), Positives = 524/685 (76%), Gaps = 5/685 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +P LR+ N+H GRQ WEFDP+  + +E   V+  R EF   R Q K+SSDL+MRMQF K 
Sbjct  12    NPLLRTTNDHTGRQVWEFDPD-DSVDESPAVEAARREFSSRRNQTKNSSDLVMRMQFSKS  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                +M L  +K+      +EE V+ +L+R +  YS +QAHDGHWP DY G LFLLP L++
Sbjct  71    NRLKMNLPAIKLDERAFATEEDVLISLKRAIGRYSALQAHDGHWPGDYAGTLFLLPSLIV  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V E++N VL  EHQKEM RY+YNHQN DGGWGLHIEG STMFC+ +NYV LR+LGE 
Sbjct  131   ALHVTESLNTVLSSEHQKEMRRYLYNHQNEDGGWGLHIEGTSTMFCSVMNYVALRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D   GAM +AR WILDHGGAT  PSWGK +LSVLGVYEWSGNNPLPPE+W++PY +PIH
Sbjct  191   LDSC-GAMLQARSWILDHGGATLTPSWGKFFLSVLGVYEWSGNNPLPPEIWMMPYFLPIH  249

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTI-LSLRRELYNHDYHQIDWDLARNQCAKED  1329
             PGRMWC+CR+VYLPMSYLYGKR+VG I S++ L LR+ELY   Y +IDWD ARN CAKED
Sbjct  250   PGRMWCNCRLVYLPMSYLYGKRFVGAITSSVVLDLRKELYIVPYDEIDWDKARNGCAKED  309

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYPH  +QD+VW  L  + EPLL  WP +KLR++AL + M+HI++EDETT Y+CI P+N
Sbjct  310   LYYPHSPLQDVVWATLKKVGEPLLMHWPGSKLRQRALDVVMEHIRYEDETTQYICIAPLN  369

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             K+LNMICRW+E+P+S A K+H+ R+ D+LW+AEDGMKM  YNGSQLWD    VQAI AT 
Sbjct  370   KMLNMICRWVEDPNSEAFKLHIERVYDFLWVAEDGMKMKSYNGSQLWDTALTVQAIFATG  429

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L +E+G  ++ AH +I  SQI+ D   +  + WYRH +KGGW  ST D GWPVSDCTAEA
Sbjct  430   LTEEFGPTIKLAHDYIKRSQIRVDCPGDQSK-WYRHISKGGWTHSTADQGWPVSDCTAEA  488

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK  L+L+++  ++ GE +E SRL D+V+L+LSL N  G F  YELTRSY WLE+LNPSE
Sbjct  489   LKVLLLLTKVPPELAGEPMEASRLDDSVNLLLSLMNEDGSFGAYELTRSYEWLELLNPSE  548

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPGY-RRKEIEACINKALTFIQTIQLPDGSWY  432
             +FG I+I+Y YVECTS+ I GL  FR+ +P + RR+EI+ CI KA  + ++IQ  DGSWY
Sbjct  549   SFGGIMIEYPYVECTSSVIQGLVLFRETYPKHCRREEIDNCIRKAADYTESIQRADGSWY  608

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             G W +C+TYGTWFG+RGL+  G TY++   IRKAC+FLLSK+LPSGGWGESYLS QDKVY
Sbjct  609   GCWAICFTYGTWFGVRGLIAAGRTYKNSQSIRKACEFLLSKELPSGGWGESYLSSQDKVY  668

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+EGNK H VNT+WAMLALI+AGQ
Sbjct  669   TNLEGNKAHAVNTSWAMLALIDAGQ  693



>ref|XP_010252186.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
 ref|XP_010252187.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
Length=755

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/684 (59%), Positives = 526/684 (77%), Gaps = 3/684 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL++VNNH+GRQ+WEFDP  GT EER +V+++R EF KNRF+ K +SDLLMRMQ  KE 
Sbjct  11    PWLKTVNNHVGRQHWEFDPEAGTPEERAEVERVREEFRKNRFRQKQNSDLLMRMQLTKEN  70

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               ++ L  VKV   EEI+EEAV  TLRR + FYS+IQAHDGHWP +  GP+F LP LVI 
Sbjct  71    PNKLNLPPVKVKDNEEITEEAVTTTLRRAISFYSSIQAHDGHWPGEIAGPIFFLPPLVIA  130

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-E  1686
             L +  A+N VL  EHQKE+ RY+YN QN DGGWGLH+EGHSTMF + ++Y+ LR+LGE  
Sbjct  131   LYITGALNTVLSPEHQKEIRRYLYNTQNKDGGWGLHVEGHSTMFSSVVSYIALRLLGEGP  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG +  M + RKWILDHGGA  IPSWGK W++VLGVYEW+G NP PPE WLLP   PIH
Sbjct  191   DDGEDMGMARVRKWILDHGGAVGIPSWGKFWVTVLGVYEWAGFNPTPPEFWLLPKCFPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGK++VGPI S +LSLR+ELY   YH+IDW+ ARN  AKEDL
Sbjct  251   PGKMLCYCRLVYMPMSYLYGKKFVGPITSLVLSLRQELYTKPYHEIDWNKARNTVAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  L+ + EP+L +WPF+ LR+KAL +AM+H+ +ED+ + Y  IG V K
Sbjct  311   YYPHPLVQDMLWAFLYKVGEPILTRWPFSMLREKALKVAMEHVHYEDKNSRYYTIGCVEK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             V+ ++  W+E+P+S A K+HL+RI DYLW+AEDG+KM  + G Q+WD GFA+QAI+++NL
Sbjct  371   VICLLACWVEDPNSEAYKLHLARIPDYLWVAEDGIKMQSF-GCQMWDAGFAIQAILSSNL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+   LRKAH F+  SQ+KE+   ++ +  YRH +KGGW FST D+GW VSDCT+E L
Sbjct  430   IEEFSPTLRKAHDFVKSSQVKENPSGDFSKM-YRHISKGGWTFSTADHGWQVSDCTSEGL  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K  L+ S+++ ++VGE +E  R+YDAVD+ILSLQ+++GGF  +E  R++ WLE+ NP+E 
Sbjct  489   KVCLLFSQISSEIVGEQLEIERMYDAVDVILSLQSSNGGFPAWEPQRAFRWLELFNPTEF  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F + +I+ +YVECTS+ I  L  F+KLHP YR+KEIE CI++A+ +I+  Q  DGSWYG 
Sbjct  549   FEDTLIETEYVECTSSVIQALALFKKLHPEYRKKEIEHCISRAIDYIEKTQKSDGSWYGC  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+C+TYGTWF +  LV  G  Y +   I+KAC FLLSKQLPSGGWGESYLS  +KVYTN
Sbjct  609   WGICFTYGTWFAVEALVACGKNYYNSPHIQKACAFLLSKQLPSGGWGESYLSATNKVYTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             IEGN+ ++V TAWAML+LI+AGQ 
Sbjct  669   IEGNRSNLVQTAWAMLSLIDAGQA  692



>emb|CBI24038.3| unnamed protein product [Vitis vinifera]
Length=801

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/702 (60%), Positives = 536/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL +VNNHIGRQ+WEFDP+ G+ +ER +V+++R EF KNRFQ K S+DLLMRMQ  KE 
Sbjct  59    PWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQSADLLMRMQLTKEN  118

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
             G       VKV   E+ ++EAV  TLRR + FYSTIQAHDGHWPA+  GPLF LP LV+ 
Sbjct  119   GCGPIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVLA  178

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L ++ A+NAVL  +HQKE++RYIYNHQN DGGWG+HI GHST+F +A +Y+ LR+LGE  
Sbjct  179   LYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSAFSYIALRLLGEGP  238

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG   AM + RKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  239   EGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPKISPIH  298

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLR ELY   Y +I+W+ ARN CAKEDL
Sbjct  299   PGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREINWNKARNSCAKEDL  358

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH++ EP+L +WPF+ +R+KAL +A+ HI +EDE + Y CIG V K
Sbjct  359   YYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYEDENSRYYCIGCVEK  418

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL ++  W+E+P+S A K HL+RI DYLW+AEDGMKM  + G Q+WD  FA+QAII+++L
Sbjct  419   VLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSF-GCQMWDAAFAIQAIISSDL  477

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EYG  LRKAH F+  SQ++++   N+    YRH+ KG W FST D+GW VSDCT E L
Sbjct  478   AHEYGPTLRKAHDFVKASQVRQNPTGNFTEM-YRHTCKGAWTFSTQDHGWQVSDCTGEGL  536

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R++ WLE  NP+E 
Sbjct  537   KVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQSSNGGFPAWEPQRAFRWLEKFNPTEF  596

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+ +YVECTS+AI GL  F KLHP +RRKEIE+CI++A+ +I+  Q PDGSWYG 
Sbjct  597   FEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIEDTQNPDGSWYGC  656

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+ GLV  G TY++   +RKAC+FLLSKQLP GGWGESYLS  +KVYTN
Sbjct  657   WGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGESYLSSTNKVYTN  716

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++VNT+WA+LALIE GQ  +    I  G ++ IN+ 
Sbjct  717   LEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQ  758



>ref|XP_002989569.1| hypothetical protein SELMODRAFT_269539 [Selaginella moellendorffii]
 gb|EFJ09445.1| hypothetical protein SELMODRAFT_269539 [Selaginella moellendorffii]
Length=762

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/683 (61%), Positives = 513/683 (75%), Gaps = 8/683 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L ++N+ +GRQ W +D  LG+ ++R +VQ+ R  F KNR   KHSSDLLMRMQ   +   
Sbjct  18    LSTLNDLVGRQIWCYDEALGSDDDRARVQEARDHFAKNRHVQKHSSDLLMRMQPLPQIPP  77

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                   VKV  + EI +  V  T+RR LRFYSTIQA DGHWP DYGGP+FL+P L+I L 
Sbjct  78    P-----VKVQGDAEIKQSDVETTIRRALRFYSTIQAEDGHWPGDYGGPMFLMPGLIIALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDG  1677
             V  AIN VL  EH +EM RY +NHQN DGGWGLHIEGHSTMF T L YV+LR+LG+E D 
Sbjct  133   VTGAINVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHSTMFGTVLVYVSLRLLGQEPD-  191

Query  1676  GNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGR  1497
                AM+ A  WI  HGG   IPSWGK WL+VLGV++WSG NPLPPE++LLPY +P+HPGR
Sbjct  192   -KPAMESALSWIFGHGGTIAIPSWGKFWLAVLGVFDWSGVNPLPPEMYLLPYAIPLHPGR  250

Query  1496  MWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYP  1317
             MWCHCRMVYLPMSY+YG+R+ G I   + +LR+EL+N  +  +DW+ ARN CAKEDLYYP
Sbjct  251   MWCHCRMVYLPMSYIYGRRFTGKITPKVEALRKELFNGPFEDVDWNRARNTCAKEDLYYP  310

Query  1316  HPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLN  1137
             HP IQD++W  LH  VEPLL  WP + LRKKAL   ++HI +ED  T Y CIGPVNKV+N
Sbjct  311   HPLIQDVLWGVLHKGVEPLLMCWPGSLLRKKALDTVLEHIHYEDVNTRYTCIGPVNKVIN  370

Query  1136  MICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDE  957
             M+C W E+P+S A K HL RI DYLW+AEDG+KM GYNGSQLWD  FAVQAII+T++ +E
Sbjct  371   MLCCWAEDPNSEAFKQHLPRIHDYLWVAEDGLKMQGYNGSQLWDTAFAVQAIISTDMLEE  430

Query  956   YGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAA  777
              G ML+KAH +I  SQ++ED   + L  ++RH + G WPFS  D+GWP+SDCT+E LK+ 
Sbjct  431   SGEMLKKAHSYIEKSQVREDCPGD-LDYFHRHISNGAWPFSNRDHGWPISDCTSEGLKSV  489

Query  776   LMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGE  597
             L+LSR++ D+VG+ + P RLYD V++I+S QN +GG A+YELTRSY W+E+ NPSETFG+
Sbjct  490   LLLSRISSDLVGKPLSPERLYDCVNMIISYQNANGGVASYELTRSYAWIELFNPSETFGD  549

Query  596   IIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGV  417
             I IDY YVECTSA +  L  F +L+P +R KEIE  + K   +I++IQ PDGSWYGSWGV
Sbjct  550   ITIDYSYVECTSACVQALCAFSRLYPDHRSKEIELFVAKGCQYIESIQRPDGSWYGSWGV  609

Query  416   CYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEG  237
             C+TYG WFG+ GLV  G +Y+    IRKACDFLLSKQLPSGGWGESYLS Q+KVYTN+EG
Sbjct  610   CFTYGIWFGVLGLVAAGKSYKHSAAIRKACDFLLSKQLPSGGWGESYLSSQNKVYTNLEG  669

Query  236   NKWHIVNTAWAMLALIEAGQVIL  168
              K H+VNTAWAMLALI  GQ  L
Sbjct  670   GKHHLVNTAWAMLALIAGGQASL  692



>ref|XP_002964634.1| hypothetical protein SELMODRAFT_81943, partial [Selaginella moellendorffii]
 gb|EFJ34967.1| hypothetical protein SELMODRAFT_81943, partial [Selaginella moellendorffii]
Length=766

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/685 (62%), Positives = 511/685 (75%), Gaps = 5/685 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L ++N+ +GRQ W +D  LG+ E+R +VQ+ R  F KNR   KHSSDLLMRMQ  K    
Sbjct  1     LSTLNDLVGRQIWCYDEALGSDEDRARVQEARDHFAKNRHVQKHSSDLLMRMQLSKAAQP  60

Query  2036  EMGLQQ-VKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                +   VKV S+ EI +  V  T+RR LRFYSTIQA DGHWP DYGGP+FL+P L+I L
Sbjct  61    LPQIPPPVKVQSDAEIKQSDVETTIRRALRFYSTIQAEDGHWPGDYGGPMFLMPGLIIAL  120

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V  AIN VL  EH +EM RY +NHQN DGGWGLHIEGHSTMF T L YV+LR+LG+E D
Sbjct  121   YVTGAINVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHSTMFGTVLVYVSLRLLGQEPD  180

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
                 AM+ A  WI  HGG   IPSWGK WL+VLGV++WSG NPLPPE++LLPY +P+HPG
Sbjct  181   --KPAMESALSWIFGHGGTIAIPSWGKFWLAVLGVFDWSGVNPLPPEMYLLPYAIPLHPG  238

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+ G I   + +LR+EL+N  +  +DW+ ARN CAKEDLYY
Sbjct  239   RMWCHCRMVYLPMSYLYGRRFTGKITPKVEALRKELFNGPFEDVDWNRARNSCAKEDLYY  298

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH  VEPLL  WP + LRKKAL   ++HI +ED  T Y+CIG VNKV+
Sbjct  299   PHPLIQDVLWGVLHKGVEPLLMHWPGSLLRKKALDTVLEHIHYEDVNTRYICIGSVNKVI  358

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K HLSRI DYLW+AEDG+KM GYNGSQLWD  FAVQAIIAT++ +
Sbjct  359   NMLCCWAEDPNSEAFKQHLSRIHDYLWVAEDGLKMQGYNGSQLWDTAFAVQAIIATDILE  418

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E G ML+KAH +I  SQ++ED   + L+ ++RH + G W FS  D+GWPV DCTAE LK 
Sbjct  419   ESGEMLKKAHSYIEKSQVREDCPGD-LKHFHRHISNGAWTFSNRDHGWPVPDCTAEGLKC  477

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNN-SGGFATYELTRSYPWLEILNPSETF  603
              L+LSR++ DVVG+ + P RLYD V LILSLQ N SGG A+YELTRSY W+E+ NPSE F
Sbjct  478   VLLLSRISSDVVGKPLSPDRLYDCVKLILSLQQNASGGVASYELTRSYSWIELFNPSEIF  537

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G I IDY YVECTSA +  L  FR+L+P +R KEIE  + K   +I++IQ PDGSWYGS 
Sbjct  538   GNITIDYSYVECTSACVQALCAFRRLYPDHRSKEIELFVAKGCQYIESIQRPDGSWYGSL  597

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYG WFG+ GLV  G + +    IR+ACDFLLSKQLPSGGWGESYLS Q+KVYTN+
Sbjct  598   GVCFTYGIWFGVLGLVASGKSNKHSAAIRRACDFLLSKQLPSGGWGESYLSSQNKVYTNL  657

Query  242   EGNKWHIVNTAWAMLALIEAGQVIL  168
             EG K H+VNTAWAMLALI  GQ  L
Sbjct  658   EGGKHHLVNTAWAMLALIAGGQASL  682



>ref|XP_010656689.1| PREDICTED: lupeol synthase isoform X2 [Vitis vinifera]
Length=754

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/702 (60%), Positives = 536/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL +VNNHIGRQ+WEFDP+ G+ +ER +V+++R EF KNRFQ K S+DLLMRMQ  KE 
Sbjct  12    PWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQSADLLMRMQLTKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
             G       VKV   E+ ++EAV  TLRR + FYSTIQAHDGHWPA+  GPLF LP LV+ 
Sbjct  72    GCGPIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVLA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L ++ A+NAVL  +HQKE++RYIYNHQN DGGWG+HI GHST+F +A +Y+ LR+LGE  
Sbjct  132   LYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSAFSYIALRLLGEGP  191

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG   AM + RKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  192   EGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPKISPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLR ELY   Y +I+W+ ARN CAKEDL
Sbjct  252   PGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREINWNKARNSCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH++ EP+L +WPF+ +R+KAL +A+ HI +EDE + Y CIG V K
Sbjct  312   YYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYEDENSRYYCIGCVEK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL ++  W+E+P+S A K HL+RI DYLW+AEDGMKM  + G Q+WD  FA+QAII+++L
Sbjct  372   VLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSF-GCQMWDAAFAIQAIISSDL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EYG  LRKAH F+  SQ++++   N+    YRH+ KG W FST D+GW VSDCT E L
Sbjct  431   AHEYGPTLRKAHDFVKASQVRQNPTGNFTEM-YRHTCKGAWTFSTQDHGWQVSDCTGEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R++ WLE  NP+E 
Sbjct  490   KVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQSSNGGFPAWEPQRAFRWLEKFNPTEF  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+ +YVECTS+AI GL  F KLHP +RRKEIE+CI++A+ +I+  Q PDGSWYG 
Sbjct  550   FEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIEDTQNPDGSWYGC  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+ GLV  G TY++   +RKAC+FLLSKQLP GGWGESYLS  +KVYTN
Sbjct  610   WGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGESYLSSTNKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++VNT+WA+LALIE GQ  +    I  G ++ IN+ 
Sbjct  670   LEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQ  711



>ref|XP_002269060.2| PREDICTED: lupeol synthase isoform X1 [Vitis vinifera]
Length=757

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/702 (60%), Positives = 536/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL +VNNHIGRQ+WEFDP+ G+ +ER +V+++R EF KNRFQ K S+DLLMRMQ  KE 
Sbjct  15    PWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQSADLLMRMQLTKEN  74

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
             G       VKV   E+ ++EAV  TLRR + FYSTIQAHDGHWPA+  GPLF LP LV+ 
Sbjct  75    GCGPIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVLA  134

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L ++ A+NAVL  +HQKE++RYIYNHQN DGGWG+HI GHST+F +A +Y+ LR+LGE  
Sbjct  135   LYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSAFSYIALRLLGEGP  194

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG   AM + RKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  195   EGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPKISPIH  254

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLR ELY   Y +I+W+ ARN CAKEDL
Sbjct  255   PGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREINWNKARNSCAKEDL  314

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH++ EP+L +WPF+ +R+KAL +A+ HI +EDE + Y CIG V K
Sbjct  315   YYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYEDENSRYYCIGCVEK  374

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL ++  W+E+P+S A K HL+RI DYLW+AEDGMKM  + G Q+WD  FA+QAII+++L
Sbjct  375   VLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSF-GCQMWDAAFAIQAIISSDL  433

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EYG  LRKAH F+  SQ++++   N+    YRH+ KG W FST D+GW VSDCT E L
Sbjct  434   AHEYGPTLRKAHDFVKASQVRQNPTGNFTEM-YRHTCKGAWTFSTQDHGWQVSDCTGEGL  492

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R++ WLE  NP+E 
Sbjct  493   KVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQSSNGGFPAWEPQRAFRWLEKFNPTEF  552

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+ +YVECTS+AI GL  F KLHP +RRKEIE+CI++A+ +I+  Q PDGSWYG 
Sbjct  553   FEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIEDTQNPDGSWYGC  612

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+ GLV  G TY++   +RKAC+FLLSKQLP GGWGESYLS  +KVYTN
Sbjct  613   WGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGESYLSSTNKVYTN  672

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++VNT+WA+LALIE GQ  +    I  G ++ IN+ 
Sbjct  673   LEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQ  714



>ref|XP_007153001.1| hypothetical protein PHAVU_004G1782001g, partial [Phaseolus vulgaris]
 gb|ESW24995.1| hypothetical protein PHAVU_004G1782001g, partial [Phaseolus vulgaris]
Length=685

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/616 (68%), Positives = 494/616 (80%), Gaps = 1/616 (0%)
 Frame = -3

Query  2024  QQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLSVMEA  1845
             ++ KV  EE+++EE V R LR+ LR  ST+QA DG WP+DYGGPLFLLP LVIGL V   
Sbjct  4     EKKKVEREEDMNEEVVGRRLRKALRSVSTLQAEDGFWPSDYGGPLFLLPGLVIGLWVTGT  63

Query  1844  INAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGGNGA  1665
             +NAVL+ EHQ EM RY+ NHQN DGGWGLHIEGHS MF TALNYVTLR+LGEE DGG G+
Sbjct  64    LNAVLRREHQSEMRRYLLNHQNEDGGWGLHIEGHSIMFSTALNYVTLRLLGEEVDGGEGS  123

Query  1664  MKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCH  1485
             MKKAR WI+D GG T IPSWGKLWLSVLGVYEWSG   +PPE+WLLPY VP HPGRMWCH
Sbjct  124   MKKARAWIIDRGGVTHIPSWGKLWLSVLGVYEWSGMKAVPPEIWLLPYNVPFHPGRMWCH  183

Query  1484  CRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAI  1305
              R+VYLPMSYLYG+R+VGP+N  ILSLR+ELY   YH +DWD A+N C KED+Y+  P I
Sbjct  184   TRLVYLPMSYLYGRRFVGPMNPLILSLRKELYTLPYHILDWDQAKNLCPKEDMYHRCPMI  243

Query  1304  QDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICR  1125
             Q+I+W  + N+ EPLL  WP++KLRKKAL   M HI +ED+TTNYVCIGP+NKVLNM+C 
Sbjct  244   QNILWSFVENVGEPLLMHWPYSKLRKKALHCVMQHIHYEDQTTNYVCIGPINKVLNMVCC  303

Query  1124  WIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSM  945
             W+E P+S A K H+SRIKDYLW+AEDGMKM GYNGSQ WDV  +VQAI+ATNL DEYGSM
Sbjct  304   WVENPNSEAFKCHISRIKDYLWVAEDGMKMQGYNGSQFWDVALSVQAILATNLEDEYGSM  363

Query  944   LRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLS  765
             L+KA+ FI  SQI  +S  N    WYRH +KGGWPFST DNGWP  DCTAE LKAA++LS
Sbjct  364   LKKANNFIKGSQITANSSGN-PSYWYRHISKGGWPFSTTDNGWPSIDCTAEGLKAAILLS  422

Query  764   RMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIID  585
              +  + VG+A+E  +LYDAV+LILSLQN +GGFA+YELTRSY WLE +NP+ETF +I+ID
Sbjct  423   NLPHETVGKAVEIEQLYDAVNLILSLQNRNGGFASYELTRSYAWLEKMNPAETFEDIMID  482

Query  584   YQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTY  405
             YQ VECTS+AI GL  F + +P YRRKEIE CI KA ++I+++QL DGSWYGSWG+CYTY
Sbjct  483   YQCVECTSSAIQGLALFTQRYPTYRRKEIETCIAKAASYIESVQLADGSWYGSWGICYTY  542

Query  404   GTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWH  225
             GTWFGI+GLV  G  Y+    IR+ C+FLLS Q  SGGWGESY++CQ  VYTN++GNK H
Sbjct  543   GTWFGIKGLVAAGKRYQDDDSIRRGCEFLLSNQQLSGGWGESYVACQKMVYTNLKGNKSH  602

Query  224   IVNTAWAMLALIEAGQ  177
              VNTAWAMLALIEA Q
Sbjct  603   AVNTAWAMLALIEAEQ  618



>gb|AFW80117.1| hypothetical protein ZEAMMB73_095189, partial [Zea mays]
Length=762

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/690 (61%), Positives = 520/690 (75%), Gaps = 8/690 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK-E  2046
             P LRS N  +GR  WEF+P+LGT E+R +V+K R +F  +RFQ +HS+D+LMRMQ ++  
Sbjct  14    PLLRSTNRFVGRTVWEFEPDLGTPEQRAEVEKARRDFSDHRFQRRHSADVLMRMQMQQYS  73

Query  2045  KGQEMGLQQV---KVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             KG  + L      K+G +E+++EEAV  +L+R +   S +QAHDGHWP D  GPLFLLP 
Sbjct  74    KGTPLKLDLPAVKKLGEDEDVTEEAVSTSLKRAINRVSALQAHDGHWPGDCSGPLFLLPG  133

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             L+I L V  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLH+EGHS M  T LNYV LR++
Sbjct  134   LIITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHSAMLGTTLNYVALRLI  193

Query  1694  GEERDGGN---GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
             GE  D G     AM++ R WIL  GGAT+  SWGK WL+VLGVY+WSGNNPLPPE+WLLP
Sbjct  194   GEGPDSGGDDGAAMERGRNWILQRGGATYTTSWGKFWLTVLGVYDWSGNNPLPPEMWLLP  253

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             Y +P HPGRMWCHCR VYLPMSY+YGKR+VG I   +L LR ELY   Y  IDW+ ARNQ
Sbjct  254   YHLPFHPGRMWCHCRAVYLPMSYVYGKRFVGRITPLVLELRNELYGDPYSLIDWNKARNQ  313

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPH  +QD++W  LH  VEP++  WP  K R+ AL  AM HI +EDE+T Y+ 
Sbjct  314   CAKEDLYYPHSFLQDVLWATLHKFVEPVMMHWPGIKFREIALRTAMRHIHYEDESTRYIN  373

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             +GPVNKVLNM+  WIE+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD G  V A
Sbjct  374   LGPVNKVLNMLACWIEDPNSEAFKLHVPRIYDYLWLAEDGMKMKGYNGSQLWDAGLTVLA  433

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             I+ T+L +E+G  L+ AH F+  SQI  D+ +  L  WYRH +KGGWPFST D+GW VSD
Sbjct  434   IVNTDLIEEFGPTLKLAHAFVKNSQII-DNCLEDLNQWYRHMSKGGWPFSTADHGWCVSD  492

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CTA  L+A L+LS ++  +VGEA+E  R+YD V+ ++SL NN+GGFAT+ELTRSY WLE 
Sbjct  493   CTATGLEATLLLSTISPQIVGEAMEVGRVYDGVNCLISLMNNNGGFATFELTRSYAWLEH  552

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             +NPSETFG I+IDY YVECTS++I  L  F+KL+P +R +EI++CI+K   FI+++Q  D
Sbjct  553   INPSETFGGIMIDYPYVECTSSSIQALALFKKLYPRHRTEEIDSCISKGANFIESMQRND  612

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSWGVC+TY TWF + GL   G T+E    I+KAC+FLLSK+LPSGGWGESYLSCQ
Sbjct  613   GSWYGSWGVCFTYATWFAVFGLACAGRTFEDSPAIKKACEFLLSKELPSGGWGESYLSCQ  672

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             DKVYTN+EG + H VNT+WAMLALI  GQ 
Sbjct  673   DKVYTNLEGMRPHAVNTSWAMLALIRVGQA  702



>emb|CAN60556.1| hypothetical protein VITISV_020304 [Vitis vinifera]
Length=758

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/702 (60%), Positives = 535/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL +VNNHIGRQ+WEFDP+ G+ +ER +V+++R EF KNRFQ K S+DLLMRMQ  KE 
Sbjct  12    PWLMTVNNHIGRQHWEFDPDAGSPQERAEVERVREEFKKNRFQFKQSADLLMRMQLTKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
             G       VKV   E+ ++EAV  TLRR + FYSTIQAHDGHWPA+  GPLF LP LVI 
Sbjct  72    GCGPIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVIA  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L ++ A+NAVL  +HQKE++RYIYNHQN DGGWG+HI GHST+F +A +Y+ LR+LGE  
Sbjct  132   LYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSAFSYIALRLLGEGP  191

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG   AM + RKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  192   EGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPKISPIH  251

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLR ELY   Y +I+W+ ARN CAKEDL
Sbjct  252   PGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREINWNKARNSCAKEDL  311

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH++ EP+L +WPF+ +R+KAL +A+ HI +EDE + Y CIG V K
Sbjct  312   YYPHPLAQDMLWGFLHHVAEPILXRWPFSIMREKALKVALKHIHYEDENSRYYCIGCVEK  371

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL ++  W+E+P+S A K HL+RI DYLW+AEDGMKM  + G Q+WD  FA+QAII+++L
Sbjct  372   VLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSF-GCQMWDAAFAIQAIISSDL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EYG  LRKAH F+  SQ++++   N+    YRH+ KG W FST D+GW VSDCT E L
Sbjct  431   AHEYGXTLRKAHDFVKASQVRQNPSGNFTEM-YRHTCKGAWTFSTQDHGWQVSDCTGEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R++ WLE  NP+E 
Sbjct  490   KVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQSSNGGFPAWEPQRAFRWLEKFNPTEF  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+ +YVECTS+AI GL  F KLHP +RRKEIE+CI++A+ +I+  Q PDGSWYG 
Sbjct  550   FEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIEDTQNPDGSWYGC  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+ GLV  G TY++   +RKAC+FLLSKQLP GGWGESYLS  DKVYTN
Sbjct  610   WGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGESYLSSTDKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++VN +WA+LALIE GQ  +    I  G ++ IN+ 
Sbjct  670   LEGNRSNLVNXSWALLALIEGGQAEIDPTPIHRGMRVLINSQ  711



>ref|XP_008655662.1| PREDICTED: cycloartenol synthase-like isoform X1 [Zea mays]
Length=768

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/690 (61%), Positives = 520/690 (75%), Gaps = 8/690 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK-E  2046
             P LRS N  +GR  WEF+P+LGT E+R +V+K R +F  +RFQ +HS+D+LMRMQ ++  
Sbjct  14    PLLRSTNRFVGRTVWEFEPDLGTPEQRAEVEKARRDFSDHRFQRRHSADVLMRMQMQQYS  73

Query  2045  KGQEMGLQQV---KVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPF  1875
             KG  + L      K+G +E+++EEAV  +L+R +   S +QAHDGHWP D  GPLFLLP 
Sbjct  74    KGTPLKLDLPAVKKLGEDEDVTEEAVSTSLKRAINRVSALQAHDGHWPGDCSGPLFLLPG  133

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             L+I L V  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLH+EGHS M  T LNYV LR++
Sbjct  134   LIITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHSAMLGTTLNYVALRLI  193

Query  1694  GEERDGGN---GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllP  1524
             GE  D G     AM++ R WIL  GGAT+  SWGK WL+VLGVY+WSGNNPLPPE+WLLP
Sbjct  194   GEGPDSGGDDGAAMERGRNWILQRGGATYTTSWGKFWLTVLGVYDWSGNNPLPPEMWLLP  253

Query  1523  YIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQ  1344
             Y +P HPGRMWCHCR VYLPMSY+YGKR+VG I   +L LR ELY   Y  IDW+ ARNQ
Sbjct  254   YHLPFHPGRMWCHCRAVYLPMSYVYGKRFVGRITPLVLELRNELYGDPYSLIDWNKARNQ  313

Query  1343  CAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVC  1164
             CAKEDLYYPH  +QD++W  LH  VEP++  WP  K R+ AL  AM HI +EDE+T Y+ 
Sbjct  314   CAKEDLYYPHSFLQDVLWATLHKFVEPVMMHWPGIKFREIALRTAMRHIHYEDESTRYIN  373

Query  1163  IGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQA  984
             +GPVNKVLNM+  WIE+P+S A K+H+ RI DYLWLAEDGMKM GYNGSQLWD G  V A
Sbjct  374   LGPVNKVLNMLACWIEDPNSEAFKLHVPRIYDYLWLAEDGMKMKGYNGSQLWDAGLTVLA  433

Query  983   IIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSD  804
             I+ T+L +E+G  L+ AH F+  SQI  D+ +  L  WYRH +KGGWPFST D+GW VSD
Sbjct  434   IVNTDLIEEFGPTLKLAHAFVKNSQII-DNCLEDLNQWYRHMSKGGWPFSTADHGWCVSD  492

Query  803   CTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEI  624
             CTA  L+A L+LS ++  +VGEA+E  R+YD V+ ++SL NN+GGFAT+ELTRSY WLE 
Sbjct  493   CTATGLEATLLLSTISPQIVGEAMEVGRVYDGVNCLISLMNNNGGFATFELTRSYAWLEH  552

Query  623   LNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPD  444
             +NPSETFG I+IDY YVECTS++I  L  F+KL+P +R +EI++CI+K   FI+++Q  D
Sbjct  553   INPSETFGGIMIDYPYVECTSSSIQALALFKKLYPRHRTEEIDSCISKGANFIESMQRND  612

Query  443   GSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQ  264
             GSWYGSWGVC+TY TWF + GL   G T+E    I+KAC+FLLSK+LPSGGWGESYLSCQ
Sbjct  613   GSWYGSWGVCFTYATWFAVFGLACAGRTFEDSPAIKKACEFLLSKELPSGGWGESYLSCQ  672

Query  263   DKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             DKVYTN+EG + H VNT+WAMLALI  GQ 
Sbjct  673   DKVYTNLEGMRPHAVNTSWAMLALIRVGQA  702



>ref|XP_007014712.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
 gb|EOY32331.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
Length=755

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/704 (58%), Positives = 528/704 (75%), Gaps = 6/704 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             + PWL +VN H+GRQ+WEFDPN G+ EE+ QV++LR EF KNRF++K SSDLLMRMQ  K
Sbjct  9     EGPWLATVNGHVGRQHWEFDPNAGSPEEQAQVERLRLEFKKNRFRVKQSSDLLMRMQLTK  68

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E    +    VK+  EE ++EEA   TLRR + FYS++QAHDGHWPA+  GPLF LP LV
Sbjct  69    ENPCGLIPPPVKLNHEEVVTEEATTVTLRRAISFYSSLQAHDGHWPAETAGPLFFLPPLV  128

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             + L V   +N +L  EHQKE++RYIYNHQN DGGWGLHIEGHSTMF TA++Y+TLR+LGE
Sbjct  129   MALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHSTMFGTAISYITLRLLGE  188

Query  1688  ERDGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
               + G G A+ + RKWILDHGG   IPSWGK W++VLGVYEW+G NPLPPE WLLP + P
Sbjct  189   RPEDGEGMAVARGRKWILDHGGLVGIPSWGKFWVTVLGVYEWAGCNPLPPEFWLLPKVSP  248

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPG+M C+CR+VY+PMSYLYGKR+VGPI   I  LR+ELYN  YH+I+W+ ARN  AKE
Sbjct  249   IHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIRQLRQELYNQPYHEINWNAARNTVAKE  308

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP +QD+ W  LH++VEP L +WPF+ LR KAL +A+ H+ +EDE + Y+CIG V
Sbjct  309   DLYYPHPLVQDLTWGFLHHVVEPFLTRWPFSMLRDKALKVAIQHVHYEDENSRYLCIGCV  368

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
              KVL ++  W+E+P+S A K HL+R+ DY W+AEDG+KM  + G Q+WD  FA+QAI+++
Sbjct  369   EKVLCLMACWVEDPNSEAYKRHLARLPDYYWIAEDGLKMQTF-GCQMWDAAFAIQAIMSS  427

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEYG  LRKAH F+  SQ++E+   N+    YRH +KG W FST D+GW VSDCTAE
Sbjct  428   NLSDEYGPTLRKAHDFVKASQVRENPSGNF-SGMYRHISKGSWTFSTQDHGWQVSDCTAE  486

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LK AL+ S+M++D+VGE +E  R YDAV++ILSLQ+N+GGF  +E  R+Y WLE  NP+
Sbjct  487   GLKCALLFSQMSNDLVGEKLETQRFYDAVNVILSLQSNNGGFPAWEPQRAYGWLEKFNPT  546

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             E F + +I+ +YVECTS+AI  L  FRKLHP +RR EI+ C+ +   +I+  Q  DGSWY
Sbjct  547   EFFEDTLIEREYVECTSSAIQALALFRKLHPKHRRAEIDHCVARGARYIEDTQNQDGSWY  606

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             G WG+CYTYG WF + GL   G  Y +   +RKAC+FLLSKQL +GGWGESYLS Q+KVY
Sbjct  607   GCWGICYTYGAWFAVEGLAACGRNYHNSPALRKACEFLLSKQLANGGWGESYLSSQNKVY  666

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             TN+ GN+ ++V+TAWA+L+LI AGQ  +    I  G K+ IN+ 
Sbjct  667   TNLPGNRANLVHTAWALLSLIAAGQADVDPTPIHRGIKVLINSQ  710



>ref|XP_010048520.1| PREDICTED: LOW QUALITY PROTEIN: lupeol synthase-like [Eucalyptus 
grandis]
Length=755

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/702 (58%), Positives = 531/702 (76%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL SVNNH+GRQ+WEFDP+ GT EER +V+++R EF +NRF+IK S+DLLMRMQ  KE 
Sbjct  11    PWLTSVNNHVGRQHWEFDPDAGTPEERAEVERVRDEFTRNRFRIKQSADLLMRMQLTKEN  70

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                     VKV   E+++EEA   TLRR + FYS+IQAHDGHWPA+  GPLF  P +V  
Sbjct  71    PSGPIPPPVKVEEGEDVTEEAATTTLRRAISFYSSIQAHDGHWPAENAGPLFFFPPMVFA  130

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-E  1686
             LS+  A+NA+   EH+KE+ RYIYNHQN DGGWG HIEGHSTMF +AL+Y+ LR+LGE  
Sbjct  131   LSITGAMNAIFSPEHKKEIKRYIYNHQNEDGGWGFHIEGHSTMFGSALSYIALRLLGEGP  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG +GAM + RKWILDHGG    PSWGK WL+VLGVYEW+G NPLPPE WLLP   PIH
Sbjct  191   DDGEDGAMARGRKWILDHGGLVGTPSWGKFWLAVLGVYEWAGCNPLPPEFWLLPRKFPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG M C+CR+VY+PMSYLYG+R+VGP+   ILSLR ELY   Y++I+W+ AR+  AKEDL
Sbjct  251   PGNMLCYCRLVYMPMSYLYGRRFVGPVTGLILSLRXELYTEPYNEINWNRARSTVAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH++ EP+L +WP + +R+KAL +A+ H+ +EDE + Y+ IG V K
Sbjct  311   YYPHPLVQDMLWGFLHHVTEPVLKRWPLSMMREKALKVAIKHVHYEDENSRYLTIGCVEK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL M+  W+E+P+S A K HL+RI DY W+AEDG+KM  + G Q+WD  FA+QAI++ NL
Sbjct  371   VLCMVACWVEDPNSEAYKRHLARIPDYYWIAEDGLKMQTF-GCQMWDAAFAIQAIMSGNL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY + LRK H F+  SQ++++   ++ ++ YRH +KG W F+  D+GW VSDCTAE L
Sbjct  430   TEEYATTLRKGHDFVKASQVQDNPSGDF-KAMYRHISKGAWTFAMQDHGWQVSDCTAEGL  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E 
Sbjct  489   KTALLFSQMSPDLVGEKMETERFYDAVNVILSLQSSNGGFPAWEPQRAYAWLEKFNPTEF  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F E +I+ +YVECTS+AI GL  F+KLHP +RRKEI++CI +A+ +I+  QLPDGSWYG 
Sbjct  549   FEETLIEREYVECTSSAIQGLVLFKKLHPKHRRKEIDSCIARAIDYIEHTQLPDGSWYGC  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWF + GL   G +Y +C  +RKAC+FLLSKQLP GGWGESYLS Q+KVYTN
Sbjct  609   WGICYTYGTWFAVEGLAACGKSYRNCTTVRKACEFLLSKQLPCGGWGESYLSSQNKVYTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++V TAWA+L+LI+AGQ  +    I  G K+ IN+ 
Sbjct  669   LEGNRPNLVQTAWALLSLIDAGQAEIDATPIHRGVKVLINSQ  710



>ref|XP_006474340.1| PREDICTED: cycloartenol synthase 2-like isoform X2 [Citrus sinensis]
Length=634

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/568 (73%), Positives = 486/568 (86%), Gaps = 2/568 (0%)
 Frame = -3

Query  1874  LVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRIL  1695
             +V+GL V  A+NA+L  EH++EM+RY+YNHQN DGGWGLHIEG STMFCTAL+YVTLR+L
Sbjct  1     MVMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCSTMFCTALSYVTLRLL  60

Query  1694  GEERDGGN-GAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             GE  DGG+ GAM+KARKWILD GG T IPSWGK+WLSVLGVYEWSGNNPLPPE+WLLPY 
Sbjct  61    GETMDGGDDGAMEKARKWILDRGGVTSIPSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYF  120

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             +P HPGRMWCHCRM+YLPMSYLYG R+VGP NS ILSLR+ELY   YH IDWD ARN CA
Sbjct  121   LPFHPGRMWCHCRMMYLPMSYLYGTRFVGPFNSLILSLRKELYTLPYHSIDWDHARNFCA  180

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLYYPHP IQDI+W  LH I EPL+ KWPF+KLR  AL   M HI +EDE T Y+CIG
Sbjct  181   KEDLYYPHPMIQDILWGCLHKIGEPLVKKWPFSKLRHNALKTVMQHIHYEDENTQYICIG  240

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
             PVNKVLNMIC W+E+P+S A K HLSRIKDYLWLAEDGMKM GYNGSQLWDV FAVQAI+
Sbjct  241   PVNKVLNMICCWVEDPNSEAYKRHLSRIKDYLWLAEDGMKMQGYNGSQLWDVTFAVQAIL  300

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             AT+L DE GS L+KA  F+  +Q++ED   + L  WYRH +KGGWPFST DNGWPV DCT
Sbjct  301   ATDLVDECGSTLKKAFSFLKNTQVREDCSGD-LNYWYRHISKGGWPFSTADNGWPVLDCT  359

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             AE LKAA++LS++  D+VGEAI+ ++LYDAV++ILSLQN++GGFA+YELTRSY WLE++N
Sbjct  360   AEGLKAAILLSQLPADIVGEAIQENQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMIN  419

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             P+ETFG+IIIDYQYVECTSAAI GLK F K++PG+RRKEIEACI KA+ FI++ Q PDGS
Sbjct  420   PAETFGDIIIDYQYVECTSAAIQGLKSFMKIYPGHRRKEIEACIEKAIEFIESKQQPDGS  479

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWGVC+TYGTWFG++GLV  G TYE+ + I+KAC+FLLSKQL SGGWGES LSCQ+K
Sbjct  480   WYGSWGVCFTYGTWFGVKGLVTCGKTYENSNNIKKACNFLLSKQLDSGGWGESDLSCQNK  539

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYTN+EGNK H+VNTAWAML+LIEAGQ 
Sbjct  540   VYTNLEGNKSHLVNTAWAMLSLIEAGQA  567



>ref|XP_002989509.1| hypothetical protein SELMODRAFT_129950 [Selaginella moellendorffii]
 gb|EFJ09385.1| hypothetical protein SELMODRAFT_129950 [Selaginella moellendorffii]
Length=782

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/684 (61%), Positives = 513/684 (75%), Gaps = 4/684 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L ++N+ +GRQ W +D  +G+ E+R +VQ+ R  F KNR   KHSSDLLMRMQ  K    
Sbjct  18    LSTLNDLVGRQIWCYDEAIGSDEDRARVQEARDHFTKNRHVHKHSSDLLMRMQLSKAAQP  77

Query  2036  EMGLQQ-VKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                +   VKV  + EI +  V  T+RR LRFYSTIQA DGHWP DYGGP+FL+P L+I L
Sbjct  78    LPQIPPPVKVQGDAEIKQSDVETTIRRALRFYSTIQAEDGHWPGDYGGPMFLMPGLIIAL  137

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V  AIN VL  EHQ+EM RY +NHQN DGGWGLHIEGHSTMF T L YV+LR+LG+E D
Sbjct  138   YVTGAINVVLSPEHQREMCRYFFNHQNEDGGWGLHIEGHSTMFGTVLVYVSLRLLGQEPD  197

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
                 AM+ A  WI  HGG   IPSWGK WL+VLGV++WSG NPLPPE++LLPY +P+HPG
Sbjct  198   --KPAMESALSWIFGHGGTIAIPSWGKFWLAVLGVFDWSGVNPLPPEMYLLPYAIPLHPG  255

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+ G I   + +LR+EL+N  +  +DW+ ARN CAKEDLYY
Sbjct  256   RMWCHCRMVYLPMSYLYGRRFTGKITPKVEALRKELFNGPFEDVDWNRARNTCAKEDLYY  315

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH  VEPLL +WP + LRKKAL   ++HI +ED  T Y+CIG V+KV+
Sbjct  316   PHPLIQDVLWGVLHKGVEPLLMRWPGSLLRKKALDTVLEHIHYEDVNTRYICIGSVHKVI  375

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K HL RI DYLW+AEDG+KM  YNGSQLWD  FAVQAII+T++ +
Sbjct  376   NMLCCWAEDPNSEAFKQHLPRIHDYLWVAEDGLKMQAYNGSQLWDTAFAVQAIISTDMLE  435

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E   ML+KAH +I  SQ++ED   + L  ++RH + G WP S  D+GWP+SDCT+E LK+
Sbjct  436   ESREMLKKAHSYIEKSQVREDCPGD-LDYFHRHISNGAWPLSNRDHGWPISDCTSEGLKS  494

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
              L+LSR++ DVVG+ + P RLYD V++I+S QN +GG A+YELTRSY W+E+ NPSETFG
Sbjct  495   VLLLSRISSDVVGKPLSPERLYDCVNMIISYQNANGGVASYELTRSYAWIELFNPSETFG  554

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             +I IDY YVECTSA +  L  F +L+P +R KEIE  + K   +I++IQ PDGSWYGSWG
Sbjct  555   DITIDYSYVECTSACVQALCAFSRLYPDHRSKEIELFVAKGCKYIESIQRPDGSWYGSWG  614

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             VC+TYG WFG+ GLV  G +Y+    IRKACDFLLSKQLPSGGWGESYLS Q+KVYTN+E
Sbjct  615   VCFTYGIWFGVLGLVAAGKSYKHSAAIRKACDFLLSKQLPSGGWGESYLSSQNKVYTNLE  674

Query  239   GNKWHIVNTAWAMLALIEAGQVIL  168
             G K H+VNTAWAMLALI  GQ  L
Sbjct  675   GGKHHLVNTAWAMLALIAGGQASL  698



>ref|XP_002989508.1| hypothetical protein SELMODRAFT_160256 [Selaginella moellendorffii]
 gb|EFJ09384.1| hypothetical protein SELMODRAFT_160256 [Selaginella moellendorffii]
Length=783

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/685 (61%), Positives = 512/685 (75%), Gaps = 5/685 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L ++N+ +GRQ W +D  LG+ E+R +VQ+ R  F KNR   KHSSDLLMRMQ  K    
Sbjct  18    LSTLNDLVGRQIWCYDEALGSDEDRARVQEARDHFAKNRHVQKHSSDLLMRMQLSKAAQP  77

Query  2036  EMGLQQ-VKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGL  1860
                +   VKV S+ EI +  V  T+RR LRFYSTIQA DGHWP DYGGP+FL+P L+I L
Sbjct  78    LPQIPPPVKVQSDAEIKQSDVETTIRRALRFYSTIQAEDGHWPGDYGGPMFLMPGLIIAL  137

Query  1859  SVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERD  1680
              V  A+N VL  EH +EM RY +NHQN DGGWGLHIEGHSTMF T L YV+LR+LG+E D
Sbjct  138   YVTGAVNVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHSTMFGTVLVYVSLRLLGQEPD  197

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
                 AM+ A  WI  HGG   IPSWGK WL+VLGV++WSG NPLPPE++LLPY +P+HPG
Sbjct  198   --KPAMESALSWIFGHGGTIAIPSWGKFWLAVLGVFDWSGVNPLPPEMYLLPYAIPLHPG  255

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             RMWCHCRMVYLPMSYLYG+R+ G I  T+ +LR+EL+N  +  +DW+ ARN CAKEDLYY
Sbjct  256   RMWCHCRMVYLPMSYLYGRRFTGKITPTVEALRKELFNGPFEDVDWNRARNACAKEDLYY  315

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH  VEPLL +WP + LRKKAL   ++HI +ED  T Y+CIG VNKV+
Sbjct  316   PHPLIQDVLWGVLHKGVEPLLMRWPGSLLRKKALDTVLEHIHYEDVNTRYICIGSVNKVI  375

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
             NM+C W E+P+S A K HLSRI DYLW+AEDG+KM GYNGSQLWD  FAVQAII+T++ +
Sbjct  376   NMLCCWAEDPNSEAFKQHLSRIHDYLWVAEDGLKMQGYNGSQLWDTAFAVQAIISTDMLE  435

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             E G ML+KAH +I  SQ++ED   + L+ ++RH + G W FS  D+GWPV DCTAE LK 
Sbjct  436   ESGEMLKKAHSYIEKSQVREDCPGD-LKHFHRHISNGAWTFSNRDHGWPVPDCTAEGLKC  494

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNN-SGGFATYELTRSYPWLEILNPSETF  603
              L+LSR++ DVVG+ + P RLYD V LILSLQ N SGG A+YELTRSY W+E+ NPSE F
Sbjct  495   VLLLSRISSDVVGKPLSPDRLYDCVKLILSLQQNASGGVASYELTRSYSWIELFNPSEIF  554

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G I IDY YVECTSA +  L  F +L+P +R KEI   + K   +I++IQ PDGSWYGS 
Sbjct  555   GNITIDYSYVECTSACVQALCAFSRLYPDHRSKEIALFVAKGCQYIESIQRPDGSWYGSL  614

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             GVC+TYG WFG+ GLV  G +++    IR+ACDFLLSKQLPSGGWGESYLS Q+KVYTN+
Sbjct  615   GVCFTYGIWFGVLGLVAAGKSHKHSAAIRRACDFLLSKQLPSGGWGESYLSSQNKVYTNL  674

Query  242   EGNKWHIVNTAWAMLALIEAGQVIL  168
             EG K H+VNTAWAMLALI  GQ  L
Sbjct  675   EGGKHHLVNTAWAMLALIAGGQASL  699



>gb|KHN16704.1| Lupeol synthase [Glycine soja]
Length=729

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/700 (59%), Positives = 535/700 (76%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SVNN IGRQ+WEFDPN GT +ER QV+++R E+ KNRF IK S DLLMRMQ  KE   
Sbjct  19    LISVNNFIGRQHWEFDPNAGTPQERAQVERVREEYKKNRFCIKQSGDLLMRMQLTKENTC  78

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                L +V V   E ++EEA++ T+R+ + FYS+IQAHDGHWPA+  GPLF L  LV+ L 
Sbjct  79    GPILARVNVKDTENVTEEALITTMRKAINFYSSIQAHDGHWPAESAGPLFFLQPLVMALY  138

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-ERD  1680
             +  ++N VL  EHQKE++RY+YNHQN DGGWGLHIE HSTMF +AL+Y+ LRILGE   D
Sbjct  139   ITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHSTMFGSALSYIALRILGEGPED  198

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G + AM + RKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPE+WLLP   PIHPG
Sbjct  199   GEDRAMARGRKWILDHGGLEAIPSWGKFWVTVLGVYEWSGCNPLPPEIWLLPKYAPIHPG  258

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYL+GKR+VGPI   I+SLR E+YN  Y QIDW+ AR+  AKEDLYY
Sbjct  259   KMLCYCRLVYMPMSYLFGKRFVGPITGLIISLREEMYNQPYDQIDWNNARSTVAKEDLYY  318

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ EPLLN WPF+ LR+KAL +A+DHI++EDE + Y+CIG V KVL
Sbjct  319   PHPLIQDMLWASLHHVAEPLLNCWPFSMLREKALEVAIDHIRYEDENSGYLCIGSVEKVL  378

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+    GSQLWD   A+QAII+ +L +
Sbjct  379   CLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSL-GSQLWDATLAIQAIISCDLSE  437

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH F+  SQ+ E+   N+ ++ +RH +KG W FS  D GW VSDCTAE LKA
Sbjct  438   EYGPTLRKAHHFVKASQVLENPSGNF-KAMHRHISKGAWTFSMQDQGWQVSDCTAEGLKA  496

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS+M+ D++GE +E  R YDAVD+ILSLQ+ +GGF  +E  R+Y WLE  NP+E F 
Sbjct  497   ALLLSQMSPDLIGEKMEDERFYDAVDVILSLQSGNGGFPAWEPQRAYRWLEKFNPTEIFK  556

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             + +I+ +YVECTS+A+ GL  FRKL+P +RRKE++ CI+KA+ +I+  Q PDGSW+G WG
Sbjct  557   DTLIEMEYVECTSSALQGLALFRKLYPKHRRKEVDLCISKAIRYIEKTQNPDGSWFGCWG  616

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGT F ++GL   G  Y +   +RKAC FLLSKQLP+GGWGESYLS Q+KVYTN++
Sbjct  617   ICYTYGTLFSVKGLTDCGKNYRNSPALRKACKFLLSKQLPNGGWGESYLSSQNKVYTNLK  676

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             GN+ ++V T+WA+++LI+AGQV +    ++ G ++ IN+ 
Sbjct  677   GNRANLVQTSWALMSLIDAGQVEIDPTPVERGIRLLINSQ  716



>ref|XP_003530475.1| PREDICTED: lupeol synthase isoform 1 [Glycine max]
Length=763

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/700 (59%), Positives = 535/700 (76%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SVNN IGRQ+WEFDPN GT +ER QV+++R E+ KNRF IK S DLLMRMQ  KE   
Sbjct  13    LISVNNFIGRQHWEFDPNAGTPQERAQVERVREEYKKNRFCIKQSGDLLMRMQLTKENTC  72

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                L +V V   E ++EEA++ T+R+ + FYS+IQAHDGHWPA+  GPLF L  LV+ L 
Sbjct  73    GPILARVNVKDTENVTEEALITTMRKAINFYSSIQAHDGHWPAESAGPLFFLQPLVMALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-ERD  1680
             +  ++N VL  EHQKE++RY+YNHQN DGGWGLHIE HSTMF +AL+Y+ LRILGE   D
Sbjct  133   ITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHSTMFGSALSYIALRILGEGPED  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G + AM + RKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPE+WLLP   PIHPG
Sbjct  193   GEDRAMARGRKWILDHGGLEAIPSWGKFWVTVLGVYEWSGCNPLPPEIWLLPKYAPIHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYL+GKR+VGPI   I+SLR E+YN  Y QIDW+ AR+  AKEDLYY
Sbjct  253   KMLCYCRLVYMPMSYLFGKRFVGPITGLIISLREEMYNQPYDQIDWNNARSTVAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ EPLLN WPF+ LR+KAL +A+DHI++EDE + Y+CIG V KVL
Sbjct  313   PHPLIQDMLWASLHHVAEPLLNCWPFSMLREKALEVAIDHIRYEDENSGYLCIGSVEKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+    GSQLWD   A+QAII+ +L +
Sbjct  373   CLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSL-GSQLWDATLAIQAIISCDLSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH F+  SQ+ E+   N+ ++ +RH +KG W FS  D GW VSDCTAE LKA
Sbjct  432   EYGPTLRKAHHFVKASQVLENPSGNF-KAMHRHISKGAWTFSMQDQGWQVSDCTAEGLKA  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS+M+ D++GE +E  R YDAVD+ILSLQ+ +GGF  +E  R+Y WLE  NP+E F 
Sbjct  491   ALLLSQMSPDLIGEKMEDERFYDAVDVILSLQSGNGGFPAWEPQRAYRWLEKFNPTEIFK  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             + +I+ +YVECTS+A+ GL  FRKL+P +RRKE++ CI+KA+ +I+  Q PDGSW+G WG
Sbjct  551   DTLIEMEYVECTSSALQGLALFRKLYPKHRRKEVDLCISKAIRYIEKTQNPDGSWFGCWG  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGT F ++GL   G  Y +   +RKAC FLLSKQLP+GGWGESYLS Q+KVYTN++
Sbjct  611   ICYTYGTLFSVKGLTDCGKNYRNSPALRKACKFLLSKQLPNGGWGESYLSSQNKVYTNLK  670

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             GN+ ++V T+WA+++LI+AGQV +    ++ G ++ IN+ 
Sbjct  671   GNRANLVQTSWALMSLIDAGQVEIDPTPVERGIRLLINSQ  710



>ref|XP_010656690.1| PREDICTED: lupeol synthase isoform X3 [Vitis vinifera]
Length=752

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/702 (59%), Positives = 534/702 (76%), Gaps = 11/702 (2%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWL +VNNHIGRQ+WEFDP+ G+ +ER +V+++R EF KNRFQ K S+DLLMRMQ  KE 
Sbjct  15    PWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQSADLLMRMQLTKEN  74

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
             G       VKV   E+ ++EAV  TLRR + FYSTIQAHDGHWPA+  GPLF LP LV+ 
Sbjct  75    GCGPIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAESAGPLFFLPPLVLA  134

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L ++ A+NAVL  +HQKE++RYIYNHQN DGGWG+HI GHST+F +A +Y+ LR+LGE  
Sbjct  135   LYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSAFSYIALRLLGEGP  194

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             +GG   AM + RKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  195   EGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPKISPIH  254

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLR ELY   Y +I+W+ ARN CAKEDL
Sbjct  255   PGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREINWNKARNSCAKEDL  314

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP  QD++W  LH++ EP+L +WPF+ +R+KAL +A+ HI +EDE + Y CIG V K
Sbjct  315   YYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYEDENSRYYCIGCVEK  374

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL ++  W+E+P+S A K HL+RI DYLW+AEDGMKM      Q+WD  FA+QAII+++L
Sbjct  375   VLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKM------QMWDAAFAIQAIISSDL  428

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
               EYG  LRKAH F+  SQ++++   N+    YRH+ KG W FST D+GW VSDCT E L
Sbjct  429   AHEYGPTLRKAHDFVKASQVRQNPTGNFTEM-YRHTCKGAWTFSTQDHGWQVSDCTGEGL  487

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+ S+M+ D+VGE +E  R YDAV++ILSLQ+++GGF  +E  R++ WLE  NP+E 
Sbjct  488   KVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQSSNGGFPAWEPQRAFRWLEKFNPTEF  547

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F +++I+ +YVECTS+AI GL  F KLHP +RRKEIE+CI++A+ +I+  Q PDGSWYG 
Sbjct  548   FEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIEDTQNPDGSWYGC  607

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+ GLV  G TY++   +RKAC+FLLSKQLP GGWGESYLS  +KVYTN
Sbjct  608   WGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGESYLSSTNKVYTN  667

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             +EGN+ ++VNT+WA+LALIE GQ  +    I  G ++ IN+ 
Sbjct  668   LEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQ  709



>ref|XP_004308480.1| PREDICTED: lupeol synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/683 (60%), Positives = 534/683 (78%), Gaps = 3/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+++NH+GRQ+WEFDP+ GT EER QV+++R EF +NRF+IK S+DLLMRMQ  K+ 
Sbjct  11    PWLRTLDNHVGRQHWEFDPDEGTPEERAQVERVREEFTRNRFRIKQSADLLMRMQLTKDN  70

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                     ++V   E+I+E+AV  T+RR L F+S++QAHDGHWPA+  GPLF +  LVI 
Sbjct  71    PSGPIPAAIRVKGIEDITEKAVTVTIRRSLSFFSSLQAHDGHWPAESAGPLFFIQPLVIA  130

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V  A+ AVL  EHQKE++RYIYNHQN DGGWGLHIEGHSTMF +AL+Y+ LR+LGE  
Sbjct  131   LYVTGALCAVLGPEHQKEIIRYIYNHQNEDGGWGLHIEGHSTMFGSALSYIALRLLGEGP  190

Query  1682  DGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
             D G G A+ +ARKWILDHGGA  IPSWGK WL+VLGVYEWSG NPLPPE WLLP I PIH
Sbjct  191   DDGEGMAVARARKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLPPEFWLLPNIFPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VG I   + SLRRELYN  YHQI+W  ARN  AKEDL
Sbjct  251   PGKMLCYCRLVYMPMSYLYGKRFVGQITGLVKSLRRELYNEPYHQINWSKARNTVAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QD++W  LH++ EP+L +WPF+ LR+KAL +A++H+ +EDE + Y+CIG V K
Sbjct  311   YYPHPLVQDMLWGFLHHVAEPVLARWPFSILREKALKVAIEHVHYEDENSRYLCIGSVEK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL +I  W+E+P+S A K+HL+RI DY W+AEDG+K   + GSQ+WD  F++QAI++ +L
Sbjct  371   VLCLIACWVEDPNSEAYKLHLARIPDYFWVAEDGLKFQSF-GSQMWDAAFSIQAILSCDL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG+ LRKAH F+  SQI+E+ G +Y  + YRH +KG W FS  D+GW VSDCT+E L
Sbjct  430   NEEYGATLRKAHDFVKASQIRENPGGDYA-AMYRHISKGAWTFSIQDHGWQVSDCTSEGL  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K AL+LS+M + +VGE +E    YDAV++ILSLQ+ SGGF  +E  R++ WLE  NP+E 
Sbjct  489   KVALLLSQMPEKLVGEGMEADCFYDAVNVILSLQSISGGFPAWEPQRAFSWLEKFNPTEF  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F + +I+ +YVECTS+A+ GL  FR+ +P +RR+EI++CI+KA+++I+  Q PDGSWYG 
Sbjct  549   FEDTLIEREYVECTSSAVQGLALFRRFYPNHRRQEIDSCISKAISYIEEAQNPDGSWYGC  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWFG+  L   G  Y++   +RKAC FLLSKQLP+GGWGESYLS Q+KVYTN
Sbjct  609   WGICYTYGTWFGVGALAVCGKNYQNSLILRKACAFLLSKQLPNGGWGESYLSSQNKVYTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQ  177
             +EGN+ ++V+TAWA+L+L++AGQ
Sbjct  669   LEGNRANLVHTAWALLSLMDAGQ  691



>gb|EMT12088.1| Cycloartenol synthase [Aegilops tauschii]
Length=697

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/684 (61%), Positives = 512/684 (75%), Gaps = 31/684 (5%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             DPWLR+ N H+GRQ WEFD      +    V   R EF   R Q+KHS+DL MR+Q  KE
Sbjct  12    DPWLRTKNAHVGRQVWEFDAAADDPDALAAVDAARREFAARRHQLKHSADLPMRIQLAKE  71

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                ++ L  +K+G  E+++EEAV  TLRR L  +ST+QAHDGHWP DYGGP+FL+P L  
Sbjct  72    NPLKLDLPAIKLGENEDVTEEAVSTTLRRALSTFSTLQAHDGHWPGDYGGPMFLMPGL--  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
                                         N DGGWGLHIEG STMF +AL YV+LR+LGE 
Sbjct  130   ----------------------------NEDGGWGLHIEGPSTMFGSALTYVSLRLLGEG  161

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G+GAM+K R WILDHGGAT+I SWGK WL+VLGV++WSGNNPLPPE W+LPY +P+H
Sbjct  162   PDSGDGAMEKGRNWILDHGGATYITSWGKFWLAVLGVFDWSGNNPLPPETWMLPYCLPVH  221

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPM Y+YGKR+VG I   IL LR EL+   Y ++DWD ARN CAKEDL
Sbjct  222   PGRMWCHCRMVYLPMCYVYGKRFVGRITPIILELRNELFKVPYSEVDWDSARNLCAKEDL  281

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQDI+W  LH  VEP++  WP NKLR+K+L   M H+ +EDE T Y+CIGPVNK
Sbjct  282   YYPHPLIQDILWATLHKFVEPVMMHWPGNKLREKSLNHVMQHVHYEDENTRYICIGPVNK  341

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+  WIE+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQLWD  FAVQAI AT+L
Sbjct  342   VLNMLACWIEDPNSEAFKLHIPRIYDYLWVAEDGMKMQGYNGSQLWDTAFAVQAIAATDL  401

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+   L+ AH FI  SQ+ +D   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  402   IEEFAPTLKLAHDFIKNSQVVDDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  460

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KA+L+LS+++ ++VGE++E +RLYDAV+ ++S  N +GGFATYEL RSY WLE++NP+ET
Sbjct  461   KASLLLSKISPEIVGESVEVNRLYDAVNCLMSWMNENGGFATYELQRSYAWLELINPAET  520

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             FG+I+IDY YVECTSAAI  L  F+KL+PG+RRK+++ CINKA ++I++IQ  DGSWYGS
Sbjct  521   FGDIVIDYPYVECTSAAIQALTSFKKLYPGHRRKDVDNCINKAASYIESIQRKDGSWYGS  580

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             W VC+TYGTWFG++GL+  G T++S   IRKACDFL+SK+LP GGWGESYLS QD+VYTN
Sbjct  581   WAVCFTYGTWFGVKGLLAAGRTFKSSPAIRKACDFLMSKELPFGGWGESYLSSQDQVYTN  640

Query  245   IEGNKWHIVNTAWAMLALIEAGQV  174
             +EG   H VNT WAML LI+AGQ 
Sbjct  641   LEGKHTHAVNTGWAMLTLIDAGQA  664



>ref|XP_003573823.1| PREDICTED: cycloartenol synthase-like isoform X1 [Brachypodium 
distachyon]
Length=759

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/685 (61%), Positives = 519/685 (76%), Gaps = 6/685 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +P LR+ N+H GRQ WEFDP+    +E   V+  R EF   R Q K+SSDLLMR+QF K 
Sbjct  12    NPLLRTTNDHAGRQVWEFDPD--DSDEIAAVEAARIEFSSRRNQTKNSSDLLMRIQFSKS  69

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                +M L  +K+      +EE V+ +L+R +  YST+QAHDGHWP DY G LFLLP L++
Sbjct  70    NRLKMNLPAIKLDEHAFATEEDVLISLKRAIGRYSTLQAHDGHWPGDYAGTLFLLPSLIV  129

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L V E++N VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMFC+ +NYV LR+LGE 
Sbjct  130   ALHVTESLNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGRSTMFCSVMNYVALRLLGEG  189

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D   G M +AR WILDHGGAT  PSWGK +LSVLGVYEWSGNNPLPPE+W++PY +PIH
Sbjct  190   LDSC-GPMLQARSWILDHGGATLTPSWGKFFLSVLGVYEWSGNNPLPPEIWMMPYFLPIH  248

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTI-LSLRRELYNHDYHQIDWDLARNQCAKED  1329
             PGRMWCHCR+VYLPMSYLYGKR+VG   S++ L LR+ELY+  Y +IDWD ARN CAKED
Sbjct  249   PGRMWCHCRLVYLPMSYLYGKRFVGATTSSVVLDLRKELYSVPYDEIDWDKARNGCAKED  308

Query  1328  LYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVN  1149
             LYYP   +QD+VW  L  + EPLL  WP NKLRK+AL + M+HI++EDETT Y+CI  +N
Sbjct  309   LYYPRSPLQDVVWATLKKVGEPLLMHWPGNKLRKRALDVVMEHIRYEDETTQYICIAALN  368

Query  1148  KVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATN  969
             K+LNMICRW+E+P+S A K+H+ R+ D+LW+AEDGMKM  YNGSQLWD    VQAI AT 
Sbjct  369   KMLNMICRWVEDPNSEAFKLHIQRVYDFLWVAEDGMKMKSYNGSQLWDTALTVQAIFATG  428

Query  968   LCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEA  789
             L   +G  ++ AH +I  SQI+ D   +  + W+RH +KGGW  ST D+ WPVSDCTAEA
Sbjct  429   LTKVFGPTIKLAHDYIKRSQIRVDCPGDQSK-WHRHISKGGWTHSTADHRWPVSDCTAEA  487

Query  788   LKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSE  609
             LK  L+L+++  +++GE +E SRL D V+L+LSL N+ G F  YELTRSY WLE+LNPSE
Sbjct  488   LKVLLLLTKVPPELIGEPMESSRLDDTVNLLLSLMNDDGSFGAYELTRSYEWLELLNPSE  547

Query  608   TFGEIIIDYQYVECTSAAIIGLKYFRKLHPG-YRRKEIEACINKALTFIQTIQLPDGSWY  432
             +FG I+I+Y YVECTS+ I GL  F++ +P  YRR+EI+ CI KA  + ++IQ  DGSWY
Sbjct  548   SFGGIMIEYPYVECTSSVIQGLVLFKETYPTHYRREEIDKCIRKAADYTESIQRADGSWY  607

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             G W +C+TYGTWFG+ GL+  G TYE+   IRKAC+FLLSK+LPSGGWGESYLS QDKVY
Sbjct  608   GCWAICFTYGTWFGVSGLIAAGRTYENSQSIRKACEFLLSKELPSGGWGESYLSSQDKVY  667

Query  251   TNIEGNKWHIVNTAWAMLALIEAGQ  177
             TN+EGNK H VNT+WAMLALI+AGQ
Sbjct  668   TNLEGNKAHAVNTSWAMLALIDAGQ  692



>ref|XP_003570909.1| PREDICTED: cycloartenol synthase-like [Brachypodium distachyon]
Length=775

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/688 (60%), Positives = 511/688 (74%), Gaps = 6/688 (1%)
 Frame = -3

Query  2222  PW---LRSVNNHIGRQYWEFDPNLGTQEERQQVQKL--RAEFHKNRFQIKHSSDLLMRMQ  2058
             PW   LRS N H GRQ WEF  +               R  F + R + KHS+DLLMR+Q
Sbjct  17    PWQQQLRSTNEHAGRQVWEFVDDPAAVAAAAADAVDDARRGFCRRRHEAKHSADLLMRLQ  76

Query  2057  FEKEKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLP  1878
             F +    ++ +  +K+   E+++EEAV+ +L+R +  Y+T+QAHDGHWP D  GP+FLLP
Sbjct  77    FAELNPPKLDIPGIKLEEHEDVTEEAVLTSLKRAIGRYATLQAHDGHWPGDIAGPMFLLP  136

Query  1877  FLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRI  1698
              LVI L    A++ VL  EHQKE+ RY+YNHQN DGGWGLHIEG STMF + L YVTLR+
Sbjct  137   GLVIALHSTGALDTVLSSEHQKEICRYLYNHQNTDGGWGLHIEGPSTMFGSVLTYVTLRL  196

Query  1697  LGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYI  1518
             LGEE D G+GAM+ A+ WIL HGGATF  SWGK WLSVLGV++WSGNNPL PELWLLPY 
Sbjct  197   LGEEPDSGDGAMEIAQDWILGHGGATFTTSWGKFWLSVLGVFDWSGNNPLLPELWLLPYS  256

Query  1517  VPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCA  1338
             +P HPGRMW HCRMVY PMSY+YGKR+VGPI   +L+LR+EL+   Y +IDWD ARNQCA
Sbjct  257   LPFHPGRMWSHCRMVYFPMSYIYGKRFVGPITPIVLNLRKELFKVPYDEIDWDKARNQCA  316

Query  1337  KEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIG  1158
             KEDLY PHP  QDI+W  LH  VEP+L+ WP  KLR++AL   M HI +EDE T Y+C G
Sbjct  317   KEDLYCPHPLGQDILWATLHKFVEPVLSHWPGCKLRERALKNVMQHIHYEDENTQYICSG  376

Query  1157  PVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAII  978
              V KVLNM+  WIE+P S   K+H+ RI DYLW+AEDGMKM GYNGSQLWD  F V+A++
Sbjct  377   AVGKVLNMLSCWIEDPTSQEFKLHIPRIYDYLWVAEDGMKMQGYNGSQLWDTAFTVEALL  436

Query  977   ATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCT  798
             +T L +E G  L+ AH +I  SQ+  D   + L  WYRH +KG W FST D GWPVSDCT
Sbjct  437   STELTEELGPTLKLAHEYIKNSQVLHDCHGD-LSYWYRHISKGAWTFSTADQGWPVSDCT  495

Query  797   AEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILN  618
             A  LKA+L+LS+++ +VVG ++E ++L+DAV+ +LS  N +GGFA YELTRSY WLE LN
Sbjct  496   ALGLKASLLLSKISPEVVGVSLETNKLHDAVNCLLSWMNGNGGFAPYELTRSYAWLEFLN  555

Query  617   PSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             PSETFG+I+IDY YVECTSA I  L  FRK +PG+RR+EI+ CI KA  FIQ+IQ  DGS
Sbjct  556   PSETFGDIMIDYPYVECTSAVIQALTSFRKHYPGHRREEIDKCIRKADNFIQSIQRSDGS  615

Query  437   WYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDK  258
             WYGSWGVC+T+GTWF +RGLV  G T+++   IRKAC FLLSK+LPSGGWGESYLSC+DK
Sbjct  616   WYGSWGVCFTHGTWFAVRGLVAAGRTFKNSPAIRKACGFLLSKELPSGGWGESYLSCRDK  675

Query  257   VYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             VYT +E  + H VNT+WAMLALI+AGQ 
Sbjct  676   VYTELEERRPHAVNTSWAMLALIDAGQA  703



>sp|H2KWF1.1|PAKSY_ORYSJ RecName: Full=Parkeol synthase [Oryza sativa Japonica Group]
 gb|ABG22399.1| Cycloartenol synthase, putative, expressed [Oryza sativa Japonica 
Group]
Length=759

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/683 (59%), Positives = 515/683 (75%), Gaps = 1/683 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLRSVNN +GRQ WEFDP+LGT EER  V+K R EF ++RF+ KHSSDLLMRMQF KE 
Sbjct  12    PWLRSVNNLLGRQVWEFDPDLGTPEERADVEKARREFAEHRFERKHSSDLLMRMQFAKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
              Q++ L  VK G  E++  EAV  +L+R +     +QAHDGHWP DY G +F LP L+I 
Sbjct  72    CQKLDLLAVKRGEHEDVMGEAVWSSLKRAISRVCNLQAHDGHWPGDYAGLMFFLPGLIIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L V   +N VL  EHQKEM RYIYNHQN DGGWGLHIEGHSTM  ++LNYV LR+LGE  
Sbjct  132   LHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHSTMLGSSLNYVALRLLGEGP  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             +GG+G ++  R WILDHGGATF  SWGK WLSVLGV++WSGNNP+PPEL LLPY +P HP
Sbjct  192   NGGDGCIENGRNWILDHGGATFTTSWGKFWLSVLGVFDWSGNNPVPPELLLLPYQLPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRM  + RMV++PMSY+YGKR+VGP+   +L LR ELYN  Y +IDW+ AR QCAKED+Y
Sbjct  252   GRMSSYIRMVFIPMSYIYGKRFVGPVTPVVLELRSELYNDPYDEIDWNKARTQCAKEDMY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YP  +  D+ W  LH  +EP+L +WP  KLR+KAL  +M ++ +EDE T Y+C G V K 
Sbjct  312   YPRSSKLDMFWSFLHKFIEPVLLRWPGRKLREKALATSMRNVHYEDECTRYICFGGVPKA  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LN++  WIE+P S A K H++R+ DYLW+AEDGMKM  Y+GSQ+WD G  V+A++AT+L 
Sbjct  372   LNILACWIEDPSSEAFKCHIARVYDYLWIAEDGMKMQIYDGSQVWDAGLTVEALVATDLV  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
              E G  L++AH F+  SQ+ ++   ++ R WYRH +KGGW F+T D+GW VSDCTA ALK
Sbjct  432   KELGPTLKRAHSFLKNSQLLDNCPRDFNR-WYRHISKGGWTFTTADDGWQVSDCTATALK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L+LSR++ ++VGE +E    YDAV+ ++SL N++GGF+ +EL RS  WLE +NP+E F
Sbjct  491   ACLLLSRISPEIVGEPLEIDAQYDAVNCLMSLMNDNGGFSAFELVRSNTWLEHINPTEAF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSW  423
             G ++I+Y YVECTS++I  L  F+KLHPG+R++E+E CI+K   FI++ Q  DGSWYGSW
Sbjct  551   GRVMIEYPYVECTSSSIQCLALFKKLHPGHRKEEVENCISKGANFIESSQRSDGSWYGSW  610

Query  422   GVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNI  243
             G+C+TY TWF + GLV  G T  +   +RKACDFLLSKQLPSGGWGESYLSC D+VYTN+
Sbjct  611   GICFTYATWFAVTGLVSAGRTLGNSATVRKACDFLLSKQLPSGGWGESYLSCHDEVYTNL  670

Query  242   EGNKWHIVNTAWAMLALIEAGQV  174
             +GN+ H  +TAWAM+ALI+AGQ 
Sbjct  671   KGNRPHGTHTAWAMIALIDAGQA  693



>gb|KHN00954.1| Lupeol synthase [Glycine soja]
Length=755

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/700 (59%), Positives = 532/700 (76%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SVN+ IGRQ+W FDPN GT +ER +V++LR +F KNRF IK S+DLLMRMQ  KE   
Sbjct  13    LISVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQSADLLMRMQLTKENQC  72

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                   VKV   E I+ E ++ T+RRG+ FYS+IQAHDGHWPA+  GPLF L  LV+ L 
Sbjct  73    GPIPPAVKVRDTENITMEDLITTIRRGISFYSSIQAHDGHWPAESAGPLFFLQPLVMALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-ERD  1680
             +  +++ VL  EH+KE++RY+YNHQN DGGWG HIEGHS+MF +AL+Y+ LRILGE  +D
Sbjct  133   ITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGSALSYIALRILGEGSQD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G   AM +ARKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPE WLLP   PIHPG
Sbjct  193   GEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLPPEFWLLPKCSPIHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYLYGK++VGPI S I SLR E+YN  Y QI+W+ ARN  AKEDLYY
Sbjct  253   KMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQINWNKARNIVAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ E ++N WPF+ LR+KAL +A++H+++EDE + Y+CIG V KVL
Sbjct  313   PHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYEDENSRYLCIGSVEKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+  + G Q+WD  FA+QAI+A N+ +
Sbjct  373   CLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSF-GCQMWDAAFAIQAILACNVSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH F+  SQ++E+   ++ ++ YRH +KG W FS  D+GW VSDCTAE LKA
Sbjct  432   EYGPTLRKAHSFVKASQVRENPSGDF-KAMYRHISKGSWTFSMHDHGWQVSDCTAEGLKA  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS MA D+VGE +E  RLYDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E F 
Sbjct  491   ALLLSEMATDLVGEEMEAERLYDAVNVILSLQSSNGGFPAWEPQRAYRWLEKFNPTEFFE  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             + +I+ +YVECT +A+ GL  FRKL+P +RRKEI+ CI+ A+ +I+  Q PDGSWYG WG
Sbjct  551   DTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYIENTQNPDGSWYGCWG  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGTWF + GL   G  Y +   +RKAC FLLSKQLP+GGWGESYLS Q+KVYTN+E
Sbjct  611   ICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWGESYLSSQNKVYTNLE  670

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             GN+ ++V T+WA+L+LI+AGQ  +    I  G K+ IN+ 
Sbjct  671   GNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQ  710



>ref|XP_006606308.1| PREDICTED: lupeol synthase-like isoform X1 [Glycine max]
 ref|XP_006606309.1| PREDICTED: lupeol synthase-like isoform X2 [Glycine max]
Length=755

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/700 (59%), Positives = 532/700 (76%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SVN+ IGRQ+W FDPN GT +ER +V++LR +F KNRF IK S+DLLMRMQ  KE   
Sbjct  13    LISVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQSADLLMRMQLTKENQC  72

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                   VKV   E I+ E ++ T+RRG+ FYS+IQAHDGHWPA+  GPLF L  LV+ L 
Sbjct  73    GPIPPAVKVRDTENITMEDMITTIRRGISFYSSIQAHDGHWPAESAGPLFFLQPLVMALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE-ERD  1680
             +  +++ VL  EH+KE++RY+YNHQN DGGWG HIEGHS+MF +AL+Y+ LRILGE  +D
Sbjct  133   ITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGSALSYIALRILGEGSQD  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G   AM +ARKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPE WLLP   PIHPG
Sbjct  193   GEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLPPEFWLLPKCSPIHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYLYGK++VGPI S I SLR E+YN  Y QI+W+ ARN  AKEDLYY
Sbjct  253   KMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQINWNKARNIVAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ E ++N WPF+ LR+KAL +A++H+++EDE + Y+CIG V KVL
Sbjct  313   PHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYEDENSRYLCIGSVEKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+  + G Q+WD  FA+QAI+A N+ +
Sbjct  373   CLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSF-GCQMWDAAFAIQAILACNVSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  LRKAH F+  SQ++E+   ++ ++ YRH +KG W FS  D+GW VSDCTAE LKA
Sbjct  432   EYGPTLRKAHSFVKASQVRENPSGDF-KAMYRHISKGSWTFSMHDHGWQVSDCTAEGLKA  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS MA D+VGE +E  RLYDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E F 
Sbjct  491   ALLLSEMATDLVGEEMEAERLYDAVNVILSLQSSNGGFPAWEPQRAYRWLEKFNPTEFFE  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             + +I+ +YVECT +A+ GL  FRKL+P +RRKEI+ CI+ A+ +I+  Q PDGSWYG WG
Sbjct  551   DTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYIENTQNPDGSWYGCWG  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGTWF + GL   G  Y +   +RKAC FLLSKQLP+GGWGESYLS Q+KVYTN+E
Sbjct  611   ICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWGESYLSSQNKVYTNLE  670

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             GN+ ++V T+WA+L+LI+AGQ  +    I  G K+ IN+ 
Sbjct  671   GNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQ  710



>ref|XP_010244586.1| PREDICTED: cycloartenol synthase 2 isoform X2 [Nelumbo nucifera]
Length=617

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/597 (67%), Positives = 479/597 (80%), Gaps = 1/597 (0%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             + WLR+ NNH+GRQ WEFDP LGT EE  +V+K R  F K RF+ KHSSDLLMR+QF KE
Sbjct  11    NSWLRTTNNHVGRQVWEFDPKLGTPEEIMEVEKAREGFQKRRFEKKHSSDLLMRIQFAKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
               Q   L QVKV   E++++EAV  TL+R + FYSTIQAHDGHWP DYGGP+FLLP L+I
Sbjct  71    NPQSTILPQVKVKDSEDVTDEAVKITLKRAISFYSTIQAHDGHWPGDYGGPMFLLPGLII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
              L +  A+NAVL +EHQ+EM RY+YNHQN DGGWGLHIEG STMF TALNYVTLR+LGE 
Sbjct  131   ILYITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPSTMFGTALNYVTLRLLGEG  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              D G GAM+K RKWILDHGG T I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY +P H
Sbjct  191   TDDGEGAMEKGRKWILDHGGVTAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYFLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+ELY   YH++DW+ A N CAKEDL
Sbjct  251   PGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELYTVPYHEVDWNQACNLCAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP +QDI+W  LH +VEP+L  WP  +LR+KAL  A+ HI +ED+ T YVCIGPVNK
Sbjct  311   YYPHPLVQDILWASLHKVVEPILKCWPGKRLREKALLTAIQHIHYEDDNTRYVCIGPVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VLNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+++L
Sbjct  371   VLNMLCCWVEDPNSEAFKLHLLRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISSSL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EYG  L+KAH +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE L
Sbjct  431   IEEYGPTLKKAHEYIKNSQVLEDCPGD-LSYWYRHISKGAWPFSTADHGWPISDCTAEGL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             KAAL+LS+   ++VGE +   RLYDAV++ILSLQN  GGFATYELTRSYPWLE++NP+ET
Sbjct  490   KAALLLSKSPPEIVGEPLNAKRLYDAVNVILSLQNGHGGFATYELTRSYPWLELINPAET  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             FG+I+IDY YVECTSAAI  L  F+KL+P +R++EIE CI +A  F++ IQ  DGSW
Sbjct  550   FGDIVIDYPYVECTSAAIQALTLFKKLYPRHRQEEIEICIKRAANFLEGIQASDGSW  606



>ref|XP_008353332.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase 2-like 
[Malus domestica]
Length=607

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/595 (67%), Positives = 482/595 (81%), Gaps = 1/595 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR++NNH+GRQ WEFDP LGT EE  +V++ R  +H NRF  KHSSDLLMR+QF KE 
Sbjct  12    PWLRTLNNHVGRQVWEFDPKLGTPEELLEVERARENYHNNRFAKKHSSDLLMRIQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                  L QVKV   E+++EEAV  T+RRG+ ++ST+QAHDGHWP DYGGP+FLLP LVI 
Sbjct  72    PGRAVLPQVKVKETEDVTEEAVTNTVRRGISYHSTLQAHDGHWPGDYGGPMFLLPGLVIT  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             L++  A+NAVL +EH+KE+ RY+YNHQN DGGW LHIEG STMF + L YVTLR+LGE  
Sbjct  132   LTITGALNAVLSDEHKKEICRYLYNHQNKDGGWXLHIEGPSTMFGSVLTYVTLRLLGEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
               G GAM+  R+WILDHGGAT I SWGK+WLSVLG +EWSGNNPLPPE+WLLPY++PIHP
Sbjct  192   KDGQGAMESGRRWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPPEIWLLPYMLPIHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+N  YH+IDW+ ARNQCAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDWNEARNQCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  LH  VEP+L +WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPLVQDILWSSLHMAVEPILLRWPGKKLREKALRTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W E+P+S A K+H+ RI DYLW+AEDGMKM GYNGSQ WD  F+VQAIIATNL 
Sbjct  372   LNMLCCWAEDPNSEAFKLHIPRIYDYLWIAEDGMKMQGYNGSQAWDTSFSVQAIIATNLI  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +E+GS+LRK H +I  SQ+ ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEFGSILRKGHQYIKDSQVLEDCPGD-LDYWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             A L LS++  ++VGE ++  RLYDAV++ILSLQN  GGFATYELTRSY WLE++NP+ETF
Sbjct  491   AVLSLSKIPSEIVGEPLDTKRLYDAVNVILSLQNGDGGFATYELTRSYSWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGS  438
             G+I+IDY YVECTSA+I  L  F+KL+P +RR+EIE+CI KA+ FI+ IQ  DGS
Sbjct  551   GDIVIDYPYVECTSASIQALVSFKKLYPSHRREEIESCIKKAVEFIEKIQASDGS  605



>dbj|BAA86932.1| lupeol synthase [Taraxacum officinale]
Length=758

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/705 (56%), Positives = 523/705 (74%), Gaps = 7/705 (1%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             DD WL + NNH+GRQ+W+FDP+ GT+EER +++K+R  F  NRFQ K S+DLLMR Q  K
Sbjct  11    DDEWLTTTNNHVGRQHWQFDPDAGTEEERAEIEKIRLNFKLNRFQFKQSADLLMRTQLRK  70

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E         +K+   EE++ +AV  TL+R + FYSTIQAHDGHWPA+  GPLF LP LV
Sbjct  71    ENPINKIPDAIKLNETEEVTNDAVTTTLKRAISFYSTIQAHDGHWPAESAGPLFFLPPLV  130

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L V  A+N +L   HQ E+ RYIYNHQN DGGWGLHIEGHST+F + L+Y+TLR+LGE
Sbjct  131   IALYVTGAMNDILTPAHQLEIKRYIYNHQNEDGGWGLHIEGHSTIFGSVLSYITLRLLGE  190

Query  1688  ERD--GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIV  1515
             E D    + A+ K RKWILDHGGA  IPSWGK WL++LGVYEW G NP+PPE WL+P   
Sbjct  191   EADSVAEDMALVKGRKWILDHGGAVGIPSWGKFWLTILGVYEWGGCNPMPPEFWLMPKFF  250

Query  1514  PIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAK  1335
             PIHPG+M C+CR+VY+PMSYLYGKR+VG I   +  LR+ELY   Y +I+W+ ARN CAK
Sbjct  251   PIHPGKMLCYCRLVYMPMSYLYGKRFVGKITELVRDLRQELYTDPYDEINWNKARNTCAK  310

Query  1334  EDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGP  1155
             EDLYYPHP +QD+VW  LHN+VEP+L   P + LR+KAL +AMDH+ +ED+++ Y+CIG 
Sbjct  311   EDLYYPHPFVQDMVWGVLHNVVEPVLTSRPISTLREKALKVAMDHVHYEDKSSRYLCIGC  370

Query  1154  VNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIA  975
             V KVL +I  W+E+P+  A K HL+RI DY W+AEDGMKM  + G Q+WD  FA+QAI +
Sbjct  371   VEKVLCLIATWVEDPNGDAYKRHLARIPDYFWVAEDGMKMQSF-GCQMWDAAFAIQAIFS  429

Query  974   TNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTA  795
             +NL +EYG  L+KAH F+  SQ++++   ++ +  YRH++KG W FS  D+GW VSDCTA
Sbjct  430   SNLTEEYGPTLKKAHEFVKASQVRDNPPGDFSKM-YRHTSKGAWTFSIQDHGWQVSDCTA  488

Query  794   EALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNP  615
             E LK +L+ S+M   +VGE +E   LYDAV++ILSLQ+ +GGF  +E  R+Y WLE  NP
Sbjct  489   EGLKVSLLYSQMNPKLVGEKVETEHLYDAVNVILSLQSENGGFPAWEPQRAYAWLEKFNP  548

Query  614   SETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSW  435
             +E F +++I+ +YVECTS+AI GL  F+KLHPG+R KEIE CI++A+ +++  Q  DGSW
Sbjct  549   TEFFEDVLIEREYVECTSSAIQGLTLFKKLHPGHRTKEIEHCISRAVKYVEDTQESDGSW  608

Query  434   YGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKV  255
             YG WG+CYTYGTWF +  LV  G  Y +C  ++KAC FLLSKQLP GGWGESYLS  +KV
Sbjct  609   YGCWGICYTYGTWFAVDALVACGKNYHNCPALQKACKFLLSKQLPDGGWGESYLSSSNKV  668

Query  254   YTNIEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             YTN+EGN+ ++V+T+WA+++LI+AGQ  +    I  G ++ IN+ 
Sbjct  669   YTNLEGNRSNLVHTSWALISLIKAGQAEIDPTPISNGVRLLINSQ  713



>ref|XP_007019806.1| Cycloartenol synthase 1 isoform 5 [Theobroma cacao]
 gb|EOY17031.1| Cycloartenol synthase 1 isoform 5 [Theobroma cacao]
Length=612

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/598 (67%), Positives = 481/598 (80%), Gaps = 1/598 (0%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             PWLR+VNNH+GRQ WEFDP+LG+ EE  ++ K R  F  NRFQ KHSSDLLMR+QF KE 
Sbjct  12    PWLRTVNNHVGRQIWEFDPDLGSPEEIMEIDKARHNFTDNRFQRKHSSDLLMRLQFSKEN  71

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
                + L QVKV   E I+E  V  TLRR + F+S++QAHDGHWP DYGGP+FL+P LVI 
Sbjct  72    PVPVVLPQVKVEEAENITEGMVTNTLRRAINFHSSLQAHDGHWPGDYGGPMFLMPGLVIS  131

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEER  1683
             LS+  A+NAVL EEH+KEM RY+YNHQN DGGWGLHIEG STMF T L+YVTLR+L E  
Sbjct  132   LSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPSTMFGTVLSYVTLRLLSEGA  191

Query  1682  DGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHP  1503
             + G GAM++ R WIL HGGAT I SWGK+WLSVLGV+EWSGNNPLPPE+WLLPY++P HP
Sbjct  192   NDGQGAMERGRDWILSHGGATQITSWGKMWLSVLGVFEWSGNNPLPPEIWLLPYMLPFHP  251

Query  1502  GRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLY  1323
             GRMWCHCRMVYLPMSYLYGKR+VGPI  T+LSLR+EL+   YH+IDW+ ARN CAKEDLY
Sbjct  252   GRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFTIPYHEIDWNQARNLCAKEDLY  311

Query  1322  YPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKV  1143
             YPHP +QDI+W  L  +VEP+L  WP  KLR+KAL  A++HI +EDE T Y+CIGPVNKV
Sbjct  312   YPHPMVQDILWASLDKVVEPILMHWPGKKLREKALQTAIEHIHYEDENTRYICIGPVNKV  371

Query  1142  LNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLC  963
             LNM+C W+E+P+S A K+HL RI DYLWLAEDGMKM GYNGSQLWD  FAVQAII+TNL 
Sbjct  372   LNMLCCWVEDPNSEAFKLHLPRIYDYLWLAEDGMKMQGYNGSQLWDTAFAVQAIISTNLT  431

Query  962   DEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALK  783
             +EYG  LRKA+ +I  SQ++ED   + L  WYRH +KG WPFST D+GWP+SDCTAE LK
Sbjct  432   EEYGLTLRKANTYIKNSQVREDCPGD-LNFWYRHISKGAWPFSTADHGWPISDCTAEGLK  490

Query  782   AALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETF  603
             AAL+LS++  ++VGE +E   LYDAV++ILSLQN  GG+ATYELTRSY WLE++NP+ETF
Sbjct  491   AALLLSKIPSEIVGEPVEAKCLYDAVNVILSLQNADGGYATYELTRSYCWLELINPAETF  550

Query  602   GEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYG  429
             G+I+IDY YVECTSAAI  L  F+  HPG+R++EI+ CI KA  FI++IQ  DGSW+G
Sbjct  551   GDIVIDYPYVECTSAAIQALTSFKNSHPGHRQEEIDQCIQKAAKFIESIQASDGSWFG  608



>ref|XP_010095206.1| Lupeol synthase [Morus notabilis]
 gb|EXB58667.1| Lupeol synthase [Morus notabilis]
Length=788

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/732 (57%), Positives = 534/732 (73%), Gaps = 39/732 (5%)
 Frame = -3

Query  2219  WLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE--  2046
             ++RSVNNH+GRQ+WEFDP+ GT EER  VQ+LR  F  NRF  K S+DLLMR+Q  +E  
Sbjct  12    YVRSVNNHVGRQHWEFDPDAGTLEERAHVQRLRQHFKNNRFLHKQSADLLMRLQTIREIL  71

Query  2045  ---------------KGQEMGLQQ----------VKVGSEEEISEEAVVRTLRRGLRFYS  1941
                            +  E  L++          VKV   E+I+E+AV  TLRR L FYS
Sbjct  72    HNELRVGMTILPISTRTHEYPLRKENPCGSIPPPVKVNETEDITEDAVANTLRRALSFYS  131

Query  1940  TIQAHDGHWPADYGGPLFLLP------FLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQN  1779
             +IQAHDGHWPA+  GPLF LP       LVI L V  A+NAVL  EH+KE++RYIYNHQN
Sbjct  132   SIQAHDGHWPAESAGPLFFLPPLTAIKALVISLYVTGAVNAVLGPEHRKEIIRYIYNHQN  191

Query  1778  IDGGWGLHIEGHSTMFCTALNYVTLRILGEE-RDGGNGAMKKARKWILDHGGATFIPSWG  1602
              DGGWGLHIEGHSTMF +AL+Y+ LR+LG+   DG + AM+KARKWILDHGG   IPSWG
Sbjct  192   EDGGWGLHIEGHSTMFGSALSYIALRLLGQGLDDGDDNAMEKARKWILDHGGVVAIPSWG  251

Query  1601  KLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPIN  1422
             K W++VLGVYEWSG NPLPPE WLLP I PIHPG+M C+CR+VY+PMSYLYGKR+VGPI 
Sbjct  252   KFWITVLGVYEWSGCNPLPPEFWLLPTISPIHPGKMLCYCRLVYMPMSYLYGKRFVGPIT  311

Query  1421  STILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPF  1242
               + SLR+ELYN  Y  ++W+ ARN  AKEDLYYPHP +QD++W  LH++ EP+L  WPF
Sbjct  312   KLVKSLRQELYNQPYDHVNWNKARNTVAKEDLYYPHPVVQDMLWGFLHHVAEPILRHWPF  371

Query  1241  NKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYL  1062
             + LR KAL  A+ H+ +EDE + Y+CIG V KVL +I  W+E+P+S A K+HL+RI DYL
Sbjct  372   SMLRDKALKAAIQHVHYEDENSRYLCIGCVEKVLCLIACWVEDPNSEAYKLHLARIPDYL  431

Query  1061  WLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINY  882
             WLAEDG+K   + GSQ+WD  FAVQAII+ NL +EYG  LR+AH F+  SQ++E+   ++
Sbjct  432   WLAEDGLKFQSF-GSQMWDAAFAVQAIISCNLNEEYGPTLRRAHEFVKASQVRENPSGDF  490

Query  881   LRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVD  702
              +  YRH +KG W FS  D+GW VSDCTAE LKAAL+ S+M  ++VGE +E  R YDAV+
Sbjct  491   SKM-YRHISKGAWTFSIQDHGWQVSDCTAEGLKAALLFSQMPTEIVGEKMETERFYDAVN  549

Query  701   LILSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLH  522
             +ILSLQ+ +GGF  +E  R++ WLE  NP+E F + +I+ +YVECTS+AI GL  FRKL+
Sbjct  550   VILSLQSKNGGFPAWEPQRAFRWLEKFNPTEFFEDTLIEREYVECTSSAIQGLAMFRKLY  609

Query  521   PGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHG  342
             P +RRKEI++CI+K L +IQ  Q  DGSW G WG+CYTYGTWF +  L   G +Y +C  
Sbjct  610   PKHRRKEIDSCISKGLGYIQDTQNLDGSWTGCWGICYTYGTWFAVEALAACGKSYNNCVS  669

Query  341   IRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQVIL--  168
             ++KAC FLLSKQLP+GGWGESYLS Q+KVYTN+EG++ ++V TAWA+L+LI+AGQ  +  
Sbjct  670   LQKACQFLLSKQLPNGGWGESYLSSQNKVYTNLEGHRANLVQTAWALLSLIKAGQADINP  729

Query  167   -*IKVGDKIFIN  135
               I  G ++ IN
Sbjct  730   TPIHRGIRVLIN  741



>ref|XP_010669609.1| PREDICTED: lupeol synthase-like [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/684 (58%), Positives = 515/684 (75%), Gaps = 3/684 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             +DPWL S NNH+GRQ+WEFDP  GT EER +V+K+R EF KNR + K S DLLMRMQ  +
Sbjct  10    EDPWLVSTNNHVGRQHWEFDPVAGTPEERAEVEKVREEFKKNRLKKKQSDDLLMRMQLRR  69

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E       Q + +  +E+I+E+AV  T++R + F+STIQAHDGHWPA+  GPLF LP LV
Sbjct  70    ENPSLAMPQGITLKEKEDITEKAVNMTVKRAINFFSTIQAHDGHWPAESAGPLFFLPPLV  129

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             I L +  A N +L  +HQKE+ RYIYNHQN DGGWGLHIEGHSTMF + ++Y+ LR+LGE
Sbjct  130   IALHITGATNTILSPQHQKEIKRYIYNHQNEDGGWGLHIEGHSTMFGSIISYIALRLLGE  189

Query  1688  ERDGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
               D G   A+ + R+WILDHGGAT IPSWGK WL+VLGVYEW G NP+PPE WLLP I P
Sbjct  190   GPDDGEANAVTRGRQWILDHGGATGIPSWGKFWLTVLGVYEWDGCNPMPPEFWLLPKISP  249

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             +HPG+M C+CR+VY+PMSYLYGKR+VGPI S ILSLRRELY   Y++I+W+ ARN CAKE
Sbjct  250   MHPGKMLCYCRLVYMPMSYLYGKRFVGPITSLILSLRRELYIQPYNEINWNNARNSCAKE  309

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP +QD+VW  LH+  EP+LN+WPF+KLR+K++ +AM+H+ +ED  + Y+CIG V
Sbjct  310   DLYYPHPLMQDMVWGFLHHFTEPILNRWPFSKLREKSMKIAMEHVHYEDVASRYLCIGCV  369

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
              KVL ++  W+E+ +S A K HL+RI DY WLAEDGMKM  + GSQ+WD  F +QAI A+
Sbjct  370   EKVLCLLACWVEDSNSEAYKRHLARIPDYFWLAEDGMKMQSF-GSQMWDAAFGIQAIFAS  428

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
              L  EY   L+KAH F+  SQ+KE+   N+ +  YRH +KG W FS  D+GW VSDCTAE
Sbjct  429   GLIQEYAPTLKKAHDFVKASQVKENPSGNF-KEMYRHISKGAWTFSIQDHGWQVSDCTAE  487

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LK AL+ S M  + VGE ++   LYDAV++ LSLQ+ +GGF  +E  R++ W+E  NP+
Sbjct  488   GLKTALLYSSMPTEFVGEKMDAECLYDAVNVTLSLQSENGGFPAWEPQRAFRWIEKFNPT  547

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             E F +++I+ +YVECTS+AI GL  F++L+PG+R+KEIE CI K L +I+  Q PDGSWY
Sbjct  548   EFFEDVLIEREYVECTSSAIQGLTLFKELYPGHRKKEIEMCIAKGLDYIEETQNPDGSWY  607

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             G WG+CYTYGTWFG+  LV     + +   +RKAC FL+SKQLP GGWGE+YLS  +KVY
Sbjct  608   GCWGICYTYGTWFGVEALVACRKNFYNSLALRKACHFLISKQLPDGGWGENYLSSPNKVY  667

Query  251   TNIEGNKWHIVNTAWAMLALIEAG  180
             TN+EGNK ++V T+WA+L+L++AG
Sbjct  668   TNLEGNKSNLVQTSWALLSLMKAG  691



>ref|XP_006453169.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
 gb|ESR66409.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
Length=612

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/546 (74%), Positives = 468/546 (86%), Gaps = 2/546 (0%)
 Frame = -3

Query  1808  MLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEERDGGN-GAMKKARKWILDH  1632
             M+RY+YNHQN DGGWGLHIEG STMFCTAL+YVTLR+LGE  DGG+ GAM+KARKWILD 
Sbjct  1     MIRYLYNHQNRDGGWGLHIEGCSTMFCTALSYVTLRLLGETMDGGDDGAMEKARKWILDR  60

Query  1631  GGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPGRMWCHCRMVYLPMSYL  1452
             GG T IPSWGK+WLSVLGVYEWSGNNPLPPE+WLLPY +P HPGRMWCHCRM+YLPMSYL
Sbjct  61    GGVTSIPSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYFLPFHPGRMWCHCRMMYLPMSYL  120

Query  1451  YGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYYPHPAIQDIVWDGLHNI  1272
             YG R+VGP NS ILSLR+ELY   YH IDWD ARN CAKEDLY PHP IQDI+W  LH I
Sbjct  121   YGTRFVGPFNSLILSLRKELYTLPYHSIDWDHARNFCAKEDLYNPHPMIQDILWGCLHKI  180

Query  1271  VEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVLNMICRWIEEPDSIAVK  1092
              EPL+ KWPF+KLR  AL   M HI +EDE T Y+CIGPVNKVLNMIC W+E+P+S A K
Sbjct  181   GEPLVKKWPFSKLRHNALKTVMQHIHYEDENTQYICIGPVNKVLNMICCWVEDPNSEAYK  240

Query  1091  VHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCDEYGSMLRKAHLFINVS  912
              HLSRIKDYLWLAEDGMKM GYNGSQLWDV FAVQAI+AT+L DE GS L+KA  F+  +
Sbjct  241   RHLSRIKDYLWLAEDGMKMQGYNGSQLWDVTFAVQAILATDLVDECGSTLKKAFSFLKNT  300

Query  911   QIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKAALMLSRMADDVVGEAI  732
             Q++ED   + L  WYRH +KGGWPFST DNGWPV DCTAE LKAA++LS++  D+VGEAI
Sbjct  301   QVREDCSGD-LNYWYRHISKGGWPFSTADNGWPVLDCTAEGLKAAILLSQLPADIVGEAI  359

Query  731   EPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFGEIIIDYQYVECTSAAI  552
             + ++LYDAV++ILSLQN++GGFA+YELTRSY WLE++NP+ETFG+IIIDYQYVECTSAAI
Sbjct  360   QENQLYDAVNVILSLQNSTGGFASYELTRSYAWLEMINPAETFGDIIIDYQYVECTSAAI  419

Query  551   IGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWGVCYTYGTWFGIRGLVG  372
              GLK F K++PG+RRKEIEACI KA+ FI++ Q PDGSWYGSWGVC+TYGTWFG++GLV 
Sbjct  420   QGLKSFMKIYPGHRRKEIEACIEKAIEFIESKQQPDGSWYGSWGVCFTYGTWFGVKGLVT  479

Query  371   GGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIEGNKWHIVNTAWAMLAL  192
              G TYE+ + I+KAC+FLLSKQL SGGWGES LSCQ+KVYTN+EGNK H+VNTAWAML+L
Sbjct  480   CGKTYENSNNIKKACNFLLSKQLDSGGWGESDLSCQNKVYTNLEGNKSHLVNTAWAMLSL  539

Query  191   IEAGQV  174
             IEAGQ 
Sbjct  540   IEAGQA  545



>ref|XP_010932783.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
 ref|XP_010932784.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
 ref|XP_010932786.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
Length=759

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/700 (58%), Positives = 519/700 (74%), Gaps = 4/700 (1%)
 Frame = -3

Query  2225  DPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKE  2046
             +P LR++NN +GRQ WEFDPNLGT EE  +V++ R  +HK+RF+IKH++DL+MR+QFEKE
Sbjct  11    NPMLRTINNFVGRQTWEFDPNLGTPEELAKVEEARENYHKHRFEIKHNADLIMRIQFEKE  70

Query  2045  KGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVI  1866
                 + L  VK+G  E+I++EAV+ TLRR L  Y+T+QAHDGHWP D+ GP+F LP  +I
Sbjct  71    NPNVVTLPPVKIGENEDITKEAVLATLRRVLIRYATLQAHDGHWPNDFSGPMFNLPLWII  130

Query  1865  GLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE  1686
             GL V+ A+N V   EHQ+E+LRY+YNHQN DGGWGLHIEG STM  T+L YV LR+LGEE
Sbjct  131   GLHVIGALNTVFSSEHQREILRYMYNHQNEDGGWGLHIEGPSTMLGTSLQYVCLRLLGEE  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              +GG+G+M KA+KWILDHGGAT   +WGK  LS+LGVYEWSG+ PL PE WLLPY +P H
Sbjct  191   VEGGDGSMLKAQKWILDHGGATTTSAWGKFLLSMLGVYEWSGSYPLSPETWLLPYFLPFH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PGRMW  CR  Y+ MSY+YGKR+VGPI  TILSLR+ELY   Y  IDW+ ARNQ AKED 
Sbjct  251   PGRMWSACRTAYMAMSYIYGKRFVGPITPTILSLRKELYTTPYDLIDWNQARNQYAKEDS  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             Y   P +Q+IV   LH +VEP+   WP  KLR+KAL   + HI +EDE T YVC   VNK
Sbjct  311   YNRTPLVQNIVCSFLHKVVEPIFMSWPGKKLREKALNTLLQHIHYEDENTQYVCYAAVNK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
              LNM+  W+E  +S A K+HL+R  DY+W+AEDGMK+    GSQLWD  F VQAII+T L
Sbjct  371   ALNMVVCWLEGSNSEAYKMHLARADDYIWIAEDGMKIKAVKGSQLWDTAFTVQAIISTGL  430

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +E+G  L+KAH FI  SQI ED   + L SWYR  +KG WPFS  D GW VSD TAEAL
Sbjct  431   FEEFGPTLKKAHEFIKNSQILEDCPGD-LNSWYRDKSKGSWPFSMGDQGWMVSDTTAEAL  489

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
              A L+LS+++ ++VG+ ++  RLYDAVD++L LQ+ SG + ++E  R+ PWL+I+NP E 
Sbjct  490   LALLLLSQISPELVGDPMDVRRLYDAVDILLYLQDKSGAYGSFERIRTSPWLQIMNPDEN  549

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
                 I++ QYVECT++ +  L +F+KL+P YR++EIE CI KA   I+ +Q PDGSWYGS
Sbjct  550   VANCIVEIQYVECTASVVRALSFFKKLYPDYRKQEIETCIAKAANAIEKMQNPDGSWYGS  609

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WGVC+TYGTWFGI+GLV  G +YE+   IRKAC+FLLSKQL SGGWGESY SCQ+KVYTN
Sbjct  610   WGVCFTYGTWFGIKGLVAAGRSYENSSCIRKACEFLLSKQLASGGWGESYRSCQEKVYTN  669

Query  245   IEGNKWHIVNTAWAMLALIEAGQV---IL*IKVGDKIFIN  135
             ++GN+ H V T W MLALI+AGQ     + ++   K+ IN
Sbjct  670   LKGNRPHAVQTGWTMLALIDAGQAKRDPVPLRRAAKVLIN  709



>dbj|BAE53430.1| lupeol synthase [Lotus japonicus]
Length=755

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/700 (56%), Positives = 532/700 (76%), Gaps = 6/700 (1%)
 Frame = -3

Query  2216  LRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEKGQ  2037
             L SV+N IGRQ+W FDPN GT +E ++++++R EF KNRF IK S+DLLMRMQ  KE   
Sbjct  13    LVSVSNFIGRQHWVFDPNAGTPQEHEEIERMRQEFTKNRFSIKQSADLLMRMQLRKENPC  72

Query  2036  EMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIGLS  1857
                   VK+   E+++ EA++ T+RR + FYS+IQAHDGHWPA+  GPLF +  LV+ L 
Sbjct  73    GPIPPAVKLRDVEKVTAEALITTIRRSITFYSSIQAHDGHWPAESAGPLFFVQPLVMALY  132

Query  1856  VMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE-RD  1680
             +  +++ VL  +H+KE++RY+YNHQN DGGWG HIEGHSTMF +AL+Y+ LR+LG+   D
Sbjct  133   ITGSLDDVLGPQHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSALSYIALRVLGQSLED  192

Query  1679  GGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIHPG  1500
             G + A+ + RKWILDHGG   IPSWGK W++VLGVYEWSG NPLPPE WLLP I PIHPG
Sbjct  193   GEDMAVARGRKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLPPEFWLLPKIFPIHPG  252

Query  1499  RMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDLYY  1320
             +M C+CR+VY+PMSYLYGK++VGPI + + SLR+ELYN  Y ++DW+ ARN  AKEDLYY
Sbjct  253   KMLCYCRLVYMPMSYLYGKKFVGPITALVRSLRKELYNEPYDRVDWNKARNTVAKEDLYY  312

Query  1319  PHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNKVL  1140
             PHP IQD++W  LH++ E +LN WPF+ LR+KA+ +A++H+++EDETT Y+CIG V KVL
Sbjct  313   PHPLIQDMLWGFLHHVGERVLNTWPFSMLRQKAIEVAINHVRYEDETTRYLCIGSVEKVL  372

Query  1139  NMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNLCD  960
              +I RW+E+P+S A K+HL+RI DY WLAEDG+K+  + G Q+WD  FA+QAI++ N+ +
Sbjct  373   YLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSF-GCQMWDAAFAIQAILSGNVSE  431

Query  959   EYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEALKA  780
             EYG  L+KAH F+  SQ++E+   ++ ++ YRH +KG W FS  D+GW VSDCTAE LK 
Sbjct  432   EYGPTLKKAHHFVKASQVRENPSGDF-KAMYRHISKGAWTFSMHDHGWQVSDCTAEGLKV  490

Query  779   ALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSETFG  600
             AL+LS M+DD+VG  +E  + YDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E F 
Sbjct  491   ALLLSEMSDDLVGAKMETEQFYDAVNVILSLQSSNGGFPAWEPQRAYQWLEKFNPTEFFE  550

Query  599   EIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGSWG  420
             E +I+ +YVECT +A+  L  FRKL+P +RRKEI+ CI+KA+ +I+  Q PDGSWYG WG
Sbjct  551   ETLIEREYVECTGSAMQALALFRKLYPKHRRKEIDRCISKAIRYIENTQNPDGSWYGCWG  610

Query  419   VCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTNIE  240
             +CYTYGTWF + GL   G  +++   +R+AC FLLSKQLP+GGWGESYLS QDKVYTNIE
Sbjct  611   ICYTYGTWFAVEGLTACGKNFQNSVTLRRACKFLLSKQLPNGGWGESYLSSQDKVYTNIE  670

Query  239   GNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             G + ++V ++WA+L+L+ AGQ  +    I  G ++ IN+ 
Sbjct  671   GKRANLVQSSWALLSLMRAGQAEIDPTPIHRGIRLLINSQ  710



>sp|Q8W3Z2.1|LUPS_BETPL RecName: Full=Lupeol synthase [Betula platyphylla]
 dbj|BAB83087.1| lupeol synthase [Betula platyphylla]
Length=755

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/702 (57%), Positives = 520/702 (74%), Gaps = 6/702 (1%)
 Frame = -3

Query  2222  PWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEKEK  2043
             P L S N+ IGRQ+WEFDP+ GT +ER +V+K+R EF KNRFQ+K S+DLLMRMQ  KE 
Sbjct  11    PGLVSGNDFIGRQHWEFDPDAGTPQERAEVEKVREEFTKNRFQMKQSADLLMRMQLRKEN  70

Query  2042  GQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLVIG  1863
               +     VKV   E I+EEAV+ TLRR L FYS+IQAHDGHWP +  GPLF L   V+ 
Sbjct  71    PCQPIPPPVKVKETEVITEEAVITTLRRSLSFYSSIQAHDGHWPGESAGPLFFLQPFVMA  130

Query  1862  LSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGEE-  1686
             L +   +N +    HQKE++RY+YNHQN DGGWG HIEGHSTMF +AL+Y+ LRILGE  
Sbjct  131   LYITGDLNTIFSPAHQKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSALSYIALRILGEGL  190

Query  1685  RDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVPIH  1506
              DG +GAM K+RKWILDHGG   IPSWGK W++VLG+YEWSG NPLPPE W LP I PIH
Sbjct  191   EDGEDGAMAKSRKWILDHGGLVAIPSWGKFWVTVLGLYEWSGCNPLPPEFWFLPDIFPIH  250

Query  1505  PGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKEDL  1326
             PG+M C+CR+VY+PMSYLYGKR+VGPI   I SLR+ELYN  YHQI+W+ AR+  AKEDL
Sbjct  251   PGKMLCYCRLVYMPMSYLYGKRFVGPITGLIQSLRQELYNEPYHQINWNKARSTVAKEDL  310

Query  1325  YYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPVNK  1146
             YYPHP IQD++W  LH++ EP+L +WPF+ LR+KAL  A+ H+ +EDE + Y+CIG V K
Sbjct  311   YYPHPLIQDLLWGFLHHVAEPVLTRWPFSMLREKALKAAIGHVHYEDENSKYLCIGSVEK  370

Query  1145  VLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIATNL  966
             VL +I  W E+P+  A K+HL RI D  W+AEDG+K+  + G Q+WD GFA+QAI++ NL
Sbjct  371   VLCLIACWAEDPNGEAYKLHLGRIPDNYWVAEDGLKIQSF-GCQMWDAGFAIQAILSCNL  429

Query  965   CDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAEAL  786
              +EY   LRKAH F+  SQ+ E+   ++ ++ YRH  KG W FS  D+GW VSDCTAE L
Sbjct  430   NEEYWPTLRKAHEFVKASQVPENPSGDF-KAMYRHINKGAWTFSMQDHGWQVSDCTAEGL  488

Query  785   KAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPSET  606
             K A++ S+M  D+VGE IE  RLYDAV++ILSLQ+++GGF  +E  R+Y WLE  NP+E 
Sbjct  489   KVAILFSQMPPDLVGEKIEKERLYDAVNVILSLQSSNGGFPAWEPQRAYGWLEKFNPTEF  548

Query  605   FGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWYGS  426
             F + +I+ +YVECTS A+ GL  FRK +P +R  EI++ I + + +I+ +Q PDGSWYG 
Sbjct  549   FEDTLIEREYVECTSPAVHGLALFRKFYPRHRGTEIDSSIYRGIQYIEDVQEPDGSWYGH  608

Query  425   WGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVYTN  246
             WG+CYTYGTWF +  L   G  Y++C  +RK+C+FLLSKQLP+GGWGESYLS Q+KV+TN
Sbjct  609   WGICYTYGTWFAVGALAACGRNYKNCPALRKSCEFLLSKQLPNGGWGESYLSSQNKVWTN  668

Query  245   IEGNKWHIVNTAWAMLALIEAGQVIL---*IKVGDKIFINNH  129
             IEGN+ ++V TAWA+L+LI+A Q  +    I  G ++ IN+ 
Sbjct  669   IEGNRANLVQTAWALLSLIDARQAEIDPTPIHRGVRVLINSQ  710



>ref|XP_008809074.1| PREDICTED: cycloartenol synthase-like isoform X2 [Phoenix dactylifera]
Length=628

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/577 (68%), Positives = 477/577 (83%), Gaps = 1/577 (0%)
 Frame = -3

Query  1904  YGGPLFLLPFLVIGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCT  1725
             +GGP+FL+P L+I LSV  A+NAVL  EHQ+E+ RY+YNHQN DGGWGLHIEGHSTMF +
Sbjct  10    HGGPMFLMPGLIIVLSVTGALNAVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHSTMFGS  69

Query  1724  ALNYVTLRILGEERDGGNGAMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplp  1545
             AL YV+LR+LGE  D G+GAM+ AR WILDHGGAT I SWGK WLSVLGV+EW GNNPLP
Sbjct  70    ALTYVSLRLLGEGPDDGDGAMQTARTWILDHGGATAITSWGKFWLSVLGVFEWYGNNPLP  129

Query  1544  pelwllPYIVPIHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQID  1365
             PE+WLLPY +P+HPGRMWCHCRMVYLPMSY+YGKR+VGPI  T+LSLR+EL+   Y QID
Sbjct  130   PEMWLLPYFLPVHPGRMWCHCRMVYLPMSYIYGKRFVGPITPTVLSLRKELFACPYQQID  189

Query  1364  WDLARNQCAKEDLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHED  1185
             W+ ARN+CAKEDLYYPHP IQDI+W  LH + EP+L   P + LRKKAL  AM HI +ED
Sbjct  190   WNRARNECAKEDLYYPHPLIQDIIWASLHKVAEPILMHSPGSMLRKKALHTAMQHIHYED  249

Query  1184  ETTNYVCIGPVNKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWD  1005
             E+T Y+CIGPVNKVLNM+  WIE+P S A K+HL RI D+LW+AEDGMKM GYNGSQ+WD
Sbjct  250   ESTRYICIGPVNKVLNMLSCWIEDPYSEAFKLHLPRIYDFLWIAEDGMKMKGYNGSQMWD  309

Query  1004  VGFAVQAIIATNLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPD  825
             +G +VQAII+T+L +EYG  LR+AH FI  SQ+ ED+  + L  W+RH +KGGW FST D
Sbjct  310   MGLSVQAIISTDLSEEYGPTLRRAHDFIKDSQVLEDAPGD-LSFWHRHISKGGWTFSTAD  368

Query  824   NGWPVSDCTAEALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTR  645
             +GWPVSDCT+E L A+L+LS+++ ++VGE +   R+YDAV++ILSL N +GGFAT+E TR
Sbjct  369   HGWPVSDCTSEGLMASLLLSKISPEIVGEPLCAGRIYDAVNVILSLMNKNGGFATFEPTR  428

Query  644   SYPWLEILNPSETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFI  465
             SY WLEI+NPSETFG+I+IDY YVECTSAA+ GL  F+KL+PG+RR +IE CI KA  FI
Sbjct  429   SYAWLEIINPSETFGDIVIDYPYVECTSAAMQGLSSFKKLYPGHRRDDIENCIRKASNFI  488

Query  464   QTIQLPDGSWYGSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWG  285
             + IQ PDGSWYGSW VC+T+GTWFG+RGL+  G TY++   IRKAC FLLSKQL SGGWG
Sbjct  489   EMIQRPDGSWYGSWAVCFTHGTWFGVRGLIAAGRTYQNSPCIRKACQFLLSKQLASGGWG  548

Query  284   ESYLSCQDKVYTNIEGNKWHIVNTAWAMLALIEAGQV  174
             ESYLSCQ+KVY+++EGN+ H VNTAWAMLALI+AGQ 
Sbjct  549   ESYLSCQNKVYSSLEGNRCHAVNTAWAMLALIDAGQA  585



>ref|XP_007014713.1| Beta-Amyrin Synthase isoform 2 [Theobroma cacao]
 gb|EOY32332.1| Beta-Amyrin Synthase isoform 2 [Theobroma cacao]
Length=685

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/662 (59%), Positives = 498/662 (75%), Gaps = 3/662 (0%)
 Frame = -3

Query  2228  DDPWLRSVNNHIGRQYWEFDPNLGTQEERQQVQKLRAEFHKNRFQIKHSSDLLMRMQFEK  2049
             + PWL +VN H+GRQ+WEFDPN G+ EE+ QV++LR EF KNRF++K SSDLLMRMQ  K
Sbjct  9     EGPWLATVNGHVGRQHWEFDPNAGSPEEQAQVERLRLEFKKNRFRVKQSSDLLMRMQLTK  68

Query  2048  EKGQEMGLQQVKVGSEEEISEEAVVRTLRRGLRFYSTIQAHDGHWPADYGGPLFLLPFLV  1869
             E    +    VK+  EE ++EEA   TLRR + FYS++QAHDGHWPA+  GPLF LP LV
Sbjct  69    ENPCGLIPPPVKLNHEEVVTEEATTVTLRRAISFYSSLQAHDGHWPAETAGPLFFLPPLV  128

Query  1868  IGLSVMEAINAVLQEEHQKEMLRYIYNHQNIDGGWGLHIEGHSTMFCTALNYVTLRILGE  1689
             + L V   +N +L  EHQKE++RYIYNHQN DGGWGLHIEGHSTMF TA++Y+TLR+LGE
Sbjct  129   MALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHSTMFGTAISYITLRLLGE  188

Query  1688  ERDGGNG-AMKKARKWILDHGGATFIPSWGKLWLSVLGVYEWSGNNplppelwllPYIVP  1512
               + G G A+ + RKWILDHGG   IPSWGK W++VLGVYEW+G NPLPPE WLLP + P
Sbjct  189   RPEDGEGMAVARGRKWILDHGGLVGIPSWGKFWVTVLGVYEWAGCNPLPPEFWLLPKVSP  248

Query  1511  IHPGRMWCHCRMVYLPMSYLYGKRYVGPINSTILSLRRELYNHDYHQIDWDLARNQCAKE  1332
             IHPG+M C+CR+VY+PMSYLYGKR+VGPI   I  LR+ELYN  YH+I+W+ ARN  AKE
Sbjct  249   IHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIRQLRQELYNQPYHEINWNAARNTVAKE  308

Query  1331  DLYYPHPAIQDIVWDGLHNIVEPLLNKWPFNKLRKKALTLAMDHIQHEDETTNYVCIGPV  1152
             DLYYPHP +QD+ W  LH++VEP L +WPF+ LR KAL +A+ H+ +EDE + Y+CIG V
Sbjct  309   DLYYPHPLVQDLTWGFLHHVVEPFLTRWPFSMLRDKALKVAIQHVHYEDENSRYLCIGCV  368

Query  1151  NKVLNMICRWIEEPDSIAVKVHLSRIKDYLWLAEDGMKMTGYNGSQLWDVGFAVQAIIAT  972
              KVL ++  W+E+P+S A K HL+R+ DY W+AEDG+KM  + G Q+WD  FA+QAI+++
Sbjct  369   EKVLCLMACWVEDPNSEAYKRHLARLPDYYWIAEDGLKMQTF-GCQMWDAAFAIQAIMSS  427

Query  971   NLCDEYGSMLRKAHLFINVSQIKEDSGINYLRSWYRHSTKGGWPFSTPDNGWPVSDCTAE  792
             NL DEYG  LRKAH F+  SQ++E+   N+    YRH +KG W FST D+GW VSDCTAE
Sbjct  428   NLSDEYGPTLRKAHDFVKASQVRENPSGNF-SGMYRHISKGSWTFSTQDHGWQVSDCTAE  486

Query  791   ALKAALMLSRMADDVVGEAIEPSRLYDAVDLILSLQNNSGGFATYELTRSYPWLEILNPS  612
              LK AL+ S+M++D+VGE +E  R YDAV++ILSLQ+N+GGF  +E  R+Y WLE  NP+
Sbjct  487   GLKCALLFSQMSNDLVGEKLETQRFYDAVNVILSLQSNNGGFPAWEPQRAYGWLEKFNPT  546

Query  611   ETFGEIIIDYQYVECTSAAIIGLKYFRKLHPGYRRKEIEACINKALTFIQTIQLPDGSWY  432
             E F + +I+ +YVECTS+AI  L  FRKLHP +RR EI+ C+ +   +I+  Q  DGSWY
Sbjct  547   EFFEDTLIEREYVECTSSAIQALALFRKLHPKHRRAEIDHCVARGARYIEDTQNQDGSWY  606

Query  431   GSWGVCYTYGTWFGIRGLVGGGNTYESCHGIRKACDFLLSKQLPSGGWGESYLSCQDKVY  252
             G WG+CYTYG WF + GL   G  Y +   +RKAC+FLLSKQL +GGWGESYLS Q+K +
Sbjct  607   GCWGICYTYGAWFAVEGLAACGRNYHNSPALRKACEFLLSKQLANGGWGESYLSSQNKAW  666

Query  251   TN  246
             T 
Sbjct  667   TT  668



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7435306155344