BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25294_g1_i9 len=993 path=[3267:0-214 3482:215-324 5742:325-330
3598:331-420 5816:421-424 3690:425-513 5522:514-516 3782:517-549
6045:550-550 6046:551-551 1289:552-614 6203:615-626 40:627-671
6237:672-685 6251:686-690 4097:691-727 6279:728-728 4133:729-734
488:735-992]

Length=993
                                                                      Score     E

ref|XP_004232317.1|  PREDICTED: uncharacterized protein LOC101257032    226   5e-69   
ref|XP_011098440.1|  PREDICTED: uncharacterized protein LOC105177...    225   2e-68   
ref|XP_011098441.1|  PREDICTED: uncharacterized protein LOC105177...    224   2e-68   
ref|XP_011098442.1|  PREDICTED: uncharacterized protein LOC105177...    224   2e-68   
ref|XP_009631034.1|  PREDICTED: uncharacterized protein LOC104120867    224   2e-68   
ref|XP_006338587.1|  PREDICTED: uncharacterized protein LOC102599852    223   6e-68   
emb|CDP02082.1|  unnamed protein product                                223   1e-67   
ref|XP_009785949.1|  PREDICTED: uncharacterized protein LOC104234139    223   1e-67   
ref|XP_010251142.1|  PREDICTED: uncharacterized protein LOC104593...    219   9e-67   
ref|XP_010251141.1|  PREDICTED: uncharacterized protein LOC104593...    220   1e-66   
ref|XP_002524661.1|  sirohydrochlorin ferrochelatase, putative          218   7e-66   Ricinus communis
ref|XP_008458790.1|  PREDICTED: uncharacterized protein LOC103498093    216   3e-65   
gb|KDP45322.1|  hypothetical protein JCGZ_09571                         214   2e-64   
ref|XP_006829077.1|  hypothetical protein AMTR_s00001p00260270          214   3e-64   
ref|XP_004142793.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    213   3e-64   
ref|XP_006446562.1|  hypothetical protein CICLE_v10016757mg             213   4e-64   
gb|KHG13683.1|  Sirohydrochlorin ferrochelatase                         214   4e-64   
ref|XP_010530522.1|  PREDICTED: uncharacterized protein LOC104807...    214   6e-64   
ref|XP_010033307.1|  PREDICTED: uncharacterized protein LOC104422628    213   1e-63   
ref|XP_006470275.1|  PREDICTED: uncharacterized protein LOC102627039    212   2e-63   
ref|XP_009377185.1|  PREDICTED: uncharacterized protein LOC103965821    211   2e-63   
ref|XP_008230561.1|  PREDICTED: uncharacterized protein LOC103329819    211   4e-63   
gb|EPS61981.1|  hypothetical protein M569_12814                         208   6e-63   
ref|XP_010523580.1|  PREDICTED: uncharacterized protein LOC104801894    211   6e-63   
ref|XP_009409075.1|  PREDICTED: uncharacterized protein LOC103991...    208   7e-63   
ref|XP_009409070.1|  PREDICTED: uncharacterized protein LOC103991...    209   7e-63   
ref|XP_007031548.1|  Sirohydrochlorin ferrochelatase B                  210   8e-63   
ref|XP_009409074.1|  PREDICTED: uncharacterized protein LOC103991...    208   9e-63   
gb|KDO55188.1|  hypothetical protein CISIN_1g023828mg                   212   1e-62   
emb|CAN60425.1|  hypothetical protein VITISV_021073                     207   1e-62   Vitis vinifera
ref|XP_007217178.1|  hypothetical protein PRUPE_ppa012658mg             207   3e-62   
ref|XP_008348192.1|  PREDICTED: uncharacterized protein LOC103411331    206   5e-62   
ref|XP_002299633.2|  hypothetical protein POPTR_0001s17900g             208   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009409069.1|  PREDICTED: uncharacterized protein LOC103991...    209   5e-62   
ref|XP_010093442.1|  Sirohydrochlorin ferrochelatase                    208   5e-62   
ref|XP_008357734.1|  PREDICTED: uncharacterized protein LOC103421473    207   7e-62   
ref|XP_010500571.1|  PREDICTED: uncharacterized protein LOC104777944    208   1e-61   
ref|NP_564562.1|  sirohydrochlorin ferrochelatase B                     207   1e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34882.3|  unnamed protein product                                204   1e-61   
gb|KHN27452.1|  Sirohydrochlorin ferrochelatase                         207   1e-61   
ref|XP_010479465.1|  PREDICTED: uncharacterized protein LOC104758...    207   1e-61   
ref|XP_003524552.1|  PREDICTED: uncharacterized protein LOC100500...    207   1e-61   
ref|XP_010479466.1|  PREDICTED: uncharacterized protein LOC104758...    207   2e-61   
ref|XP_006579772.1|  PREDICTED: uncharacterized protein LOC100500...    206   2e-61   
ref|XP_011002713.1|  PREDICTED: uncharacterized protein LOC105109...    206   3e-61   
ref|XP_006393176.1|  hypothetical protein EUTSA_v10011756mg             206   3e-61   
gb|AAM67145.1|  unknown                                                 206   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341717.1|  PREDICTED: uncharacterized protein LOC103404567    207   4e-61   
ref|XP_003618170.1|  Sirohydrochlorin ferrochelatase                    205   4e-61   
emb|CDY45053.1|  BnaA08g02220D                                          206   5e-61   
ref|XP_010461867.1|  PREDICTED: uncharacterized protein LOC104742...    206   5e-61   
ref|XP_003618171.1|  Sirohydrochlorin ferrochelatase                    205   5e-61   
ref|XP_010461868.1|  PREDICTED: uncharacterized protein LOC104742...    206   6e-61   
ref|XP_002273543.1|  PREDICTED: uncharacterized protein LOC100244073    205   7e-61   Vitis vinifera
gb|AFK44994.1|  unknown                                                 204   2e-60   
ref|XP_008783194.1|  PREDICTED: uncharacterized protein LOC103702509    204   2e-60   
ref|XP_009381040.1|  PREDICTED: uncharacterized protein LOC103969...    203   2e-60   
ref|XP_004489242.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    203   3e-60   
ref|XP_006647189.1|  PREDICTED: uncharacterized protein LOC102709053    202   3e-60   
gb|KFK35946.1|  hypothetical protein AALP_AA4G058800                    203   5e-60   
ref|XP_009381038.1|  PREDICTED: uncharacterized protein LOC103969...    202   7e-60   
emb|CDY03592.1|  BnaC03g68510D                                          202   1e-59   
ref|XP_004291766.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    202   1e-59   
ref|XP_010915963.1|  PREDICTED: uncharacterized protein LOC105040...    201   1e-59   
gb|EEC72956.1|  hypothetical protein OsI_06840                          198   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_003574408.1|  PREDICTED: uncharacterized protein LOC100845...    201   3e-59   
ref|XP_010235070.1|  PREDICTED: uncharacterized protein LOC100845...    201   3e-59   
ref|XP_009107234.1|  PREDICTED: uncharacterized protein LOC103832890    201   3e-59   
dbj|BAD21683.1|  unknown protein                                        200   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952284.1|  PREDICTED: uncharacterized protein LOC101756...    199   9e-59   
ref|XP_002891559.1|  hypothetical protein ARALYDRAFT_314421             200   1e-58   
ref|XP_010238623.1|  PREDICTED: uncharacterized protein LOC100837...    199   2e-58   
ref|XP_003578793.1|  PREDICTED: uncharacterized protein LOC100837...    199   2e-58   
dbj|BAK06991.1|  predicted protein                                      199   2e-58   
gb|ACG31626.1|  sirohydrochlorin ferrochelatase                         198   3e-58   Zea mays [maize]
ref|XP_002453737.1|  hypothetical protein SORBIDRAFT_04g012200          198   4e-58   Sorghum bicolor [broomcorn]
gb|ACG41745.1|  sirohydrochlorin ferrochelatase                         197   6e-58   Zea mays [maize]
ref|XP_010915962.1|  PREDICTED: uncharacterized protein LOC105040...    200   7e-58   
gb|ACR35235.1|  unknown                                                 195   1e-57   Zea mays [maize]
gb|AAD50047.1|AC007980_12  Hypothetical protein                         197   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291765.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    196   3e-57   
ref|NP_001132509.1|  sirohydrochlorin ferrochelatase isoform 1          195   4e-57   Zea mays [maize]
ref|XP_010670852.1|  PREDICTED: uncharacterized protein LOC104887804    193   5e-56   
ref|XP_009334112.1|  PREDICTED: uncharacterized protein LOC103926952    190   6e-55   
ref|XP_010461882.1|  PREDICTED: uncharacterized protein LOC104742567    184   3e-54   
gb|ABK26418.1|  unknown                                                 187   4e-54   Picea sitchensis
ref|XP_003618173.1|  Sirohydrochlorin cobaltochelatase                  180   4e-51   
ref|XP_008667254.1|  PREDICTED: sirohydrochlorin ferrochelatase i...    177   1e-49   
ref|NP_001046609.1|  Os02g0296800                                       168   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14170.1|  Sirohydrochlorin ferrochelatase                         166   4e-47   
ref|XP_001765290.1|  predicted protein                                  167   5e-47   
ref|XP_002964135.1|  hypothetical protein SELMODRAFT_37056              164   9e-46   
ref|XP_002993172.1|  hypothetical protein SELMODRAFT_26806              164   1e-45   
gb|EMS54863.1|  Sirohydrochlorin ferrochelatase                         159   2e-44   
ref|XP_006446561.1|  hypothetical protein CICLE_v10016757mg             160   7e-44   
gb|KDO55189.1|  hypothetical protein CISIN_1g023828mg                   159   1e-42   
gb|KDO55190.1|  hypothetical protein CISIN_1g023828mg                   158   2e-42   
ref|XP_010530526.1|  PREDICTED: uncharacterized protein LOC104807...    155   8e-42   
ref|XP_011002714.1|  PREDICTED: uncharacterized protein LOC105109...    154   1e-41   
ref|XP_001421596.1|  predicted protein                                  145   5e-39   Ostreococcus lucimarinus CCE9901
ref|XP_004291768.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    147   5e-39   
gb|EMS61947.1|  Sirohydrochlorin ferrochelatase                         144   6e-39   
ref|XP_002506350.1|  predicted protein                                  145   6e-39   Micromonas commoda
gb|EMT15526.1|  Sirohydrochlorin ferrochelatase                         141   2e-37   
ref|XP_004291767.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    141   1e-36   
ref|XP_003083605.1|  unnamed protein product                            139   6e-36   
ref|WP_002650018.1|  cbiX protein                                       134   2e-34   
ref|XP_003063280.1|  predicted protein                                  129   7e-33   
ref|XP_010530527.1|  PREDICTED: uncharacterized protein LOC104807...    124   4e-30   
ref|XP_007217608.1|  hypothetical protein PRUPE_ppa017033mg             119   9e-30   
gb|KHN12062.1|  Sirohydrochlorin ferrochelatase                         112   5e-27   
gb|EMT21287.1|  Sirohydrochlorin ferrochelatase                         111   1e-26   
ref|WP_014437036.1|  putative sirohydrochlorin cobaltochelatase         110   4e-25   
gb|EYU44776.1|  hypothetical protein MIMGU_mgv1a015745mg                105   6e-24   
gb|KDO55191.1|  hypothetical protein CISIN_1g023828mg                   107   1e-23   
ref|XP_007151006.1|  hypothetical protein PHAVU_004G0108001g            101   2e-22   
ref|XP_007508641.1|  predicted protein                                  100   2e-21   
emb|CBJ30308.1|  sirohydrochlorin ferrochelatase, putative chloro...  99.4    5e-21   
ref|XP_005536035.1|  hypothetical protein, conserved                  97.4    1e-20   
ref|XP_001698709.1|  sirohydrochlorin ferrochelatase, SIRB            97.1    4e-20   Chlamydomonas reinhardtii
ref|XP_005851931.1|  hypothetical protein CHLNCDRAFT_133580           93.2    2e-19   
ref|WP_026174408.1|  hypothetical protein                             92.4    2e-19   
ref|WP_019395087.1|  hypothetical protein                             92.4    2e-18   
ref|XP_005643741.1|  CbiX-domain-containing protein                   89.4    3e-18   
ref|WP_039740278.1|  sirohydrochlorin cobaltochelatase                89.4    3e-18   
ref|XP_005711482.1|  unnamed protein product                          92.4    3e-18   
ref|XP_007216178.1|  hypothetical protein PRUPE_ppa015785mg           87.0    4e-18   
gb|EWM29197.1|  Cobalamin (vitamin B12) biosynthesis CbiX             91.3    6e-18   
ref|WP_026842098.1|  sirohydrochlorin cobaltochelatase                85.9    5e-17   
ref|WP_010943630.1|  sirohydrochlorin cobaltochelatase                85.1    8e-17   
dbj|GAM09629.1|  sirohydrochlorin ferrochelatase                      85.1    1e-16   
gb|KHN23513.1|  hypothetical protein glysoja_029802                   85.5    2e-16   
ref|WP_011735221.1|  sirohydrochlorin cobaltochelatase                84.3    2e-16   
gb|KIH76331.1|  sirohydrochlorin cobaltochelatase                     84.3    2e-16   
ref|WP_039646717.1|  sirohydrochlorin cobaltochelatase                84.0    2e-16   
ref|WP_012531975.1|  sirohydrochlorin cobaltochelatase                83.6    3e-16   
ref|WP_004513845.1|  sirohydrochlorin cobaltochelatase                83.6    3e-16   
ref|WP_015838817.1|  sirohydrochlorin cobaltochelatase                82.8    5e-16   
ref|WP_015745553.1|  NUDIX hydrolase                                  86.3    6e-16   
ref|WP_033020593.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    85.1    6e-16   
ref|WP_038084991.1|  hypothetical protein                             81.6    1e-15   
ref|XP_010678615.1|  PREDICTED: uncharacterized protein LOC104894137  81.6    2e-15   
ref|WP_015718893.1|  sirohydrochlorin cobaltochelatase                80.9    3e-15   
ref|WP_031405718.1|  sirohydrochlorin ferrochelatase                  82.4    6e-15   
ref|XP_005703681.1|  sirohydrochlorin cobaltochelatase-like protein   80.9    7e-15   
ref|WP_033024693.1|  sirohydrochlorin ferrochelatase                  81.3    1e-14   
ref|WP_003252999.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    80.1    4e-14   
ref|WP_013877513.1|  sirohydrochlorin ferrochelatase                  80.1    4e-14   
ref|WP_028396246.1|  sirohydrochlorin ferrochelatase                  80.1    4e-14   
gb|EZP78485.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     79.7    5e-14   
ref|WP_013146355.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    79.7    5e-14   
ref|WP_033005041.1|  sirohydrochlorin ferrochelatase                  79.7    5e-14   
ref|WP_011229916.1|  sirohydrochlorin ferrochelatase                  79.7    5e-14   
dbj|GAD14749.1|  cobalamin (vitamin B12) biosynthesis CbiX protein    79.7    7e-14   
dbj|GAJ60479.1|  hypothetical protein B23_3724                        79.7    7e-14   
gb|EPR29416.1|  Sirohydrochlorin cobaltochelatase                     79.7    7e-14   
ref|WP_015373928.1|  hypothetical protein                             79.0    8e-14   
ref|XP_009040729.1|  hypothetical protein AURANDRAFT_32321            77.4    9e-14   
ref|WP_025949077.1|  sirohydrochlorin ferrochelatase                  79.0    1e-13   
ref|WP_020469001.1|  hypothetical protein                             76.3    2e-13   
ref|WP_006562971.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  78.6    2e-13   
ref|WP_033009575.1|  sirohydrochlorin ferrochelatase                  78.2    2e-13   
ref|WP_012645135.1|  sirohydrochlorin cobaltochelatase                75.9    2e-13   
ref|WP_002647251.1|  cobalamin biosynthesis protein CbiX              75.9    2e-13   
ref|WP_013075784.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  75.5    3e-13   
ref|WP_004228345.1|  sirohydrochlorin ferrochelatase                  77.4    3e-13   
ref|WP_036220089.1|  sirohydrochlorin ferrochelatase                  77.0    4e-13   
ref|WP_012546612.1|  sirohydrochlorin cobaltochelatase                74.7    4e-13   
ref|WP_008178094.1|  hypothetical protein                             77.0    4e-13   
ref|WP_036119918.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    77.0    4e-13   
ref|WP_020463526.1|  cobalamin biosynthesis protein CbiX              75.5    5e-13   
ref|WP_036145522.1|  sirohydrochlorin ferrochelatase                  77.0    5e-13   
ref|WP_018505183.1|  hypothetical protein                             75.9    5e-13   
ref|WP_027716685.1|  sirohydrochlorin cobaltochelatase                74.7    5e-13   
ref|WP_011936979.1|  sirohydrochlorin cobaltochelatase                74.7    5e-13   
ref|WP_020958631.1|  sirohydrochlorin ferrochelatase                  76.6    6e-13   
ref|WP_028842031.1|  hypothetical protein                             74.3    6e-13   
ref|WP_029761480.1|  sirohydrochlorin ferrochelatase                  76.6    6e-13   
ref|WP_003352908.1|  hypothetical protein                             76.6    6e-13   
ref|WP_008881209.1|  sirohydrochlorin ferrochelatase                  76.6    6e-13   
ref|WP_011886753.1|  sirohydrochlorin ferrochelatase                  76.6    7e-13   
ref|WP_035741568.1|  cobalamin biosynthesis protein CbiX              74.3    7e-13   
ref|WP_028409577.1|  sirohydrochlorin ferrochelatase                  76.3    1e-12   
ref|WP_025116673.1|  sirohydrochlorin ferrochelatase                  76.3    1e-12   
ref|WP_012749140.1|  sirohydrochlorin ferrochelatase                  76.3    1e-12   
ref|WP_036581629.1|  sirohydrochlorin cobaltochelatase                77.0    1e-12   
gb|EXX87131.1|  sirohydrochlorin cobaltochelatase                     77.0    1e-12   
ref|WP_016991507.1|  sirohydrochlorin ferrochelatase                  75.9    1e-12   
ref|WP_035350149.1|  sirohydrochlorin ferrochelatase                  75.5    1e-12   
ref|WP_026894565.1|  hypothetical protein                             73.6    1e-12   
ref|WP_039237066.1|  sirohydrochlorin ferrochelatase                  75.5    2e-12   
ref|WP_036078574.1|  sirohydrochlorin ferrochelatase                  75.1    2e-12   
gb|AHN23033.1|  sirohydrochlorin ferrochelatase                       75.1    2e-12   
ref|WP_017436092.1|  sirohydrochlorin ferrochelatase                  74.7    3e-12   
ref|WP_024364856.1|  sirohydrochlorin ferrochelatase                  74.7    3e-12   
ref|WP_026369597.1|  hypothetical protein                             72.4    3e-12   
ref|WP_036125151.1|  sirohydrochlorin ferrochelatase                  74.7    3e-12   
gb|KIG09584.1|  Sirohydrochlorin ferrochelatase                       74.7    3e-12   
sp|P61817.1|SIRB_BACME  RecName: Full=Sirohydrochlorin ferrochela...  75.1    3e-12   Bacillus megaterium
ref|WP_022628363.1|  hypothetical protein                             75.1    5e-12   
ref|WP_010041782.1|  cobalamin biosynthesis protein CbiX              71.6    6e-12   
ref|WP_016765792.1|  sirohydrochlorin ferrochelatase                  73.9    6e-12   
ref|WP_034284565.1|  sirohydrochlorin ferrochelatase                  73.9    6e-12   
ref|WP_014968621.1|  cobalamin (vitamin B12) biosynthesis protein...  71.6    6e-12   
ref|WP_029281449.1|  hypothetical protein                             73.9    7e-12   
ref|WP_013085292.1|  sirohydrochlorin ferrochelatase                  73.9    7e-12   
ref|WP_012292364.1|  sirohydrochlorin ferrochelatase                  73.6    9e-12   
ref|WP_028412599.1|  sirohydrochlorin ferrochelatase                  73.6    9e-12   
ref|WP_033580478.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    73.6    9e-12   
dbj|BAL52372.1|  cobalamin (vitamin B12) biosynthesis CbiX protein    71.6    9e-12   
ref|WP_010857495.1|  sirohydrochlorin ferrochelatase                  73.2    9e-12   
gb|ETT46724.1|  cobalt-precorrin-3B C(17)-methyltransferase (coba...  75.9    1e-11   
ref|WP_013059579.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    73.6    1e-11   
ref|WP_036166469.1|  sirohydrochlorin ferrochelatase                  73.2    1e-11   
ref|WP_009673137.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  74.7    1e-11   
ref|WP_011602248.1|  cobalamin biosynthesis protein CbiX              71.2    1e-11   
ref|WP_015246709.1|  hypothetical protein                             71.6    1e-11   
ref|WP_033398315.1|  cobalamin biosynthesis protein CbiX              70.5    1e-11   
ref|WP_033407066.1|  cobalamin biosynthesis protein CbiX              70.5    2e-11   
ref|WP_005831998.1|  sirohydrochlorin cobaltochelatase                73.6    2e-11   
ref|WP_026557944.1|  sirohydrochlorin cobaltochelatase                73.6    2e-11   
ref|WP_009740585.1|  cobalamin biosynthesis protein CbiX              70.5    2e-11   
ref|WP_025752730.1|  sirohydrochlorin ferrochelatase                  72.4    3e-11   
ref|WP_007785817.1|  sirohydrochlorin cobaltochelatase                73.6    3e-11   
ref|WP_025847508.1|  sirohydrochlorin cobaltochelatase                73.6    3e-11   
ref|WP_033025433.1|  sirohydrochlorin cobaltochelatase                72.4    3e-11   
ref|WP_012684974.1|  sirohydrochlorin cobaltochelatase                73.2    3e-11   
ref|WP_013523816.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  72.4    3e-11   
ref|WP_016741767.1|  sirohydrochlorin cobaltochelatase                73.2    3e-11   
ref|WP_033010025.1|  sirohydrochlorin cobaltochelatase                72.4    3e-11   
dbj|BAO45352.1|  cobalamin biosynthesis protein CbiX                  69.7    3e-11   
ref|WP_028400402.1|  sirohydrochlorin ferrochelatase                  72.0    3e-11   
ref|WP_033020763.1|  sirohydrochlorin cobaltochelatase                72.4    3e-11   
ref|WP_008909193.1|  Sirohydrochlorin cobaltochelatase                69.7    3e-11   
ref|WP_018393061.1|  hypothetical protein                             71.6    4e-11   
ref|WP_011887477.1|  sirohydrochlorin cobaltochelatase                72.0    4e-11   
ref|WP_029565580.1|  hypothetical protein                             72.0    4e-11   
ref|WP_013120430.1|  cobalamin biosynthesis protein CbiX              69.3    4e-11   
ref|WP_027410743.1|  sirohydrochlorin ferrochelatase                  71.6    4e-11   
ref|WP_008880154.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  72.0    4e-11   
ref|WP_015374903.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  72.0    4e-11   
ref|WP_023634354.1|  sirohydrochlorin cobaltochelatase                72.0    4e-11   
ref|WP_025908099.1|  sirohydrochlorin ferrochelatase                  71.6    4e-11   
ref|WP_033843838.1|  sirohydrochlorin cobaltochelatase                71.6    5e-11   
ref|WP_025853113.1|  sirohydrochlorin cobaltochelatase                72.4    6e-11   
ref|WP_033005389.1|  sirohydrochlorin cobaltochelatase                71.6    6e-11   
ref|WP_034124136.1|  cobalamin biosynthesis protein CbiX              68.9    6e-11   
ref|WP_027319687.1|  cobalamin biosynthesis protein CbiX              70.9    6e-11   
ref|WP_013145274.1|  sirohydrochlorin cobaltochelatase                71.6    6e-11   
ref|WP_007715908.1|  sirohydrochlorin cobaltochelatase                72.0    6e-11   
ref|WP_011231294.1|  sirohydrochlorin cobaltochelatase                71.6    6e-11   
ref|WP_025715977.1|  sirohydrochlorin cobaltochelatase                72.4    6e-11   
ref|WP_017247390.1|  sirohydrochlorin cobaltochelatase                72.0    6e-11   
ref|WP_013427378.1|  cobalamin biosynthesis protein CbiX              69.3    6e-11   
ref|WP_033016971.1|  sirohydrochlorin cobaltochelatase                71.6    6e-11   
gb|EPR28848.1|  Sirohydrochlorin cobaltochelatase                     71.6    6e-11   
ref|WP_025950690.1|  sirohydrochlorin cobaltochelatase                71.2    7e-11   
ref|WP_035300781.1|  sirohydrochlorin cobaltochelatase                72.0    7e-11   
ref|WP_035665796.1|  sirohydrochlorin cobaltochelatase                71.6    7e-11   
ref|WP_026693481.1|  cobalamin biosynthesis protein CbiX              70.9    8e-11   
ref|WP_032100806.1|  sirohydrochlorin cobaltochelatase                71.2    8e-11   
ref|WP_008637213.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    70.5    9e-11   
ref|WP_002708045.1|  cobalamin biosynthesis protein CbiX              68.6    9e-11   
ref|WP_011434989.1|  cobalamin biosynthesis protein CbiX              68.9    9e-11   
ref|WP_013277760.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  68.2    9e-11   
ref|WP_039793444.1|  sirohydrochlorin cobaltochelatase                71.2    1e-10   
dbj|BAQ12015.1|  sirohydrochlorin cobaltochelatase                    70.5    1e-10   
ref|WP_013630711.1|  cobalamin biosynthesis protein CbiX              68.2    1e-10   
ref|WP_036687663.1|  sirohydrochlorin cobaltochelatase                71.6    1e-10   
ref|WP_010497064.1|  sirohydrochlorin cobaltochelatase                71.2    1e-10   
ref|WP_017417755.1|  sirohydrochlorin ferrochelatase                  70.5    1e-10   
ref|WP_025649473.1|  sirohydrochlorin ferrochelatase                  70.1    2e-10   
ref|WP_024831709.1|  cobalamin biosynthesis protein CbiX [            67.4    2e-10   
ref|WP_007611315.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    69.7    2e-10   
ref|WP_021290226.1|  hypothetical protein                             69.3    2e-10   
ref|WP_038457957.1|  sirohydrochlorin ferrochelatase                  69.7    2e-10   
ref|WP_018393297.1|  MULTISPECIES: hypothetical protein               69.3    2e-10   
ref|WP_025678200.1|  sirohydrochlorin cobaltochelatase                70.9    2e-10   
ref|WP_013780850.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  67.8    2e-10   
ref|WP_024085290.1|  sirohydrochlorin ferrochelatase                  69.7    2e-10   
ref|WP_035661689.1|  hypothetical protein                             70.1    2e-10   
gb|AJE52004.1|  sirohydrochlorin cobaltochelatase                     70.9    2e-10   
ref|WP_016324845.1|  sirohydrochlorin cobaltochelatase                70.9    2e-10   
ref|WP_029097841.1|  sirohydrochlorin cobaltochelatase                70.5    2e-10   
ref|WP_035729698.1|  MULTISPECIES: cobalamin biosynthesis protein...  67.4    2e-10   
ref|WP_036819381.1|  sirohydrochlorin ferrochelatase                  69.3    2e-10   
ref|WP_036197389.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
ref|WP_033574587.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
ref|WP_014813253.1|  cobalamin biosynthesis protein CbiX              67.8    3e-10   
ref|WP_015417442.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
ref|WP_018567673.1|  cobalamin biosynthesis protein CbiX              70.1    3e-10   
ref|WP_003154360.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
ref|WP_015388252.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
gb|ETT77519.1|  cobalt-precorrin-3B C(17)-methyltransferase (coba...  71.2    3e-10   
ref|WP_012117524.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
ref|WP_025851338.1|  sirohydrochlorin ferrochelatase                  69.3    3e-10   
gb|AIU76979.1|  sirohydrochlorin ferrochelatase                       69.3    3e-10   
ref|WP_017000084.1|  hypothetical protein                             68.9    4e-10   
ref|WP_003351041.1|  sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_003349638.1|  sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_035505420.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    68.9    4e-10   
ref|WP_007409741.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    68.9    4e-10   
ref|WP_013373524.1|  sirohydrochlorin cobaltochelatase                70.1    4e-10   
ref|WP_032871435.1|  sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_020955802.1|  sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_014417735.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    68.9    4e-10   
ref|WP_032874854.1|  sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_011689108.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  66.6    4e-10   
gb|EFC85574.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     67.4    4e-10   
ref|WP_015592227.1|  sirohydrochlorin cobaltochelatase                69.7    4e-10   
ref|WP_010788565.1|  Sirohydrochlorin ferrochelatase                  68.9    4e-10   
ref|WP_035950348.1|  cobalamin biosynthesis protein CbiX              67.4    5e-10   
ref|WP_028552448.1|  sirohydrochlorin cobaltochelatase                70.1    5e-10   
ref|WP_016482666.1|  hypothetical protein                             66.6    5e-10   
ref|WP_003250807.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  68.9    6e-10   
ref|WP_013986294.1|  sirohydrochlorin cobaltochelatase                68.6    6e-10   
dbj|GAJ44148.1|  sirohydrochlorin cobaltochelatase                    68.9    6e-10   
ref|WP_014278563.1|  sirohydrochlorin cobaltochelatase                69.7    6e-10   
ref|WP_029518590.1|  sirohydrochlorin cobaltochelatase                69.7    6e-10   
ref|WP_039230896.1|  hypothetical protein                             68.2    6e-10   
ref|WP_020816898.1|  cobalamin biosynthesis protein CbiX [            66.2    6e-10   
ref|WP_015326928.1|  hypothetical protein                             65.9    7e-10   
ref|WP_025719598.1|  sirohydrochlorin cobaltochelatase                69.3    7e-10   
ref|WP_039271661.1|  sirohydrochlorin cobaltochelatase                69.3    7e-10   
ref|WP_003348076.1|  sirohydrochlorin ferrochelatase                  67.8    8e-10   
ref|WP_004891937.1|  sirohydrochlorin cobaltochelatase                68.2    8e-10   
ref|WP_007145131.1|  cobalamin biosynthesis protein CbiX              65.9    8e-10   
ref|WP_014312600.1|  cobalamin biosynthesis protein CbiX              65.9    8e-10   
ref|WP_020561351.1|  hypothetical protein                             66.2    9e-10   
ref|WP_031409368.1|  sirohydrochlorin cobaltochelatase                68.2    9e-10   
ref|WP_010632624.1|  ferrochelatase                                   67.8    9e-10   
ref|WP_014759467.1|  MULTISPECIES: cobalamin biosynthesis protein...  65.5    9e-10   
ref|WP_027140169.1|  cobalamin biosynthesis protein CbiX              65.9    9e-10   
ref|WP_029192916.1|  sirohydrochlorin cobaltochelatase                68.6    9e-10   
gb|KHF30441.1|  Sirohydrochlorin cobaltochelatase                     67.4    1e-09   
ref|WP_038541467.1|  cobalamin biosynthesis protein CbiX              67.4    1e-09   
ref|WP_013312415.1|  sirohydrochlorin cobaltochelatase                68.9    1e-09   
ref|WP_010191876.1|  cobalamin biosynthesis protein CbiX              67.8    1e-09   
ref|WP_038502003.1|  sirohydrochlorin ferrochelatase                  67.4    1e-09   
ref|WP_010897661.1|  hypothetical protein                             67.8    1e-09   
ref|WP_026582457.1|  sirohydrochlorin cobaltochelatase                68.2    1e-09   
ref|WP_036151054.1|  sirohydrochlorin ferrochelatase                  67.4    1e-09   
ref|WP_016837051.1|  hypothetical protein                             67.4    1e-09   
ref|WP_034409739.1|  cobalamin biosynthesis protein CbiX              65.1    1e-09   
ref|WP_015593409.1|  sirohydrochlorin ferrochelatase                  67.0    1e-09   
ref|WP_029973487.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    67.4    1e-09   
emb|CEI81445.1|  Sirohydrochlorin ferrochelatase                      67.4    1e-09   
ref|WP_014304986.1|  sirohydrochlorin ferrochelatase                  67.4    1e-09   
ref|WP_010303041.1|  sirohydrochlorin ferrochelatase                  67.4    1e-09   
ref|WP_026683035.1|  sirohydrochlorin ferrochelatase                  67.0    2e-09   
ref|WP_010347177.1|  sirohydrochlorin cobaltochelatase                68.6    2e-09   
ref|WP_003329007.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    67.4    2e-09   
ref|WP_034405951.1|  hypothetical protein                             65.1    2e-09   
ref|WP_019382738.1|  cobalamin biosynthesis protein CbiX              67.0    2e-09   
ref|WP_026559411.1|  hypothetical protein                             67.0    2e-09   
gb|EPZ39496.1|  Sirohydrochlorin cobaltochelatase (CbiXL)             67.4    2e-09   
dbj|GAJ39165.1|  sirohydrochlorin cobaltochelatase                    67.4    2e-09   
ref|WP_035062928.1|  sirohydrochlorin cobaltochelatase                67.4    2e-09   
ref|WP_036841580.1|  sirohydrochlorin ferrochelatase                  66.6    2e-09   
dbj|GAF66320.1|  hypothetical protein BTS2_3220                       67.0    2e-09   
ref|WP_025366059.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_034419847.1|  hypothetical protein                             64.7    2e-09   
ref|WP_016936172.1|  sirohydrochlorin ferrochelatase                  67.0    2e-09   
ref|WP_019688872.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_031462386.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_017428597.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  68.2    2e-09   
ref|WP_007432845.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_016822797.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_034306931.1|  sirohydrochlorin ferrochelatase                  66.6    2e-09   
ref|WP_038241655.1|  sirohydrochlorin ferrochelatase                  66.6    2e-09   
ref|WP_013875164.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  65.1    2e-09   
ref|WP_019391267.1|  sirohydrochlorin cobaltochelatase                67.4    2e-09   
gb|KGX91813.1|  sirohydrochlorin ferrochelatase                       67.0    3e-09   
emb|CEG32767.1|  sirohydrochlorin ferrochelatase                      66.6    3e-09   
ref|WP_034624882.1|  hypothetical protein                             67.0    3e-09   
ref|WP_004616997.1|  cobalamin biosynthesis protein CbiX [            64.3    3e-09   
ref|WP_015738951.1|  cobalamin biosynthesis protein CbiX              64.3    3e-09   
ref|WP_026585256.1|  cobalamin biosynthesis protein CbiX              66.2    3e-09   
ref|WP_023990791.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  67.4    3e-09   
ref|WP_017434177.1|  sirohydrochlorin cobaltochelatase                66.6    3e-09   
ref|WP_020932864.1|  Cobalamin (vitamin B12) biosynthesis CbiX        64.3    3e-09   
ref|WP_006828641.1|  hypothetical protein                             66.2    3e-09   
ref|WP_035329920.1|  cobalamin biosynthesis protein CbiX              66.2    4e-09   
ref|WP_003395469.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  66.2    4e-09   
ref|WP_006524556.1|  cobalamin biosynthesis protein CbiX              63.9    4e-09   
ref|WP_035486231.1|  sirohydrochlorin cobaltochelatase                65.9    4e-09   
ref|WP_031438689.1|  membrane protein                                 67.4    4e-09   
ref|WP_007022881.1|  hypothetical protein                             63.9    4e-09   
ref|WP_023555957.1|  sirohydrochlorin cobaltochelatase                66.6    4e-09   
ref|WP_038091833.1|  sirohydrochlorin cobaltochelatase                66.6    5e-09   
ref|WP_028309103.1|  hypothetical protein                             63.5    5e-09   
ref|WP_035413378.1|  sirohydrochlorin ferrochelatase                  65.5    5e-09   
gb|KIG06569.1|  Sirohydrochlorin ferrochelatase                       65.5    5e-09   
ref|WP_009334413.1|  cobalamin biosynthesis protein CbiX              65.5    5e-09   
ref|WP_011735191.1|  sirohydrochlorin cobaltochelatase                63.5    6e-09   
ref|WP_019982889.1|  cobalamin biosynthesis protein CbiX              66.2    6e-09   
ref|WP_019240818.1|  hypothetical protein                             65.5    6e-09   
ref|WP_012575716.1|  sirohydrochlorin cobaltochelatase                65.9    6e-09   
gb|EZP77428.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     65.9    6e-09   
ref|WP_018706608.1|  hypothetical protein                             65.5    6e-09   
ref|WP_035019712.1|  sirohydrochlorin cobaltochelatase                65.9    6e-09   
ref|WP_027365712.1|  cobalamin biosynthesis protein CbiX              63.2    6e-09   
dbj|GAC90162.1|  sirohydrochlorin cobaltochelatase CbiXL              65.9    7e-09   
ref|WP_028394278.1|  sirohydrochlorin cobaltochelatase                66.2    7e-09   
ref|WP_018923116.1|  hypothetical protein                             65.5    7e-09   
ref|WP_012860466.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  63.2    8e-09   
ref|WP_020959933.1|  sirohydrochlorin cobaltochelatase                65.5    8e-09   
ref|WP_015924786.1|  cobalamin biosynthesis protein CbiX [            62.8    9e-09   
ref|WP_006893827.1|  membrane protein                                 66.6    9e-09   
ref|WP_010288936.1|  sirohydrochlorin cobaltochelatase                65.5    9e-09   
ref|WP_015005472.1|  MULTISPECIES: cobalamin biosynthesis protein...  62.8    9e-09   
ref|WP_022950286.1|  cobalamin biosynthesis protein CbiX              62.8    9e-09   
ref|WP_024978866.1|  membrane protein                                 66.2    1e-08   
ref|WP_027749757.1|  cobalamin biosynthesis protein CbiX              65.5    1e-08   
ref|WP_013352206.1|  sirohydrochlorin ferrochelatase                  64.7    1e-08   
ref|WP_035102093.1|  sirohydrochlorin cobaltochelatase                65.5    1e-08   
ref|WP_031537983.1|  cobalamin biosynthesis protein CbiX              64.3    1e-08   
ref|WP_009498495.1|  sirohydrochlorin cobaltochelatase                64.7    1e-08   
ref|WP_010327903.1|  sirohydrochlorin ferrochelatase                  64.7    1e-08   
ref|WP_015863807.1|  sirohydrochlorin cobaltochelatase                64.7    1e-08   
ref|WP_006638230.1|  sirohydrochlorin ferrochelatase                  64.7    1e-08   
ref|WP_029499070.1|  sirohydrochlorin ferrochelatase                  64.7    1e-08   
ref|WP_039073917.1|  sirohydrochlorin ferrochelatase                  64.7    1e-08   
ref|WP_025682314.1|  sirohydrochlorin cobaltochelatase                65.5    1e-08   
ref|WP_035378336.1|  hypothetical protein                             62.4    1e-08   
ref|WP_016129008.1|  CbiX protein                                     64.3    1e-08   
ref|WP_000648877.1|  cobalamin biosynthesis protein CbiX              64.3    1e-08   
ref|WP_019119442.1|  hypothetical protein                             65.1    2e-08   
ref|WP_024121351.1|  sirohydrochlorin ferrochelatase                  64.3    2e-08   
ref|WP_034315548.1|  membrane protein                                 63.2    2e-08   
ref|WP_031410762.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_023510476.1|  ferrochelatase                                   64.3    2e-08   
gb|KFI04724.1|  sirohydrochlorin ferrochelatase                       64.3    2e-08   
ref|WP_019258361.1|  sirohydrochlorin ferrochelatase                  64.3    2e-08   
gb|EYE89224.1|  cobalamin biosynthesis protein CbiX                   62.4    2e-08   
ref|WP_005959738.1|  MULTISPECIES: cobalamin biosynthesis protein...  62.0    2e-08   
ref|WP_027150244.1|  membrane protein                                 65.5    2e-08   
ref|WP_003221508.1|  sirohydrochlorin ferrochelatase                  64.3    2e-08   
ref|WP_023857232.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    64.3    2e-08   
ref|WP_026011727.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  64.3    2e-08   
ref|WP_031932191.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_013822558.1|  cobalamin biosynthesis protein CbiX              62.0    2e-08   
ref|WP_002478705.1|  cobalamin biosynthesis protein CbiX              63.9    2e-08   
ref|WP_013643784.1|  sirohydrochlorin cobaltochelatase                62.4    2e-08   
ref|WP_003388113.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_018907810.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_018793867.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_024983474.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_020608857.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_018806192.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_018584198.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_019900583.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_010334197.1|  sirohydrochlorin ferrochelatase                  63.9    2e-08   
ref|WP_028674403.1|  uroporphyrin-III methyltransferase               65.5    2e-08   
ref|WP_018587221.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_028589800.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_009793607.1|  MULTISPECIES: cobalamin biosynthesis protein...  63.9    2e-08   
ref|WP_038840926.1|  uroporphyrin-III methyltransferase               65.5    2e-08   
ref|WP_018794884.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_025680727.1|  sirohydrochlorin cobaltochelatase                65.1    2e-08   
ref|WP_028677317.1|  uroporphyrin-III methyltransferase               65.5    2e-08   
ref|WP_018789664.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_012182837.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_037562268.1|  sirohydrochlorin ferrochelatase                  63.9    2e-08   
ref|WP_020216145.1|  uroporphyrin-III C-methyltransferase             65.5    2e-08   
ref|WP_039070784.1|  sirohydrochlorin cobaltochelatase                64.7    2e-08   
ref|WP_014823192.1|  hypothetical protein                             63.5    2e-08   
ref|WP_026579745.1|  sirohydrochlorin ferrochelatase                  63.9    2e-08   
ref|WP_029536343.1|  uroporphyrin-III methyltransferase               65.5    2e-08   
ref|WP_029027250.1|  uroporphyrin-III methyltransferase               65.5    2e-08   
ref|WP_000648878.1|  cobalamin biosynthesis protein CbiX              63.5    2e-08   
ref|WP_014479753.1|  hypothetical protein                             63.9    2e-08   
ref|WP_027307932.1|  hypothetical protein                             61.6    2e-08   
ref|WP_019031635.1|  uroporphyrin-III C-methyltransferase             65.1    2e-08   
ref|WP_027409804.1|  sirohydrochlorin cobaltochelatase                63.9    2e-08   
ref|WP_026674981.1|  sirohydrochlorin cobaltochelatase                64.3    2e-08   
ref|WP_003206312.1|  cobalamin biosynthesis protein CbiX              63.5    2e-08   
ref|WP_016204101.1|  hypothetical protein                             63.5    2e-08   
ref|WP_018764223.1|  cobalamin biosynthesis protein CbiX              63.5    2e-08   
ref|WP_003181646.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    63.9    3e-08   
ref|WP_003238637.1|  sirohydrochlorin ferrochelatase                  63.9    3e-08   
ref|WP_003196216.1|  cobalamin biosynthesis protein CbiX              63.5    3e-08   
ref|WP_030578279.1|  cobalamin biosynthesis protein CbiX              64.3    3e-08   
ref|WP_034103947.1|  cobalamin biosynthesis protein CbiX              61.6    3e-08   
gb|AAU83302.1|  conserved hypothetical protein                        62.0    3e-08   
ref|WP_016114020.1|  CbiX protein                                     63.5    3e-08   
ref|WP_023556467.1|  cobalamin biosynthesis protein CbiX              63.5    3e-08   
ref|WP_008405067.1|  Sirohydrochlorin cobaltochelatase                63.5    3e-08   
ref|WP_033671030.1|  cobalamin biosynthesis protein CbiX              63.5    3e-08   
ref|WP_036939047.1|  cobalamin biosynthesis protein CbiX              61.2    3e-08   
ref|WP_006094168.1|  MULTISPECIES: cobalamin biosynthesis protein...  63.5    3e-08   
ref|WP_013873672.1|  cobalamin biosynthesis protein CbiX              64.7    3e-08   
dbj|BAN68768.1|  cobalamin biosynthesis CbiX protein                  61.6    3e-08   
ref|WP_014663922.1|  sirohydrochlorin ferrochelatase                  63.5    3e-08   
ref|WP_038828205.1|  sirohydrochlorin ferrochelatase                  63.5    3e-08   
ref|WP_021479317.1|  sirohydrochlorin ferrochelatase                  63.5    3e-08   
ref|WP_007083674.1|  sirohydrochlorin ferrochelatase                  63.2    3e-08   
ref|WP_030327547.1|  uroporphyrin-III methyltransferase               64.7    3e-08   
ref|WP_026591274.1|  cobalamin biosynthesis protein CbiX              63.2    3e-08   
ref|WP_024716106.1|  sirohydrochlorin ferrochelatase                  63.5    3e-08   



>ref|XP_004232317.1| PREDICTED: uncharacterized protein LOC101257032 [Solanum lycopersicum]
Length=206

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            + FVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQQGARR+IVSPFFL PGRHW QDI
Sbjct  84   NGFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQQGARRVIVSPFFLSPGRHWNQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P++ITAPLG+HELLVDV+NDRI+HCLSHI G ADECSVCAGTGKCQ
Sbjct  144  PSLTAEAAKEHPGVPYVITAPLGLHELLVDVVNDRINHCLSHIAGKADECSVCAGTGKCQ  203

Query  256  LYE  248
            L +
Sbjct  204  LRQ  206



>ref|XP_011098440.1| PREDICTED: uncharacterized protein LOC105177107 isoform X1 [Sesamum 
indicum]
Length=213

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDI
Sbjct  91   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDI  150

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P++ITAPLG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+
Sbjct  151  PSLTAEAAKDHPGVPYVITAPLGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCR  210

Query  256  LYE  248
            LY 
Sbjct  211  LYN  213



>ref|XP_011098441.1| PREDICTED: uncharacterized protein LOC105177107 isoform X2 [Sesamum 
indicum]
Length=209

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDI
Sbjct  87   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDI  146

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P++ITAPLG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+
Sbjct  147  PSLTAEAAKDHPGVPYVITAPLGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCR  206

Query  256  LYE  248
            LY 
Sbjct  207  LYN  209



>ref|XP_011098442.1| PREDICTED: uncharacterized protein LOC105177107 isoform X3 [Sesamum 
indicum]
Length=208

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDI
Sbjct  86   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDI  145

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P++ITAPLG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+
Sbjct  146  PSLTAEAAKDHPGVPYVITAPLGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCR  205

Query  256  LYE  248
            LY 
Sbjct  206  LYN  208



>ref|XP_009631034.1| PREDICTED: uncharacterized protein LOC104120867 [Nicotiana tomentosiformis]
Length=206

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+++TKYPIVEPAHMELAEPSI+DAFN CVQ+GARR+IVSPFFL PGRHW QDI
Sbjct  84   NEFVAMFRQRTKYPIVEPAHMELAEPSIRDAFNLCVQRGARRVIVSPFFLSPGRHWNQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +IITAPLG+HELLVDV+NDRI HCL+HI G ADECSVCAGTGKCQ
Sbjct  144  PSLTAEAAKEHPGVSYIITAPLGLHELLVDVVNDRIKHCLNHIAGKADECSVCAGTGKCQ  203

Query  256  LYE  248
            L +
Sbjct  204  LRQ  206



>ref|XP_006338587.1| PREDICTED: uncharacterized protein LOC102599852 [Solanum tuberosum]
Length=206

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQQGARR+IVSPFFL PGRHW QDI
Sbjct  84   NEFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQQGARRVIVSPFFLSPGRHWNQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ ++ITAPLG+HELLV+V+NDRI+HCLSHI G ADECSVCAGTGKC+
Sbjct  144  PSLTAEAAKEHPGVSYLITAPLGLHELLVNVVNDRINHCLSHIAGKADECSVCAGTGKCR  203

Query  256  LYE  248
            L +
Sbjct  204  LRQ  206



>emb|CDP02082.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
             EFV MF+EKTKYPIVEPAHMELAEPSIK+AF++CVQ+GARRI+VSPFFLFPGRHW QDI
Sbjct  88   SEFVTMFKEKTKYPIVEPAHMELAEPSIKNAFSSCVQKGARRIVVSPFFLFPGRHWNQDI  147

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +++TAPLG+HELLVD++NDRI +CLSH+ G ADECSVCAGTGKC 
Sbjct  148  PSLTAEAAKEHPGVSYVVTAPLGLHELLVDILNDRIKYCLSHVAGYADECSVCAGTGKCH  207

Query  256  LYE  248
            LYE
Sbjct  208  LYE  210



>ref|XP_009785949.1| PREDICTED: uncharacterized protein LOC104234139 [Nicotiana sylvestris]
Length=206

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQ+GARR+IVSPFFL PGRHW QDI
Sbjct  84   NEFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQRGARRVIVSPFFLSPGRHWNQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ ++ITAPLG+HELLVDV+NDRI HCL+HI G ADECSVCAGTGKCQ
Sbjct  144  PSLTAEAAKEHPGVSYVITAPLGLHELLVDVVNDRIKHCLNHIAGKADECSVCAGTGKCQ  203

Query  256  LYE  248
            L +
Sbjct  204  LRQ  206



>ref|XP_010251142.1| PREDICTED: uncharacterized protein LOC104593131 isoform X2 [Nelumbo 
nucifera]
Length=166

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+++T YPIVEPAHMELAEPSIKDAFN CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  44   NEFVKMFRDRTGYPIVEPAHMELAEPSIKDAFNLCVQQGANRVIVSPFFLFPGRHWYQDI  103

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPGI +IITAPLG+HEL+VD++NDRI+HCLSH+ GNA+EC  C GTGKC+
Sbjct  104  PSLTAEAAKEHPGISYIITAPLGLHELMVDIMNDRINHCLSHVAGNANECEACTGTGKCR  163

Query  256  LYE  248
            +Y+
Sbjct  164  IYD  166



>ref|XP_010251141.1| PREDICTED: uncharacterized protein LOC104593131 isoform X1 [Nelumbo 
nucifera]
Length=210

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+++T YPIVEPAHMELAEPSIKDAFN CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  88   NEFVKMFRDRTGYPIVEPAHMELAEPSIKDAFNLCVQQGANRVIVSPFFLFPGRHWYQDI  147

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPGI +IITAPLG+HEL+VD++NDRI+HCLSH+ GNA+EC  C GTGKC+
Sbjct  148  PSLTAEAAKEHPGISYIITAPLGLHELMVDIMNDRINHCLSHVAGNANECEACTGTGKCR  207

Query  256  LYE  248
            +Y+
Sbjct  208  IYD  210



>ref|XP_002524661.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
 gb|EEF37680.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
Length=210

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+++T YPIVEPAHMELAEPSIKDAF  CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  89   NEFVNMFRDRTGYPIVEPAHMELAEPSIKDAFGLCVQQGANRVIVSPFFLFPGRHWHQDI  148

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +I+TAPLG+HELLVDV+NDRI+HCLSH+ G+ADEC+ C GTGKC+
Sbjct  149  PSLTAEAAKEHPGVSYIVTAPLGLHELLVDVLNDRIEHCLSHVAGDADECAACVGTGKCK  208

Query  256  LY  251
            LY
Sbjct  209  LY  210



>ref|XP_008458790.1| PREDICTED: uncharacterized protein LOC103498093 [Cucumis melo]
Length=205

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT YPIVEPAHMELAEPSI+D+F +CV+QGA+RIIVSPFFLFPGRHWQQDI
Sbjct  84   NEFVAMFRDKTGYPIVEPAHMELAEPSIRDSFTSCVEQGAKRIIVSPFFLFPGRHWQQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPGI +IITAPLG+HE LVDV+NDRI+HCLSH  G ADEC VCAGTGKC+
Sbjct  144  PSLTAEAAKDHPGISYIITAPLGLHEKLVDVVNDRINHCLSHAAGVADECEVCAGTGKCR  203

Query  256  L  254
             
Sbjct  204  F  204



>gb|KDP45322.1| hypothetical protein JCGZ_09571 [Jatropha curcas]
Length=210

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++K+ YPIVEPAHMELAEPSIKDAF  CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  89   NEFVAMFRDKSGYPIVEPAHMELAEPSIKDAFGLCVQQGANRVIVSPFFLFPGRHWHQDI  148

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEAAK HPG+ +IITAPLG+HELLVDV+NDRI HCL H+ G+ADEC+ C GTGKC+
Sbjct  149  PSLAAEAAKEHPGVSYIITAPLGLHELLVDVVNDRIKHCLRHVAGDADECAACVGTGKCK  208

Query  256  LY  251
            LY
Sbjct  209  LY  210



>ref|XP_006829077.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
 gb|ERM96493.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
Length=204

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            + FVAMF+E++ YPIVEPAHMELA PSIKDAF ACVQQGA RI+VSP+FLFPGRHW+QDI
Sbjct  81   NAFVAMFKERSGYPIVEPAHMELATPSIKDAFCACVQQGANRIVVSPYFLFPGRHWKQDI  140

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEAAK HPGIP+++TAPLG+HEL+VDV+NDRI HCLSH++GNADEC VCAGTG C+
Sbjct  141  PSLAAEAAKEHPGIPYVVTAPLGLHELMVDVLNDRIKHCLSHVEGNADECDVCAGTGGCR  200



>ref|XP_004142793.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 ref|XP_004156688.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 gb|KGN51370.1| hypothetical protein Csa_5G523150 [Cucumis sativus]
Length=205

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT YPIVEPAHMELAEPSIKD+F  CV+QGA+RIIVSPFFLFPGRHWQQDI
Sbjct  84   NEFVAMFKDKTGYPIVEPAHMELAEPSIKDSFTLCVEQGAKRIIVSPFFLFPGRHWQQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPGI +IITAPLG+HE LVDV+NDRI++CLSH  G +DEC VCAGTGKC+
Sbjct  144  PSLTAEAAKDHPGISYIITAPLGLHEQLVDVVNDRINYCLSHAAGVSDECEVCAGTGKCR  203

Query  256  L  254
             
Sbjct  204  F  204



>ref|XP_006446562.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59802.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=202

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  80   NQFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWYQDI  139

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P+I+TAPLG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+
Sbjct  140  PSLTAEAAKEHPGVPYIVTAPLGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTDRCR  199

Query  256  LY  251
            LY
Sbjct  200  LY  201



>gb|KHG13683.1| Sirohydrochlorin ferrochelatase [Gossypium arboreum]
Length=219

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+EK+ YPIVEPAHMELAEPSIKDAF  CVQ+GA R+IVSPFFLFPGRHW QDI
Sbjct  90   NEFVAMFREKSGYPIVEPAHMELAEPSIKDAFGLCVQRGANRVIVSPFFLFPGRHWYQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P LTA+AAK HPG+ +IITAPLG+HELLVDV+NDRI HCLSH+ G+ADEC+ CAGT KC+
Sbjct  150  PLLTADAAKDHPGVSYIITAPLGLHELLVDVMNDRIKHCLSHVAGDADECAACAGTSKCK  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_010530522.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530523.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530524.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530525.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
Length=227

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -3

Query  637  HLSSV*EDEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG  458
            H S++  DEFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPG
Sbjct  96   HESNLMLDEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVVSPFFLFPG  155

Query  457  RHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            RHWQQDIPSLTA+ AK  PGI ++ITAPLG+H LLVDV+NDRI HCL H  G+ADEC VC
Sbjct  156  RHWQQDIPSLTADVAKEFPGIAYLITAPLGLHNLLVDVVNDRIKHCLGHAQGDADECEVC  215

Query  277  AGTGKCQLYE  248
            AGTGKC+LY 
Sbjct  216  AGTGKCKLYN  225



>ref|XP_010033307.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 ref|XP_010033308.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 gb|KCW52917.1| hypothetical protein EUGRSUZ_J02232 [Eucalyptus grandis]
Length=222

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT YPIVEPAHMELAEPSIKDAF++CV++G  R+IV+PFFLFPGRHW +DI
Sbjct  101  NEFVAMFRDKTGYPIVEPAHMELAEPSIKDAFSSCVRRGVTRVIVTPFFLFPGRHWHKDI  160

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +IITAPLG+HELLVDV+NDRI HCLSH++G ADEC  C GTGKC+
Sbjct  161  PSLTAEAAKEHPGVSYIITAPLGLHELLVDVVNDRIKHCLSHVEGAADECEACVGTGKCR  220

Query  256  LY  251
            +Y
Sbjct  221  IY  222



>ref|XP_006470275.1| PREDICTED: uncharacterized protein LOC102627039 [Citrus sinensis]
Length=210

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIP
Sbjct  81   QFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIP  140

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            SLTAEAAK HPG+P+I+TAPLG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+L
Sbjct  141  SLTAEAAKEHPGVPYIVTAPLGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTNRCRL  200

Query  253  Y  251
            Y
Sbjct  201  Y  201



>ref|XP_009377185.1| PREDICTED: uncharacterized protein LOC103965821 [Pyrus x bretschneideri]
Length=210

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVEPAHMELAEPSI+DAFN+CV+QGA R+IVSPFFL PGRHW QDI
Sbjct  89   NEFVSMFRERTGYPIVEPAHMELAEPSIRDAFNSCVEQGADRVIVSPFFLLPGRHWNQDI  148

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +I+TAPLG+H LLVDV+NDRI+HCLS + G+A+EC+VCAGT KCQ
Sbjct  149  PSLTAEAAKEHPGVSYIVTAPLGLHPLLVDVMNDRINHCLSRVAGDAEECAVCAGTNKCQ  208

Query  256  LY  251
            L+
Sbjct  209  LH  210



>ref|XP_008230561.1| PREDICTED: uncharacterized protein LOC103329819 [Prunus mume]
Length=203

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVEPAHMELAEPSI  AFN+CV QGA R+IVSPFFLFPGRHW QDI
Sbjct  82   NEFVSMFKERTGYPIVEPAHMELAEPSIHVAFNSCVLQGANRVIVSPFFLFPGRHWNQDI  141

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +++TAPLG+H LLVDV+NDRI+HCLSHI G+A+ECSVC GT KCQ
Sbjct  142  PSLTAEAAKEHPGVSYLVTAPLGLHPLLVDVLNDRINHCLSHIAGDAEECSVCVGTNKCQ  201

Query  256  LY  251
            L+
Sbjct  202  LH  203



>gb|EPS61981.1| hypothetical protein M569_12814, partial [Genlisea aurea]
Length=150

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            D+FV+MF+EKTKY IVEPAHMELAEPSIK+AF++CV++GA+ ++VSPFFLFPGRHW +DI
Sbjct  28   DDFVSMFREKTKYAIVEPAHMELAEPSIKNAFDSCVRRGAKCVVVSPFFLFPGRHWHKDI  87

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+P++ITAPLG+HELLVDV+ DRI +CLSH+ G   ECSVCAGTGKC+
Sbjct  88   PSLTAEAAKEHPGVPYMITAPLGLHELLVDVVKDRIRYCLSHVAGEEGECSVCAGTGKCR  147

Query  256  LYE  248
            LY+
Sbjct  148  LYD  150



>ref|XP_010523580.1| PREDICTED: uncharacterized protein LOC104801894 [Tarenaya hassleriana]
Length=227

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            DEFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R+++SPFFLFPGRHWQQDI
Sbjct  103  DEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVISPFFLFPGRHWQQDI  162

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLT +AAK  PGI ++ITAPLG+H LLVDV+NDRI HCL H  G+ADEC VCAGTGKC+
Sbjct  163  PSLTVDAAKEFPGIAYLITAPLGLHNLLVDVVNDRIKHCLGHAQGDADECEVCAGTGKCK  222

Query  256  LYE  248
            LY 
Sbjct  223  LYN  225



>ref|XP_009409075.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409076.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409077.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409078.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=161

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDI
Sbjct  38   NEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDI  97

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL A+A+K H GI ++ITAPLG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC+
Sbjct  98   PSLVADASKEHSGISYVITAPLGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCR  157

Query  256  LYE  248
            +Y+
Sbjct  158  IYQ  160



>ref|XP_009409070.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409072.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409073.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDI
Sbjct  50   NEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDI  109

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL A+A+K H GI ++ITAPLG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC+
Sbjct  110  PSLVADASKEHSGISYVITAPLGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCR  169

Query  256  LYE  248
            +Y+
Sbjct  170  IYQ  172



>ref|XP_007031548.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
 gb|EOY02474.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
Length=210

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT Y IVEPAHMELAEPSI+DAF  CVQ+GA R+IVSPFFLFPGRHW QDI
Sbjct  89   NEFVAMFRDKTGYQIVEPAHMELAEPSIRDAFGLCVQRGANRVIVSPFFLFPGRHWYQDI  148

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLT +AAK HPG+ +++TAPLG+HELLVDV+NDRI HCLSH+ G+ADEC+ CAGT KC+
Sbjct  149  PSLTTDAAKEHPGVSYMVTAPLGLHELLVDVVNDRIKHCLSHVAGDADECAACAGTSKCK  208

Query  256  LY  251
            LY
Sbjct  209  LY  210



>ref|XP_009409074.1| PREDICTED: uncharacterized protein LOC103991368 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=172

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDI
Sbjct  49   NEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDI  108

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL A+A+K H GI ++ITAPLG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC+
Sbjct  109  PSLVADASKEHSGISYVITAPLGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCR  168

Query  256  LYE  248
            +Y+
Sbjct  169  IYQ  171



>gb|KDO55188.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=276

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIP
Sbjct  147  QFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIP  206

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            SLTAEAAK HPG+P+I+TAPLG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+L
Sbjct  207  SLTAEAAKEHPGVPYIVTAPLGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTDRCRL  266

Query  253  Y  251
            Y
Sbjct  267  Y  267



>emb|CAN60425.1| hypothetical protein VITISV_021073 [Vitis vinifera]
Length=150

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT Y IVEPAHMELAEPSI +AFN+CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  24   NEFVTMFRDKTGYLIVEPAHMELAEPSITNAFNSCVQQGANRVIVSPFFLFPGRHWHQDI  83

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ ++ITAPLG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC+
Sbjct  84   PSLTAEAAKEHPGVSYVITAPLGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCR  143

Query  256  LYE  248
            +Y+
Sbjct  144  VYQ  146



>ref|XP_007217178.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
 gb|EMJ18377.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
Length=159

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVEPAHMELAEPSI  AFN+CV QGA R+IVSPFFL PGRHW QDI
Sbjct  38   NEFVSMFKERTGYPIVEPAHMELAEPSIHVAFNSCVLQGANRVIVSPFFLLPGRHWNQDI  97

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +++TAPLG+H LLVDV+NDRI+HCLSHI G+A+ECSVC GT KCQ
Sbjct  98   PSLTAEAAKEHPGVSYLVTAPLGLHPLLVDVLNDRINHCLSHIAGDAEECSVCVGTNKCQ  157

Query  256  LY  251
            L+
Sbjct  158  LH  159



>ref|XP_008348192.1| PREDICTED: uncharacterized protein LOC103411331, partial [Malus 
domestica]
Length=161

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVE AHMELAEPSI+DAF++CV+QGA R++VSPFFL PGRHW QDI
Sbjct  40   NEFVSMFRERTGYPIVEAAHMELAEPSIRDAFSSCVEQGANRVVVSPFFLSPGRHWNQDI  99

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +I+TAPLG+H LLVDV+NDRI+HC+SH+ GNA+EC+VCAG  KCQ
Sbjct  100  PSLTAEAAKEHPGVSYIVTAPLGLHHLLVDVLNDRINHCISHVAGNAEECAVCAGANKCQ  159

Query  256  LY  251
            L+
Sbjct  160  LH  161



>ref|XP_002299633.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
 gb|EEE84438.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
Length=220

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT Y IVEPAHMELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DI
Sbjct  99   NEFVAMFRDKTGYLIVEPAHMELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWHRDI  158

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLT EAAK HPG+ ++ITAPLG+HELLVDV+NDRI++CLSHI G+A+EC+VC GT KC+
Sbjct  159  PSLTDEAAKEHPGVSYLITAPLGLHELLVDVMNDRINYCLSHIAGDANECAVCVGTSKCK  218

Query  256  LY  251
            LY
Sbjct  219  LY  220



>ref|XP_009409069.1| PREDICTED: uncharacterized protein LOC103991368 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDI
Sbjct  124  NEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDI  183

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL A+A+K H GI ++ITAPLG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC+
Sbjct  184  PSLVADASKEHSGISYVITAPLGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCR  243

Query  256  LYE  248
            +Y+
Sbjct  244  IYQ  246



>ref|XP_010093442.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
 gb|EXB54066.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
Length=211

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+++T Y IVEPAHMELAEPSI+++F+ CVQ GA R+IVSPFFLFPGRHW QDI
Sbjct  90   NEFVTMFRQRTGYEIVEPAHMELAEPSIRNSFDKCVQLGASRVIVSPFFLFPGRHWHQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK H G+ +IITAPLG+HELLVDV+NDRI HCLSH+ G+ADEC+VC GTGKC+
Sbjct  150  PSLTAEAAKEHSGVSYIITAPLGLHELLVDVVNDRIKHCLSHVAGDADECAVCVGTGKCR  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_008357734.1| PREDICTED: uncharacterized protein LOC103421473 [Malus domestica]
Length=210

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVE AHMELAEPSI+DAF++CV+QGA R++VSPFFL PGRHW QDI
Sbjct  89   NEFVSMFRERTGYPIVEAAHMELAEPSIRDAFSSCVEQGANRVVVSPFFLSPGRHWNQDI  148

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +I+TAPLG+H LLVDV+NDRI+HC+SH+ G+A+EC+VCAG  KCQ
Sbjct  149  PSLTAEAAKEHPGVSYIVTAPLGLHHLLVDVLNDRINHCISHVAGBAEECAVCAGXNKCQ  208

Query  256  LY  251
            L+
Sbjct  209  LH  210



>ref|XP_010500571.1| PREDICTED: uncharacterized protein LOC104777944 [Camelina sativa]
Length=226

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DI
Sbjct  102  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDI  161

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  162  PSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  221

Query  256  LYE  248
            LY 
Sbjct  222  LYN  224



>ref|NP_564562.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
 gb|AAO42090.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50678.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32521.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
Length=225

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+EKT YPIVEPAHMELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW  DI
Sbjct  101  EEFVKMFKEKTGYPIVEPAHMELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDI  160

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  161  PSLTADAAKEFSGISYLITAPLGPHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  220

Query  256  LYE  248
            LY 
Sbjct  221  LYN  223



>emb|CBI34882.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT Y IVEPAHMELAEPSI +AF++CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  3    NEFVTMFRDKTGYLIVEPAHMELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHWHQDI  62

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ ++ITAPLG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC+
Sbjct  63   PSLTAEAAKEHPGVSYVITAPLGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCR  122

Query  256  LY  251
            +Y
Sbjct  123  VY  124



>gb|KHN27452.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=211

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDI
Sbjct  90   NEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+AEAAK HP + +I+TAPLG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+
Sbjct  150  PSLSAEAAKEHPDVSYIVTAPLGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCR  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_010479465.1| PREDICTED: uncharacterized protein LOC104758326 isoform X1 [Camelina 
sativa]
Length=230

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DI
Sbjct  106  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWLKDI  165

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  166  PSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  225

Query  256  LYE  248
            LY 
Sbjct  226  LYN  228



>ref|XP_003524552.1| PREDICTED: uncharacterized protein LOC100500125 isoform X1 [Glycine 
max]
 ref|XP_006579770.1| PREDICTED: uncharacterized protein LOC100500125 isoform X2 [Glycine 
max]
 ref|XP_006579771.1| PREDICTED: uncharacterized protein LOC100500125 isoform X3 [Glycine 
max]
Length=211

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDI
Sbjct  90   NEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+AEAAK HP + +I+TAPLG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+
Sbjct  150  PSLSAEAAKEHPDVSYIVTAPLGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCR  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_010479466.1| PREDICTED: uncharacterized protein LOC104758326 isoform X2 [Camelina 
sativa]
Length=227

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DI
Sbjct  103  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWLKDI  162

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  163  PSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  222

Query  256  LYE  248
            LY 
Sbjct  223  LYN  225



>ref|XP_006579772.1| PREDICTED: uncharacterized protein LOC100500125 isoform X4 [Glycine 
max]
 ref|XP_006579773.1| PREDICTED: uncharacterized protein LOC100500125 isoform X5 [Glycine 
max]
Length=206

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDI
Sbjct  85   NEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDI  144

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+AEAAK HP + +I+TAPLG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+
Sbjct  145  PSLSAEAAKEHPDVSYIVTAPLGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCR  204

Query  256  LY  251
            LY
Sbjct  205  LY  206



>ref|XP_011002713.1| PREDICTED: uncharacterized protein LOC105109646 isoform X1 [Populus 
euphratica]
Length=220

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT Y IVEPAHMELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DI
Sbjct  99   NEFVAMFRDKTGYLIVEPAHMELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWYRDI  158

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLT EAAK HPG+ ++ITAPLG+HELLVDV++DRI++CLSHI G+A+EC+VC GT KC+
Sbjct  159  PSLTDEAAKEHPGVSYLITAPLGLHELLVDVMDDRINYCLSHIAGDANECAVCVGTSKCK  218

Query  256  LY  251
            LY
Sbjct  219  LY  220



>ref|XP_006393176.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
 gb|ESQ30462.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
Length=226

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDI
Sbjct  102  EEFVKMFKDKTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDI  161

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI  CLSH++G+ADEC VCAGT KC+
Sbjct  162  PSLTADAAKEFSGISYLITAPLGLHNLLIDVVNDRIQRCLSHVEGDADECPVCAGTNKCK  221

Query  256  LY  251
            LY
Sbjct  222  LY  223



>gb|AAM67145.1| unknown [Arabidopsis thaliana]
Length=225

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW  DI
Sbjct  101  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDI  160

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  161  PSLTADAAKEFSGISYLITAPLGRHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTKKCK  220

Query  256  LYE  248
            LY 
Sbjct  221  LYN  223



>ref|XP_008341717.1| PREDICTED: uncharacterized protein LOC103404567 [Malus domestica]
Length=247

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV+MF+E+T YPIVEPAHMEL EPSI DAFN+CV+QGA R+IVSPFFL PGRHW QDI
Sbjct  126  NEFVSMFRERTGYPIVEPAHMELXEPSIXDAFNSCVEQGANRVIVSPFFLLPGRHWNQDI  185

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ +I+TAPLG+H LLVDV+NDRI+HCLS + G A+ C+VCAGT KCQ
Sbjct  186  PSLTAEAAKEHPGVSYIVTAPLGLHPLLVDVMNDRINHCLSRVAGEAEXCAVCAGTNKCQ  245

Query  256  LY  251
            L+
Sbjct  246  LH  247



>ref|XP_003618170.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
 gb|AES74388.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=200

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV M++ KT Y IVEPAHMELAEPSI DAF +CVQQGA RII+SPFFL PGRHW QDI
Sbjct  78   NEFVEMYRRKTGYQIVEPAHMELAEPSIGDAFQSCVQQGAHRIIISPFFLGPGRHWSQDI  137

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+AEAAK HPG+ +I+TAPLG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC 
Sbjct  138  PSLSAEAAKQHPGVSYIVTAPLGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCI  197

Query  256  LYE  248
            L++
Sbjct  198  LHQ  200



>emb|CDY45053.1| BnaA08g02220D [Brassica napus]
Length=228

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDI
Sbjct  100  EEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDI  159

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+LTA+AAK  P I ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  160  PALTADAAKEFPSISYLITAPLGLHNLLIDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  219

Query  256  LYE  248
            LY 
Sbjct  220  LYN  222



>ref|XP_010461867.1| PREDICTED: uncharacterized protein LOC104742549 isoform X1 [Camelina 
sativa]
Length=230

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DI
Sbjct  106  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDI  165

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  166  PSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTDKCK  225

Query  256  LYE  248
            +Y 
Sbjct  226  IYN  228



>ref|XP_003618171.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=210

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EFV M++ KT Y IVEPAHMELAEPSI DAF +CVQQGA RII+SPFFL PGRHW QDIP
Sbjct  89   EFVEMYRRKTGYQIVEPAHMELAEPSIGDAFQSCVQQGAHRIIISPFFLGPGRHWSQDIP  148

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            SL+AEAAK HPG+ +I+TAPLG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC L
Sbjct  149  SLSAEAAKQHPGVSYIVTAPLGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCIL  208

Query  253  YE  248
            ++
Sbjct  209  HQ  210



>ref|XP_010461868.1| PREDICTED: uncharacterized protein LOC104742549 isoform X2 [Camelina 
sativa]
Length=227

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DI
Sbjct  103  EEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDI  162

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  163  PSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTDKCK  222

Query  256  LYE  248
            +Y 
Sbjct  223  IYN  225



>ref|XP_002273543.1| PREDICTED: uncharacterized protein LOC100244073 [Vitis vinifera]
Length=208

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++KT Y IVEPAHMELAEPSI +AF++CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  87   NEFVTMFRDKTGYLIVEPAHMELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHWHQDI  146

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK HPG+ ++ITAPLG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC+
Sbjct  147  PSLTAEAAKEHPGVSYVITAPLGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCR  206

Query  256  LY  251
            +Y
Sbjct  207  VY  208



>gb|AFK44994.1| unknown [Medicago truncatula]
Length=200

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV M++ KT Y IVEPAHMELAEPSI DAF +CVQQG  RII+SPFFL PGRHW QDI
Sbjct  78   NEFVEMYRRKTGYQIVEPAHMELAEPSIGDAFQSCVQQGVHRIIISPFFLGPGRHWSQDI  137

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+AEAAK HPG+ +I+TAPLG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC 
Sbjct  138  PSLSAEAAKQHPGVSYIVTAPLGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCI  197

Query  256  LYE  248
            L++
Sbjct  198  LHQ  200



>ref|XP_008783194.1| PREDICTED: uncharacterized protein LOC103702509 [Phoenix dactylifera]
Length=205

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA R+IVSPFFL PGRHWQQDI
Sbjct  84   NEFVAMFKARTGYRIVEPAHMELAAPSIRDAFKTCVLQGANRVIVSPFFLSPGRHWQQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA++ H GI +IITAPLG+HEL+VDV+NDRI HCLSH+ G+ADEC+VCAGTGKC+
Sbjct  144  PALAAEASREHSGISYIITAPLGLHELMVDVMNDRIKHCLSHVAGDADECTVCAGTGKCR  203

Query  256  LY  251
            LY
Sbjct  204  LY  205



>ref|XP_009381040.1| PREDICTED: uncharacterized protein LOC103969271 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELA+PSI DAF  C+Q+GA+R+I+SPFFL PGRHW QDI
Sbjct  83   NEFVAMFKARTGYQIVEPAHMELAKPSINDAFRLCMQKGAKRVIISPFFLSPGRHWLQDI  142

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L A+A+K H GI +IITAPLG+HEL+VDV+NDRI HCL+H+ G+ADECSVCAGTGKC+
Sbjct  143  PALVADASKEHSGISYIITAPLGLHELMVDVMNDRIKHCLTHVAGDADECSVCAGTGKCR  202

Query  256  LYE  248
            LY+
Sbjct  203  LYQ  205



>ref|XP_004489242.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cicer arietinum]
Length=200

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+ KT Y IVE AHMELAEPSI DAF +CVQQGARR+I+SPFFL PGRHW QDI
Sbjct  78   NEFVEMFRHKTGYQIVELAHMELAEPSIGDAFQSCVQQGARRVIISPFFLSPGRHWSQDI  137

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL+A AAK HPG+ +I+TAPLG+HELLVDV+NDRI +CL H+ G+ADECSVCAGTGKC 
Sbjct  138  PSLSAAAAKQHPGVSYIVTAPLGLHELLVDVVNDRITYCLKHVAGDADECSVCAGTGKCI  197

Query  256  LYE  248
            L++
Sbjct  198  LHQ  200



>ref|XP_006647189.1| PREDICTED: uncharacterized protein LOC102709053 [Oryza brachyantha]
Length=165

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FVAMF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  43   NDFVAMFRTRTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  102

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  +P+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  103  PALAAEASKEHSNVPYIVTAPLGLHELMVDIMNDRIKYCLRHVSGDVDECTVCAGTGKCR  162

Query  256  LY  251
            LY
Sbjct  163  LY  164



>gb|KFK35946.1| hypothetical protein AALP_AA4G058800 [Arabis alpina]
Length=217

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+++T Y IVEPAHMELA+PSIKDAF+ CVQQGA+R++VSPFFLFPGRHW QDI
Sbjct  93   EEFVKMFKDETGYLIVEPAHMELAKPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHQDI  152

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTA+AAK   GI ++ITAPLG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  153  PSLTADAAKEFSGISYLITAPLGPHNLLMDVVNDRIQHCLSHVEGDADECVVCAGTNKCK  212

Query  256  LY  251
            LY
Sbjct  213  LY  214



>ref|XP_009381038.1| PREDICTED: uncharacterized protein LOC103969271 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=218

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF+ +T Y IVEPAHMELA+PSI DAF  C+Q+GA+R+I+SPFFL PGRHW QDI
Sbjct  94   NEFVAMFKARTGYQIVEPAHMELAKPSINDAFRLCMQKGAKRVIISPFFLSPGRHWLQDI  153

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L A+A+K H GI +IITAPLG+HEL+VDV+NDRI HCL+H+ G+ADECSVCAGTGKC+
Sbjct  154  PALVADASKEHSGISYIITAPLGLHELMVDVMNDRIKHCLTHVAGDADECSVCAGTGKCR  213

Query  256  LYE  248
            LY+
Sbjct  214  LYQ  216



>emb|CDY03592.1| BnaC03g68510D [Brassica napus]
Length=222

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDI
Sbjct  98   EEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDI  157

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+LTA+AAK    I ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  158  PALTADAAKEFSDISYLITAPLGLHNLLIDVVNDRIQHCLSHVEGDADECLVCAGTNKCK  217

Query  256  LYE  248
            LY 
Sbjct  218  LYN  220



>ref|XP_004291766.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=205

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW QDI
Sbjct  85   NEFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQDI  144

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSLTAEAAK H G+ +++TAPLG+H LLVDV+NDRI+HCLSH+ G+A EC+VC GTGKCQ
Sbjct  145  PSLTAEAAKKH-GVSYMVTAPLGLHPLLVDVMNDRINHCLSHVAGDAGECAVCVGTGKCQ  203

Query  256  LY  251
            L+
Sbjct  204  LH  205



>ref|XP_010915963.1| PREDICTED: uncharacterized protein LOC105040911 isoform X2 [Elaeis 
guineensis]
Length=205

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            DEFVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA+R+IVSPFFL PGRHW QDI
Sbjct  84   DEFVAMFKARTGYRIVEPAHMELAAPSIRDAFETCVLQGAKRVIVSPFFLSPGRHWHQDI  143

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA++ H GI +IITAPLG+HEL+VDV+NDRI HCLSH+  +ADEC+VCAGTGKC+
Sbjct  144  PALAAEASREHSGISYIITAPLGLHELMVDVMNDRIKHCLSHVAADADECTVCAGTGKCR  203

Query  256  LY  251
            LY
Sbjct  204  LY  205



>gb|EEC72956.1| hypothetical protein OsI_06840 [Oryza sativa Indica Group]
 gb|EEE56777.1| hypothetical protein OsJ_06350 [Oryza sativa Japonica Group]
Length=125

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FVAMF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  3    NDFVAMFRARTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  62

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  I +++TAPLG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQ
Sbjct  63   PALAAEASKEHSNITYVVTAPLGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQ  122

Query  256  LY  251
            LY
Sbjct  123  LY  124



>ref|XP_003574408.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235063.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235064.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235065.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235066.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235067.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235068.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235069.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  91   NDFVTMFRARTGYRIVEPAHMELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  150

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEA+K H  +P+IITAPLG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC+
Sbjct  151  PSLAAEASKEHSNVPYIITAPLGLHELMVDVMNDRIKYCLRHVGGDADECTVCAGTGKCR  210

Query  256  LYE  248
            LY 
Sbjct  211  LYS  213



>ref|XP_010235070.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010235072.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  90   NDFVTMFRARTGYRIVEPAHMELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEA+K H  +P+IITAPLG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC+
Sbjct  150  PSLAAEASKEHSNVPYIITAPLGLHELMVDVMNDRIKYCLRHVGGDADECTVCAGTGKCR  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_009107234.1| PREDICTED: uncharacterized protein LOC103832890 [Brassica rapa]
Length=228

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDI
Sbjct  100  EEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDI  159

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+LTA+AAK    I ++ITAPLG+H LL++V+NDRI HCLSH++G+ADEC VCAGT KC+
Sbjct  160  PALTADAAKEFSDISYLITAPLGLHNLLINVVNDRIQHCLSHVEGDADECLVCAGTNKCK  219

Query  256  LYE  248
            LY 
Sbjct  220  LYN  222



>dbj|BAD21683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD22195.1| unknown protein [Oryza sativa Japonica Group]
Length=212

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FVAMF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  90   NDFVAMFRARTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  I +++TAPLG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQ
Sbjct  150  PALAAEASKEHSNITYVVTAPLGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQ  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_004952284.1| PREDICTED: uncharacterized protein LOC101756522 isoform X1 [Setaria 
italica]
 ref|XP_004952285.1| PREDICTED: uncharacterized protein LOC101756522 isoform X2 [Setaria 
italica]
Length=212

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA RIIVSP+FL PGRHW+QDI
Sbjct  90   NDFVEMFRTRTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRIIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  +P+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  150  PALAAEASKEHSNVPYIVTAPLGLHELMVDIMNDRIKYCLQHVGGDVDECTVCAGTGKCR  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>ref|XP_002891559.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67818.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 13/136 (10%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHM-------------ELAEPSIKDAFNACVQQGARRIIVSP  476
            +EFV MF++KT YPIVEPAHM             ELAEPSIKDAF+ CVQQGA+R++VSP
Sbjct  95   EEFVKMFKDKTGYPIVEPAHMLCLLFADVHTLHQELAEPSIKDAFSLCVQQGAKRVVVSP  154

Query  475  FFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            FFLFPGRHW +DIPSLTA+AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+A
Sbjct  155  FFLFPGRHWHKDIPSLTADAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDA  214

Query  295  DECSVCAGTGKCQLYE  248
            DEC VCAGT KC+LY 
Sbjct  215  DECLVCAGTNKCKLYN  230



>ref|XP_010238623.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010238624.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW QDI
Sbjct  91   NDFVTMFRARTGYRIVEPAHMELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWNQDI  150

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEA+K H  +P+I+TAPLG+HEL+VDV+NDRI +CL H+ G+A+EC+VCAGTGKC+
Sbjct  151  PSLAAEASKEHSNVPYIVTAPLGLHELMVDVMNDRIKYCLRHVGGDANECTVCAGTGKCR  210

Query  256  LYE  248
            LY 
Sbjct  211  LYS  213



>ref|XP_003578793.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010238625.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW QDI
Sbjct  90   NDFVTMFRARTGYRIVEPAHMELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWNQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEA+K H  +P+I+TAPLG+HEL+VDV+NDRI +CL H+ G+A+EC+VCAGTGKC+
Sbjct  150  PSLAAEASKEHSNVPYIVTAPLGLHELMVDVMNDRIKYCLRHVGGDANECTVCAGTGKCR  209

Query  256  LYE  248
            LY 
Sbjct  210  LYS  212



>dbj|BAK06991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ +T Y IVEPAHMELAEPSIK+AF  CVQQGA RIIVSP+FL PGRHW+QDI
Sbjct  90   NDFVTMFRARTGYRIVEPAHMELAEPSIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEA+K H  + +I+TAPLG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC 
Sbjct  150  PSLAAEASKEHSNVAYIVTAPLGLHELMVDVMNDRIKYCLRHVAGDADECAVCAGTGKCH  209

Query  256  LY  251
            LY
Sbjct  210  LY  211



>gb|ACG31626.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDI
Sbjct  90   NDFVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  IP+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  150  PALAAEASKEHSNIPYIVTAPLGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCR  209

Query  256  LYE  248
            +Y 
Sbjct  210  MYS  212



>ref|XP_002453737.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
 gb|EES06713.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
Length=212

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  90   NDFVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA++ H  IP+++TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  150  PALAAEASREHSNIPYLVTAPLGLHELMVDIMNDRIKYCLRHVAGDIDECTVCAGTGKCR  209

Query  256  LYE  248
            LY 
Sbjct  210  LYS  212



>gb|ACG41745.1| sirohydrochlorin ferrochelatase [Zea mays]
 gb|ACG45177.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ KT Y IVE AHMELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDI
Sbjct  90   NDFVEMFRAKTSYSIVEAAHMELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  IP+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  150  PALAAEASKEHSNIPYIVTAPLGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCR  209

Query  256  LYE  248
            LY 
Sbjct  210  LYS  212



>ref|XP_010915962.1| PREDICTED: uncharacterized protein LOC105040911 isoform X1 [Elaeis 
guineensis]
Length=293

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            DEFVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA+R+IVSPFFL PGRHW QDI
Sbjct  172  DEFVAMFKARTGYRIVEPAHMELAAPSIRDAFETCVLQGAKRVIVSPFFLSPGRHWHQDI  231

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA++ H GI +IITAPLG+HEL+VDV+NDRI HCLSH+  +ADEC+VCAGTGKC+
Sbjct  232  PALAAEASREHSGISYIITAPLGLHELMVDVMNDRIKHCLSHVAADADECTVCAGTGKCR  291

Query  256  LY  251
            LY
Sbjct  292  LY  293



>gb|ACR35235.1| unknown [Zea mays]
Length=166

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ KT Y IVE AHMELAEP+IKDAF  CVQQG  R+IVSP+FL PGRHW+QDI
Sbjct  44   NDFVEMFRAKTSYSIVEAAHMELAEPTIKDAFGKCVQQGVSRVIVSPYFLSPGRHWKQDI  103

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L AEA+K H  IP+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  104  PALAAEASKEHSNIPYIVTAPLGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCR  163

Query  256  LY  251
            LY
Sbjct  164  LY  165



>gb|AAD50047.1|AC007980_12 Hypothetical protein [Arabidopsis thaliana]
Length=242

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 17/140 (12%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHM-----------------ELAEPSIKDAFNACVQQGARRI  488
            +EFV MF+EKT YPIVEPAHM                 ELAEPSIKDAF+ CVQQGA+R+
Sbjct  101  EEFVKMFKEKTGYPIVEPAHMMTFKLCLLFADFYTLHQELAEPSIKDAFSLCVQQGAKRV  160

Query  487  IVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHI  308
            +VSPFFLFPGRHW  DIPSLTA+AAK   GI ++ITAPLG H LL+DV+NDRI HCLSH+
Sbjct  161  VVSPFFLFPGRHWHTDIPSLTADAAKEFSGISYLITAPLGPHNLLLDVVNDRIQHCLSHV  220

Query  307  DGNADECSVCAGTGKCQLYE  248
            +G+ADEC VCAGT KC+LY 
Sbjct  221  EGDADECLVCAGTNKCKLYN  240



>ref|XP_004291765.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=210

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 6/127 (5%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQ---  446
            +EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW    
Sbjct  85   NEFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQTV  144

Query  445  --QDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAG  272
              QDIPSLTAEAAK H G+ +++TAPLG+H LLVDV+NDRI+HCLSH+ G+A EC+VC G
Sbjct  145  ILQDIPSLTAEAAKKH-GVSYMVTAPLGLHPLLVDVMNDRINHCLSHVAGDAGECAVCVG  203

Query  271  TGKCQLY  251
            TGKCQL+
Sbjct  204  TGKCQLH  210



>ref|NP_001132509.1| sirohydrochlorin ferrochelatase isoform 1 [Zea mays]
 gb|ACF81375.1| unknown [Zea mays]
Length=212

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDI
Sbjct  90   NDFVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDI  149

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L A A+K H  IP+I+TAPLG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+
Sbjct  150  PALAAVASKEHSNIPYIVTAPLGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCR  209

Query  256  LYE  248
            +Y 
Sbjct  210  MYS  212



>ref|XP_010670852.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670853.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670854.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670855.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670856.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670857.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670859.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  631  SSV*EDEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRH  452
            S++  +EFV MF+ +T YPIVEPAHMELAEPSIKDAF+ CVQQGA  +I+SPFFLFPGRH
Sbjct  85   SNILLNEFVLMFKSRTGYPIVEPAHMELAEPSIKDAFDLCVQQGANCVIISPFFLFPGRH  144

Query  451  WQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAG  272
            W QDIP L   AA  HPGI +++TAPLG+HELLVDV+ DRID+CLSH+ G  +EC+VCAG
Sbjct  145  WHQDIPVLAGAAALEHPGINYLVTAPLGLHELLVDVVKDRIDYCLSHVAGQVEECAVCAG  204

Query  271  TGKCQL  254
            TG+C+ 
Sbjct  205  TGRCKF  210



>ref|XP_009334112.1| PREDICTED: uncharacterized protein LOC103926952 [Pyrus x bretschneideri]
Length=220

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 108/132 (82%), Gaps = 10/132 (8%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ--  443
            +EFV+MF+E+T YP+V  AHMELAEPSI+DAF++CV+QGA R++VS FFL PGRHW    
Sbjct  89   NEFVSMFRERTGYPVVVAAHMELAEPSIRDAFSSCVEQGANRVVVSLFFLSPGRHWNTVA  148

Query  442  --------DIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADEC  287
                    DIPSLTAEAAK HPG+  I+TAPLG+H LLVDV+NDRI+HC+SH+ G+A+EC
Sbjct  149  QLTINIDGDIPSLTAEAAKEHPGVSHIVTAPLGLHHLLVDVLNDRINHCISHVAGDAEEC  208

Query  286  SVCAGTGKCQLY  251
            +VCAGT KCQL+
Sbjct  209  AVCAGTNKCQLH  220



>ref|XP_010461882.1| PREDICTED: uncharacterized protein LOC104742567 [Camelina sativa]
Length=116

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +    LTA
Sbjct  1    MFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHK----LTA  56

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            +AAK   GI ++ITAPLG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC++Y 
Sbjct  57   DAAKEFSGISYLITAPLGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKIYS  114



>gb|ABK26418.1| unknown [Picea sitchensis]
Length=214

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            D FV M++++T +PIVE AHMELA+P+IK+AF++CV QGA R+I+SP+FL PGRHW+QDI
Sbjct  91   DAFVDMYKKRTGHPIVELAHMELAQPTIKEAFDSCVNQGAARVIISPYFLSPGRHWKQDI  150

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            PSL AEAAK HPG+P+I+TAPLG+HEL+V+VI DRI +CLSH+ G++ EC +C+GTG+CQ
Sbjct  151  PSLAAEAAKEHPGVPYIVTAPLGLHELMVNVIEDRIKYCLSHVAGDSAECEMCSGTGQCQ  210



>ref|XP_003618173.1| Sirohydrochlorin cobaltochelatase [Medicago truncatula]
 gb|ACJ85904.1| unknown [Medicago truncatula]
 gb|AES74391.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=208

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
             +FV MF+ KT Y IVEPAHMELA+PSI DAF +CVQQGA RII+SPFFL  G+H+ +DI
Sbjct  78   SKFVEMFRNKTGYKIVEPAHMELAKPSIADAFQSCVQQGAHRIIISPFFLATGKHFNEDI  137

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L+AEAAK HPG+ ++ITAPLG+H LLVD++NDRI+ CL H  G+A+ECSVC G GKC 
Sbjct  138  PALSAEAAKQHPGVSYLITAPLGLHVLLVDIVNDRINGCLKHGAGDAEECSVCDGIGKCI  197

Query  256  LYE  248
            L +
Sbjct  198  LKQ  200



>ref|XP_008667254.1| PREDICTED: sirohydrochlorin ferrochelatase isoform 1 isoform 
X1 [Zea mays]
Length=248

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 105/158 (66%), Gaps = 36/158 (23%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHM------------------------------------ELA  545
            ++FV MF+ KT Y IVEPAHM                                    ELA
Sbjct  90   NDFVEMFRAKTSYRIVEPAHMASREEGELQGSEKEESCGEGGELLTAEREIDICAGEELA  149

Query  544  EPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGV  365
            EP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDIP+L A A+K H  IP+I+TAPLG+
Sbjct  150  EPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDIPALAAVASKEHSNIPYIVTAPLGL  209

Query  364  HELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC++Y
Sbjct  210  HELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRMY  247



>ref|NP_001046609.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAF08523.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAG89217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            IV+    ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  I
Sbjct  15   IVDECVQELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNI  74

Query  394  PFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
             +++TAPLG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQLY
Sbjct  75   TYVVTAPLGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQLY  122



>gb|EMT14170.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=104

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL AEA+K H  + +I+TAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVAYIVTAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ADEC+VCAGTGKC LY
Sbjct  63   LGLHELMVDIMNDRIKYCLRHVAGDADECAVCAGTGKCHLY  103



>ref|XP_001765290.1| predicted protein [Physcomitrella patens]
 gb|EDQ70018.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV ++++KT +PIVE AHMELAEPSI  AF+ CV+QGA R+I+ P+F FPGRHW +DIP+
Sbjct  22   FVDLYKQKTGHPIVEAAHMELAEPSISHAFDRCVEQGAERVIICPYFFFPGRHWDRDIPA  81

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            L+A+AA+ H  +P+++TAP+G+HEL+V V+ DR+++CLS + GN +EC +C GTG+CQ
Sbjct  82   LSAKAAEKHVDVPYVVTAPIGLHELMVQVLVDRMEYCLSRVAGNVEECDMCRGTGRCQ  139



>ref|XP_002964135.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
 gb|EFJ34468.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
Length=158

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV M++ KT + IV+ AHMELA PSI+DAF+ CV+ GA+R+IVSP+FLFPGRHW +DI
Sbjct  39   EEFVEMYKRKTGHEIVQAAHMELAAPSIEDAFDRCVELGAQRVIVSPYFLFPGRHWNKDI  98

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L A A+  HPGI +++TAP+G+HEL+VDV+ DR+ +C+S  +G ADEC +C GTG+C+
Sbjct  99   PALAAAASAKHPGIRYLVTAPIGLHELMVDVLEDRMKYCVSRAEGRADECDMCVGTGRCR  158



>ref|XP_002993172.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
 gb|EFJ05812.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
Length=158

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV M++ KT + IV+ AHMELA PSI+DAF+ CV+ GA+R+IVSP+FLFPGRHW +DI
Sbjct  39   EEFVNMYKRKTGHEIVQAAHMELAAPSIEDAFDRCVELGAQRVIVSPYFLFPGRHWNKDI  98

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            P+L A A+  HPGI +++TAP+G+HEL+VDV+ DR+ +C+S  +G ADEC +C GTG+C+
Sbjct  99   PALAAAASAKHPGIRYLVTAPIGLHELMVDVLEDRMKYCVSRAEGRADECDMCVGTGRCR  158



>gb|EMS54863.1| Sirohydrochlorin ferrochelatase [Triticum urartu]
Length=107

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL AEA+K H  + +I+TAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVAYIVTAP  62

Query  373  LGVHELL---VDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+   VDV+NDRI +CL H+ G+A EC+VCAGTGKC LY
Sbjct  63   LGLHELMVITVDVMNDRIKYCLRHVAGDAGECAVCAGTGKCHLY  106



>ref|XP_006446561.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59801.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=181

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDI
Sbjct  80   NQFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWYQDI  139

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVD  347
            PSLTAEAAK HPG+P+I+TAPLG+HE LV+
Sbjct  140  PSLTAEAAKEHPGVPYIVTAPLGLHEQLVN  169



>gb|KDO55189.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=247

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIP
Sbjct  147  QFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIP  206

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVD  347
            SLTAEAAK HPG+P+I+TAPLG+HE LV+
Sbjct  207  SLTAEAAKEHPGVPYIVTAPLGLHEQLVN  235



>gb|KDO55190.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=246

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIP
Sbjct  147  QFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIP  206

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLV  350
            SLTAEAAK HPG+P+I+TAPLG+HE LV
Sbjct  207  SLTAEAAKEHPGVPYIVTAPLGLHEQLV  234



>ref|XP_010530526.1| PREDICTED: uncharacterized protein LOC104807109 isoform X2 [Tarenaya 
hassleriana]
Length=196

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 87/130 (67%), Gaps = 31/130 (24%)
 Frame = -3

Query  637  HLSSV*EDEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG  458
            H S++  DEFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPG
Sbjct  96   HESNLMLDEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVVSPFFLFPG  155

Query  457  RHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            RHWQQ                               DV+NDRI HCL H  G+ADEC VC
Sbjct  156  RHWQQ-------------------------------DVVNDRIKHCLGHAQGDADECEVC  184

Query  277  AGTGKCQLYE  248
            AGTGKC+LY 
Sbjct  185  AGTGKCKLYN  194



>ref|XP_011002714.1| PREDICTED: uncharacterized protein LOC105109646 isoform X2 [Populus 
euphratica]
Length=189

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFVAMF++KT Y IVEPAHMELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DI
Sbjct  99   NEFVAMFRDKTGYLIVEPAHMELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWYRDI  158

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLV  350
            PSLT EAAK HPG+ ++ITAPLG+HELLV
Sbjct  159  PSLTDEAAKEHPGVSYLITAPLGLHELLV  187



>ref|XP_001421596.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99889.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=134

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            + F A++   T   +VEPAHMELA P+I DAF  CV++GA  ++V+PFFL PGRHWQ+DI
Sbjct  19   ERFAALYATATGRAVVEPAHMELAPPTIADAFERCVERGANVVVVAPFFLSPGRHWQEDI  78

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            P L  EAA  HPG+ ++I+AP+G+H L+ +VI+ R+ HCL+H++    EC VCAG+
Sbjct  79   PRLVDEAAAAHPGVKYLISAPIGLHPLMAEVIDSRLRHCLAHVNEGGPECDVCAGS  134



>ref|XP_004291768.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 4 [Fragaria 
vesca subsp. vesca]
Length=194

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 1/90 (1%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW QDI
Sbjct  85   NEFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQDI  144

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVD  347
            PSLTAEAAK H G+ +++TAPLG+H LLVD
Sbjct  145  PSLTAEAAKKH-GVSYMVTAPLGLHPLLVD  173



>gb|EMS61947.1| Sirohydrochlorin ferrochelatase [Triticum urartu]
Length=95

 Score =   144 bits (363),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSV  281
            LG+HEL+VD++NDRI +CL H  G  DEC+V
Sbjct  63   LGLHELMVDIMNDRIKYCLRHAAGGVDECTV  93



>ref|XP_002506350.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67608.1| predicted protein, partial [Micromonas sp. RCC299]
Length=133

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            +EFV M++E+T  PIVE AHMEL EP I  AF+ CV+QGA  + VSPFFL PGRHWQ+DI
Sbjct  18   EEFVRMYREETGRPIVELAHMELCEPGIDVAFSRCVEQGATLVAVSPFFLSPGRHWQEDI  77

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            P+LTAEAA  HPG+ + + APLG+H L+  ++  R++ C++H+     +C VC GT
Sbjct  78   PALTAEAASKHPGVGYFVAAPLGLHPLMATIVESRLETCMAHLTTGGGKCDVCDGT  133



>gb|EMT15526.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=122

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECS  284
            LG+HEL+VD+++DRI +CL H  G  DEC+
Sbjct  63   LGLHELMVDIMSDRIKYCLRHAAGGVDECT  92



>ref|XP_004291767.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 3 [Fragaria 
vesca subsp. vesca]
Length=199

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 6/95 (6%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQ---  446
            +EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW    
Sbjct  85   NEFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQTV  144

Query  445  --QDIPSLTAEAAKLHPGIPFIITAPLGVHELLVD  347
              QDIPSLTAEAAK H G+ +++TAPLG+H LLVD
Sbjct  145  ILQDIPSLTAEAAKKH-GVSYMVTAPLGLHPLLVD  178



>ref|XP_003083605.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL58154.1| Cobalamin (vitamin B12) biosynthesis CbiX [Ostreococcus tauri]
Length=202

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV  +   T   IVE AHMELA PSI DAF  CV +GA  I+V+PFFL PGRHWQ+DIP 
Sbjct  82   FVEQYARVTGRDIVEAAHMELASPSIADAFGRCVDRGANVIVVAPFFLSPGRHWQEDIPQ  141

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG-KCQL  254
            L  EAA  H G+  +++AP+G+H L+V+VI+ R+ HCL+   G  D C VCAG+   CQ+
Sbjct  142  LVKEAAAAHSGVRHLVSAPIGLHPLMVEVIDSRMRHCLARAKGEVDACDVCAGSKFGCQM  201



>ref|WP_002650018.1| cbiX protein [Blastopirellula marina]
 gb|EAQ82176.1| cbiX protein [Blastopirellula marina DSM 3645]
Length=152

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E V +F++ T  PIVE AHMELAEPSI  AF  CV QGA  +IV P+FL PGRHW +DIP
Sbjct  31   EVVQLFRQTTGRPIVEAAHMELAEPSIAAAFARCVAQGAGLVIVHPYFLSPGRHWSEDIP  90

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
             L A+AA  HPG+  ++TAPLG+H+ + +++ +RI+ CL+   G    C VC    +C+L
Sbjct  91   RLAAQAAAQHPGVRHMVTAPLGLHQKMAEIMAERIEVCLARCRGEDVACGVCDEQTRCRL  150

Query  253  YE  248
             +
Sbjct  151  LD  152



>ref|XP_003063280.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52416.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=139

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
             EFV M+ E T   +VE AHME+AEPSI  AF  CV++GA  + VSPFFL PGRHWQ+DI
Sbjct  26   SEFVRMYVEHTGRGLVELAHMEIAEPSIDVAFARCVERGATLVAVSPFFLSPGRHWQEDI  85

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            P LTA AA  HPG+ + + AP+G+H L+  +++ R++ C+ H+     +C +C
Sbjct  86   PKLTAAAAGKHPGVKYFVAAPIGLHPLMSTIVDSRLETCVKHLTEGGGKCDLC  138



>ref|XP_010530527.1| PREDICTED: uncharacterized protein LOC104807109 isoform X3 [Tarenaya 
hassleriana]
Length=190

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 77/130 (59%), Gaps = 37/130 (28%)
 Frame = -3

Query  637  HLSSV*EDEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG  458
            H S++  DEFV MF+++T YPIVEPAHM                                
Sbjct  96   HESNLMLDEFVKMFKDQTGYPIVEPAHM--------------------------------  123

Query  457  RHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
                 DIPSLTA+ AK  PGI ++ITAPLG+H LLVDV+NDRI HCL H  G+ADEC VC
Sbjct  124  -----DIPSLTADVAKEFPGIAYLITAPLGLHNLLVDVVNDRIKHCLGHAQGDADECEVC  178

Query  277  AGTGKCQLYE  248
            AGTGKC+LY 
Sbjct  179  AGTGKCKLYN  188



>ref|XP_007217608.1| hypothetical protein PRUPE_ppa017033mg, partial [Prunus persica]
 gb|EMJ18807.1| hypothetical protein PRUPE_ppa017033mg, partial [Prunus persica]
Length=87

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  472  FLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNAD  293
            FL  GRHW QDIPSLTAEAAK HPG+  I+TAPLG+H+LLVDV+NDRI+H  SHI G+A+
Sbjct  14   FLITGRHWNQDIPSLTAEAAKEHPGVSSIVTAPLGLHQLLVDVLNDRINHGFSHIAGDAE  73

Query  292  ECSVCAGTGKCQLY  251
            ECSVC GT KCQL+
Sbjct  74   ECSVCVGTNKCQLH  87



>gb|KHN12062.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=80

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            +VEP HMELAEPSI+DAF +C++QG   IIV PF LFPGRHW QDIPSL+AE  K HP +
Sbjct  5    LVEPTHMELAEPSIRDAFESCIEQGVHHIIVCPFILFPGRHWSQDIPSLSAEVVKEHPDV  64

Query  394  PFIITAPLGVHELLV  350
             + +TAP+G+HEL V
Sbjct  65   SYNVTAPVGLHELFV  79



>gb|EMT21287.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=78

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+A   CVQQGA R+IVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEALGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVD  347
            LG+HEL+VD
Sbjct  63   LGLHELMVD  71



>ref|WP_014437036.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis]
 ref|YP_005445715.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis 
NBRC 102666]
 dbj|BAM03818.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis 
NBRC 102666]
Length=178

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -3

Query  616  DEFVAMFQEK-TKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQD  440
            +E   +F ++ +  PIVE AHMELA P I  A++ACV++GARRI++ PFFL  G+HW +D
Sbjct  31   EEVARLFAQRFSDAPIVEAAHMELAMPDIAAAYDACVRRGARRIVILPFFLAQGKHWTRD  90

Query  439  IPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRID  326
            IPSLT++AA+ HPG  + I  PLG+ +L++D++  R+D
Sbjct  91   IPSLTSQAAEKHPGTAYQIAEPLGIDDLILDLLKKRLD  128



>gb|EYU44776.1| hypothetical protein MIMGU_mgv1a015745mg [Erythranthe guttata]
Length=147

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFP  461
            +EFVAMF+EKTKYPIVEPAHMELAEPSIKDAFN+CVQQGA+R+IVSPFFLFP
Sbjct  95   NEFVAMFREKTKYPIVEPAHMELAEPSIKDAFNSCVQQGAKRVIVSPFFLFP  146



>gb|KDO55191.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=221

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            +FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW Q
Sbjct  147  QFVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQ  203



>ref|XP_007151006.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
 gb|ESW23000.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
Length=143

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            ++FV MF+ KT Y IVEPAHMELAEPSI+DAF +CVQQGA RIIVSPFFL PGRHW Q
Sbjct  86   NDFVKMFKYKTGYEIVEPAHMELAEPSIRDAFQSCVQQGANRIIVSPFFLSPGRHWSQ  143



>ref|XP_007508641.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20258.1| predicted protein [Bathycoccus prasinos]
Length=226

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = -3

Query  598  FQEKTKYPIVEPAHMELAEPSIKDAFNACVQ-QGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            + ++ KY +  PAHMELA PSI DAF   ++ +  R+I+V+PFFL PGRH ++DIP L  
Sbjct  103  YSKERKYEVA-PAHMELASPSIADAFRELIETKNCRKIVVAPFFLSPGRHVKEDIPRLVE  161

Query  421  EAAKLHPG---IPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCA  275
            EAA+ + G   + +++ AP+ +H L+  +I++R++ CL   +  A EC VC 
Sbjct  162  EAAEEYRGKYELEYMVAAPIALHPLMTTIIHERVEKCLEVNEKGAGECDVCG  213



>emb|CBJ30308.1| sirohydrochlorin ferrochelatase, putative chloroplast precursor 
[Ectocarpus siliculosus]
Length=215

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E    ++  + + IVE AHMELAEPSI++AF+ CV  GA+++++ PFFL PGRH   DIP
Sbjct  107  EVAERYRSFSGFEIVEAAHMELAEPSIEEAFDRCVAAGAQKVVLHPFFLSPGRHVTSDIP  166

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
            +L   AAK HPG+ ++++ PLG+ EL+  V++  +   ++
Sbjct  167  ALMVAAAKRHPGVGWVVSEPLGLQELMPRVMHAAVSESVA  206



>ref|XP_005536035.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79749.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=175

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            I+  AHME+AEP++ D F ACV+ GAR I+V P+FL PGRH   DIP++ AEAA  H  +
Sbjct  81   IIHGAHMEMAEPTLDDGFRACVEAGARHIVVVPYFLAPGRHSTTDIPNMAAEAASKHAHV  140

Query  394  PFIITAPLGVHELLVDVINDR  332
             + +TAPLGVHE + +V+ +R
Sbjct  141  TYTVTAPLGVHESIGNVVIER  161



>ref|XP_001698709.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
 gb|EDO99391.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
Length=234

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF A++ + T + +VE AHME+AEP+I  A   C ++GA  ++++P+FL  GRH Q+DIP
Sbjct  112  EFGALYGQLTGHDLVEVAHMEIAEPTIAQAVGRCAERGASTVVIAPYFLSRGRHIQEDIP  171

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHID  305
            +L  EA   HPG+  II  P+G+  L+V +I++R+   L   D
Sbjct  172  ALVREAQAEHPGLKCIIADPIGIDPLMVQLISNRVASALEGGD  214



>ref|XP_005851931.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
 gb|EFN59829.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
Length=158

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF  ++++ T   +VE AHMELAEP+I+ A   C   GARR++V+P+FL  GRH QQDIP
Sbjct  51   EFAELYKKVTGRQVVEVAHMELAEPTIEQAVGRCAAAGARRVVVAPYFLSRGRHVQQDIP  110

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +L A AA  HP +  ++  P+G+  L+  +I  R+
Sbjct  111  ALAAAAAAAHPSVECVVAEPIGIDSLMAQLIESRV  145



>ref|WP_026174408.1| hypothetical protein [Alicyclobacillus pohliae]
Length=131

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EFV   +E  +YPIV+ A +ELAEP I    + C++QGA R+IV P+FL  G H QQD+P
Sbjct  26   EFV---REDGQYPIVQAAFLELAEPDIPTGIDLCIEQGAERVIVVPYFLLTGSHVQQDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL  317
                +AA+ HP IP  +   LG H +L +++ +R+D  L
Sbjct  83   KWVGDAARKHPDIPIRVAESLGYHPILNEIVLERVDALL  121



>ref|WP_019395087.1| hypothetical protein [Bacillus endophyticus]
Length=258

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +F+   +EK   PI E   +ELAEP+I++AF  C++QGA +I+  P  L    H ++DIP
Sbjct  22   QFIERCKEKVNVPIQEACFLELAEPTIEEAFARCIRQGATKIVAVPILLLTAGHAKKDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
             +    A+ HP I  +   P GVH+ LVDV+ DRI    S ID +A    V  G+
Sbjct  82   EILLSLAEAHPEIEVVYGTPFGVHDKLVDVLMDRIREANSMIDKDATVLLVGRGS  136



>ref|XP_005643741.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19197.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=132

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE AHMELAEPSI  A + C  +G R+I+++P+FL  GRH   DIP+L AEA K HP + 
Sbjct  45   VEIAHMELAEPSIGTAVSRCASEGFRKIVIAPYFLSRGRHITSDIPALVAEAQKAHPEVE  104

Query  391  FIITAPLGVHELLVDVINDRIDHCL  317
             +I  P+G+  L+  VI +R+   L
Sbjct  105  CVIAEPIGIDPLMAQVIENRVAGAL  129



>ref|WP_039740278.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
 gb|AJE02421.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
Length=127

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  AM +E T Y IVE +  E   P+I++  +ACV +GA R+++ P+FLF G H Q+D+P
Sbjct  23   EIAAMVKEMTGYEIVEISFREQHLPTIQEGVDACVAKGAERVLLMPYFLFVGAHVQEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               AEA + HP + F +   LGVH  L +V  DRI   ++
Sbjct  83   EEMAEARRRHPNVAFAMGGHLGVHRKLAEVAADRIAEAIA  122



>ref|XP_005711482.1| unnamed protein product [Chondrus crispus]
 emb|CDF41188.1| unnamed protein product [Chondrus crispus]
Length=289

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            M +EK+  P V  AHME+A P+I D    CVQ GA  +IV PFFL PGRH   D+P+L A
Sbjct  197  MIREKSDIP-VYTAHMEIASPTIADGMEQCVQNGAEHVIVVPFFLSPGRHATTDVPNLAA  255

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDR  332
            EAA  +  + F + +P+G H  +VDVI DR
Sbjct  256  EAAAQNRNVSFEVRSPIGTHPGIVDVILDR  285



>ref|XP_007216178.1| hypothetical protein PRUPE_ppa015785mg, partial [Prunus persica]
 gb|EMJ17377.1| hypothetical protein PRUPE_ppa015785mg, partial [Prunus persica]
Length=68

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 23/88 (26%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FV+M +++T YPIVEPAHMELAEPSI  AFN+C                       DIP
Sbjct  4    DFVSMLKDRTGYPIVEPAHMELAEPSIHVAFNSC-----------------------DIP  40

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLV  350
             LTAEAAK HPG+ +I+T PLG+H LLV
Sbjct  41   YLTAEAAKEHPGVSYIVTTPLGLHPLLV  68



>gb|EWM29197.1| Cobalamin (vitamin B12) biosynthesis CbiX [Nannochloropsis gaditana]
Length=257

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  598  FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAE  419
            F+  + Y +VEPAHMEL EPSI  AF  CV++GA  II  PFFL  GRH  +DIP+L  E
Sbjct  143  FKALSGYELVEPAHMELCEPSIATAFGRCVERGATFIICHPFFLSRGRHVAEDIPNLLEE  202

Query  418  AAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSH  311
            AA + PG+ + ++ PLG+   +  ++   ++ C++ 
Sbjct  203  AASIFPGVEWALSQPLGLQADIPRLMQQAVEECIAE  238



>ref|WP_026842098.1| sirohydrochlorin cobaltochelatase [Geobacter bremensis]
Length=127

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  A+ Q  TK+ IVE +  E   P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P
Sbjct  23   EIAALVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               A+A K HPGI  ++   LGVH+ L +V+ +RI   L+
Sbjct  83   EELAQARKRHPGIEMVLGKHLGVHDKLAEVVVERIAETLT  122



>ref|WP_010943630.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens]
 ref|NP_954042.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 ref|YP_006891912.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens KN400]
 gb|AAR36392.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 gb|ADI85755.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens KN400]
Length=127

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  AM +E T + IVE +  E   P I+   +ACV QGA R+++ P+FLF G H Q+D+P
Sbjct  23   EIAAMVKEMTGFEIVEVSFREQHLPDIQQGIDACVAQGAERVLLMPYFLFVGAHVQEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               AEA   +P + F +   LGVH  L +V  DRI   L+
Sbjct  83   EEMAEARTRYPAVEFAMGGHLGVHRKLAEVAADRIAEALA  122



>dbj|GAM09629.1| sirohydrochlorin ferrochelatase [Geobacter sp. OR-1]
Length=128

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  AM ++ T Y IVE ++ E+  P+I+   +ACV QGA RI++ P+FLF G H ++D+P
Sbjct  24   EIAAMVRKMTGYDIVEVSYREMHLPNIQQGIDACVAQGAERILLMPYFLFIGAHVREDLP  83

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               A+A + +P + F +   LGVH  L +V+ +RI   L+
Sbjct  84   EEMAQAQERYPNVEFAMGNHLGVHRKLAEVVVERIAEGLT  123



>gb|KHN23513.1| hypothetical protein glysoja_029802 [Glycine soja]
Length=169

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            F+ +F        VEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFLFPGRHW Q
Sbjct  106  FIFLFFGGGVGVCVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFLFPGRHWSQ  161



>ref|WP_011735221.1| sirohydrochlorin cobaltochelatase [Pelobacter propionicus]
 ref|YP_900977.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Pelobacter 
propionicus DSM 2379]
 gb|ABK98919.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Pelobacter 
propionicus DSM 2379]
Length=127

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            M QE + + IVE +  E+ EPSI+   + CV +GA RI++ P+FLF G H Q D+P    
Sbjct  27   MVQEMSGFDIVEVSFREMHEPSIQQGIDTCVARGAERILLMPYFLFMGAHVQHDLPEEIE  86

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHI  308
            EA K HPG+   +   LG H  L ++ N+RI   L  +
Sbjct  87   EAKKRHPGLVMEMGGHLGAHPKLAEIENERIGEALDRL  124



>gb|KIH76331.1| sirohydrochlorin cobaltochelatase [Geoalkalibacter ferrihydriticus 
DSM 17813]
Length=135

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 65/103 (63%), Gaps = 0/103 (0%)
 Frame = -3

Query  604  AMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLT  425
            AM +E T + IVE +  E   P+I+   +ACV QGA+R+++ P+FLF G H  +D+P+  
Sbjct  26   AMVRECTGFEIVEVSFREQHAPNIQKGIDACVAQGAQRVLLYPYFLFAGAHVLEDLPAEM  85

Query  424  AEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
             EAA+ +PG+   +  PLGVH  L +++ +RI+  ++    +A
Sbjct  86   EEAARRYPGLVMALGEPLGVHAKLGEIVCERIEDAMTRAGWDA  128



>ref|WP_039646717.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
 gb|KIE43341.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
Length=127

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E   M +E T + IVE +  E   P+I+   +ACV QGA R+++ P+FLF G H Q+D+P
Sbjct  23   EIAVMVKEMTGFEIVEVSFREQHLPNIQQGIDACVAQGAERVLLMPYFLFVGAHVQEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               AEA   +P + F +   LGVH  L +V  DRI   L+
Sbjct  83   EEMAEARTRYPAVEFAMGGHLGVHRKLAEVAADRIAEALA  122



>ref|WP_012531975.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis]
 ref|YP_002140335.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis Bem]
 gb|ACH40539.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis Bem]
Length=127

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  A+ Q  TK+ IVE +  E   P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P
Sbjct  23   EIAALVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
                +A K HPGI  ++   LGVH+ L +V+ +RI   L+
Sbjct  83   EELDQARKRHPGIEMVLGKHLGVHDKLAEVVVERIAETLT  122



>ref|WP_004513845.1| sirohydrochlorin cobaltochelatase [Geobacter metallireducens]
 ref|YP_006719439.1| sirohydrochlorin cobaltochelatase [Geobacter metallireducens 
GS-15]
 gb|EHP85526.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
metallireducens RCH3]
 gb|ABB30719.2| sirohydrochlorin cobaltochelatase [Geobacter metallireducens 
GS-15]
Length=127

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  AM +E T Y IVE +  E   P+I++  +ACV +GARR+++ P+FLF G H Q+D+P
Sbjct  23   EIAAMVKEMTGYDIVEVSFREQHLPNIQEGIDACVAKGARRVLLMPYFLFVGAHVQEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
               A+A + +P + F +   LGVH  L +V  +RI   L+
Sbjct  83   EEMAQARERYPKVEFAMGPHLGVHRKLAEVEVERIAEALT  122



>ref|WP_015838817.1| sirohydrochlorin cobaltochelatase [Geobacter sp. M21]
 ref|YP_003023391.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M21]
 gb|ACT19633.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M21]
Length=127

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E  A  Q  TK+ IVE +  E   P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P
Sbjct  23   EIAARVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
                EA + HPGI  ++   LGVH+ L +V+ +RI   L+
Sbjct  83   EELDEAKRRHPGIEMVLGKHLGVHDKLAEVVVERIAETLT  122



>ref|WP_015745553.1| NUDIX hydrolase [Candidatus Methylomirabilis oxyfera]
 ref|YP_003207892.1| NUDIX hydrolase [Candidatus Methylomirabilis oxyfera]
 emb|CBE70093.1| NUDIX hydrolase (modular protein) [Candidatus Methylomirabilis 
oxyfera]
Length=318

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +   +  E+    IV  AHMEL EP+I+  F+ACV  GA  +IV P+FL  G+H    IP
Sbjct  23   KVAGLMGEQFGLRIVHYAHMELGEPTIQQGFDACVADGADEVIVHPYFLSAGKHVAVGIP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
             L  +AA  HPGI + IT PLGVH  + +VI +RI
Sbjct  83   DLVRQAAGRHPGITYRITRPLGVHPKIGEVILERI  117



>ref|WP_033020593.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 gb|KFX32988.1| sirohydrochlorin ferrochelatase [Geobacillus sp. G1w1]
Length=248

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA RIIV P  L    H ++DIP
Sbjct  22   RFVEQCKAAVDIPIQELCFIELAEPDIITGVDRCVAQGATRIIVIPLLLLSAGHAKRDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  +P GVH+ ++D+I DRI  C   +DG +
Sbjct  82   AALELAKQRHPAVEIVCGSPFGVHDAMIDIIIDRISECAPSLDGES  127



>ref|WP_038084991.1| hypothetical protein [Tumebacillus flagellatus]
 gb|KEO84412.1| hypothetical protein EL26_04740 [Tumebacillus flagellatus]
Length=123

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E V   +E+    IVEPA +E   PSI +   ACV+QGA+R+ V PFFL PG H   D+P
Sbjct  23   EMVRRVREQRDGWIVEPAFLEGTSPSIPEGIAACVRQGAKRVAVIPFFLLPGGHVSDDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HPG+ F +  PLG HE +  ++ ++I
Sbjct  83   AFVEAARREHPGVEFRMGRPLGGHERVRQLLWEQI  117



>ref|XP_010678615.1| PREDICTED: uncharacterized protein LOC104894137 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  631  SSV*EDEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPF  473
            S++  ++FV MF+ +T YPIVEPAHMELA+PSIKDAF+ CVQQGA R+I+SPF
Sbjct  72   SNILLNKFVLMFKSRTGYPIVEPAHMELADPSIKDAFDLCVQQGANRVIISPF  124



>ref|WP_015718893.1| sirohydrochlorin cobaltochelatase [Geobacter sp. M18]
 ref|YP_004197300.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M18]
 gb|ADW12024.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M18]
Length=127

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E     ++ T++ IVE +  E   P+I+   +ACV QGA RI++ P+FL+ G H Q+D+P
Sbjct  23   EIAKRVKKMTQFEIVEVSFREQHLPNIQQGVDACVAQGAERILLVPYFLYMGAHVQEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
                EA K +PG+  ++   LGVH+ L +V+ +R+   L+
Sbjct  83   EELEEAKKRYPGVEMVLGKHLGVHDKLAEVVVERVAESLT  122



>ref|WP_031405718.1| sirohydrochlorin ferrochelatase [Geobacillus vulcani]
Length=248

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +E    PI E   +ELAEP I    + CV QGA RIIV P  L    H + DIP
Sbjct  22   RFVERCREAIHIPIQELCFVELAEPDIVTGVDRCVAQGATRIIVIPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + +P +  I+ AP GVHE ++D+I DRI    + +DG +
Sbjct  82   AALDIAKQRYPSVEIILGAPFGVHETMIDIIIDRISEQSAPLDGES  127



>ref|XP_005703681.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
 gb|EME27161.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
Length=178

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
             V  AHMELA+P + +AF  CV+  AR I V PFFLFPGRH   DIP +    +     +
Sbjct  88   FVTFAHMELAKPDLMEAFMRCVENNARSITVCPFFLFPGRHSTVDIPEMAKNCSSQFHNV  147

Query  394  PFIITAPLGVHELLVDVINDR  332
               +  PLGVHE LVD++ +R
Sbjct  148  TCRVVEPLGVHEKLVDIVLER  168



>ref|WP_033024693.1| sirohydrochlorin ferrochelatase [Geobacillus sp. CAMR5420]
 gb|KDE50252.1| sirohydrochlorin ferrochelatase [Geobacillus sp. CAMR5420]
Length=248

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRTIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D+I DRI    + +DG +
Sbjct  82   AALDIARRRHPSVDILCGAPFGVHETMIDIIIDRISEQSAPLDGES  127



>ref|WP_003252999.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 ref|YP_003990645.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y4.1MC1]
 gb|ADP76034.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y4.1MC1]
 gb|EID42917.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidans 
TNO-09.020]
 dbj|GAJ43041.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=248

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV   + K   PI E   +ELA P I    + CVQ+GA RIIV P  L    H + DIP 
Sbjct  23   FVERCKAKIDVPIQELCFIELAVPDIATGIDICVQKGATRIIVLPILLLSAGHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               +AA+ HP +  ++  P GVH+ ++D++ DRI
Sbjct  83   AIRQAARRHPHVDIVLGKPFGVHQTMIDIVADRI  116



>ref|WP_013877513.1| sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius]
 ref|YP_004589395.1| sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius 
C56-YS93]
 gb|AEH49314.1| Sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius 
C56-YS93]
Length=248

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV   + K   PI E   +ELA P I    + CVQ+GA RIIV P  L    H + DIP 
Sbjct  23   FVERCKAKIDVPIQELCFIELAVPDIATGIDICVQKGATRIIVLPILLLSAGHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               +AA+ HP +  ++  P GVH+ ++D++ DRI
Sbjct  83   AIRQAARRHPHVDIVLGKPFGVHQTMIDIVADRI  116



>ref|WP_028396246.1| sirohydrochlorin ferrochelatase [Bacillus sp. FJAT-14578]
Length=252

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV    EK   PI E + +ELAEPSI+  F  CV++GA +I   P  L    H ++DIP 
Sbjct  23   FVETCMEKVSIPIQEVSFLELAEPSIEQGFRRCVERGATKIYAVPVLLLTAVHAKEDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
            + +   K +PG+  +   P GVHE + +++ +RI      ID   D   +  G G
Sbjct  83   ILSTLRKQYPGVDVVYGRPFGVHESITEILYERIMETNVSID--EDSLVLLVGRG  135



>gb|EZP78485.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
stearothermophilus NUB3621]
Length=248

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 0/105 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV   +     PI E   +ELAEP I    N CVQ+GA RI+V P  L    H + DIP 
Sbjct  23   FVERCKANIDVPIQELCFVELAEPDIITGINICVQKGATRIVVLPLLLLSAGHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
               +A + HP +  +   P GVHE ++DV+ DRI      +DG +
Sbjct  83   AIRQAKQRHPHVEIVYGKPFGVHETMIDVVIDRIYEQGVPLDGKS  127



>ref|WP_013146355.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 ref|YP_003252419.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 ref|YP_003672571.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
 ref|YP_004131053.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
 ref|YP_004980946.1| ferrochelatase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|ACX77937.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 gb|ADI27994.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
 gb|ADU92910.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
 gb|AEV17846.1| Ferrochelatase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|EQB96456.1| sirohydrochlorin ferrochelatase [Geobacillus sp. A8]
 gb|ESU72823.1| sirohydrochlorin ferrochelatase [Geobacillus sp. MAS1]
Length=248

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  82   AALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|WP_033005041.1| sirohydrochlorin ferrochelatase [Geobacillus sp. WSUCF1]
Length=248

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRVIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  82   AALDIARRRHPSVDILCGAPFGVHEAMIDIVIDRISEQSAPLDGES  127



>ref|WP_011229916.1| sirohydrochlorin ferrochelatase [Geobacillus kaustophilus]
 ref|YP_146265.1| hypothetical protein GK0412 [Geobacillus kaustophilus HTA426]
 dbj|BAD74697.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
Length=248

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  82   AALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  127



>dbj|GAD14749.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
kaustophilus GBlys]
Length=267

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  41   RFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  100

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  101  AALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  146



>dbj|GAJ60479.1| hypothetical protein B23_3724 [Geobacillus thermoleovorans B23]
Length=263

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  37   RFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  96

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  97   AALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  142



>gb|EPR29416.1| Sirohydrochlorin cobaltochelatase [Geobacillus sp. WSUCF1]
Length=263

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  37   RFVEQCRRVIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  96

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  97   AALDIARRRHPSVDILCGAPFGVHEAMIDIVIDRISEQSAPLDGES  142



>ref|WP_015373928.1| hypothetical protein [Geobacillus sp. GHH01]
 ref|YP_007400744.1| hypothetical protein GHH_c04280 [Geobacillus sp. GHH01]
 gb|AGE20993.1| hypothetical protein GHH_c04280 [Geobacillus sp. GHH01]
Length=248

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRVIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  82   AALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|XP_009040729.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
 gb|EGB04623.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
Length=161

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = -3

Query  604  AMFQEKTKYP--IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            A + E    P  +V PAHMELA PSI++AF+A V QG   ++  PFFL PGRH  +D+P 
Sbjct  33   AAYAESHAKPDWVVAPAHMELASPSIEEAFDALVAQGCDLVVCHPFFLSPGRHATEDVPE  92

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            L   A   HPG+  ++T   G    L+D+++  +
Sbjct  93   LLEAAKAKHPGVRAVMTPITGAAPGLLDLVDATV  126



>ref|WP_025949077.1| sirohydrochlorin ferrochelatase [Geobacillus thermocatenulatus]
Length=248

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
            +    A + HP +  +  AP GVHE ++D++ DRI    + +DG +
Sbjct  82   AALDIARRHHPSVDILCGAPFGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|WP_020469001.1| hypothetical protein [Zavarzinella formosa]
Length=131

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = -3

Query  613  EFVA-MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            EF+A   +E+ +Y  V+PA++EL  P I D    CV+ GA R+I+ P+FL  G H  +D+
Sbjct  32   EFLASRIRERGEYLHVQPAYLELCPPDIIDGGGICVEAGATRVILLPYFLSAGIHVVEDL  91

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDR  332
             +   E  K HPG  F +  PLG H LL D++ +R
Sbjct  92   TAARDELMKRHPGREFTVAEPLGRHPLLTDIMLER  126



>ref|WP_006562971.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Oscillochloris 
trichoides]
 gb|EFO79723.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Oscillochloris 
trichoides DG-6]
Length=281

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F  + Q     P  +P  +ELAEPSI   F+ CV  GA+ I+  P FL PGRH ++D+P 
Sbjct  21   FADLLQTALGVP-TQPCFLELAEPSIGAGFDLCVAAGAQEIVALPLFLGPGRHQKRDVPE  79

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSH  311
            L A A + HP +      P+G H+ LVD + DR    +  
Sbjct  80   LLAAAQREHPHVQVRYGTPVGPHQRLVDALADRASTAMGQ  119


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            M  E+ +Y  VE A+  +  P++      CVQ GARR+IV P+ LF G   + DI +   
Sbjct  153  MLYEQQEYGWVEYAYQLVVAPNVGQGITRCVQLGARRVIVLPYILFTG-FVRDDIVAQAL  211

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCA  275
             A + HP I  ++   L  H  L+D +  R   C++     A  C +C+
Sbjct  212  AAQQQHPQIEVVVAQHLFPHAGLLDAVVQRYQECVA--GAAAMTCDLCS  258



>ref|WP_033009575.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
 gb|KFL16446.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
 gb|KFX32371.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
Length=248

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + C  QGA R+IV P  L    H +QDIP
Sbjct  22   RFVEQCKAAIDIPIQELCFVELAEPDIATGVDRCAAQGATRVIVIPLLLLSAGHAKQDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HP +  +  AP GVH+ ++D+I DRI
Sbjct  82   AALKAAKQRHPSLEIVCGAPFGVHDAMIDIIIDRI  116



>ref|WP_012645135.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii]
 ref|YP_002535507.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
daltonii FRC-32]
 gb|ACM18406.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii FRC-32]
Length=127

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E   M ++ T Y IVE +  E   P+I+   +ACV +GA RI++ P+FL+ G H  +D+P
Sbjct  23   EIAGMVKKMTGYDIVEVSFREQHAPNIQKGIDACVARGAERILLLPYFLYLGAHVLEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
            +   EA + HP +   +   LGVH  L +++ +RI   L+
Sbjct  83   AELEEARQRHPQVEMAMGKHLGVHHKLAEIVVERIAQSLT  122



>ref|WP_002647251.1| cobalamin biosynthesis protein CbiX [Planctomyces maris]
 gb|EDL58513.1| Cobalamin (vitamin B12) biosynthesis CbiX protein [Planctomyces 
maris DSM 8797]
Length=134

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +  AM +E+ ++ +VE A++ELAEP+I +    CVQ GA  + + P+FL  G H Q D+ 
Sbjct  31   KLAAMLRERCEFGVVEYAYLELAEPAIPEGAARCVQAGAAEVFMLPYFLSAGVHVQNDLE  90

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDH  323
                + ++ +P + F + A LG+H L+++++ DR++ 
Sbjct  91   EFRNQFSQAYPEVRFRLCAHLGLHPLMLEIVLDRLNE  127



>ref|WP_013075784.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae]
 ref|YP_003589642.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae 
DSM 2912]
 gb|ADG06498.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae 
DSM 2912]
Length=130

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 2/113 (2%)
 Frame = -3

Query  637  HLSSV*EDEFVAM--FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  464
             L +  ED +  M   +   ++ IVE A +E+  PSI +    C+ QGA R+++ P+FL 
Sbjct  14   QLQTAAEDMYRVMDDLKRSGRWDIVEAAFLEITPPSIPEGIERCINQGAGRVVIVPYFLH  73

Query  463  PGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHID  305
             G+H  +D+P +  EA + HPGI   +   LG    L  ++ +R +  L+ +D
Sbjct  74   LGKHVLRDLPRIIEEAGRRHPGIQIGLGGHLGYDPRLALIVEERAEQALAAMD  126



>ref|WP_004228345.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|EFI68907.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis ZC1]
 gb|EKU41931.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis ZB2]
Length=246

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++   PI E   +ELA P+I +   +C+++GA  I V P  L   +H + DIP 
Sbjct  23   FLQGVQQEVTVPIQEICFLELATPTIAEGIASCIRKGATAIAVMPILLLAAQHAKYDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
              A+A KL+P + F    PLG+HE L+D +  RI   +  +  N++   +  G G
Sbjct  83   EMAKAQKLYPYVKFTYGEPLGIHEQLIDTLQARI---IEKLQPNSNASVLLIGRG  134



>ref|WP_036220089.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 gb|KEK13633.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=246

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +    CV+QGA  I V P  L   +H +QDIP 
Sbjct  23   FLQGVQQEVHVSIQEICFLELATPTIAEGIAKCVRQGATMIAVMPILLLAAQHAKQDIPR  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              AEA KL+P I F    PLG+HE ++D +  RI
Sbjct  83   EIAEAQKLYPHIQFSYGEPLGIHERIIDTLQARI  116



>ref|WP_012546612.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii]
 ref|YP_002248993.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii 
DSM 11347]
 gb|ACI21913.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii 
DSM 11347]
Length=125

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -3

Query  637  HLSSV*EDEFVAMFQ--EKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  464
            +L S+ ED  + + +  E  KY     A+++   PS+ +A   CV++GA+RII+ PFFL 
Sbjct  18   NLDSMVEDLAIVLGKKVEDIKY-----AYLKYGSPSVDEAITKCVEEGAKRIIIHPFFLS  72

Query  463  PGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHI  308
             G H   DIP +     KL+P +  + T PLG  + LV VI D I+  L  I
Sbjct  73   SGSHVSFDIPKIIENIKKLYPQLEVLCTNPLGKSKKLVYVIKDLIEENLERI  124



>ref|WP_008178094.1| hypothetical protein [Bacillus sp. B14905]
 gb|EAZ85251.1| hypothetical protein BB14905_11410 [Bacillus sp. B14905]
Length=246

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +    CV+QGA  I V P  L   +H +QDIP 
Sbjct  23   FLQGVQQEVHVSIQEICFLELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPR  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              AEA KL+P I F    PLG+HE ++D +  RI
Sbjct  83   EIAEAQKLYPHIQFSYGEPLGIHERIIDTLQARI  116



>ref|WP_036119918.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Lysinibacillus]
 gb|KER42336.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|KHK51545.1| sirohydrochlorin ferrochelatase [Lysinibacillus sp. A1]
Length=246

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +    CV+QGA  I V P  L   +H +QDIP 
Sbjct  23   FLKGVQQEVHVSIQEICFLELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPR  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              AEA KL+P I F    PLG+HE ++D +  RI
Sbjct  83   EIAEAQKLYPHIQFSYGEPLGIHERIIDTLQARI  116



>ref|WP_020463526.1| cobalamin biosynthesis protein CbiX [Frankia sp. EAN1pec]
 ref|YP_001510351.1| cobalamin (vitamin B12) biosynthesis protein CbiX [Frankia sp. 
EAN1pec]
 gb|ABW15445.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Frankia sp. 
EAN1pec]
Length=153

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -3

Query  580  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHP  401
            +  VEPA +E+A P I + + A V+ G   I+  PFFLF G H  +DIP   A A   HP
Sbjct  55   WDAVEPAFLEIARPDIAEGYAALVRTGCSEIVAHPFFLFDGNHTSRDIPDALAAAQTDHP  114

Query  400  GIPFIITAPLGVHELLVDVINDRIDHCL  317
            G  + +T PLG+H  +V  +  RI+  L
Sbjct  115  GTSWTVTQPLGLHPGVVRAVQARIEDAL  142



>ref|WP_036145522.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|KGA84556.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
Length=246

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +    CV+QGA  I V P  L   +H +QDIP 
Sbjct  23   FLQGVQQEVHVSIQEICFLELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPR  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              AEA KL+P I F    PLG+HE ++D +  RI
Sbjct  83   EIAEAQKLYPHIQFSYGEPLGIHERIIDTLQARI  116



>ref|WP_018505183.1| hypothetical protein [Frankia sp. BCU110501]
Length=185

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  580  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHP  401
            +  VEPA +E+A P I + + A V+ G   I+  PFFLF G H  +DIP   A A   HP
Sbjct  84   WDAVEPAFLEIARPDIAEGYAALVRTGCSEIVAHPFFLFDGNHTSRDIPDALAAAQADHP  143

Query  400  GIPFIITAPLGVHELLVDVINDRIDHCLSHI  308
            G  + +T PLG+H  +V  +  RI+  L  +
Sbjct  144  GTSWTVTRPLGLHPGVVRAVQARIEDALHQV  174



>ref|WP_027716685.1| sirohydrochlorin cobaltochelatase [Desulfuromonas sp. TF]
Length=135

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            M + +T   IVE A  E   P+I+   +ACV +GA R+++ P+FLF G H  +D+P   A
Sbjct  27   MVKARTGCEIVEVAFREQYAPNIQSGIDACVVRGASRVLLYPYFLFAGAHVLEDLPEEMA  86

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
            +A + +PG+  I+  PL VH  L +++ +RI   LS
Sbjct  87   QAKERYPGLEMILGRPLEVHPKLGEIVCERIWESLS  122



>ref|WP_011936979.1| sirohydrochlorin cobaltochelatase [Geobacter uraniireducens]
 ref|YP_001228823.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
uraniireducens Rf4]
 gb|ABQ24250.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
uraniireducens Rf4]
Length=127

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E   M ++ T Y IVE +  E   P+I+   +ACV +GA RI++ P+FL+ G H  +D+P
Sbjct  23   EIAGMVKQMTGYDIVEVSFREQHAPNIQKGIDACVARGAERILLIPYFLYMGAHVLEDLP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLS  314
            +   EA   +P +   +   LGVH  L +++ DRI   L+
Sbjct  83   AELEEARVRYPRVEMAMGKHLGVHRKLAEIVVDRIAESLT  122



>ref|WP_020958631.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
 ref|YP_008416363.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
 gb|AGT30819.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
Length=248

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +EL EP I    + CV QGA R+IV P  L    H + DIP
Sbjct  22   RFVEQCKAAIDIPIQELCFVELTEPDIVTGVDLCVTQGATRVIVIPLLLLSAGHAKYDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HP +  +  AP GVHE ++D+I DRI
Sbjct  82   AALEAAKRRHPSLEIVCGAPFGVHETMIDIIIDRI  116



>ref|WP_028842031.1| hypothetical protein [Thermodesulfovibrio islandicus]
Length=125

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -3

Query  637  HLSSV*EDEFVAMFQ--EKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  464
            +L S+ ED  + + +  E  KY     A+++   PS+ +A   CV++GA+RII+ PFFL 
Sbjct  18   NLDSMVEDLAIVLGKKVEDIKY-----AYLKYGSPSVDEAITKCVEEGAKRIIIHPFFLS  72

Query  463  PGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHI  308
             G H   DIP +     KL+P +  + T PLG  + LV VI D I+  L  I
Sbjct  73   SGSHVSFDIPKIIENIKKLYPQLEVLSTNPLGKSKKLVYVIKDLIEENLERI  124



>ref|WP_029761480.1| sirohydrochlorin ferrochelatase [Geobacillus thermodenitrificans]
Length=248

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA RIIV P  L    H + DIP
Sbjct  22   RFVEQCKAAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HP +  +   P GVHE ++D+I DRI
Sbjct  82   AALELAKQRHPSLEIVCGTPFGVHESMIDIIIDRI  116



>ref|WP_003352908.1| hypothetical protein [Bacillus smithii]
 gb|EHL79119.1| hypothetical protein HMPREF1015_01417 [Bacillus smithii 7_3_47FAA]
Length=253

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EFV   Q++   PI E A +ELA P+IKDAF  C+++GA  + + P  LF   H + DIP
Sbjct  22   EFVRQVQKEISIPIQEIAFLELARPTIKDAFLRCIEKGADEVYIIPILLFAAGHVKTDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
             +  +    +P +  +   P+GVH+ + +++ +RI      I  +A    V  G+
Sbjct  82   KILLQLQVSYPSVTILYGEPIGVHKSVSEILKNRIKETGVPIKDHAGVLLVARGS  136



>ref|WP_008881209.1| sirohydrochlorin ferrochelatase [Geobacillus sp. G11MC16]
 gb|EDY04929.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. G11MC16]
Length=248

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA RIIV P  L    H + DIP
Sbjct  22   RFVEQCKAAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HP +  +   P GVHE ++D+I DRI
Sbjct  82   AALELAKQRHPSLEIVCGTPFGVHESMIDIIIDRI  116



>ref|WP_011886753.1| sirohydrochlorin ferrochelatase [Geobacillus thermodenitrificans]
 ref|YP_001124511.1| ferrochelatase [Geobacillus thermodenitrificans NG80-2]
 gb|ABO65766.1| Ferrochelatase [Geobacillus thermodenitrificans NG80-2]
Length=248

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
             FV   +     PI E   +ELAEP I    + CV QGA RIIV P  L    H + DIP
Sbjct  22   RFVEQCKAAIDIPIQELCFVELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +    A + HP +  +   P GVHE ++D+I DRI
Sbjct  82   AALELAKQRHPSLEIVCGTPFGVHESMIDIIIDRI  116



>ref|WP_035741568.1| cobalamin biosynthesis protein CbiX, partial [Frankia sp. BMG5.12]
Length=123

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  583  KYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLH  404
            ++  VEPA ++LA P I   + A V  G   II  PFFLF G H  +DIP   A A   H
Sbjct  35   EWDAVEPAFLDLAHPDIAQGYAALVDAGCSEIIAHPFFLFEGNHTARDIPDALAAAQSAH  94

Query  403  PGIPFIITAPLGVHELLVDVINDRIDHCL  317
            PG  + IT PLG+H  +V  +  RI+  L
Sbjct  95   PGTRWTITLPLGLHPGVVHAVRARIEDAL  123



>ref|WP_028409577.1| sirohydrochlorin ferrochelatase [Bacillus sp. 171095_106]
Length=255

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H +QDIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELAAPTIEQGFEACIEQGATRIAIVPLLLLKAAHAKQDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_025116673.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
Length=246

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +    CV+QGA  I V P  L   +H +QDIP 
Sbjct  23   FLQGVQQEVHVSIQEICFLELATPTIAEGITNCVRQGATMIAVMPILLLAAQHAKQDIPR  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               EA KL+P I F    PLG+HE ++D +  RI
Sbjct  83   EIVEAQKLYPHIQFSYGEPLGIHERIIDTLQARI  116



>ref|WP_012749140.1| sirohydrochlorin ferrochelatase [Geobacillus sp. WCH70]
 ref|YP_002948592.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. WCH70]
 gb|ACS23326.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. WCH70]
Length=248

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FV   +     PI E   +ELA P I    + CVQ+GA RI+V P  L    H + DIP
Sbjct  22   DFVEQCKANIDVPIQELCFIELAYPDIVTGIDICVQKGATRIVVLPILLLSAGHAKHDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
                +A + HP +  ++  P GVHE ++D++ DRI
Sbjct  82   EAIRQAKQRHPHLEIVLGKPFGVHETMIDIVVDRI  116



>ref|WP_036581629.1| sirohydrochlorin cobaltochelatase, partial [Paenibacillus darwinianus]
Length=297

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF    +E+ +  ++E   +ELA P I+    ACV QGA R+++ P  LF   H +  IP
Sbjct  22   EFADRVRERAQGVVIETCFLELARPDIQQGIAACVSQGAERVVLVPIILFAAGHAKLHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC-LSHIDGNAD  293
            +    A K +PG+ F    P+G+H+ +VD++  R+    L   DG  D
Sbjct  82   AEIDRAKKRYPGVEFAYGRPIGIHQKVVDILQSRLSEAGLPEGDGERD  129


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +  E+     VE + + + EPS  +    C++ GA++I V P+FLF G   ++ I ++TA
Sbjct  156  LLWEQVPAKWVESSFIGVTEPSFPEGLERCLRLGAKKIYVLPYFLFTGILIKR-IEAMTA  214

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            E A+LHP     +    G H  LV+++ DR+
Sbjct  215  EFAQLHPEARVELAGYFGFHPQLVELLLDRV  245



>gb|EXX87131.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX88821.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX89714.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
Length=305

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF    +E+ +  ++E   +ELA P I+    ACV QGA R+++ P  LF   H +  IP
Sbjct  22   EFADRVRERAQGVVIETCFLELARPDIQQGIAACVSQGAERVVLVPIILFAAGHAKLHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC-LSHIDGNAD  293
            +    A K +PG+ F    P+G+H+ +VD++  R+    L   DG  D
Sbjct  82   AEIDRAKKRYPGVEFAYGRPIGIHQKVVDILQSRLSEAGLPEGDGERD  129


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +  E+     VE + + + EPS  +    C++ GA++I V P+FLF G   ++ I ++TA
Sbjct  156  LLWEQVPAKWVESSFIGVTEPSFPEGLERCLRLGAKKIYVLPYFLFTGILIKR-IEAMTA  214

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA-DECSVC  278
            E A+LHP     +    G H  LV+++ DR+       +G A   C +C
Sbjct  215  EFAQLHPEARVELAGYFGFHPQLVELLLDRVAEA---AEGRAFMNCDMC  260



>ref|WP_016991507.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans]
Length=246

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++   PI E   +ELA PSI +   +C+++GA  I V P  L   +H + DIP 
Sbjct  23   FLQGVQQEVTVPIQEICFLELATPSIAEGIASCIRKGATAIAVMPILLLAAQHAKHDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              A+A +L+P + F    PLG+HE L+D +  RI
Sbjct  83   EMAKAQELYPYVKFTYGEPLGIHERLIDTLQARI  116



>ref|WP_035350149.1| sirohydrochlorin ferrochelatase, partial [Fictibacillus gelatini]
Length=237

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++K   PI E   +ELAEP+I++    C+ QGA +I V P  L    H ++DIP 
Sbjct  23   FINKAKKKMDCPIQEICFLELAEPTIEEGIKRCIHQGATKIAVVPILLLTATHAKEDIPG  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
               +A   +P + F    P GVH  ++DV+ +R+    + ID +A
Sbjct  83   EIEKAMNKYPDVQFSYGRPFGVHSKIIDVLMERVKSQKAKIDDDA  127



>ref|WP_026894565.1| hypothetical protein [Clostridiisalibacter paucivorans]
Length=121

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  616  DEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            ++ V M +E   Y +V  AHME++EP+I       V+ G + I+V P+FL+ G H ++DI
Sbjct  22   EKVVDMVKEMASYEMVAGAHMEISEPNIPMVVGGLVENGIKNILVVPYFLYEGIHIKEDI  81

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDR  332
            P +  E +  +  + F +  P+G   LL D+I  R
Sbjct  82   PEIIGELSDKYKNVTFKMGKPIGAEPLLADIILKR  116



>ref|WP_039237066.1| sirohydrochlorin ferrochelatase [Bacillus thermotolerans]
 gb|KIA67967.1| Sirohydrochlorin ferrochelatase [Bacillus thermotolerans]
 gb|KIG04798.1| Sirohydrochlorin ferrochelatase [Bacillaceae bacterium MTCC 8252]
Length=255

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = -3

Query  598  FQEKTK----YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F E+TK     PI E   +ELAEP+I     +CV+QGA  IIV PF L    H ++DIP 
Sbjct  23   FIEQTKPFVDVPIQETCFLELAEPTIAQGVASCVEQGADEIIVFPFLLLAAGHAKKDIPH  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
               +     P + F    P+GVHE L+D++ +R++     I+ +     V  G+   Q
Sbjct  83   ELKKVKGQFPAVTFYYAQPIGVHEALIDILIERMEETGESIEPDDSVLIVGRGSSDTQ  140



>ref|WP_036078574.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans]
 gb|KGR83547.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans 
JCM 21713 = 10a = NBRC 103108]
Length=246

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++   PI E   +ELA+P+I +   +C+++GA  I V P  L   +H + DIP 
Sbjct  23   FLQGVQQEVTVPIQEICFLELAKPTIAEGIASCIRKGATAIAVMPILLLAAQHAKHDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              A+A +L+P + F    PLG+HE L+D +  RI
Sbjct  83   EMAKAQELYPFVKFTYGEPLGIHERLIDTLQARI  116



>gb|AHN23033.1| sirohydrochlorin ferrochelatase [Lysinibacillus varians]
Length=249

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q+    PI E   +ELAEP+I      C +QGA  I + P  L   +H + DIP 
Sbjct  23   FLQRVQQDIALPIQEICFLELAEPTIAQGIENCFRQGATDIAIMPILLLAAQHAKHDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               +A K +P + F    PLGVHELL+D +  RI
Sbjct  83   EIDKAQKQYPTVHFTYGEPLGVHELLIDTLQKRI  116



>ref|WP_017436092.1| sirohydrochlorin ferrochelatase [Geobacillus caldoxylosilyticus]
 dbj|GAJ40902.1| sirohydrochlorin cobaltochelatase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=248

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV   +     PI E   +EL EP I    + CVQ+GA RIIV P  L    H + DIP 
Sbjct  23   FVEKCKRSIDVPIQELCFLELVEPDIITGIDICVQKGATRIIVLPLLLLSAGHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
               +A + HP +  +   P GVHE ++D++  RI      +DG +
Sbjct  83   ALRQAKQRHPHVEIVCGKPFGVHETMIDIVIARIHEQGVPLDGKS  127



>ref|WP_024364856.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=249

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q+    PI E   +ELAEP+I      C +QGA  I + P  L   +H + DIP 
Sbjct  23   FLQRVQQDIALPIQEICFLELAEPTIAQGIENCFRQGATDIAIMPILLLAAQHAKHDIPK  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               +A K +P + F    PLGVHELL+D +  RI
Sbjct  83   EIDKARKQYPTVHFTYGEPLGVHELLIDTLQKRI  116



>ref|WP_026369597.1| hypothetical protein [bacterium JKG1]
Length=122

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -3

Query  607  VAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSL  428
            V + + +  +PIVE   ME  EPSI  A   CV QGA R+I  P+FL  G+H   D+P L
Sbjct  25   VDIVRARGVFPIVEVGFMECNEPSIPQAIARCVAQGATRVIAVPYFLHTGKHVTDDLPGL  84

Query  427  TAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               A   +P + F++   LG   LL DV+ +R+
Sbjct  85   LEAAQAQYPTVTFLMGDYLGHDPLLADVLAERV  117



>ref|WP_036125151.1| sirohydrochlorin ferrochelatase, partial [Lysinibacillus sphaericus]
Length=236

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++    I E   +ELA P+I +   +C+++GA  I V P  L   +H +QDIP 
Sbjct  13   FLQGVQQEVHVSIQEVCFLELATPTIAEGIESCIRKGATAIAVMPILLLAAQHAKQDIPK  72

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              A+A K +P + F    PLG+HE L+D +  RI
Sbjct  73   EVAKAQKQYPSVKFTYGEPLGIHERLIDSLQARI  106



>gb|KIG09584.1| Sirohydrochlorin ferrochelatase [Bacillaceae bacterium MTCC 10057]
Length=255

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 60/118 (51%), Gaps = 4/118 (3%)
 Frame = -3

Query  598  FQEKTK----YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F E+TK     PI E   +ELAEP+I     +CV+QGA  IIV PF L    H ++DIP 
Sbjct  23   FIEQTKPFVDVPIQETCFLELAEPTIAQGVASCVEQGADEIIVFPFLLLAAGHAKKDIPH  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
               +     P + F    P+GVHE L+D++ +R++     I  +     V  G+   Q
Sbjct  83   ELKKVKGQFPAVTFYYAQPIGVHEALIDILIERMEETGESIGPDDSVLIVGRGSSDTQ  140



>sp|P61817.1|SIRB_BACME RecName: Full=Sirohydrochlorin ferrochelatase [Bacillus megaterium]
 emb|CAD48922.1| ferrochelatase [Bacillus megaterium]
Length=266

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  34   FIERCKKNLDVPIQEVCFLELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  93

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  94   EIQKVYERYPQVEVLYGEPFGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  146



>ref|WP_022628363.1| hypothetical protein [Bacillus marmarensis]
 gb|ERN52984.1| hypothetical protein A33I_13540 [Bacillus marmarensis DSM 21297]
Length=294

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +   +  EK  Y +VEPA M + +P IK+    C++ GA+R+++ P+FLF G   ++ + 
Sbjct  151  KMTRLLWEKLNYKLVEPAFMGVTDPLIKEGVERCIKLGAKRVVILPYFLFTGILIKR-LE  209

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
             +  E  + +PGI F +    G H  L  +I DRI+  L   +  N D C
Sbjct  210  KMVKEFEQEYPGISFNLAGYFGFHSRLQTIIKDRIEEALQGEVKMNCDTC  259


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            ++E  ++E A+P+I+     CV++GA  + V P  L    H +  IP+   EA + +P I
Sbjct  36   LIETCYLEFAKPTIEQGIQTCVEKGASSVFVIPLMLLAAGHSKIHIPAAIDEARERYPQI  95

Query  394  PFIITAPLGVHELLVDVINDRIDHCLSHIDGNAD  293
             F    P G+HE  +++  DR+     ++D NAD
Sbjct  96   QFTYGRPFGIHEETLEICKDRLVEVGENVD-NAD  128



>ref|WP_010041782.1| cobalamin biosynthesis protein CbiX [Gemmata obscuriglobus]
Length=124

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = -3

Query  613  EFVAM-FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDI  437
            EFVA   + + +YP+V+ +++ELAEP I+     CV  GA  +++ P+FL PG H  +D+
Sbjct  25   EFVAASLRARGRYPVVQVSYLELAEPDIETGGAQCVGAGATDVLLLPYFLSPGIHVAEDL  84

Query  436  PSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDR  332
                 + +   P + F +  PLG H LL+DV+  R
Sbjct  85   TEAREKLSARFPWVRFALAEPLGRHPLLIDVLEQR  119



>ref|WP_016765792.1| sirohydrochlorin ferrochelatase [Bacillus megaterium]
 gb|KFN06813.1| cbiX family protein [Bacillus megaterium]
 gb|KGJ85623.1| sirohydrochlorin ferrochelatase [Bacillus megaterium NBRC 15308 
= ATCC 14581]
Length=255

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_034284565.1| sirohydrochlorin ferrochelatase [Bacillus sp. 72]
Length=249

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            I E  ++EL+EPSI +    CVQ+GA  II  PF L    H ++DIP    +AA+ +P +
Sbjct  35   IQEICYLELSEPSIAEGLARCVQKGATEIIAMPFLLLTAGHAKKDIPEELKKAAQHYPNL  94

Query  394  PFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
                  PLGVHE +VDV+ DR+           D C +  G G
Sbjct  95   MIRYGRPLGVHEHIVDVLIDRMKEAAPF---QEDACVLLVGRG  134



>ref|WP_014968621.1| cobalamin (vitamin B12) biosynthesis protein CbiX [Gottschalkia 
acidurici]
 ref|YP_006789334.1| cobalamin (vitamin B12) biosynthesis protein CbiX [ [[Clostridium] 
acidurici 9a]
 gb|AFS79487.1| cobalamin (vitamin B12) biosynthesis protein CbiX [ [[Clostridium] 
acidurici 9a]
Length=123

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -3

Query  607  VAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSL  428
            V   +EK   P VE   MEL+EP I    +    +G R   V P+FLFPG H ++DIP +
Sbjct  24   VEGLKEKLDTPNVEGCFMELSEPYIPRTIDKMYNEGVRDFTVLPYFLFPGIHIKEDIPEI  83

Query  427  TAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              E  + +  I   +  P+G H+ L+D++ +RI
Sbjct  84   LNECKEKYGDISIKLAEPIGYHDSLIDILKERI  116



>ref|WP_029281449.1| hypothetical protein [Bacillus indicus]
 gb|KEZ50032.1| hypothetical protein AZ46_0204805 [Bacillus indicus LMG 22858]
Length=261

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q   +  I E   +ELAEPSI++ F ACV+ GA +I V P  L    H ++DIP 
Sbjct  24   FIRRVQPHIEADIQEICFLELAEPSIEEGFAACVRNGAEKIAVVPLLLLTAAHAKEDIPK  83

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              AEAA L P +      P+GVHE L + +  R+
Sbjct  84   EVAEAASLFPHVEVTYGKPIGVHEKLAESVLKRV  117



>ref|WP_013085292.1| sirohydrochlorin ferrochelatase [Bacillus megaterium]
 ref|YP_003600063.1| sirohydrochlorin ferrochelatase [Bacillus megaterium DSM 319]
 gb|ADF41713.1| sirohydrochlorin ferrochelatase [Bacillus megaterium DSM 319]
Length=255

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELASPAIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_012292364.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 ref|YP_001696343.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus C3-41]
 gb|ACA38213.1| Sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus C3-41]
 gb|EWH30636.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus CBAM5]
Length=246

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++ +  I E   +ELA P+I +    CV+QGA RI + P  L   +H ++DIP 
Sbjct  23   FLQGVQQEVQVSIQEICFLELATPTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPI  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              A+A KL P I F    PLG+HE ++D +  RI
Sbjct  83   EIAKAQKLFPHILFSYGEPLGIHERIIDSLQARI  116



>ref|WP_028412599.1| sirohydrochlorin ferrochelatase [Bacillus sp. 278922_107]
Length=255

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELAYPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_033580478.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
Length=255

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELAYPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>dbj|BAL52372.1| cobalamin (vitamin B12) biosynthesis CbiX protein [uncultured 
planctomycete]
Length=147

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = -3

Query  619  EDEFVAM-FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            E E+VA   QE+     VE A++E+AEP+I      C++ G   +I+ P+FL  GRH ++
Sbjct  28   ELEWVAARLQERLPGFFVEHAYLEIAEPTIAQGIARCLEHGVSSVILVPYFLSAGRHVRE  87

Query  442  DIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSH  311
            D+ S  A+AA  +P   F +   LG H+LLV+++  RI   L +
Sbjct  88   DLESARAQAAHQYPQAKFFLAEALGPHDLLVELMVLRIQEVLKN  131



>ref|WP_010857495.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 gb|EON74343.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus OT4b.31]
Length=240

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q +   PI E   +ELAEP+I +   +C+Q+GA  I + P  L   +H + DIP 
Sbjct  23   FLLRVQREVDVPIQEICFLELAEPTITEGIASCIQRGATAIAIMPILLLAAQHAKYDIPI  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               +A   +P + F    PLGVHELL+D ++ R+
Sbjct  83   EIEKAKIQYPTVRFTYGEPLGVHELLIDTLHARV  116



>gb|ETT46724.1| cobalt-precorrin-3B C(17)-methyltransferase (cobalt-precorrin-3 
methyltransferase) [Paenibacillus sp. FSL R7-269]
Length=980

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +  EKT Y  VE   + +A+PS++D    C+  GAR+IIV P+ LF G   QQ      A
Sbjct  750  LLWEKTGYRSVESCFIAIAKPSLQDGLERCLALGARKIIVLPYLLFTGVLMQQ-FAERVA  808

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            + A  HPG+   I   LG H LLVD++ +RI   L      N D C
Sbjct  809  QFAAGHPGLEVEIGGTLGAHPLLVDMLTERIGETLEGRAFSNCDNC  854


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF  +   +     VE   +ELA PSI      C++ GA  I V P  LF   H + DIP
Sbjct  598  EFTRLLAARKPELKVETCFIELASPSIAGGIARCIEGGAAEIYVVPIILFAAGHSKLDIP  657

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
                EA + +PG+ FI   PLGV +  VD++ +RI
Sbjct  658  MAIDEAKQRYPGVKFIYGRPLGVQDRAVDILLERI  692



>ref|WP_013059579.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
 ref|YP_003565340.1| sirohydrochlorin ferrochelatase [Bacillus megaterium QM B1551]
 gb|ADE71906.1| sirohydrochlorin ferrochelatase [Bacillus megaterium QM B1551]
Length=255

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F AC++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI    +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILVERIKE--TNVDKHEDSMVLLVGRG  135



>ref|WP_036166469.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=246

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q++ +  I E   +ELA P+I +    CV+QGA RI + P  L   +H ++DIP 
Sbjct  23   FLQGVQQEIQVSIQEICFLELATPTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPI  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
              A+A KL P I F    PLG+HE ++D +  RI
Sbjct  83   EIAKAQKLFPHILFSYGEPLGIHERIIDSLQARI  116



>ref|WP_009673137.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Paenibacillus]
 gb|EGL18475.1| sirohydrochlorin cobaltochelatase [Paenibacillus sp. HGF7]
 gb|EPD89711.1| hypothetical protein HMPREF1207_01560 [Paenibacillus sp. HGH0039]
Length=392

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV+   E  +  I+E   +EL +P+I      CV +GA RI V P  LF   H +  IP 
Sbjct  23   FVSRLAETMEQAIIETCFLELEKPTISQGIQTCVNRGATRIAVVPIILFSAGHAKIHIPG  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               EA + +PG+ FI   P+GVHE +VD++  R+
Sbjct  83   AIDEAKERYPGVQFIYGRPIGVHEGVVDIMTARL  116



>ref|WP_011602248.1| cobalamin biosynthesis protein CbiX [Frankia alni]
 ref|YP_711282.1| sirohydrochlorin cobaltochelatase [Frankia alni ACN14a]
 emb|CAJ59686.1| putative Sirohydrochlorin cobaltochelatase [Frankia alni ACN14a]
Length=154

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = -3

Query  580  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHP  401
            +  VE A +E++ P I + ++     G   I+V PFFLF G H ++D+P+   EA   HP
Sbjct  55   WGAVEAAFLEVSRPDIGEGYDTLADAGCTEIVVYPFFLFGGNHTRRDLPAALEEARGRHP  114

Query  400  GIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNAD  293
               +I++ PLG+H  +V+ +  R+D  L  +   AD
Sbjct  115  TTRWILSEPLGLHTCVVEAVRARLDDTLRALVDAAD  150



>ref|WP_015246709.1| hypothetical protein [Singulisphaera acidiphila]
 ref|YP_007203258.1| hypothetical protein Sinac_3293 [Singulisphaera acidiphila DSM 
18658]
 gb|AGA27563.1| hypothetical protein Sinac_3293 [Singulisphaera acidiphila DSM 
18658]
Length=169

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 64/121 (53%), Gaps = 4/121 (3%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +  A F E+ ++PIVEP  +ELA+P I +    CV QGA R+++ P+FL  G H  +D+ 
Sbjct  28   QLAARFMERGEHPIVEPCFLELADPDILNGGRRCVAQGATRVLMIPYFLSAGVHLLRDLT  87

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            +      + HP + F +   LG   LL  ++ +RI    + +DG  +  +  +     +L
Sbjct  88   AARDALRQAHPTVEFRLGPALGPDPLLEQLVAERI----ARLDGADEAPAFASSDDLAKL  143

Query  253  Y  251
            Y
Sbjct  144  Y  144



>ref|WP_033398315.1| cobalamin biosynthesis protein CbiX, partial [Desulfospira joergensenii]
Length=118

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -3

Query  583  KYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLH  404
            ++  VE A ++  EP +++     VQ+GA++I + PFF+  G H  QD+P    +A K H
Sbjct  34   EFHFVEHAFLQFTEPGLEEVMETLVQRGAKKIFIFPFFIAVGTHVLQDLPECIEKAQKTH  93

Query  403  PGIPFIITAPLGVHELLVDVINDRI  329
            PG+ FIIT  LG  E + DVI + +
Sbjct  94   PGVDFIITRHLGALESIEDVILNEV  118



>ref|WP_033407066.1| cobalamin biosynthesis protein CbiX [Thiothrix disciformis]
Length=121

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  595  QEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEA  416
            Q   ++  VE A +ELAEPSI DA +ACV QGA  I++ P+FL  GRH  +D+P+L  E 
Sbjct  31   QAGERFAKVESAFLELAEPSIPDAIDACVAQGATEIVIVPYFLSAGRHVAEDVPALVKER  90

Query  415  AKLHPGIPFIITAPLG  368
            +  +P + F     LG
Sbjct  91   SLHYPQVRFEYVKHLG  106



>ref|WP_005831998.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri]
 gb|ELK41305.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri BAB-2500]
Length=313

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA    +   PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +   EA +LHP + FI   P+G+HE ++++++ R+
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHEEVINILSTRM  116


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++    L  
Sbjct  154  LFWERYKARWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKRMSDQLE-  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
               + +P   F +    G H LL +V+ DRI+  L   +  N D C
Sbjct  213  RFRQQYPEAQFEMAEYFGFHPLLKEVMKDRIEEALHGEVKLNCDTC  258



>ref|WP_026557944.1| sirohydrochlorin cobaltochelatase [Bacillus sp. NSP2.1]
Length=325

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA    +   PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +   EA +LHP + FI   P+G+HE ++++++ R+
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHEEVINILSTRM  116


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++    L  
Sbjct  154  LFWERYKARWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKRMSDQLE-  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DRI+  L   +  N D C
Sbjct  213  KFRQQYPEAQFEMAEYFGFHPLLKEVMKDRIEEALHGEVKLNCDTC  258



>ref|WP_009740585.1| cobalamin biosynthesis protein CbiX [Frankia sp. QA3]
 gb|EIV94194.1| hypothetical protein FraQA3DRAFT_3936 [Frankia sp. QA3]
Length=153

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = -3

Query  580  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHP  401
            +  VE A +E++ P I + ++     G   I+V PFFLF G H ++D+P+   EA   HP
Sbjct  54   WGAVEAAFLEVSRPDIDEGYDNLADAGCTEIVVYPFFLFGGNHTRRDLPAALEEARGRHP  113

Query  400  GIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNAD  293
               +I++ PLG+H  +++ +  R+D  L  +   AD
Sbjct  114  TTRWILSEPLGLHACVIEAVRARLDDTLRELVDAAD  149



>ref|WP_025752730.1| sirohydrochlorin ferrochelatase [Bacillus flexus]
Length=255

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   ++    PI E   +ELA P+I+  F  C++QGA RI + P  L    H + DIP 
Sbjct  23   FIERCKKNLDVPIQEVCFLELASPTIEQGFEVCIEQGATRIAIVPLLLLTAAHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
               +  + +P +  +   P GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  83   EIHKVYERYPQVEVLYGEPFGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_007785817.1| sirohydrochlorin cobaltochelatase [Brevibacillus sp. CF112]
 gb|EJL40613.1| hypothetical protein PMI08_04335 [Brevibacillus sp. CF112]
Length=333

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA    +   PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +   EA +LHP + FI   P+G+HE ++++++ R+
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHEEVINILSTRM  116


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++    L  
Sbjct  154  LFWERYKARWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKRMSDQLE-  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DRI+  L   +  N D C
Sbjct  213  KFRQQYPEAQFEMAEYFGFHPLLKEVMKDRIEEALHGEVKLNCDTC  258



>ref|WP_025847508.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri]
Length=331

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA    +   PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
            +   EA +LHP + FI   P+G+HE ++++++ R+
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHEEVINILSTRM  116


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++    L  
Sbjct  154  LFWERYKARWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKRMSDQLE-  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DRI+  L   +  N D C
Sbjct  213  KFRQQYPEAQFEMAEYFGFHPLLKEVMKDRIEEALHGEVKLNCDTC  258



>ref|WP_033025433.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. CAMR5420]
 gb|KDE48664.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. CAMR5420]
Length=276

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRIIV P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIIVLPYFLFTGILIKRLEQQVAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR+   L      A  C VC
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVLDRLQEVLDQT--VAMNCDVC  259


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE + +E   PSI +    CV+ GA  + V P  L P  H +  IP+   EA K +P I 
Sbjct  37   VETSFLEFGRPSISEGIARCVEAGAAEVAVIPLILLPAGHSKLHIPAEIDEAKKRYPHIM  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_012684974.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis]
 ref|YP_002770727.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis NBRC 
100599]
 dbj|BAH42223.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis NBRC 
100599]
Length=312

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA        PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC-LSHIDGNADECSVCAGTG  266
            +   EA +LHP + FI   P+G+H+ +++++  R++    +  + N D   +  G G
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHDEVINILTARMEEAGFASGEDNDDLAVLVIGRG  138


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++ +     
Sbjct  154  LFWERYKAKWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKR-MSDQLE  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DR+   L   +  N D C
Sbjct  213  KFREQYPEAEFEMAEYFGFHPLLKEVLKDRVVEALHGEVKLNCDTC  258



>ref|WP_013523816.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 ref|YP_003253687.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 ref|YP_004132321.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
 gb|ACX79205.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 gb|ADU94178.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
Length=275

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRI+V P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIVVLPYFLFTGILIKRLEQQVAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR++  L      A  C +C
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVLDRLNEVLGQT--VAMNCDIC  259


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            +E + +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P + 
Sbjct  37   IETSFLEFGRPSISEGIERCAEAGAMEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHMV  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_016741767.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis]
Length=319

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA        PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVARGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC-LSHIDGNADECSVCAGTG  266
            +   EA +LHP + FI   P+G+H+ +++++  R++    +  + N D   +  G G
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHDEVINILTARMEEAGFASGEDNDDLAVLVIGRG  138


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++ +     
Sbjct  154  LFWERYKAKWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKR-MSDQLE  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DR+   L   +  N D C
Sbjct  213  KFREQYPEAQFEMAEYFGFHPLLKEVLKDRVVEALHGEVKLNCDTC  258



>ref|WP_033010025.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
 gb|KFL16096.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
 gb|KFX32067.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
Length=274

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (56%), Gaps = 3/108 (3%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+T Y ++EPA M +  PS+ DA   C+  GA+RI+V P+FLF G   ++  P + A
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGAKRIVVLPYFLFTGVLIKRLEPQV-A  213

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            +    HP + F +   +G H  L+D++ DR+   L      A  C VC
Sbjct  214  QYRLDHPHVSFALADYVGFHPKLIDIVLDRLQEVLDQT--VAMNCDVC  259


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE + +E   PSI +    CV+ GA  + V P  L P  H +  IP+   EA   +P I 
Sbjct  37   VETSFLEFGRPSISEGIARCVEAGAAEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHIM  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>dbj|BAO45352.1| cobalamin biosynthesis protein CbiX [gamma proteobacterium Hiromi1]
Length=130

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPG-  398
            +V    +ELAEPSI +    CV+ GA R++V P+FL  GRH  +DIP+   EA +LHP  
Sbjct  38   LVRAGFLELAEPSIPEGIGQCVEAGADRVVVLPYFLSAGRHVSEDIPAEVEEARRLHPKA  97

Query  397  ----IPFIITAPLGVHELLVDV  344
                 P++ +AP GV  LLV++
Sbjct  98   SIVLAPYLGSAP-GVSRLLVEL  118



>ref|WP_028400402.1| sirohydrochlorin ferrochelatase [Bacillus panaciterrae]
Length=252

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV    EK   PI E   +ELAEPSI + F ACV++GA  I V P  L    H ++DIP 
Sbjct  23   FVTQCMEKVDAPIQEVCFLELAEPSIAEGFAACVEKGATHIAVVPVLLLTAVHAKEDIPQ  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDH  323
                  + +P I      PLGVHE ++ ++ +RI  
Sbjct  83   ELQAVQREYPHIAVTYGQPLGVHEQIIPILLERIKQ  118



>ref|WP_033020763.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. G1w1]
 gb|KFX32851.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. G1w1]
Length=277

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y +VEPA M +  PS+ DA + C+  GA+RI++ P+FLF G   +  ++ +  
Sbjct  155  LFWEQTDYSLVEPAFMGVTTPSLDDAVHRCLALGAKRIVILPYFLFTGVLIKRLERQVAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  + F +    G H  L D++ DR++  L      A  C VC
Sbjct  215  YQAE----HSHLSFALAGYFGFHPKLADIVLDRLEEALGQT--AAMNCDVC  259


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (47%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE   +E   PSI +    C   GA  + V P  L P  H +  IP+   EA   +P I 
Sbjct  37   VETCFLEFGRPSIGEGIERCAAAGATDVAVIPLILLPAGHSKLHIPAEIDEAKARYPHIT  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+G+HE    ++ DR+
Sbjct  97   FRYGRPIGIHEQTFAILRDRL  117



>ref|WP_008909193.1| Sirohydrochlorin cobaltochelatase [Caloramator australicus]
 emb|CCJ33935.1| Sirohydrochlorin cobaltochelatase [Caloramator australicus RC3]
Length=122

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            V PA ME  EP+IK A +   +QG +RII  P+FL+ G H ++DIP+L  E A  +  + 
Sbjct  35   VFPAFMEFNEPNIKKAIDEIYKQGIKRIIAIPYFLYTGIHIKEDIPNLLKEVANKYKDLT  94

Query  391  FIITAPLGVHELLVDVINDRID  326
               T+P+  H  +++++ +R +
Sbjct  95   IEFTSPIEYHPFILEILKERFN  116



>ref|WP_018393061.1| hypothetical protein [Bacillus sp. 37MA]
Length=249

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            I E  ++EL++PSI +    CVQ+GA  +I  PF L    H ++DIP    +AA+ +P +
Sbjct  35   IQEICYLELSDPSIAEGLARCVQKGATEVIAMPFLLLTAGHAKKDIPEELKKAAQHYPNL  94

Query  394  PFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
                  PLGVHE +VDV+ DR+           D C +  G G
Sbjct  95   MIRYGRPLGVHEHIVDVLIDRMKEAAPF---QEDACVLLVGRG  134



>ref|WP_011887477.1| sirohydrochlorin cobaltochelatase [Geobacillus thermodenitrificans]
 ref|YP_001125802.1| Cbi protein [Geobacillus thermodenitrificans NG80-2]
 gb|ABO67057.1| Cbi protein [Geobacillus thermodenitrificans NG80-2]
Length=275

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRI+V P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIVVLPYFLFTGILIKRLEQQMAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR++  L      A  C +C
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVFDRLNEVLGQT--VAMNCDIC  259


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            +E + +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P + 
Sbjct  37   IETSFLEFGRPSIGEGIERCAEAGAMEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHMV  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_029565580.1| hypothetical protein [Bacillus cibi]
 gb|KEZ54190.1| hypothetical protein GS18_0204495 [Bacillus cibi]
Length=261

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   Q   +  I E   +ELAEPSI++ F ACV++GA +I V P  L    H ++DIP 
Sbjct  24   FIRRVQPHIEADIQEICFLELAEPSIEEGFAACVRKGAGKIAVVPLLLLTAAHAKEDIPK  83

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRI  329
               EAA L P +      P+GVHE L + +  R+
Sbjct  84   EVKEAASLFPHVEVTYGKPIGVHEKLAESVLKRV  117



>ref|WP_013120430.1| cobalamin biosynthesis protein CbiX [Thermincola potens]
 ref|YP_003640316.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Thermincola 
potens JR]
 gb|ADG82415.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Thermincola 
potens JR]
Length=121

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -3

Query  574  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGI  395
            IVE A ++  +P + +A    + +GAR++I+ P FL+ G H Q+DIP++ AE    +PG+
Sbjct  36   IVEIASLQFNKPDLPEAIQTVIAKGARKVIIIPLFLYNGIHMQEDIPAVIAEQKDKNPGV  95

Query  394  PFIITAPLGVHELLVDVINDRIDHC  320
              ++   LG  + +V V+ DRI   
Sbjct  96   EIVLAKNLGADDRIVGVLLDRIKEV  120



>ref|WP_027410743.1| sirohydrochlorin ferrochelatase [Anoxybacillus tepidamans]
Length=248

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            FV   +     PI E   +ELA+P +      CVQQGA RI+V P  L    H + DIP 
Sbjct  23   FVERCKSSIDCPIQEICFIELADPDMMTGIERCVQQGATRIVVIPVLLLAAGHAKHDIPE  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDH  323
               +A + +P +  ++  P GVHE +V +I +RI  
Sbjct  83   AIQKALQRYPYLNIVLEQPFGVHEKMVQIIGERISE  118



>ref|WP_008880154.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 ref|YP_004982508.1| Cobalamin (Vitamin B12) biosynthesis CbiX protein [Geobacillus 
thermoleovorans CCB_US3_UF5]
 gb|EDY06196.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. G11MC16]
 gb|AEV19408.1| Cobalamin (Vitamin B12) biosynthesis CbiX protein [Geobacillus 
thermoleovorans CCB_US3_UF5]
 gb|EQB94495.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. A8]
 dbj|GAJ58833.1| hypothetical protein B23_2046 [Geobacillus thermoleovorans B23]
Length=275

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRI+V P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIVVLPYFLFTGILIKRLEQQMAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR++  L      A  C +C
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVLDRLNEVLGQT--VAMNCDIC  259


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            +E + +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P + 
Sbjct  37   IETSFLEFGRPSIGEGIERCAEAGAMEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHMV  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_015374903.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 ref|YP_007402117.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. GHH01]
 gb|AGE22366.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. GHH01]
 dbj|GAD13548.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
kaustophilus GBlys]
Length=276

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRI+V P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIVVLPYFLFTGILIKRLEQQMAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR++  L      A  C +C
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVLDRLNEVLGQT--VAMNCDIC  259


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            +E + +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P + 
Sbjct  37   IETSFLEFGRPSIGEGIERCAEAGAMEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHMV  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_023634354.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. MAS1]
 gb|ESU71191.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. MAS1]
Length=275

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y ++EPA M +  PS+ DA   C+  GARRI+V P+FLF G   +  +Q +  
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGARRIVVLPYFLFTGILIKRLEQQMAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  I F +    G H  L +++ DR++  L      A  C +C
Sbjct  215  YQAE----HSHISFALAGYFGFHPKLEEIVLDRLNEVLGQT--VAMNCDIC  259


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            +E + +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P + 
Sbjct  37   IETSFLEFGRPSIGEGIERCAEAGAMEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHMM  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_025908099.1| sirohydrochlorin ferrochelatase [Bacillus flexus]
Length=255

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EF+   + K   PI E   +ELAEP+I+  F  CV+QGA RI + P  L    H + DIP
Sbjct  22   EFIERSKSKIDVPIQEVCFLELAEPTIEQGFKRCVEQGATRIAIVPILLLTAGHAKVDIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNA  296
                +  + +P I  +   P GV   +VD++ +RI    + I  +A
Sbjct  82   EEINKVYQHYPHIKVVYGTPFGVDNQIVDILIERIKETEATIKKDA  127



>ref|WP_033843838.1| sirohydrochlorin cobaltochelatase [Geobacillus subterraneus]
Length=279

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPG---RHWQQDIPS  431
            +F E+T Y +VEPA M +  PS+ DA + C+  GA+RI++ P+FLF G   +  ++ +  
Sbjct  155  LFWEQTDYSLVEPAFMGVTTPSLDDAVHRCLALGAKRIVILPYFLFTGVLIKRLERQVAQ  214

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
              AE    H  + F + +  G H  L D++ DR++  L      A  C VC
Sbjct  215  YQAE----HSHLSFALASYFGFHPKLADIVLDRLEEALGQT--VAMNCDVC  259


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE   +E   PSI +    C + GA  + V P  L P  H +  IP+   EA   +P I 
Sbjct  37   VETCFLEFGRPSIGEGIERCAEAGATDVAVIPLILLPAGHSKLHIPAEIDEAKGRYPHIT  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+G+HE    ++ DR+
Sbjct  97   FRYGRPIGIHEQTFAILRDRL  117



>ref|WP_025853113.1| sirohydrochlorin cobaltochelatase [Paenibacillus ehimensis]
Length=344

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (50%), Gaps = 1/117 (1%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            EFV   + +   PIVE   +E   PSI      CV +GA RI V P  LF   H +  IP
Sbjct  22   EFVRAVEGRLGEPIVETCFLEFEAPSISKGIATCVAKGATRIAVVPITLFAAGHAKLHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC-LSHIDGNADECSVCAGTG  266
            +   +A + +P + F+   P+GVHEL +D++  R+    +  + G  D   +  G G
Sbjct  82   AAIDDARRRYPAVQFMYGRPIGVHELALDILISRLTEAGVDGLAGTDDTALLVIGRG  138



>ref|WP_033005389.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. WSUCF1]
Length=274

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 3/108 (3%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+T Y ++EPA M +  PS+ DA   C+  GA+RI+V P+FLF G   ++ +    A
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGAKRIVVLPYFLFTGVLIKR-LERQVA  213

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            +    HP + F +   +G H  L+D++ DR+   L      A  C VC
Sbjct  214  QYRLDHPHVSFALADYVGFHPKLIDIVLDRLQEVLDQT--VAMNCDVC  259


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE + +E   PSI +    CV+ GA  + V P  L P  H +  IP+   EA   +P I 
Sbjct  37   VETSFLEFGRPSISEGIARCVEAGAAEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHIM  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_034124136.1| cobalamin biosynthesis protein CbiX [Desulfotomaculum sp. BIC-A1/1_c7]
Length=121

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            E + M + K+ Y  V  A ++  +P +  A    V  G  RIIV+P FL+ G H ++DIP
Sbjct  23   ELLEMIKIKSNYDFVTGAALQFNQPDLPAALAETVSAGMERIIVAPIFLYMGLHMKEDIP  82

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL  317
             +  E  K +PG+   +T  +G    L +++ DRI   +
Sbjct  83   EILEEERKKYPGVEIAMTRNIGADNKLAEIVMDRIGEVV  121



>ref|WP_027319687.1| cobalamin biosynthesis protein CbiX [Bacillus sp. URHB0009]
Length=241

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  610  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPS  431
            F+   +E+   PI E + +EL EPSI++ F AC ++GA  I V P FL    H + DIP 
Sbjct  23   FIERVKERIDAPIQELSFLELTEPSIEEGFRACAEKGATEITVVPLFLLAAGHIKSDIPQ  82

Query  430  LTAEAAKLHPGIPFIITAPLGVHELLVD  347
              A     +P I   I+ P G+ +L++D
Sbjct  83   ALAPLMNENPSIKVTISDPFGLQDLMLD  110



>ref|WP_013145274.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. C56-T3]
 ref|YP_003671311.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
 gb|ADI26734.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
Length=274

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 3/108 (3%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+T Y ++EPA M +  PS+ DA   C+  GA+RI+V P+FLF G   ++ +    A
Sbjct  155  LFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGAKRIVVLPYFLFTGVLIKR-LERQVA  213

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            +    HP + F +   +G H  L+D++ DR+   L      A  C VC
Sbjct  214  QYRLDHPHVSFALADYVGFHPKLIDIVLDRLQEVLDQT--VAMNCDVC  259


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = -3

Query  571  VEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIP  392
            VE + +E   PSI +    CV+ GA  + V P  L P  H +  IP+   EA   +P I 
Sbjct  37   VETSFLEFGRPSISEGIERCVEAGAAEVAVIPLILLPAGHSKLHIPAEIDEAKARYPHIM  96

Query  391  FIITAPLGVHELLVDVINDRI  329
            F    P+GVHE    ++ +R+
Sbjct  97   FRYGRPIGVHEQTFAILRERL  117



>ref|WP_007715908.1| sirohydrochlorin cobaltochelatase [Brevibacillus sp. BC25]
 gb|EJL32729.1| hypothetical protein PMI05_00121 [Brevibacillus sp. BC25]
Length=313

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = -3

Query  613  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIP  434
            +FVA        PI+E   +E A P +    N CV +GA R+ V P  LF   H +  IP
Sbjct  22   QFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVAKGATRVAVIPIILFSAGHAKIHIP  81

Query  433  SLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRID  326
            +   EA +LHP + FI   P+G+H+ +++++  R++
Sbjct  82   AAIDEAKELHPHVQFIYGRPIGIHDEVINILTARME  117


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = -3

Query  601  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTA  422
            +F E+ K   VE A M +  P   +    C++ GA+RI++ P+FLF G   ++ +     
Sbjct  154  LFWERYKAKWVETAFMGVTYPLYDEGVERCLKLGAKRIVLLPYFLFTGVLIKR-MSDQLE  212

Query  421  EAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCL-SHIDGNADEC  287
            +  + +P   F +    G H LL +V+ DR+   L   +  N D C
Sbjct  213  KFREQYPEAQFEMAEYFGFHPLLKEVLKDRVVEALHGEVKLNCDTC  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2205876588188