BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25294_g1_i15 len=1149 path=[3267:0-214 3482:215-324 5742:325-330
3598:331-420 5816:421-424 3690:425-513 5522:514-516 3782:517-549
6045:550-550 6046:551-551 3815:552-552 3816:553-634 105:635-739
6172:740-747 6180:748-750 6183:751-763 6196:764-770 6203:771-782
40:783-827 6237:828-841 6251:842-846 4097:847-883 6279:884-884
4133:885-890 488:891-1148]

Length=1149
                                                                      Score     E

ref|XP_009631034.1|  PREDICTED: uncharacterized protein LOC104120867    184   3e-60   
ref|XP_004232317.1|  PREDICTED: uncharacterized protein LOC101257032    187   6e-59   
ref|XP_011098440.1|  PREDICTED: uncharacterized protein LOC105177...    186   5e-58   
ref|XP_011098442.1|  PREDICTED: uncharacterized protein LOC105177...    185   5e-58   
ref|XP_011098441.1|  PREDICTED: uncharacterized protein LOC105177...    185   6e-58   
ref|XP_009785949.1|  PREDICTED: uncharacterized protein LOC104234139    181   1e-56   
emb|CDP02082.1|  unnamed protein product                                184   2e-56   
ref|XP_002524661.1|  sirohydrochlorin ferrochelatase, putative          183   2e-56   Ricinus communis
ref|XP_006338587.1|  PREDICTED: uncharacterized protein LOC102599852    182   3e-56   
ref|XP_010251141.1|  PREDICTED: uncharacterized protein LOC104593...    185   1e-55   
gb|KDP45322.1|  hypothetical protein JCGZ_09571                         177   9e-54   
ref|XP_008357734.1|  PREDICTED: uncharacterized protein LOC103421473    172   3e-53   
ref|XP_002273543.1|  PREDICTED: uncharacterized protein LOC100244073    172   4e-53   Vitis vinifera
ref|XP_009377185.1|  PREDICTED: uncharacterized protein LOC103965821    174   1e-52   
ref|XP_010251142.1|  PREDICTED: uncharacterized protein LOC104593...    184   1e-52   
gb|KHN27452.1|  Sirohydrochlorin ferrochelatase                         175   1e-52   
ref|XP_003524552.1|  PREDICTED: uncharacterized protein LOC100500...    175   1e-52   
ref|XP_006579772.1|  PREDICTED: uncharacterized protein LOC100500...    174   2e-52   
ref|XP_010093442.1|  Sirohydrochlorin ferrochelatase                    175   9e-52   
gb|KHG13683.1|  Sirohydrochlorin ferrochelatase                         176   3e-51   
ref|XP_009409069.1|  PREDICTED: uncharacterized protein LOC103991...    176   4e-51   
ref|XP_007031548.1|  Sirohydrochlorin ferrochelatase B                  175   5e-51   
ref|XP_008341717.1|  PREDICTED: uncharacterized protein LOC103404567    169   2e-50   
ref|XP_006446562.1|  hypothetical protein CICLE_v10016757mg             179   3e-50   
ref|XP_006829077.1|  hypothetical protein AMTR_s00001p00260270          179   4e-50   
ref|XP_008458790.1|  PREDICTED: uncharacterized protein LOC103498093    178   6e-50   
ref|XP_006470275.1|  PREDICTED: uncharacterized protein LOC102627039    178   7e-50   
ref|XP_008230561.1|  PREDICTED: uncharacterized protein LOC103329819    172   8e-50   
ref|XP_009409070.1|  PREDICTED: uncharacterized protein LOC103991...    176   1e-49   
ref|XP_009409075.1|  PREDICTED: uncharacterized protein LOC103991...    176   1e-49   
ref|XP_009409074.1|  PREDICTED: uncharacterized protein LOC103991...    176   2e-49   
emb|CAN60425.1|  hypothetical protein VITISV_021073                     174   2e-49   Vitis vinifera
gb|KDO55188.1|  hypothetical protein CISIN_1g023828mg                   178   4e-49   
ref|XP_009334112.1|  PREDICTED: uncharacterized protein LOC103926952    158   4e-49   
ref|XP_004142793.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    176   5e-49   
ref|XP_010530522.1|  PREDICTED: uncharacterized protein LOC104807...    176   7e-49   
ref|XP_010033307.1|  PREDICTED: uncharacterized protein LOC104422628    175   1e-48   
ref|XP_004489242.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    174   1e-48   
emb|CBI34882.3|  unnamed protein product                                172   1e-48   
ref|XP_010523580.1|  PREDICTED: uncharacterized protein LOC104801894    175   2e-48   
ref|XP_003618171.1|  Sirohydrochlorin ferrochelatase                    174   2e-48   
ref|XP_003618170.1|  Sirohydrochlorin ferrochelatase                    174   2e-48   
gb|EPS61981.1|  hypothetical protein M569_12814                         171   4e-48   
ref|XP_002299633.2|  hypothetical protein POPTR_0001s17900g             174   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008348192.1|  PREDICTED: uncharacterized protein LOC103411331    171   6e-48   
ref|XP_008783194.1|  PREDICTED: uncharacterized protein LOC103702509    171   6e-48   
gb|AFK44994.1|  unknown                                                 172   1e-47   
ref|XP_002891559.1|  hypothetical protein ARALYDRAFT_314421             173   1e-47   
gb|KFK35946.1|  hypothetical protein AALP_AA4G058800                    172   1e-47   
gb|EEC72956.1|  hypothetical protein OsI_06840                          169   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_011002713.1|  PREDICTED: uncharacterized protein LOC105109...    172   2e-47   
ref|XP_006647189.1|  PREDICTED: uncharacterized protein LOC102709053    170   2e-47   
ref|XP_003574408.1|  PREDICTED: uncharacterized protein LOC100845...    171   3e-47   
ref|XP_010235070.1|  PREDICTED: uncharacterized protein LOC100845...    171   3e-47   
ref|XP_010500571.1|  PREDICTED: uncharacterized protein LOC104777944    172   3e-47   
emb|CDY45053.1|  BnaA08g02220D                                          171   4e-47   
dbj|BAK06991.1|  predicted protein                                      169   4e-47   
ref|XP_007217178.1|  hypothetical protein PRUPE_ppa012658mg             169   4e-47   
ref|XP_010479465.1|  PREDICTED: uncharacterized protein LOC104758...    171   5e-47   
ref|XP_010479466.1|  PREDICTED: uncharacterized protein LOC104758...    171   6e-47   
ref|XP_009381040.1|  PREDICTED: uncharacterized protein LOC103969...    170   6e-47   
ref|XP_010915963.1|  PREDICTED: uncharacterized protein LOC105040...    167   8e-47   
ref|XP_004952284.1|  PREDICTED: uncharacterized protein LOC101756...    170   9e-47   
ref|XP_006393176.1|  hypothetical protein EUTSA_v10011756mg             170   1e-46   
gb|ACG41745.1|  sirohydrochlorin ferrochelatase                         170   1e-46   Zea mays [maize]
gb|AAM67145.1|  unknown                                                 170   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381038.1|  PREDICTED: uncharacterized protein LOC103969...    170   1e-46   
ref|NP_564562.1|  sirohydrochlorin ferrochelatase B                     170   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461867.1|  PREDICTED: uncharacterized protein LOC104742...    170   1e-46   
gb|AAD50047.1|AC007980_12  Hypothetical protein                         170   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ACR35235.1|  unknown                                                 167   2e-46   Zea mays [maize]
ref|XP_010238623.1|  PREDICTED: uncharacterized protein LOC100837...    169   2e-46   
ref|XP_010461868.1|  PREDICTED: uncharacterized protein LOC104742...    169   2e-46   
gb|EMT14170.1|  Sirohydrochlorin ferrochelatase                         165   2e-46   
ref|XP_003578793.1|  PREDICTED: uncharacterized protein LOC100837...    169   2e-46   
dbj|BAD21683.1|  unknown protein                                        169   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915962.1|  PREDICTED: uncharacterized protein LOC105040...    166   3e-46   
gb|ACG31626.1|  sirohydrochlorin ferrochelatase                         168   3e-46   Zea mays [maize]
ref|XP_004291766.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    168   4e-46   
ref|NP_001046609.1|  Os02g0296800                                       165   6e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDY03592.1|  BnaC03g68510D                                          168   6e-46   
ref|XP_002453737.1|  hypothetical protein SORBIDRAFT_04g012200          167   9e-46   Sorghum bicolor [broomcorn]
ref|XP_009107234.1|  PREDICTED: uncharacterized protein LOC103832890    166   3e-45   
ref|NP_001132509.1|  sirohydrochlorin ferrochelatase isoform 1          165   7e-45   Zea mays [maize]
ref|XP_008667254.1|  PREDICTED: sirohydrochlorin ferrochelatase i...    165   2e-44   
ref|XP_004291765.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    162   8e-44   
gb|EMS54863.1|  Sirohydrochlorin ferrochelatase                         158   1e-43   
gb|ABK26418.1|  unknown                                                 161   2e-43   Picea sitchensis
ref|XP_010461882.1|  PREDICTED: uncharacterized protein LOC104742567    156   9e-43   
ref|XP_010670852.1|  PREDICTED: uncharacterized protein LOC104887804    158   4e-42   
ref|XP_003618173.1|  Sirohydrochlorin cobaltochelatase                  149   7e-39   
gb|EMS61947.1|  Sirohydrochlorin ferrochelatase                         145   1e-38   
gb|EMT15526.1|  Sirohydrochlorin ferrochelatase                         144   5e-38   
ref|XP_001765290.1|  predicted protein                                  142   5e-37   
ref|XP_002964135.1|  hypothetical protein SELMODRAFT_37056              139   5e-36   
ref|XP_002993172.1|  hypothetical protein SELMODRAFT_26806              139   6e-36   
ref|XP_006446561.1|  hypothetical protein CICLE_v10016757mg             126   3e-33   
gb|KDO55189.1|  hypothetical protein CISIN_1g023828mg                   125   3e-33   
gb|KDO55190.1|  hypothetical protein CISIN_1g023828mg                   125   5e-33   
ref|XP_011002714.1|  PREDICTED: uncharacterized protein LOC105109...    120   3e-31   
ref|XP_001421596.1|  predicted protein                                  125   9e-31   Ostreococcus lucimarinus CCE9901
ref|XP_003083605.1|  unnamed protein product                            123   4e-30   
ref|XP_007217608.1|  hypothetical protein PRUPE_ppa017033mg             119   2e-29   
ref|XP_004291768.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    114   1e-28   
ref|XP_002506350.1|  predicted protein                                  118   2e-28   Micromonas commoda
ref|XP_010530526.1|  PREDICTED: uncharacterized protein LOC104807...    117   2e-27   
ref|XP_004291767.1|  PREDICTED: sirohydrochlorin ferrochelatase-l...    108   8e-27   
gb|EMT21287.1|  Sirohydrochlorin ferrochelatase                         111   2e-26   
gb|EYU44776.1|  hypothetical protein MIMGU_mgv1a015745mg              80.9    9e-26   
ref|WP_002650018.1|  cbiX protein                                       111   1e-25   
ref|XP_003063280.1|  predicted protein                                  109   4e-25   
ref|XP_010530527.1|  PREDICTED: uncharacterized protein LOC104807...    105   2e-23   
gb|KHN12062.1|  Sirohydrochlorin ferrochelatase                         101   7e-23   
ref|WP_014437036.1|  putative sirohydrochlorin cobaltochelatase       94.4    6e-21   
ref|XP_007151006.1|  hypothetical protein PHAVU_004G0108001g          71.2    8e-20   
gb|KHN23513.1|  hypothetical protein glysoja_029802                   72.0    8e-19   
ref|XP_005536035.1|  hypothetical protein, conserved                  90.1    4e-18   
ref|XP_007508641.1|  predicted protein                                89.0    7e-18   
gb|KDO55191.1|  hypothetical protein CISIN_1g023828mg                 73.6    9e-18   
emb|CBJ30308.1|  sirohydrochlorin ferrochelatase, putative chloro...  86.3    4e-17   
ref|XP_001698709.1|  sirohydrochlorin ferrochelatase, SIRB            79.0    6e-16   Chlamydomonas reinhardtii
ref|XP_005643741.1|  CbiX-domain-containing protein                   80.9    2e-15   
ref|XP_005711482.1|  unnamed protein product                          80.1    7e-15   
ref|WP_026174408.1|  hypothetical protein                             79.0    3e-14   
gb|EWM29197.1|  Cobalamin (vitamin B12) biosynthesis CbiX             73.2    4e-14   
ref|WP_019395087.1|  hypothetical protein                             80.9    4e-14   
ref|WP_015745553.1|  NUDIX hydrolase                                  77.4    6e-14   
ref|XP_005851931.1|  hypothetical protein CHLNCDRAFT_133580           75.9    1e-13   
ref|WP_039740278.1|  sirohydrochlorin cobaltochelatase                76.6    2e-13   
ref|WP_033020593.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    78.2    3e-13   
ref|WP_015718893.1|  sirohydrochlorin cobaltochelatase                75.9    4e-13   
ref|WP_039646717.1|  sirohydrochlorin cobaltochelatase                75.1    7e-13   
ref|WP_010943630.1|  sirohydrochlorin cobaltochelatase                74.3    1e-12   
gb|KIH76331.1|  sirohydrochlorin cobaltochelatase                     74.3    2e-12   
ref|WP_026842098.1|  sirohydrochlorin cobaltochelatase                74.3    2e-12   
ref|WP_011735221.1|  sirohydrochlorin cobaltochelatase                73.2    3e-12   
ref|XP_005703681.1|  sirohydrochlorin cobaltochelatase-like protein   74.3    3e-12   
ref|WP_031405718.1|  sirohydrochlorin ferrochelatase                  74.7    5e-12   
ref|WP_015838817.1|  sirohydrochlorin cobaltochelatase                72.4    6e-12   
gb|EZP78485.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     74.7    6e-12   
ref|WP_033024693.1|  sirohydrochlorin ferrochelatase                  74.3    8e-12   
ref|WP_006562971.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  74.3    1e-11   
ref|WP_004513845.1|  sirohydrochlorin cobaltochelatase                71.6    1e-11   
ref|WP_012531975.1|  sirohydrochlorin cobaltochelatase                71.6    1e-11   
ref|WP_033005041.1|  sirohydrochlorin ferrochelatase                  73.6    1e-11   
gb|EPR29416.1|  Sirohydrochlorin cobaltochelatase                     73.6    2e-11   
ref|WP_015373928.1|  hypothetical protein                             73.2    2e-11   
ref|WP_013146355.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    73.2    2e-11   
ref|WP_011229916.1|  sirohydrochlorin ferrochelatase                  73.2    2e-11   
dbj|GAM09629.1|  sirohydrochlorin ferrochelatase                      70.9    2e-11   
dbj|GAD14749.1|  cobalamin (vitamin B12) biosynthesis CbiX protein    73.2    2e-11   
ref|WP_036220089.1|  sirohydrochlorin ferrochelatase                  72.8    2e-11   
dbj|GAJ60479.1|  hypothetical protein B23_3724                        73.2    2e-11   
ref|WP_036119918.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    72.4    3e-11   
ref|WP_008178094.1|  hypothetical protein                             72.4    3e-11   
ref|WP_036145522.1|  sirohydrochlorin ferrochelatase                  72.4    3e-11   
ref|WP_025949077.1|  sirohydrochlorin ferrochelatase                  72.4    3e-11   
ref|WP_033009575.1|  sirohydrochlorin ferrochelatase                  72.0    4e-11   
ref|WP_013877513.1|  sirohydrochlorin ferrochelatase                  72.0    5e-11   
ref|WP_003252999.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    72.0    5e-11   
ref|WP_012546612.1|  sirohydrochlorin cobaltochelatase                69.7    6e-11   
ref|WP_025116673.1|  sirohydrochlorin ferrochelatase                  71.6    7e-11   
ref|WP_038084991.1|  hypothetical protein                             69.3    8e-11   
ref|WP_029281449.1|  hypothetical protein                             71.6    8e-11   
ref|WP_028842031.1|  hypothetical protein                             69.3    8e-11   
ref|WP_020958631.1|  sirohydrochlorin ferrochelatase                  71.2    8e-11   
ref|WP_034284565.1|  sirohydrochlorin ferrochelatase                  71.2    9e-11   
ref|XP_009040729.1|  hypothetical protein AURANDRAFT_32321            66.2    1e-10   
ref|WP_028409577.1|  sirohydrochlorin ferrochelatase                  71.2    1e-10   
ref|WP_011886753.1|  sirohydrochlorin ferrochelatase                  70.9    1e-10   
ref|WP_029761480.1|  sirohydrochlorin ferrochelatase                  70.9    1e-10   
ref|WP_008881209.1|  sirohydrochlorin ferrochelatase                  70.9    1e-10   
ref|WP_004228345.1|  sirohydrochlorin ferrochelatase                  70.5    1e-10   
ref|WP_036125151.1|  sirohydrochlorin ferrochelatase                  70.5    2e-10   
ref|WP_035741568.1|  cobalamin biosynthesis protein CbiX              66.2    3e-10   
ref|WP_012749140.1|  sirohydrochlorin ferrochelatase                  69.7    3e-10   
dbj|BAO45352.1|  cobalamin biosynthesis protein CbiX                  67.8    3e-10   
sp|P61817.1|SIRB_BACME  RecName: Full=Sirohydrochlorin ferrochela...  69.7    3e-10   Bacillus megaterium
ref|WP_039237066.1|  sirohydrochlorin ferrochelatase                  69.7    3e-10   
ref|WP_028396246.1|  sirohydrochlorin ferrochelatase                  69.7    3e-10   
ref|WP_029565580.1|  hypothetical protein                             69.7    4e-10   
ref|WP_020463526.1|  cobalamin biosynthesis protein CbiX              67.8    5e-10   
ref|WP_018505183.1|  hypothetical protein                             68.2    5e-10   
ref|WP_018393061.1|  hypothetical protein                             68.9    5e-10   
ref|WP_027716685.1|  sirohydrochlorin cobaltochelatase                67.4    5e-10   
ref|WP_016765792.1|  sirohydrochlorin ferrochelatase                  68.9    6e-10   
gb|KIG09584.1|  Sirohydrochlorin ferrochelatase                       68.9    6e-10   
ref|WP_035350149.1|  sirohydrochlorin ferrochelatase                  68.6    6e-10   
ref|WP_016991507.1|  sirohydrochlorin ferrochelatase                  68.6    6e-10   
ref|WP_018567673.1|  cobalamin biosynthesis protein CbiX              69.3    7e-10   
ref|WP_013085292.1|  sirohydrochlorin ferrochelatase                  68.6    7e-10   
ref|WP_033580478.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    68.6    7e-10   
ref|WP_028412599.1|  sirohydrochlorin ferrochelatase                  68.6    7e-10   
ref|XP_010678615.1|  PREDICTED: uncharacterized protein LOC104894137  49.3    8e-10   
ref|WP_013059579.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    68.2    9e-10   
ref|WP_036078574.1|  sirohydrochlorin ferrochelatase                  68.2    1e-09   
ref|WP_017436092.1|  sirohydrochlorin ferrochelatase                  68.2    1e-09   
gb|AHN23033.1|  sirohydrochlorin ferrochelatase                       68.2    1e-09   
ref|WP_024364856.1|  sirohydrochlorin ferrochelatase                  67.8    1e-09   
ref|WP_011602248.1|  cobalamin biosynthesis protein CbiX              66.2    1e-09   
ref|WP_033398315.1|  cobalamin biosynthesis protein CbiX              65.5    1e-09   
ref|WP_012292364.1|  sirohydrochlorin ferrochelatase                  67.4    2e-09   
ref|WP_036166469.1|  sirohydrochlorin ferrochelatase                  67.4    2e-09   
gb|EXX87131.1|  sirohydrochlorin cobaltochelatase                     68.2    2e-09   
ref|WP_036581629.1|  sirohydrochlorin cobaltochelatase                68.2    2e-09   
ref|WP_025752730.1|  sirohydrochlorin ferrochelatase                  67.4    2e-09   
ref|WP_036197389.1|  sirohydrochlorin ferrochelatase                  67.0    2e-09   
ref|WP_012645135.1|  sirohydrochlorin cobaltochelatase                65.1    2e-09   
ref|WP_009740585.1|  cobalamin biosynthesis protein CbiX              65.5    2e-09   
ref|WP_035505420.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    66.6    3e-09   
ref|WP_018393297.1|  MULTISPECIES: hypothetical protein               66.6    3e-09   
ref|WP_013075784.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  64.7    4e-09   
ref|WP_025649473.1|  sirohydrochlorin ferrochelatase                  66.6    4e-09   
ref|WP_007611315.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    66.6    4e-09   
ref|WP_011434989.1|  cobalamin biosynthesis protein CbiX              63.5    4e-09   
ref|WP_024085290.1|  sirohydrochlorin ferrochelatase                  66.6    4e-09   
ref|WP_027410743.1|  sirohydrochlorin ferrochelatase                  66.2    4e-09   
ref|WP_010857495.1|  sirohydrochlorin ferrochelatase                  66.2    4e-09   
ref|WP_038457957.1|  sirohydrochlorin ferrochelatase                  66.6    4e-09   
dbj|BAQ12015.1|  sirohydrochlorin cobaltochelatase                    66.2    5e-09   
ref|WP_036841580.1|  sirohydrochlorin ferrochelatase                  65.9    5e-09   
ref|WP_015417442.1|  sirohydrochlorin ferrochelatase                  66.2    5e-09   
ref|WP_033574587.1|  sirohydrochlorin ferrochelatase                  66.2    5e-09   
ref|WP_013780850.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  63.5    6e-09   
ref|WP_015388252.1|  sirohydrochlorin ferrochelatase                  66.2    6e-09   
ref|WP_017417755.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_003154360.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_007409741.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    65.9    6e-09   
ref|WP_012117524.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_032874854.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_014417735.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    65.9    6e-09   
ref|WP_032871435.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_029973487.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    65.9    6e-09   
ref|WP_020955802.1|  sirohydrochlorin ferrochelatase                  65.9    6e-09   
ref|WP_025851338.1|  sirohydrochlorin ferrochelatase                  65.9    7e-09   
ref|WP_025715977.1|  sirohydrochlorin cobaltochelatase                67.0    7e-09   
ref|WP_033407066.1|  cobalamin biosynthesis protein CbiX              63.9    7e-09   
ref|WP_035661689.1|  hypothetical protein                             66.2    7e-09   
gb|AIU76979.1|  sirohydrochlorin ferrochelatase                       65.9    7e-09   
gb|KGX91813.1|  sirohydrochlorin ferrochelatase                       65.9    7e-09   
ref|WP_011936979.1|  sirohydrochlorin cobaltochelatase                63.5    8e-09   
ref|WP_003349638.1|  sirohydrochlorin ferrochelatase                  65.5    8e-09   
ref|WP_036151054.1|  sirohydrochlorin ferrochelatase                  65.5    8e-09   
ref|WP_002708045.1|  cobalamin biosynthesis protein CbiX              63.5    9e-09   
ref|WP_027140169.1|  cobalamin biosynthesis protein CbiX              60.8    1e-08   
dbj|BAL52372.1|  cobalamin (vitamin B12) biosynthesis CbiX protein    63.5    1e-08   
dbj|GAF66320.1|  hypothetical protein BTS2_3220                       65.1    1e-08   
emb|CEI81445.1|  Sirohydrochlorin ferrochelatase                      65.1    1e-08   
ref|WP_003348076.1|  sirohydrochlorin ferrochelatase                  64.3    1e-08   
ref|WP_020469001.1|  hypothetical protein                             63.2    1e-08   
ref|WP_010897661.1|  hypothetical protein                             65.1    1e-08   
ref|WP_025678200.1|  sirohydrochlorin cobaltochelatase                65.9    1e-08   
gb|AJE52004.1|  sirohydrochlorin cobaltochelatase                     65.9    2e-08   
ref|WP_010303041.1|  sirohydrochlorin ferrochelatase                  64.7    2e-08   
ref|WP_016324845.1|  sirohydrochlorin cobaltochelatase                65.9    2e-08   
ref|WP_013373524.1|  sirohydrochlorin cobaltochelatase                65.9    2e-08   
ref|WP_034624882.1|  hypothetical protein                             65.1    2e-08   
ref|WP_013427378.1|  cobalamin biosynthesis protein CbiX              62.8    2e-08   
ref|WP_025719598.1|  sirohydrochlorin cobaltochelatase                65.5    2e-08   
ref|WP_010788565.1|  Sirohydrochlorin ferrochelatase                  64.7    2e-08   
ref|WP_038502003.1|  sirohydrochlorin ferrochelatase                  64.3    2e-08   
ref|WP_020561351.1|  hypothetical protein                             62.8    2e-08   
ref|WP_039271661.1|  sirohydrochlorin cobaltochelatase                65.5    2e-08   
ref|WP_029518590.1|  sirohydrochlorin cobaltochelatase                65.5    2e-08   
ref|WP_014278563.1|  sirohydrochlorin cobaltochelatase                65.5    2e-08   
ref|WP_009673137.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  65.5    2e-08   
ref|WP_014304986.1|  sirohydrochlorin ferrochelatase                  64.3    2e-08   
ref|WP_016837051.1|  hypothetical protein                             63.9    2e-08   
ref|WP_019240818.1|  hypothetical protein                             63.9    2e-08   
ref|WP_013312415.1|  sirohydrochlorin cobaltochelatase                65.5    2e-08   
ref|WP_003352908.1|  hypothetical protein                             63.9    2e-08   
ref|WP_035729698.1|  MULTISPECIES: cobalamin biosynthesis protein...  62.0    3e-08   
ref|WP_019982889.1|  cobalamin biosynthesis protein CbiX              64.7    3e-08   
ref|WP_015738951.1|  cobalamin biosynthesis protein CbiX              62.0    3e-08   
ref|WP_016936172.1|  sirohydrochlorin ferrochelatase                  63.9    3e-08   
ref|WP_013120430.1|  cobalamin biosynthesis protein CbiX              61.6    3e-08   
ref|WP_014968621.1|  cobalamin (vitamin B12) biosynthesis protein...  61.6    4e-08   
ref|WP_003250807.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  63.9    4e-08   
dbj|GAJ44148.1|  sirohydrochlorin cobaltochelatase                    63.9    4e-08   
ref|WP_035486231.1|  sirohydrochlorin cobaltochelatase                63.5    4e-08   
ref|WP_003351041.1|  sirohydrochlorin ferrochelatase                  63.5    4e-08   
ref|WP_021290226.1|  hypothetical protein                             63.2    5e-08   
ref|WP_030578279.1|  cobalamin biosynthesis protein CbiX              63.9    5e-08   
ref|WP_010347177.1|  sirohydrochlorin cobaltochelatase                64.3    5e-08   
ref|WP_008909193.1|  Sirohydrochlorin cobaltochelatase                61.2    5e-08   
ref|WP_038241655.1|  sirohydrochlorin ferrochelatase                  63.2    5e-08   
gb|ETT46724.1|  cobalt-precorrin-3B C(17)-methyltransferase (coba...  65.1    5e-08   
ref|WP_017000084.1|  hypothetical protein                             63.2    6e-08   
ref|WP_025908099.1|  sirohydrochlorin ferrochelatase                  63.2    6e-08   
ref|WP_010191876.1|  cobalamin biosynthesis protein CbiX              62.8    6e-08   
ref|WP_003329007.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    62.8    7e-08   
ref|WP_026693481.1|  cobalamin biosynthesis protein CbiX              62.8    7e-08   
ref|WP_000648877.1|  cobalamin biosynthesis protein CbiX              62.8    7e-08   
ref|WP_007432845.1|  sirohydrochlorin cobaltochelatase                63.9    7e-08   
ref|WP_026369597.1|  hypothetical protein                             60.8    7e-08   
ref|WP_002647251.1|  cobalamin biosynthesis protein CbiX              60.8    8e-08   
ref|WP_016129008.1|  CbiX protein                                     62.4    8e-08   
gb|KIG06569.1|  Sirohydrochlorin ferrochelatase                       62.4    8e-08   
ref|XP_008353469.1|  PREDICTED: uncharacterized protein LOC103417039  61.6    8e-08   
ref|WP_023990791.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  63.5    8e-08   
ref|WP_039230896.1|  hypothetical protein                             62.4    9e-08   
ref|WP_028400402.1|  sirohydrochlorin ferrochelatase                  62.4    9e-08   
ref|WP_036819381.1|  sirohydrochlorin ferrochelatase                  62.0    9e-08   
ref|WP_026557944.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_037571693.1|  cobalamin biosynthesis protein CbiX              63.2    1e-07   
ref|WP_014813253.1|  cobalamin biosynthesis protein CbiX              60.8    1e-07   
ref|WP_025847508.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_005831998.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_000648878.1|  cobalamin biosynthesis protein CbiX              62.0    1e-07   
ref|WP_007785817.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
gb|ETT77519.1|  cobalt-precorrin-3B C(17)-methyltransferase (coba...  63.9    1e-07   
ref|WP_002168520.1|  cobalamin biosynthesis protein CbiX              61.6    1e-07   
ref|WP_006828641.1|  hypothetical protein                             62.0    1e-07   
ref|WP_025366059.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_030347044.1|  cobalamin biosynthesis protein CbiX              62.8    1e-07   
ref|WP_026697795.1|  hypothetical protein                             62.0    1e-07   
ref|WP_019688872.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_017428597.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  62.8    1e-07   
ref|WP_038599097.1|  sirohydrochlorin cobaltochelatase                63.2    1e-07   
ref|WP_031462386.1|  sirohydrochlorin cobaltochelatase                62.8    1e-07   
ref|WP_019391267.1|  sirohydrochlorin cobaltochelatase                62.4    1e-07   
ref|WP_016822797.1|  sirohydrochlorin cobaltochelatase                62.8    1e-07   
ref|WP_016741767.1|  sirohydrochlorin cobaltochelatase                62.8    1e-07   
ref|WP_012684974.1|  sirohydrochlorin cobaltochelatase                62.4    2e-07   
ref|WP_027319687.1|  cobalamin biosynthesis protein CbiX              61.6    2e-07   
ref|WP_015661374.1|  metal binding protein                            62.4    2e-07   
dbj|GAE24829.1|  sirohydrochlorin ferrochelatase                      60.5    2e-07   
ref|WP_002118828.1|  cobalamin biosynthesis protein CbiX              61.2    2e-07   
ref|WP_020121385.1|  cobalamin biosynthesis protein CbiX              62.0    2e-07   
ref|WP_018907810.1|  uroporphyrin-III C-methyltransferase             63.2    2e-07   
ref|WP_018793867.1|  uroporphyrin-III C-methyltransferase             63.2    2e-07   
ref|WP_018789664.1|  uroporphyrin-III C-methyltransferase             63.2    2e-07   
gb|EEK89711.1|  Cobalamin (Vitamin B12) biosynthesis CbiX protein     60.8    2e-07   
ref|WP_019900583.1|  uroporphyrin-III C-methyltransferase             63.2    2e-07   
ref|WP_028674403.1|  uroporphyrin-III methyltransferase               63.2    2e-07   
ref|WP_019382738.1|  cobalamin biosynthesis protein CbiX              61.2    2e-07   
ref|WP_020608857.1|  uroporphyrin-III C-methyltransferase             63.2    2e-07   
ref|WP_029027250.1|  uroporphyrin-III methyltransferase               63.2    2e-07   
ref|WP_018587221.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_022950286.1|  cobalamin biosynthesis protein CbiX              59.7    2e-07   
gb|EEL82401.1|  Cobalamin (Vitamin B12) biosynthesis CbiX protein     60.8    2e-07   
ref|WP_038840926.1|  uroporphyrin-III methyltransferase               62.8    2e-07   
ref|WP_028677317.1|  uroporphyrin-III methyltransferase               62.8    2e-07   
ref|WP_018584198.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_012182837.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_018806192.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_018794884.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_028309103.1|  hypothetical protein                             55.1    2e-07   
ref|WP_020216145.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_035300781.1|  sirohydrochlorin cobaltochelatase                62.4    2e-07   
ref|WP_029536343.1|  uroporphyrin-III methyltransferase               62.8    2e-07   
ref|WP_019031635.1|  uroporphyrin-III C-methyltransferase             62.8    2e-07   
ref|WP_013352206.1|  sirohydrochlorin ferrochelatase                  61.2    2e-07   
ref|WP_030612435.1|  cobalamin biosynthesis protein CbiX              62.0    2e-07   
ref|WP_012575716.1|  sirohydrochlorin cobaltochelatase                61.6    2e-07   
ref|WP_005959738.1|  MULTISPECIES: cobalamin biosynthesis protein...  59.3    2e-07   
ref|WP_025671924.1|  hypothetical protein                             58.2    2e-07   
gb|EFC85574.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     60.1    2e-07   
ref|WP_035019712.1|  sirohydrochlorin cobaltochelatase                61.6    2e-07   
ref|WP_007715908.1|  sirohydrochlorin cobaltochelatase                62.0    3e-07   
ref|WP_027749757.1|  cobalamin biosynthesis protein CbiX              61.6    3e-07   
ref|WP_026585256.1|  cobalamin biosynthesis protein CbiX              60.8    3e-07   
ref|WP_002193041.1|  cobalamin biosynthesis protein CbiX              60.8    3e-07   
gb|EEL88182.1|  Cobalamin (Vitamin B12) biosynthesis CbiX protein     60.1    3e-07   
ref|WP_031165901.1|  cobalamin biosynthesis protein CbiX              61.6    3e-07   
dbj|GAC90162.1|  sirohydrochlorin cobaltochelatase CbiXL              61.2    3e-07   
ref|WP_034306931.1|  sirohydrochlorin ferrochelatase                  60.8    3e-07   
ref|WP_024121351.1|  sirohydrochlorin ferrochelatase                  60.8    3e-07   
ref|WP_010327903.1|  sirohydrochlorin ferrochelatase                  60.8    3e-07   
ref|WP_026105113.1|  hypothetical protein                             61.2    3e-07   
ref|WP_017247390.1|  sirohydrochlorin cobaltochelatase                61.6    3e-07   
emb|CEG32767.1|  sirohydrochlorin ferrochelatase                      60.8    3e-07   
ref|WP_033730198.1|  cobalamin biosynthesis protein CbiX              60.5    3e-07   
ref|WP_000676491.1|  CbiX domain-containing protein                   60.5    3e-07   
ref|WP_039073917.1|  sirohydrochlorin ferrochelatase                  60.8    3e-07   
ref|WP_014671924.1|  cobalamin biosynthesis protein CbiX              61.6    3e-07   
ref|WP_002064462.1|  cobalamin biosynthesis protein CbiX              60.8    3e-07   
ref|WP_035393038.1|  hypothetical protein                             60.8    3e-07   
ref|WP_030378980.1|  MULTISPECIES: cobalamin biosynthesis protein...  61.6    3e-07   
ref|WP_038477435.1|  hypothetical protein                             60.8    3e-07   
ref|WP_028589800.1|  sirohydrochlorin cobaltochelatase                61.6    3e-07   
ref|WP_037708138.1|  cobalamin biosynthesis protein CbiX              61.6    3e-07   
ref|WP_035950348.1|  cobalamin biosynthesis protein CbiX              59.3    3e-07   
ref|WP_008637213.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    60.5    3e-07   
ref|WP_025680727.1|  sirohydrochlorin cobaltochelatase                62.0    3e-07   
ref|WP_026683035.1|  sirohydrochlorin ferrochelatase                  60.5    3e-07   
ref|WP_035546703.1|  sirohydrochlorin ferrochelatase                  60.8    3e-07   
ref|WP_000676492.1|  CbiX domain-containing protein                   60.5    3e-07   
ref|WP_003221508.1|  sirohydrochlorin ferrochelatase                  60.8    4e-07   
ref|WP_035329920.1|  cobalamin biosynthesis protein CbiX              60.5    4e-07   
gb|KFI04724.1|  sirohydrochlorin ferrochelatase                       60.8    4e-07   
ref|WP_025682314.1|  sirohydrochlorin cobaltochelatase                61.6    4e-07   
ref|WP_015593409.1|  sirohydrochlorin ferrochelatase                  60.5    4e-07   
ref|WP_032100806.1|  sirohydrochlorin cobaltochelatase                60.8    4e-07   
ref|WP_019258361.1|  sirohydrochlorin ferrochelatase                  60.5    4e-07   
ref|WP_007381139.1|  cobalamin biosynthesis protein CbiX              61.2    4e-07   
gb|EJS55126.1|  hypothetical protein ICG_03388                        60.1    4e-07   
ref|WP_000676458.1|  CbiX domain-containing protein                   60.1    4e-07   
ref|WP_010334197.1|  sirohydrochlorin ferrochelatase                  60.5    4e-07   
ref|WP_016201373.1|  sirohydrochlorin ferrochelatase                  60.5    4e-07   
ref|WP_000644380.1|  cobalamin biosynthesis protein CbiX              60.5    4e-07   
ref|WP_010288936.1|  sirohydrochlorin cobaltochelatase                60.8    4e-07   
ref|WP_031535104.1|  sirohydrochlorin ferrochelatase                  60.5    5e-07   
ref|WP_000676457.1|  CbiX domain-containing protein                   60.1    5e-07   
ref|WP_014479753.1|  hypothetical protein                             60.5    5e-07   
ref|WP_000676442.1|  CbiX domain-containing protein                   60.1    5e-07   
ref|WP_018807860.1|  uroporphyrin-III C-methyltransferase             61.6    5e-07   
ref|WP_030318446.1|  cobalamin biosynthesis protein CbiX              60.8    5e-07   
ref|WP_020140775.1|  cobalamin biosynthesis protein CbiX              60.8    5e-07   
ref|WP_003238637.1|  sirohydrochlorin ferrochelatase                  60.5    5e-07   
ref|WP_010632624.1|  ferrochelatase                                   60.1    5e-07   
ref|WP_034124136.1|  cobalamin biosynthesis protein CbiX              58.2    5e-07   
gb|KEZ84179.1|  cobalamin biosynthesis protein CbiX                   60.1    5e-07   
ref|WP_002030685.1|  MULTISPECIES: cobalamin biosynthesis protein...  60.1    5e-07   
ref|WP_002011686.1|  cobalamin biosynthesis protein CbiX              60.1    5e-07   
ref|WP_016092989.1|  CbiX protein                                     60.1    5e-07   
ref|WP_000676482.1|  cobalamin biosynthesis protein CbiX              59.7    6e-07   
ref|WP_000648879.1|  MULTISPECIES: cobalamin biosynthesis protein...  60.1    6e-07   
ref|WP_003395469.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  60.5    6e-07   
gb|EEM54349.1|  Sirohydrochlorin cobaltochelatase                     59.7    6e-07   
ref|WP_009334413.1|  cobalamin biosynthesis protein CbiX              60.1    6e-07   
ref|WP_002085950.1|  cobalamin biosynthesis protein CbiX              59.7    6e-07   
ref|WP_002117497.1|  cobalamin biosynthesis protein CbiX              60.1    6e-07   
ref|WP_024027606.1|  hypothetical protein                             59.7    6e-07   
ref|WP_034409739.1|  cobalamin biosynthesis protein CbiX              58.2    6e-07   
ref|WP_026559411.1|  hypothetical protein                             60.1    6e-07   
ref|WP_011971216.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  58.2    6e-07   
ref|WP_018884068.1|  hypothetical protein                             60.8    6e-07   
ref|WP_029019566.1|  uroporphyrin-III methyltransferase               61.2    6e-07   
ref|WP_038828205.1|  sirohydrochlorin ferrochelatase                  60.1    6e-07   
ref|WP_014663922.1|  sirohydrochlorin ferrochelatase                  60.1    6e-07   
ref|WP_002158650.1|  cobalamin biosynthesis protein CbiX              59.7    7e-07   
ref|WP_023551686.1|  cobalamin biosynthesis protein CbiX              60.5    7e-07   
ref|WP_034103947.1|  cobalamin biosynthesis protein CbiX              58.2    7e-07   
ref|WP_021479317.1|  sirohydrochlorin ferrochelatase                  60.1    7e-07   
ref|WP_025853113.1|  sirohydrochlorin cobaltochelatase                60.8    7e-07   
ref|WP_008097012.1|  colbalt chelase thioredoxin                      50.8    7e-07   
ref|WP_014476769.1|  sirohydrochlorin ferrochelatase                  59.7    7e-07   
ref|WP_014642923.1|  sirohydrochlorin ferrochelatase                  59.7    7e-07   
ref|WP_012860466.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  57.8    7e-07   
gb|EYE89224.1|  cobalamin biosynthesis protein CbiX                   58.2    7e-07   
ref|WP_031142787.1|  cobalamin biosynthesis protein CbiX              60.5    7e-07   
ref|WP_008440036.1|  colbalt chelase thioredoxin                      58.5    7e-07   
ref|WP_030852460.1|  cobalamin biosynthesis protein CbiX              60.5    8e-07   
ref|WP_018736561.1|  uroporphyrin-III C-methyltransferase             61.2    8e-07   
ref|WP_033310890.1|  cobalamin biosynthesis protein CbiX              60.5    8e-07   
ref|WP_030642568.1|  MULTISPECIES: cobalamin biosynthesis protein...  60.5    8e-07   
ref|WP_031111344.1|  cobalamin biosynthesis protein CbiX              60.5    8e-07   
ref|WP_016482666.1|  hypothetical protein                             57.8    8e-07   
ref|WP_012260811.1|  cobalamin biosynthesis protein CbiX              59.3    8e-07   
ref|WP_006638230.1|  sirohydrochlorin ferrochelatase                  59.7    8e-07   
ref|WP_004891937.1|  sirohydrochlorin cobaltochelatase                60.1    8e-07   
ref|WP_036687663.1|  sirohydrochlorin cobaltochelatase                60.5    8e-07   
ref|WP_029097841.1|  sirohydrochlorin cobaltochelatase                60.1    9e-07   
ref|WP_018739780.1|  uroporphyrin-III C-methyltransferase             60.8    9e-07   
ref|WP_007083223.1|  hypothetical protein                             59.3    9e-07   
ref|WP_000648876.1|  cobalamin biosynthesis protein CbiX              59.3    9e-07   
ref|WP_016126843.1|  CbiX protein                                     59.3    9e-07   
ref|WP_013111156.1|  cobalamin biosynthesis protein CbiX              57.8    9e-07   
ref|WP_035487056.1|  hypothetical protein                             58.9    1e-06   
ref|WP_007145131.1|  cobalamin biosynthesis protein CbiX              57.4    1e-06   
ref|WP_026894565.1|  hypothetical protein                             57.4    1e-06   
ref|WP_002149477.1|  cobalamin biosynthesis protein CbiX              59.3    1e-06   
ref|WP_006524556.1|  cobalamin biosynthesis protein CbiX              57.4    1e-06   
ref|WP_024831709.1|  cobalamin biosynthesis protein CbiX [            57.4    1e-06   
ref|WP_010306248.1|  cobalamin biosynthesis protein CbiX              60.1    1e-06   
ref|WP_002135938.1|  cobalamin biosynthesis protein CbiX              59.3    1e-06   
ref|WP_015326928.1|  hypothetical protein                             57.4    1e-06   
ref|WP_000644362.1|  cobalamin biosynthesis protein CbiX              59.3    1e-06   
ref|WP_006893827.1|  membrane protein                                 60.8    1e-06   
ref|WP_027365712.1|  cobalamin biosynthesis protein CbiX              57.4    1e-06   
ref|WP_003989357.1|  cobalamin biosynthesis protein CbiX              60.1    1e-06   
ref|WP_025751692.1|  sirohydrochlorin cobaltochelatase                59.7    1e-06   
ref|WP_000644360.1|  cobalamin biosynthesis protein CbiX              59.3    1e-06   
dbj|BAN68768.1|  cobalamin biosynthesis CbiX protein                  57.4    1e-06   
ref|WP_000644361.1|  cobalamin biosynthesis protein CbiX              59.3    1e-06   
dbj|GAJ39165.1|  sirohydrochlorin cobaltochelatase                    59.7    1e-06   
ref|WP_024716106.1|  sirohydrochlorin ferrochelatase                  59.3    1e-06   
ref|WP_000676486.1|  cobalamin biosynthesis protein CbiX              57.4    1e-06   
ref|WP_013630711.1|  cobalamin biosynthesis protein CbiX              57.4    1e-06   
ref|WP_013986294.1|  sirohydrochlorin cobaltochelatase                59.3    1e-06   
ref|WP_035378336.1|  hypothetical protein                             57.4    1e-06   
ref|WP_028408302.1|  sirohydrochlorin cobaltochelatase                59.7    1e-06   
ref|WP_029317785.1|  sirohydrochlorin ferrochelatase                  59.3    1e-06   
ref|WP_026604006.1|  cobalamin biosynthesis protein CbiX              53.9    1e-06   
ref|WP_030620461.1|  cobalamin biosynthesis protein CbiX              59.7    1e-06   
ref|WP_002141468.1|  cobalamin biosynthesis protein CbiX              58.9    1e-06   
ref|WP_022628363.1|  hypothetical protein                             59.7    1e-06   
ref|WP_022967393.1|  cobalamin biosynthesis protein CbiX              57.0    1e-06   
gb|EEL06487.1|  Cobalamin (Vitamin B12) biosynthesis CbiX protein     58.5    1e-06   
ref|WP_002036044.1|  cobalamin biosynthesis protein CbiX              58.9    1e-06   
ref|WP_006600017.1|  colbalt chelase thioredoxin                      50.1    1e-06   
ref|WP_018706608.1|  hypothetical protein                             58.9    1e-06   
ref|WP_020939231.1|  metal binding protein                            59.7    1e-06   
ref|WP_010037822.1|  cobalamin biosynthesis protein CbiX              59.7    1e-06   
ref|WP_016764368.1|  sirohydrochlorin cobaltochelatase                59.7    1e-06   
ref|WP_039793444.1|  sirohydrochlorin cobaltochelatase                59.7    1e-06   
ref|WP_017560823.1|  cobalamin biosynthesis protein CbiX              58.9    1e-06   
gb|AIQ12236.1|  sirohydrochlorin cobaltochelatase                     60.1    1e-06   
ref|WP_000644354.1|  cobalamin biosynthesis protein CbiX              58.9    1e-06   



>ref|XP_009631034.1| PREDICTED: uncharacterized protein LOC104120867 [Nicotiana tomentosiformis]
Length=206

 Score =   184 bits (467),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAFN CVQ+GARR+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ +IITAP
Sbjct  105  ELAEPSIRDAFNLCVQRGARRVIVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVSYIITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI HCL+HI G ADECSVCAGTGKCQL +
Sbjct  165  LGLHELLVDVVNDRIKHCLNHIAGKADECSVCAGTGKCQLRQ  206


 Score = 76.6 bits (187),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  558
             A+P+FVK+ K PSK+ YL  R C+A  N   R E N I+ GDGVIIVDHGSRRKESNLM
Sbjct  26   SAVPEFVKLHKGPSKSRYLPQRYCMATTN---REELNGIEEGDGVIIVDHGSRRKESNLM  82

Query  557  LRTGRAFYQR  528
            L    A +++
Sbjct  83   LNEFVAMFRQ  92



>ref|XP_004232317.1| PREDICTED: uncharacterized protein LOC101257032 [Solanum lycopersicum]
Length=206

 Score =   187 bits (476),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF+ CVQQGARR+IVSPFFL PGRHW QDIPSLTAEAAK HPG+P++ITAP
Sbjct  105  ELAEPSIRDAFSLCVQQGARRVIVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVPYVITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI+HCLSHI G ADECSVCAGTGKCQL +
Sbjct  165  LGLHELLVDVVNDRINHCLSHIAGKADECSVCAGTGKCQLRQ  206


 Score = 68.9 bits (167),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 5/70 (7%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIAN-GGFRGERNCIKVGDGVIIVDHGSRRKESNLM  558
            A+P+FVK+ K PSK+ YL  R C+A ++  G +G    I+ GDGVIIVDHGSRRKESNLM
Sbjct  27   AVPEFVKLLKGPSKSRYLPQRYCMATSSREGLKG----IEEGDGVIIVDHGSRRKESNLM  82

Query  557  LRTGRAFYQR  528
            L    A ++ 
Sbjct  83   LNGFVAMFRE  92



>ref|XP_011098440.1| PREDICTED: uncharacterized protein LOC105177107 isoform X1 [Sesamum 
indicum]
Length=213

 Score =   186 bits (471),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P++ITAP
Sbjct  112  ELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDIPSLTAEAAKDHPGVPYVITAP  171

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+LY
Sbjct  172  LGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCRLY  212


 Score = 67.8 bits (164),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -2

Query  731  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  31   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  90



>ref|XP_011098442.1| PREDICTED: uncharacterized protein LOC105177107 isoform X3 [Sesamum 
indicum]
Length=208

 Score =   185 bits (470),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P++ITAP
Sbjct  107  ELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDIPSLTAEAAKDHPGVPYVITAP  166

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+LY
Sbjct  167  LGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCRLY  207


 Score = 67.8 bits (164),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -2

Query  731  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  26   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  85



>ref|XP_011098441.1| PREDICTED: uncharacterized protein LOC105177107 isoform X2 [Sesamum 
indicum]
Length=209

 Score =   185 bits (470),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF++CVQQGA+R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P++ITAP
Sbjct  108  ELAEPSIKDAFSSCVQQGAQRVIVSPFFLFPGRHWHQDIPSLTAEAAKDHPGVPYVITAP  167

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI++CLSH+ G  DECSVCAGTGKC+LY
Sbjct  168  LGLHELLVDVVNDRINYCLSHVAGEEDECSVCAGTGKCRLY  208


 Score = 67.8 bits (164),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -2

Query  731  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  27   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  86



>ref|XP_009785949.1| PREDICTED: uncharacterized protein LOC104234139 [Nicotiana sylvestris]
Length=206

 Score =   181 bits (460),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF+ CVQ+GARR+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ ++ITAP
Sbjct  105  ELAEPSIRDAFSLCVQRGARRVIVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVSYVITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI HCL+HI G ADECSVCAGTGKCQL +
Sbjct  165  LGLHELLVDVVNDRIKHCLNHIAGKADECSVCAGTGKCQLRQ  206


 Score = 67.8 bits (164),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  558
             A+P+FV++ K PSK+ YL  R C+A A+   R   N I  GDGVIIVDHGSRR ESNLM
Sbjct  26   SAVPEFVRLHKGPSKSRYLPQRYCMATAS---REGLNGIGEGDGVIIVDHGSRRNESNLM  82

Query  557  LRTGRAFYQR  528
            L    A ++ 
Sbjct  83   LNEFVAMFRE  92



>emb|CDP02082.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   184 bits (466),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK+AF++CVQ+GARRI+VSPFFLFPGRHW QDIPSLTAEAAK HPG+ +++TAP
Sbjct  109  ELAEPSIKNAFSSCVQKGARRIVVSPFFLFPGRHWNQDIPSLTAEAAKEHPGVSYVVTAP  168

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVD++NDRI +CLSH+ G ADECSVCAGTGKC LYE
Sbjct  169  LGLHELLVDILNDRIKYCLSHVAGYADECSVCAGTGKCHLYE  210


 Score = 64.3 bits (155),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  752  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            GR H  A   FVKV + P    Y+  + CLA A GGF      +  GDGVIIVDHGSRRK
Sbjct  22   GRNHGRAASGFVKVPQKPWHRRYVGTQPCLATARGGFSQGLPGVGDGDGVIIVDHGSRRK  81

Query  572  ESNLML  555
            ESNLML
Sbjct  82   ESNLML  87



>ref|XP_002524661.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
 gb|EEF37680.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
Length=210

 Score =   183 bits (464),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF  CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+ +I+TAP
Sbjct  110  ELAEPSIKDAFGLCVQQGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKEHPGVSYIVTAP  169

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI+HCLSH+ G+ADEC+ C GTGKC+LY
Sbjct  170  LGLHELLVDVLNDRIEHCLSHVAGDADECAACVGTGKCKLY  210


 Score = 65.1 bits (157),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = -2

Query  752  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            G +++   P F K    PSKT YL+ R+ L+ AN GF      I   DG+IIVDHGSRRK
Sbjct  25   GASYKWTQPAFAKFPTCPSKTKYLSSRMYLSTANSGFTD--GIIGDEDGLIIVDHGSRRK  82

Query  572  ESNLML  555
            ESNLML
Sbjct  83   ESNLML  88



>ref|XP_006338587.1| PREDICTED: uncharacterized protein LOC102599852 [Solanum tuberosum]
Length=206

 Score =   182 bits (461),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF+ CVQQGARR+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ ++ITAP
Sbjct  105  ELAEPSIRDAFSLCVQQGARRVIVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVSYLITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLV+V+NDRI+HCLSHI G ADECSVCAGTGKC+L +
Sbjct  165  LGLHELLVNVVNDRINHCLSHIAGKADECSVCAGTGKCRLRQ  206


 Score = 65.5 bits (158),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            A+P+FVK+ K PSK+ YL  R  +A ++   R   N I+ GDGVIIVDHGSRRKESNLML
Sbjct  27   AVPEFVKLHKGPSKSRYLPQRYRMAASS---REGLNGIEEGDGVIIVDHGSRRKESNLML  83

Query  554  RTGRAFYQR  528
                A ++ 
Sbjct  84   NEFVAMFRE  92



>ref|XP_010251141.1| PREDICTED: uncharacterized protein LOC104593131 isoform X1 [Nelumbo 
nucifera]
Length=210

 Score =   185 bits (469),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAFN CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPGI +IITAP
Sbjct  109  ELAEPSIKDAFNLCVQQGANRVIVSPFFLFPGRHWYQDIPSLTAEAAKEHPGISYIITAP  168

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HEL+VD++NDRI+HCLSH+ GNA+EC  C GTGKC++Y+
Sbjct  169  LGLHELMVDIMNDRINHCLSHVAGNANECEACTGTGKCRIYD  210


 Score = 60.5 bits (145),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  740  RGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNL  561
            R A P FVK+ +  +K+  L+    L   N GF  E++ +   DGVIIVDHGSRR+ESNL
Sbjct  26   RWASPKFVKLPRISAKSRPLSKTFSLTAENNGFSLEKHGVSDRDGVIIVDHGSRRQESNL  85

Query  560  ML  555
            ML
Sbjct  86   ML  87



>gb|KDP45322.1| hypothetical protein JCGZ_09571 [Jatropha curcas]
Length=210

 Score =   177 bits (450),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF  CVQQGA R+IVSPFFLFPGRHW QDIPSL AEAAK HPG+ +IITAP
Sbjct  110  ELAEPSIKDAFGLCVQQGANRVIVSPFFLFPGRHWHQDIPSLAAEAAKEHPGVSYIITAP  169

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCL H+ G+ADEC+ C GTGKC+LY
Sbjct  170  LGLHELLVDVVNDRIKHCLRHVAGDADECAACVGTGKCKLY  210


 Score = 61.6 bits (148),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P F K+   P KT Y + RLCL   NG      + ++  DG+IIVDHGSRRKESNLML  
Sbjct  31   PKFSKLPGVPCKTKYSSTRLCLRTGNGEITKNAHGVRERDGLIIVDHGSRRKESNLMLNE  90

Query  548  GRAFYQ  531
              A ++
Sbjct  91   FVAMFR  96



>ref|XP_008357734.1| PREDICTED: uncharacterized protein LOC103421473 [Malus domestica]
Length=210

 Score =   172 bits (437),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF++CV+QGA R++VSPFFL PGRHW QDIPSLTAEAAK HPG+ +I+TAP
Sbjct  110  ELAEPSIRDAFSSCVEQGANRVVVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVSYIVTAP  169

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HC+SH+ G+A+EC+VCAG  KCQL+
Sbjct  170  LGLHHLLVDVLNDRINHCISHVAGBAEECAVCAGXNKCQLH  210


 Score = 64.7 bits (156),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            A+ +F  +++ PS++G L  RLC+  A+GGF    + +  GDGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLQRGPSRSGNLIIRLCMGSADGGFGRNPHGVCDGDGVIIVDHGSRRKESNLML  88



>ref|XP_002273543.1| PREDICTED: uncharacterized protein LOC100244073 [Vitis vinifera]
Length=208

 Score =   172 bits (435),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI +AF++CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+ ++ITAP
Sbjct  108  ELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKEHPGVSYVITAP  167

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC++Y
Sbjct  168  LGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCRVY  208


 Score = 65.1 bits (157),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -2

Query  752  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            G   +  +P+FVK+++    + YL  + CLA  NGG   + N +   DGVIIVDHGSRRK
Sbjct  21   GTNPKWVLPNFVKLQRSWKNSRYLPTKGCLAAGNGGLGQQTNGVGDKDGVIIVDHGSRRK  80

Query  572  ESNLML  555
            ESNLML
Sbjct  81   ESNLML  86



>ref|XP_009377185.1| PREDICTED: uncharacterized protein LOC103965821 [Pyrus x bretschneideri]
Length=210

 Score =   174 bits (440),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAFN+CV+QGA R+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ +I+TAP
Sbjct  110  ELAEPSIRDAFNSCVEQGADRVIVSPFFLLPGRHWNQDIPSLTAEAAKEHPGVSYIVTAP  169

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HCLS + G+A+EC+VCAGT KCQL+
Sbjct  170  LGLHPLLVDVMNDRINHCLSRVAGDAEECAVCAGTNKCQLH  210


 Score = 62.0 bits (149),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            A+ +F  +R+ PS++  L+ RLC+   NGGF    + +   DGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLRRGPSRSRNLSLRLCMGSGNGGFGQNPHGVGDKDGVIIVDHGSRRKESNLML  88



>ref|XP_010251142.1| PREDICTED: uncharacterized protein LOC104593131 isoform X2 [Nelumbo 
nucifera]
Length=166

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAFN CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPGI +IITAP
Sbjct  65   ELAEPSIKDAFNLCVQQGANRVIVSPFFLFPGRHWYQDIPSLTAEAAKEHPGISYIITAP  124

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HEL+VD++NDRI+HCLSH+ GNA+EC  C GTGKC++Y+
Sbjct  125  LGLHELMVDIMNDRINHCLSHVAGNANECEACTGTGKCRIYD  166



>gb|KHN27452.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=211

 Score =   175 bits (443),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDIPSL+AEAAK HP + +I+TAP
Sbjct  111  ELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDIPSLSAEAAKEHPDVSYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+LY
Sbjct  171  LGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCRLY  211


 Score = 60.5 bits (145),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 5/66 (8%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  24   GTNPSWVPLKSLNSLCCSSKPRKLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  83

Query  572  ESNLML  555
            ESNLML
Sbjct  84   ESNLML  89



>ref|XP_003524552.1| PREDICTED: uncharacterized protein LOC100500125 isoform X1 [Glycine 
max]
 ref|XP_006579770.1| PREDICTED: uncharacterized protein LOC100500125 isoform X2 [Glycine 
max]
 ref|XP_006579771.1| PREDICTED: uncharacterized protein LOC100500125 isoform X3 [Glycine 
max]
Length=211

 Score =   175 bits (443),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDIPSL+AEAAK HP + +I+TAP
Sbjct  111  ELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDIPSLSAEAAKEHPDVSYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+LY
Sbjct  171  LGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCRLY  211


 Score = 60.5 bits (145),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 5/66 (8%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  24   GTNPSWVPLKSLNSLCCSSKPRNLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  83

Query  572  ESNLML  555
            ESNLML
Sbjct  84   ESNLML  89



>ref|XP_006579772.1| PREDICTED: uncharacterized protein LOC100500125 isoform X4 [Glycine 
max]
 ref|XP_006579773.1| PREDICTED: uncharacterized protein LOC100500125 isoform X5 [Glycine 
max]
Length=206

 Score =   174 bits (441),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF +CV+QGA RIIVSPFFL PGRHW QDIPSL+AEAAK HP + +I+TAP
Sbjct  106  ELAEPSIRDAFQSCVEQGAHRIIVSPFFLSPGRHWTQDIPSLSAEAAKEHPDVSYIVTAP  165

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCL H+ G+ADECSVC+GTGKC+LY
Sbjct  166  LGLHELLVDVVNDRIKHCLKHVAGDADECSVCSGTGKCRLY  206


 Score = 60.5 bits (145),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 5/66 (8%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  573
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  19   GTNPSWVPLKSLNSLCCSSKPRNLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  78

Query  572  ESNLML  555
            ESNLML
Sbjct  79   ESNLML  84



>ref|XP_010093442.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
 gb|EXB54066.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
Length=211

 Score =   175 bits (443),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+++F+ CVQ GA R+IVSPFFLFPGRHW QDIPSLTAEAAK H G+ +IITAP
Sbjct  111  ELAEPSIRNSFDKCVQLGASRVIVSPFFLFPGRHWHQDIPSLTAEAAKEHSGVSYIITAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCLSH+ G+ADEC+VC GTGKC+LY
Sbjct  171  LGLHELLVDVVNDRIKHCLSHVAGDADECAVCVGTGKCRLY  211


 Score = 57.4 bits (137),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  558
            GA+P+F K      ++  L  RLCL   NGGF    + I   D +IIVDHGSRRKESNLM
Sbjct  29   GALPNFSKSLGVCFRSRNLIRRLCLRTENGGFEQIPHGIGEKDAIIIVDHGSRRKESNLM  88

Query  557  LRTGRAFYQR  528
            L      +++
Sbjct  89   LNEFVTMFRQ  98



>gb|KHG13683.1| Sirohydrochlorin ferrochelatase [Gossypium arboreum]
Length=219

 Score =   176 bits (445),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF  CVQ+GA R+IVSPFFLFPGRHW QDIP LTA+AAK HPG+ +IITAP
Sbjct  111  ELAEPSIKDAFGLCVQRGANRVIVSPFFLFPGRHWYQDIPLLTADAAKDHPGVSYIITAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCLSH+ G+ADEC+ CAGT KC+LY
Sbjct  171  LGLHELLVDVMNDRIKHCLSHVAGDADECAACAGTSKCKLY  211


 Score = 55.1 bits (131),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  716  KVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTGRAF  537
            K ++ PS+    + +  L   NGGF+   N +   DGVIIVDHGSRRKESNLML    A 
Sbjct  36   KFQRGPSRIRSFSAKSSLGFENGGFKQVPNGVGEKDGVIIVDHGSRRKESNLMLNEFVAM  95

Query  536  YQR  528
            ++ 
Sbjct  96   FRE  98



>ref|XP_009409069.1| PREDICTED: uncharacterized protein LOC103991368 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   176 bits (447),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDIPSL A+A+K H GI ++ITAP
Sbjct  145  ELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDIPSLVADASKEHSGISYVITAP  204

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC++Y+
Sbjct  205  LGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCRIYQ  246


 Score = 53.5 bits (127),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P+FVK+R+  +K+  L+ +  L++ N       + +   D VIIVDHGSRR+ESNLML  
Sbjct  66   PNFVKLRRIMTKSSPLSAKFGLSLRNEATGRVEHTVGDNDAVIIVDHGSRRQESNLMLNE  125

Query  548  GRAFYQ  531
              A ++
Sbjct  126  FVAMFK  131



>ref|XP_007031548.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
 gb|EOY02474.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
Length=210

 Score =   175 bits (444),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQ+GA R+IVSPFFLFPGRHW QDIPSLT +AAK HPG+ +++TAP
Sbjct  110  ELAEPSIRDAFGLCVQRGANRVIVSPFFLFPGRHWYQDIPSLTTDAAKEHPGVSYMVTAP  169

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCLSH+ G+ADEC+ CAGT KC+LY
Sbjct  170  LGLHELLVDVVNDRIKHCLSHVAGDADECAACAGTSKCKLY  210


 Score = 54.7 bits (130),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = -2

Query  725  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTG  546
            DF +V   P K+   + R  L+  NGG++   N +   DGVIIVDHGSRR+ESNLML   
Sbjct  35   DFQRV---PPKSRNFSARSSLSFENGGYKQFPNGVGAKDGVIIVDHGSRRRESNLMLNEF  91

Query  545  RAFYQ  531
             A ++
Sbjct  92   VAMFR  96



>ref|XP_008341717.1| PREDICTED: uncharacterized protein LOC103404567 [Malus domestica]
Length=247

 Score =   169 bits (428),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI DAFN+CV+QGA R+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ +I+TAP
Sbjct  147  ELXEPSIXDAFNSCVEQGANRVIVSPFFLLPGRHWNQDIPSLTAEAAKEHPGVSYIVTAP  206

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HCLS + G A+ C+VCAGT KCQL+
Sbjct  207  LGLHPLLVDVMNDRINHCLSRVAGEAEXCAVCAGTNKCQLH  247


 Score = 58.9 bits (141),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            A+  F  +++ PS++  L+ RLC+   NGGF      +   DGVIIVDHGSRRKESNLML
Sbjct  66   AVLSFSNLQRGPSRSRNLSFRLCMGSGNGGFGQNPRGVGDKDGVIIVDHGSRRKESNLML  125



>ref|XP_006446562.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59802.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=202

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  101  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWYQDIPSLTAEAAKEHPGVPYIVTAP  160

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+LY
Sbjct  161  LGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTDRCRLY  201



>ref|XP_006829077.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
 gb|ERM96493.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
Length=204

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSIKDAF ACVQQGA RI+VSP+FLFPGRHW+QDIPSL AEAAK HPGIP+++TAP
Sbjct  102  ELATPSIKDAFCACVQQGANRIVVSPYFLFPGRHWKQDIPSLAAEAAKEHPGIPYVVTAP  161

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            LG+HEL+VDV+NDRI HCLSH++GNADEC VCAGTG C+
Sbjct  162  LGLHELMVDVLNDRIKHCLSHVEGNADECDVCAGTGGCR  200



>ref|XP_008458790.1| PREDICTED: uncharacterized protein LOC103498093 [Cucumis melo]
Length=205

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+D+F +CV+QGA+RIIVSPFFLFPGRHWQQDIPSLTAEAAK HPGI +IITAP
Sbjct  105  ELAEPSIRDSFTSCVEQGAKRIIVSPFFLFPGRHWQQDIPSLTAEAAKDHPGISYIITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            LG+HE LVDV+NDRI+HCLSH  G ADEC VCAGTGKC+ 
Sbjct  165  LGLHEKLVDVVNDRINHCLSHAAGVADECEVCAGTGKCRF  204



>ref|XP_006470275.1| PREDICTED: uncharacterized protein LOC102627039 [Citrus sinensis]
Length=210

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  101  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYIVTAP  160

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+LY
Sbjct  161  LGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTNRCRLY  201



>ref|XP_008230561.1| PREDICTED: uncharacterized protein LOC103329819 [Prunus mume]
Length=203

 Score =   172 bits (437),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI  AFN+CV QGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+ +++TAP
Sbjct  103  ELAEPSIHVAFNSCVLQGANRVIVSPFFLFPGRHWNQDIPSLTAEAAKEHPGVSYLVTAP  162

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HCLSHI G+A+ECSVC GT KCQL+
Sbjct  163  LGLHPLLVDVLNDRINHCLSHIAGDAEECSVCVGTNKCQLH  203


 Score = 53.5 bits (127),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  674  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTGRAFYQR  528
            RLC+   NGGF    N +   DGVIIVDHGSRRKESNLML    + ++ 
Sbjct  42   RLCMGSGNGGFGQNPNGVGDRDGVIIVDHGSRRKESNLMLNEFVSMFKE  90



>ref|XP_009409070.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409072.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409073.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDIPSL A+A+K H GI ++ITAP
Sbjct  71   ELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDIPSLVADASKEHSGISYVITAP  130

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC++Y+
Sbjct  131  LGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCRIYQ  172



>ref|XP_009409075.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409076.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409077.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409078.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=161

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDIPSL A+A+K H GI ++ITAP
Sbjct  59   ELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDIPSLVADASKEHSGISYVITAP  118

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC++Y+
Sbjct  119  LGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCRIYQ  160



>ref|XP_009409074.1| PREDICTED: uncharacterized protein LOC103991368 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=172

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQ+GA+R+IVSPFFLFPGRHWQQDIPSL A+A+K H GI ++ITAP
Sbjct  70   ELAEPSIRDAFKLCVQEGAKRVIVSPFFLFPGRHWQQDIPSLVADASKEHSGISYVITAP  129

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI+HCLSH+ G+ADEC+ CAGTGKC++Y+
Sbjct  130  LGLHGLLVDVVNDRINHCLSHVAGDADECTACAGTGKCRIYQ  171



>emb|CAN60425.1| hypothetical protein VITISV_021073 [Vitis vinifera]
Length=150

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI +AFN+CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+ ++ITAP
Sbjct  45   ELAEPSITNAFNSCVQQGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKEHPGVSYVITAP  104

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC++Y+
Sbjct  105  LGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCRVYQ  146



>gb|KDO55188.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=276

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  167  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYIVTAP  226

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HE LVDV+NDRI HCLSH  G+ADEC VCAGT +C+LY
Sbjct  227  LGLHEQLVDVVNDRIKHCLSHAVGDADECVVCAGTDRCRLY  267



>ref|XP_009334112.1| PREDICTED: uncharacterized protein LOC103926952 [Pyrus x bretschneideri]
Length=220

 Score =   158 bits (399),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 10/111 (9%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ----------DIPSLTAEAAKLH  404
            ELAEPSI+DAF++CV+QGA R++VS FFL PGRHW            DIPSLTAEAAK H
Sbjct  110  ELAEPSIRDAFSSCVEQGANRVVVSLFFLSPGRHWNTVAQLTINIDGDIPSLTAEAAKEH  169

Query  403  PGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            PG+  I+TAPLG+H LLVDV+NDRI+HC+SH+ G+A+EC+VCAGT KCQL+
Sbjct  170  PGVSHIVTAPLGLHHLLVDVLNDRINHCISHVAGDAEECAVCAGTNKCQLH  220


 Score = 65.9 bits (159),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            A+ +F  +++ PS+ G L+ RLC   ANGGF    + +  GDGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLQRGPSRNGNLSRRLCRGSANGGFGQNPHGVCDGDGVIIVDHGSRRKESNLML  88



>ref|XP_004142793.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 ref|XP_004156688.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 gb|KGN51370.1| hypothetical protein Csa_5G523150 [Cucumis sativus]
Length=205

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKD+F  CV+QGA+RIIVSPFFLFPGRHWQQDIPSLTAEAAK HPGI +IITAP
Sbjct  105  ELAEPSIKDSFTLCVEQGAKRIIVSPFFLFPGRHWQQDIPSLTAEAAKDHPGISYIITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            LG+HE LVDV+NDRI++CLSH  G +DEC VCAGTGKC+ 
Sbjct  165  LGLHEQLVDVVNDRINYCLSHAAGVSDECEVCAGTGKCRF  204



>ref|XP_010530522.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530523.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530524.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530525.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
Length=227

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHWQQDIPSLTA+ AK  PGI ++ITAP
Sbjct  124  ELAEPSIKDAFSICVQKGAKRVVVSPFFLFPGRHWQQDIPSLTADVAKEFPGIAYLITAP  183

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI HCL H  G+ADEC VCAGTGKC+LY 
Sbjct  184  LGLHNLLVDVVNDRIKHCLGHAQGDADECEVCAGTGKCKLYN  225



>ref|XP_010033307.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 ref|XP_010033308.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 gb|KCW52917.1| hypothetical protein EUGRSUZ_J02232 [Eucalyptus grandis]
Length=222

 Score =   175 bits (444),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF++CV++G  R+IV+PFFLFPGRHW +DIPSLTAEAAK HPG+ +IITAP
Sbjct  122  ELAEPSIKDAFSSCVRRGVTRVIVTPFFLFPGRHWHKDIPSLTAEAAKEHPGVSYIITAP  181

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI HCLSH++G ADEC  C GTGKC++Y
Sbjct  182  LGLHELLVDVVNDRIKHCLSHVEGAADECEACVGTGKCRIY  222


 Score = 47.4 bits (111),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -2

Query  674  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTGRAFYQ  531
            R CL   NGGF      I   DG+IIVDHGSRR+ESNLML    A ++
Sbjct  61   RSCLKPENGGFGPRSFGIGERDGLIIVDHGSRRRESNLMLNEFVAMFR  108



>ref|XP_004489242.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cicer arietinum]
Length=200

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAF +CVQQGARR+I+SPFFL PGRHW QDIPSL+A AAK HPG+ +I+TAP
Sbjct  99   ELAEPSIGDAFQSCVQQGARRVIISPFFLSPGRHWSQDIPSLSAAAAKQHPGVSYIVTAP  158

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI +CL H+ G+ADECSVCAGTGKC L++
Sbjct  159  LGLHELLVDVVNDRITYCLKHVAGDADECSVCAGTGKCILHQ  200



>emb|CBI34882.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI +AF++CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+ ++ITAP
Sbjct  24   ELAEPSITNAFSSCVQQGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKEHPGVSYVITAP  83

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI HCL H+ G+  EC+VCAGTGKC++Y
Sbjct  84   LGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCRVY  124



>ref|XP_010523580.1| PREDICTED: uncharacterized protein LOC104801894 [Tarenaya hassleriana]
Length=227

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R+++SPFFLFPGRHWQQDIPSLT +AAK  PGI ++ITAP
Sbjct  124  ELAEPSIKDAFSICVQKGAKRVVISPFFLFPGRHWQQDIPSLTVDAAKEFPGIAYLITAP  183

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVDV+NDRI HCL H  G+ADEC VCAGTGKC+LY 
Sbjct  184  LGLHNLLVDVVNDRIKHCLGHAQGDADECEVCAGTGKCKLYN  225



>ref|XP_003618171.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=210

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAF +CVQQGA RII+SPFFL PGRHW QDIPSL+AEAAK HPG+ +I+TAP
Sbjct  109  ELAEPSIGDAFQSCVQQGAHRIIISPFFLGPGRHWSQDIPSLSAEAAKQHPGVSYIVTAP  168

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC L++
Sbjct  169  LGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCILHQ  210



>ref|XP_003618170.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
 gb|AES74388.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=200

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAF +CVQQGA RII+SPFFL PGRHW QDIPSL+AEAAK HPG+ +I+TAP
Sbjct  99   ELAEPSIGDAFQSCVQQGAHRIIISPFFLGPGRHWSQDIPSLSAEAAKQHPGVSYIVTAP  158

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC L++
Sbjct  159  LGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCILHQ  200



>gb|EPS61981.1| hypothetical protein M569_12814, partial [Genlisea aurea]
Length=150

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK+AF++CV++GA+ ++VSPFFLFPGRHW +DIPSLTAEAAK HPG+P++ITAP
Sbjct  49   ELAEPSIKNAFDSCVRRGAKCVVVSPFFLFPGRHWHKDIPSLTAEAAKEHPGVPYMITAP  108

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+ DRI +CLSH+ G   ECSVCAGTGKC+LY+
Sbjct  109  LGLHELLVDVVKDRIRYCLSHVAGEEGECSVCAGTGKCRLYD  150



>ref|XP_002299633.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
 gb|EEE84438.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
Length=220

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DIPSLT EAAK HPG+ ++ITAP
Sbjct  120  ELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWHRDIPSLTDEAAKEHPGVSYLITAP  179

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV+NDRI++CLSHI G+A+EC+VC GT KC+LY
Sbjct  180  LGLHELLVDVMNDRINYCLSHIAGDANECAVCVGTSKCKLY  220



>ref|XP_008348192.1| PREDICTED: uncharacterized protein LOC103411331, partial [Malus 
domestica]
Length=161

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF++CV+QGA R++VSPFFL PGRHW QDIPSLTAEAAK HPG+ +I+TAP
Sbjct  61   ELAEPSIRDAFSSCVEQGANRVVVSPFFLSPGRHWNQDIPSLTAEAAKEHPGVSYIVTAP  120

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HC+SH+ GNA+EC+VCAG  KCQL+
Sbjct  121  LGLHHLLVDVLNDRINHCISHVAGNAEECAVCAGANKCQLH  161



>ref|XP_008783194.1| PREDICTED: uncharacterized protein LOC103702509 [Phoenix dactylifera]
Length=205

 Score =   171 bits (433),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+DAF  CV QGA R+IVSPFFL PGRHWQQDIP+L AEA++ H GI +IITAP
Sbjct  105  ELAAPSIRDAFKTCVLQGANRVIVSPFFLSPGRHWQQDIPALAAEASREHSGISYIITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI HCLSH+ G+ADEC+VCAGTGKC+LY
Sbjct  165  LGLHELMVDVMNDRIKHCLSHVAGDADECTVCAGTGKCRLY  205


 Score = 48.5 bits (114),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P F K  +  +K   L+ + CL++ + G     + +   D VIIVDHGSRR+ESN ML  
Sbjct  26   PGFHKFSRITTKGRTLSTKCCLSVRSEGLERFEHLMGDKDAVIIVDHGSRRQESNFMLNE  85

Query  548  GRAFYQ  531
              A ++
Sbjct  86   FVAMFK  91



>gb|AFK44994.1| unknown [Medicago truncatula]
Length=200

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAF +CVQQG  RII+SPFFL PGRHW QDIPSL+AEAAK HPG+ +I+TAP
Sbjct  99   ELAEPSIGDAFQSCVQQGVHRIIISPFFLGPGRHWSQDIPSLSAEAAKQHPGVSYIVTAP  158

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HELLVDV+NDRI++CL H+ G+ADECSVCAGTGKC L++
Sbjct  159  LGLHELLVDVVNDRINYCLKHVAGDADECSVCAGTGKCILHQ  200



>ref|XP_002891559.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67818.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  129  ELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHKDIPSLTADAAKEFSGISYLITAP  188

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY 
Sbjct  189  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLYN  230



>gb|KFK35946.1| hypothetical protein AALP_AA4G058800 [Arabis alpina]
Length=217

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+PSIKDAF+ CVQQGA+R++VSPFFLFPGRHW QDIPSLTA+AAK   GI ++ITAP
Sbjct  114  ELAKPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHQDIPSLTADAAKEFSGISYLITAP  173

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  174  LGPHNLLMDVVNDRIQHCLSHVEGDADECVVCAGTNKCKLY  214



>gb|EEC72956.1| hypothetical protein OsI_06840 [Oryza sativa Indica Group]
 gb|EEE56777.1| hypothetical protein OsJ_06350 [Oryza sativa Japonica Group]
Length=125

 Score =   169 bits (427),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  I +++TAP
Sbjct  24   ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNITYVVTAP  83

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQLY
Sbjct  84   LGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQLY  124



>ref|XP_011002713.1| PREDICTED: uncharacterized protein LOC105109646 isoform X1 [Populus 
euphratica]
Length=220

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DIPSLT EAAK HPG+ ++ITAP
Sbjct  120  ELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWYRDIPSLTDEAAKEHPGVSYLITAP  179

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HELLVDV++DRI++CLSHI G+A+EC+VC GT KC+LY
Sbjct  180  LGLHELLVDVMDDRINYCLSHIAGDANECAVCVGTSKCKLY  220



>ref|XP_006647189.1| PREDICTED: uncharacterized protein LOC102709053 [Oryza brachyantha]
Length=165

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  +P+I+TAP
Sbjct  64   ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNVPYIVTAP  123

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+LY
Sbjct  124  LGLHELMVDIMNDRIKYCLRHVSGDVDECTVCAGTGKCRLY  164



>ref|XP_003574408.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235063.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235064.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235065.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235066.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235067.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235068.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235069.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDIPSL AEA+K H  +P+IITAP
Sbjct  112  ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVPYIITAP  171

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC+LY
Sbjct  172  LGLHELMVDVMNDRIKYCLRHVGGDADECTVCAGTGKCRLY  212



>ref|XP_010235070.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010235072.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDIPSL AEA+K H  +P+IITAP
Sbjct  111  ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVPYIITAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC+LY
Sbjct  171  LGLHELMVDVMNDRIKYCLRHVGGDADECTVCAGTGKCRLY  211



>ref|XP_010500571.1| PREDICTED: uncharacterized protein LOC104777944 [Camelina sativa]
Length=226

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  123  ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDIPSLTADAAKEFSGISYLITAP  182

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  183  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  223



>emb|CDY45053.1| BnaA08g02220D [Brassica napus]
Length=228

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDIP+LTA+AAK  P I ++ITAP
Sbjct  121  ELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDIPALTADAAKEFPSISYLITAP  180

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  181  LGLHNLLIDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  221



>dbj|BAK06991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   169 bits (428),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL AEA+K H  + +I+TAP
Sbjct  111  ELAEPSIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVAYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ G+ADEC+VCAGTGKC LY
Sbjct  171  LGLHELMVDVMNDRIKYCLRHVAGDADECAVCAGTGKCHLY  211


 Score = 48.1 bits (113),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -2

Query  725  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVG--DGVIIVDHGSRRKESNLML  555
            DFVK+    + +GY A       A+     E     VG  DGVIIVDHGSRR+ESNLML
Sbjct  31   DFVKLLTIGTSSGYRAMNSGPTSASKSETTEEQDYAVGENDGVIIVDHGSRRQESNLML  89



>ref|XP_007217178.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
 gb|EMJ18377.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
Length=159

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI  AFN+CV QGA R+IVSPFFL PGRHW QDIPSLTAEAAK HPG+ +++TAP
Sbjct  59   ELAEPSIHVAFNSCVLQGANRVIVSPFFLLPGRHWNQDIPSLTAEAAKEHPGVSYLVTAP  118

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HCLSHI G+A+ECSVC GT KCQL+
Sbjct  119  LGLHPLLVDVLNDRINHCLSHIAGDAEECSVCVGTNKCQLH  159



>ref|XP_010479465.1| PREDICTED: uncharacterized protein LOC104758326 isoform X1 [Camelina 
sativa]
Length=230

 Score =   171 bits (434),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  127  ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWLKDIPSLTADAAKEFSGISYLITAP  186

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY 
Sbjct  187  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLYN  228


 Score = 45.4 bits (106),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKTGYLAPRL-CL-AIANGGFRGERNCIKVGDGVIIVDHGSRRKESNL  561
            A+P  +KV KF S+ G       C  +  NGG    RN I   DG+IIVDHGSRR+ESNL
Sbjct  46   ALPVSLKVEKFRSQRGRRRRGSPCFGSFENGGLL--RNGIGDADGIIIVDHGSRRRESNL  103

Query  560  MLR  552
            ML 
Sbjct  104  MLE  106



>ref|XP_010479466.1| PREDICTED: uncharacterized protein LOC104758326 isoform X2 [Camelina 
sativa]
Length=227

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  124  ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWLKDIPSLTADAAKEFSGISYLITAP  183

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY 
Sbjct  184  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLYN  225



>ref|XP_009381040.1| PREDICTED: uncharacterized protein LOC103969271 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+PSI DAF  C+Q+GA+R+I+SPFFL PGRHW QDIP+L A+A+K H GI +IITAP
Sbjct  104  ELAKPSINDAFRLCMQKGAKRVIISPFFLSPGRHWLQDIPALVADASKEHSGISYIITAP  163

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HEL+VDV+NDRI HCL+H+ G+ADECSVCAGTGKC+LY+
Sbjct  164  LGLHELMVDVMNDRIKHCLTHVAGDADECSVCAGTGKCRLYQ  205



>ref|XP_010915963.1| PREDICTED: uncharacterized protein LOC105040911 isoform X2 [Elaeis 
guineensis]
Length=205

 Score =   167 bits (424),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+DAF  CV QGA+R+IVSPFFL PGRHW QDIP+L AEA++ H GI +IITAP
Sbjct  105  ELAAPSIRDAFETCVLQGAKRVIVSPFFLSPGRHWHQDIPALAAEASREHSGISYIITAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI HCLSH+  +ADEC+VCAGTGKC+LY
Sbjct  165  LGLHELMVDVMNDRIKHCLSHVAADADECTVCAGTGKCRLY  205


 Score = 48.5 bits (114),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  731  IPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLR  552
             P F K+ +  +K   L+ + CL++   G     + +   D VIIVDHGSRR+ESN ML 
Sbjct  25   FPVFHKLSRITAKGRTLSTKCCLSVRGEGLERFEHSVGDKDAVIIVDHGSRRQESNFMLD  84

Query  551  TGRAFYQ  531
               A ++
Sbjct  85   EFVAMFK  91



>ref|XP_004952284.1| PREDICTED: uncharacterized protein LOC101756522 isoform X1 [Setaria 
italica]
 ref|XP_004952285.1| PREDICTED: uncharacterized protein LOC101756522 isoform X2 [Setaria 
italica]
Length=212

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA RIIVSP+FL PGRHW+QDIP+L AEA+K H  +P+I+TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPALAAEASKEHSNVPYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+LY
Sbjct  171  LGLHELMVDIMNDRIKYCLQHVGGDVDECTVCAGTGKCRLY  211



>ref|XP_006393176.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
 gb|ESQ30462.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
Length=226

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDIPSLTA+AAK   GI ++ITAP
Sbjct  123  ELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDIPSLTADAAKEFSGISYLITAP  182

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI  CLSH++G+ADEC VCAGT KC+LY
Sbjct  183  LGLHNLLIDVVNDRIQRCLSHVEGDADECPVCAGTNKCKLY  223



>gb|ACG41745.1| sirohydrochlorin ferrochelatase [Zea mays]
 gb|ACG45177.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  IP+I+TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNIPYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+LY
Sbjct  171  LGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRLY  211



>gb|AAM67145.1| unknown [Arabidopsis thaliana]
Length=225

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW  DIPSLTA+AAK   GI ++ITAP
Sbjct  122  ELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDIPSLTADAAKEFSGISYLITAP  181

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  182  LGRHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTKKCKLY  222



>ref|XP_009381038.1| PREDICTED: uncharacterized protein LOC103969271 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=218

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+PSI DAF  C+Q+GA+R+I+SPFFL PGRHW QDIP+L A+A+K H GI +IITAP
Sbjct  115  ELAKPSINDAFRLCMQKGAKRVIISPFFLSPGRHWLQDIPALVADASKEHSGISYIITAP  174

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HEL+VDV+NDRI HCL+H+ G+ADECSVCAGTGKC+LY+
Sbjct  175  LGLHELMVDVMNDRIKHCLTHVAGDADECSVCAGTGKCRLYQ  216



>ref|NP_564562.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
 gb|AAO42090.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50678.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32521.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
Length=225

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW  DIPSLTA+AAK   GI ++ITAP
Sbjct  122  ELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDIPSLTADAAKEFSGISYLITAP  181

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  182  LGPHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  222



>ref|XP_010461867.1| PREDICTED: uncharacterized protein LOC104742549 isoform X1 [Camelina 
sativa]
Length=230

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  127  ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDIPSLTADAAKEFSGISYLITAP  186

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC++Y
Sbjct  187  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTDKCKIY  227



>gb|AAD50047.1|AC007980_12 Hypothetical protein [Arabidopsis thaliana]
Length=242

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQQGA+R++VSPFFLFPGRHW  DIPSLTA+AAK   GI ++ITAP
Sbjct  139  ELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDIPSLTADAAKEFSGISYLITAP  198

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  199  LGPHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  239



>gb|ACR35235.1| unknown [Zea mays]
Length=166

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQG  R+IVSP+FL PGRHW+QDIP+L AEA+K H  IP+I+TAP
Sbjct  65   ELAEPTIKDAFGKCVQQGVSRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNIPYIVTAP  124

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+LY
Sbjct  125  LGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRLY  165



>ref|XP_010238623.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010238624.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW QDIPSL AEA+K H  +P+I+TAP
Sbjct  112  ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWNQDIPSLAAEASKEHSNVPYIVTAP  171

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ G+A+EC+VCAGTGKC+LY
Sbjct  172  LGLHELMVDVMNDRIKYCLRHVGGDANECTVCAGTGKCRLY  212



>ref|XP_010461868.1| PREDICTED: uncharacterized protein LOC104742549 isoform X2 [Camelina 
sativa]
Length=227

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +DIPSLTA+AAK   GI ++ITAP
Sbjct  124  ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHKDIPSLTADAAKEFSGISYLITAP  183

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC++Y
Sbjct  184  LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTDKCKIY  224



>gb|EMT14170.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=104

 Score =   165 bits (418),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL AEA+K H  + +I+TAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVAYIVTAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ADEC+VCAGTGKC LY
Sbjct  63   LGLHELMVDIMNDRIKYCLRHVAGDADECAVCAGTGKCHLY  103



>ref|XP_003578793.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010238625.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW QDIPSL AEA+K H  +P+I+TAP
Sbjct  111  ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWNQDIPSLAAEASKEHSNVPYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ G+A+EC+VCAGTGKC+LY
Sbjct  171  LGLHELMVDVMNDRIKYCLRHVGGDANECTVCAGTGKCRLY  211



>dbj|BAD21683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD22195.1| unknown protein [Oryza sativa Japonica Group]
Length=212

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  I +++TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNITYVVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQLY
Sbjct  171  LGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQLY  211



>ref|XP_010915962.1| PREDICTED: uncharacterized protein LOC105040911 isoform X1 [Elaeis 
guineensis]
Length=293

 Score =   166 bits (421),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+DAF  CV QGA+R+IVSPFFL PGRHW QDIP+L AEA++ H GI +IITAP
Sbjct  193  ELAAPSIRDAFETCVLQGAKRVIVSPFFLSPGRHWHQDIPALAAEASREHSGISYIITAP  252

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI HCLSH+  +ADEC+VCAGTGKC+LY
Sbjct  253  LGLHELMVDVMNDRIKHCLSHVAADADECTVCAGTGKCRLY  293


 Score = 47.8 bits (112),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  731  IPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLR  552
             P F K+ +  +K   L+ + CL++   G     + +   D VIIVDHGSRR+ESN ML 
Sbjct  113  FPVFHKLSRITAKGRTLSTKCCLSVRGEGLERFEHSVGDKDAVIIVDHGSRRQESNFMLD  172

Query  551  TGRAFYQ  531
               A ++
Sbjct  173  EFVAMFK  179



>gb|ACG31626.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDIP+L AEA+K H  IP+I+TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDIPALAAEASKEHSNIPYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC++Y
Sbjct  171  LGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRMY  211



>ref|XP_004291766.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=205

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW QDIPSLTAEAAK H G+ +++TAP
Sbjct  106  ELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQDIPSLTAEAAKKH-GVSYMVTAP  164

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LLVDV+NDRI+HCLSH+ G+A EC+VC GTGKCQL+
Sbjct  165  LGLHPLLVDVMNDRINHCLSHVAGDAGECAVCVGTGKCQLH  205



>ref|NP_001046609.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAF08523.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAG89217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score =   165 bits (417),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA+K H  I +++TAP
Sbjct  22   ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNITYVVTAP  81

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VDV+NDRI +CL H+ GN +EC+VCAGTGKCQLY
Sbjct  82   LGLHELMVDVMNDRIKYCLRHVAGNVEECTVCAGTGKCQLY  122



>emb|CDY03592.1| BnaC03g68510D [Brassica napus]
Length=222

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDIP+LTA+AAK    I ++ITAP
Sbjct  119  ELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDIPALTADAAKEFSDISYLITAP  178

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  179  LGLHNLLIDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  219



>ref|XP_002453737.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
 gb|EES06713.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
Length=212

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+IVSP+FL PGRHW+QDIP+L AEA++ H  IP+++TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASREHSNIPYLVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC+LY
Sbjct  171  LGLHELMVDIMNDRIKYCLRHVAGDIDECTVCAGTGKCRLY  211



>ref|XP_009107234.1| PREDICTED: uncharacterized protein LOC103832890 [Brassica rapa]
Length=228

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIK AF+ CVQQGA+R++VSPFFLFPGRHW QDIP+LTA+AAK    I ++ITAP
Sbjct  121  ELAEPSIKSAFSLCVQQGAKRVVVSPFFLFPGRHWHQDIPALTADAAKEFSDISYLITAP  180

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL++V+NDRI HCLSH++G+ADEC VCAGT KC+LY
Sbjct  181  LGLHNLLINVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY  221



>ref|NP_001132509.1| sirohydrochlorin ferrochelatase isoform 1 [Zea mays]
 gb|ACF81375.1| unknown [Zea mays]
Length=212

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDIP+L A A+K H  IP+I+TAP
Sbjct  111  ELAEPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDIPALAAVASKEHSNIPYIVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC++Y 
Sbjct  171  LGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRMYS  212



>ref|XP_008667254.1| PREDICTED: sirohydrochlorin ferrochelatase isoform 1 isoform 
X1 [Zea mays]
Length=248

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IKDAF  CVQQGA R+I+SP+FL PGRHW+QDIP+L A A+K H  IP+I+TAP
Sbjct  147  ELAEPTIKDAFGKCVQQGASRVIISPYFLSPGRHWKQDIPALAAVASKEHSNIPYIVTAP  206

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+VD++NDRI +CL H+ G+ DEC+VCAGTGKC++Y
Sbjct  207  LGLHELMVDIMNDRIKYCLRHVAGDVDECTVCAGTGKCRMY  247



>ref|XP_004291765.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=210

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 6/106 (6%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ-----DIPSLTAEAAKLHPGIPF  389
            ELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW Q     DIPSLTAEAAK H G+ +
Sbjct  106  ELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQTVILQDIPSLTAEAAKKH-GVSY  164

Query  388  IITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            ++TAPLG+H LLVDV+NDRI+HCLSH+ G+A EC+VC GTGKCQL+
Sbjct  165  MVTAPLGLHPLLVDVMNDRINHCLSHVAGDAGECAVCVGTGKCQLH  210



>gb|EMS54863.1| Sirohydrochlorin ferrochelatase [Triticum urartu]
Length=107

 Score =   158 bits (399),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL AEA+K H  + +I+TAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLAAEASKEHSNVAYIVTAP  62

Query  373  LGVHELL---VDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+HEL+   VDV+NDRI +CL H+ G+A EC+VCAGTGKC LY
Sbjct  63   LGLHELMVITVDVMNDRIKYCLRHVAGDAGECAVCAGTGKCHLY  106



>gb|ABK26418.1| unknown [Picea sitchensis]
Length=214

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+P+IK+AF++CV QGA R+I+SP+FL PGRHW+QDIPSL AEAAK HPG+P+I+TAP
Sbjct  112  ELAQPTIKEAFDSCVNQGAARVIISPYFLSPGRHWKQDIPSLAAEAAKEHPGVPYIVTAP  171

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            LG+HEL+V+VI DRI +CLSH+ G++ EC +C+GTG+CQ
Sbjct  172  LGLHELMVNVIEDRIKYCLSHVAGDSAECEMCSGTGQCQ  210



>ref|XP_010461882.1| PREDICTED: uncharacterized protein LOC104742567 [Camelina sativa]
Length=116

 Score =   156 bits (394),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHW +    LTA+AAK   GI ++ITAP
Sbjct  17   ELAEPSIKDAFSLCVQKGAKRVVVSPFFLFPGRHWHK----LTADAAKEFSGISYLITAP  72

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLY  251
            LG+H LL+DV+NDRI HCLSH++G+ADEC VCAGT KC++Y
Sbjct  73   LGLHNLLMDVVNDRIQHCLSHVEGDADECLVCAGTNKCKIY  113



>ref|XP_010670852.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670853.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670854.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670855.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670856.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670857.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670859.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQQGA  +I+SPFFLFPGRHW QDIP L   AA  HPGI +++TAP
Sbjct  111  ELAEPSIKDAFDLCVQQGANCVIISPFFLFPGRHWHQDIPVLAGAAALEHPGINYLVTAP  170

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQL  254
            LG+HELLVDV+ DRID+CLSH+ G  +EC+VCAGTG+C+ 
Sbjct  171  LGLHELLVDVVKDRIDYCLSHVAGQVEECAVCAGTGRCKF  210



>ref|XP_003618173.1| Sirohydrochlorin cobaltochelatase [Medicago truncatula]
 gb|ACJ85904.1| unknown [Medicago truncatula]
 gb|AES74391.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=208

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+PSI DAF +CVQQGA RII+SPFFL  G+H+ +DIP+L+AEAAK HPG+ ++ITAP
Sbjct  99   ELAKPSIADAFQSCVQQGAHRIIISPFFLATGKHFNEDIPALSAEAAKQHPGVSYLITAP  158

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H LLVD++NDRI+ CL H  G+A+ECSVC G GKC L +
Sbjct  159  LGLHVLLVDIVNDRINGCLKHGAGDAEECSVCDGIGKCILKQ  200



>gb|EMS61947.1| Sirohydrochlorin ferrochelatase [Triticum urartu]
Length=95

 Score =   145 bits (365),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA RIIVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRIIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSV  281
            LG+HEL+VD++NDRI +CL H  G  DEC+V
Sbjct  63   LGLHELMVDIMNDRIKYCLRHAAGGVDECTV  93



>gb|EMT15526.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=122

 Score =   144 bits (362),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+AF  CVQQGA R+IVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEAFGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECS  284
            LG+HEL+VD+++DRI +CL H  G  DEC+
Sbjct  63   LGLHELMVDIMSDRIKYCLRHAAGGVDECT  92



>ref|XP_001765290.1| predicted protein [Physcomitrella patens]
 gb|EDQ70018.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI  AF+ CV+QGA R+I+ P+F FPGRHW +DIP+L+A+AA+ H  +P+++TAP
Sbjct  41   ELAEPSISHAFDRCVEQGAERVIICPYFFFPGRHWDRDIPALSAKAAEKHVDVPYVVTAP  100

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            +G+HEL+V V+ DR+++CLS + GN +EC +C GTG+CQ
Sbjct  101  IGLHELMVQVLVDRMEYCLSRVAGNVEECDMCRGTGRCQ  139



>ref|XP_002964135.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
 gb|EFJ34468.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
Length=158

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+DAF+ CV+ GA+R+IVSP+FLFPGRHW +DIP+L A A+  HPGI +++TAP
Sbjct  60   ELAAPSIEDAFDRCVELGAQRVIVSPYFLFPGRHWNKDIPALAAAASAKHPGIRYLVTAP  119

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            +G+HEL+VDV+ DR+ +C+S  +G ADEC +C GTG+C+
Sbjct  120  IGLHELMVDVLEDRMKYCVSRAEGRADECDMCVGTGRCR  158



>ref|XP_002993172.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
 gb|EFJ05812.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
Length=158

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+DAF+ CV+ GA+R+IVSP+FLFPGRHW +DIP+L A A+  HPGI +++TAP
Sbjct  60   ELAAPSIEDAFDRCVELGAQRVIVSPYFLFPGRHWNKDIPALAAAASAKHPGIRYLVTAP  119

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            +G+HEL+VDV+ DR+ +C+S  +G ADEC +C GTG+C+
Sbjct  120  IGLHELMVDVLEDRMKYCVSRAEGRADECDMCVGTGRCR  158



>ref|XP_006446561.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59801.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=181

 Score =   126 bits (317),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  101  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWYQDIPSLTAEAAKEHPGVPYIVTAP  160

Query  373  LGVHELLVD  347
            LG+HE LV+
Sbjct  161  LGLHEQLVN  169


 Score = 44.3 bits (103),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 10/67 (15%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P+ + +++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML  
Sbjct  32   PNSLNLQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLNQ  81

Query  548  GRAFYQR  528
              A ++ 
Sbjct  82   FVAMFRE  88



>gb|KDO55189.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=247

 Score =   125 bits (315),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  167  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYIVTAP  226

Query  373  LGVHELLVD  347
            LG+HE LV+
Sbjct  227  LGLHEQLVN  235


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 10/67 (15%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML+ 
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  548  GRAFYQR  528
              A ++ 
Sbjct  148  FVAMFRE  154



>gb|KDO55190.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=246

 Score =   125 bits (313),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW QDIPSLTAEAAK HPG+P+I+TAP
Sbjct  167  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYIVTAP  226

Query  373  LGVHELLV  350
            LG+HE LV
Sbjct  227  LGLHEQLV  234


 Score = 45.1 bits (105),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 10/67 (15%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML+ 
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  548  GRAFYQR  528
              A ++ 
Sbjct  148  FVAMFRE  154



>ref|XP_011002714.1| PREDICTED: uncharacterized protein LOC105109646 isoform X2 [Populus 
euphratica]
Length=189

 Score =   120 bits (300),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF  CVQQGA R+IVSPFFLFPGRHW +DIPSLT EAAK HPG+ ++ITAP
Sbjct  120  ELAEPSIRDAFGLCVQQGANRVIVSPFFLFPGRHWYRDIPSLTDEAAKEHPGVSYLITAP  179

Query  373  LGVHELLV  350
            LG+HELLV
Sbjct  180  LGLHELLV  187


 Score = 43.9 bits (102),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 6/41 (15%)
 Frame = -2

Query  653  NGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTGRAFYQ  531
            NG F G++      DGVIIVDHGSRRKESNLML    A ++
Sbjct  72   NGVFVGDK------DGVIIVDHGSRRKESNLMLNEFVAMFR  106



>ref|XP_001421596.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99889.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=134

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I DAF  CV++GA  ++V+PFFL PGRHWQ+DIP L  EAA  HPG+ ++I+AP
Sbjct  40   ELAPPTIADAFERCVERGANVVVVAPFFLSPGRHWQEDIPRLVDEAAAAHPGVKYLISAP  99

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            +G+H L+ +VI+ R+ HCL+H++    EC VCAG+
Sbjct  100  IGLHPLMAEVIDSRLRHCLAHVNEGGPECDVCAGS  134



>ref|XP_003083605.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL58154.1| Cobalamin (vitamin B12) biosynthesis CbiX [Ostreococcus tauri]
Length=202

 Score =   123 bits (308),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI DAF  CV +GA  I+V+PFFL PGRHWQ+DIP L  EAA  H G+  +++AP
Sbjct  101  ELASPSIADAFGRCVDRGANVIVVAPFFLSPGRHWQEDIPQLVKEAAAAHSGVRHLVSAP  160

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG-KCQL  254
            +G+H L+V+VI+ R+ HCL+   G  D C VCAG+   CQ+
Sbjct  161  IGLHPLMVEVIDSRMRHCLARAKGEVDACDVCAGSKFGCQM  201


 Score = 37.0 bits (84),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = -2

Query  662  AIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRTGRAFYQR  528
            AIA      + +  +   GV+IVDHGSRRKESN  L      Y R
Sbjct  44   AIARASMWSDDSATEDVLGVVIVDHGSRRKESNAQLEVFVEQYAR  88



>ref|XP_007217608.1| hypothetical protein PRUPE_ppa017033mg, partial [Prunus persica]
 gb|EMJ18807.1| hypothetical protein PRUPE_ppa017033mg, partial [Prunus persica]
Length=87

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  499  ARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHC  320
            A    V   FL  GRHW QDIPSLTAEAAK HPG+  I+TAPLG+H+LLVDV+NDRI+H 
Sbjct  5    ASNWTVEFRFLITGRHWNQDIPSLTAEAAKEHPGVSSIVTAPLGLHQLLVDVLNDRINHG  64

Query  319  LSHIDGNADECSVCAGTGKCQLY  251
             SHI G+A+ECSVC GT KCQL+
Sbjct  65   FSHIAGDAEECSVCVGTNKCQLH  87



>ref|XP_004291768.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 4 [Fragaria 
vesca subsp. vesca]
Length=194

 Score =   114 bits (286),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW QDIPSLTAEAAK H G+ +++TAP
Sbjct  106  ELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQDIPSLTAEAAKKH-GVSYMVTAP  164

Query  373  LGVHELLVD  347
            LG+H LLVD
Sbjct  165  LGLHPLLVD  173


 Score = 40.4 bits (93),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 7/59 (12%)
 Frame = -2

Query  725  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLML  555
            + +   + PS+T  ++    +   NGG  G+     VGD   VI+VDHGSRRKESNLML
Sbjct  31   NLLNWHRSPSRTRNMS----IESGNGGL-GQSKLDGVGDRDAVIVVDHGSRRKESNLML  84



>ref|XP_002506350.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67608.1| predicted protein, partial [Micromonas sp. RCC299]
Length=133

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EP I  AF+ CV+QGA  + VSPFFL PGRHWQ+DIP+LTAEAA  HPG+ + + AP
Sbjct  39   ELCEPGIDVAFSRCVEQGATLVAVSPFFLSPGRHWQEDIPALTAEAASKHPGVGYFVAAP  98

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            LG+H L+  ++  R++ C++H+     +C VC GT
Sbjct  99   LGLHPLMATIVESRLETCMAHLTTGGGKCDVCDGT  133



>ref|XP_010530526.1| PREDICTED: uncharacterized protein LOC104807109 isoform X2 [Tarenaya 
hassleriana]
Length=196

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 64/102 (63%), Gaps = 31/102 (30%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSIKDAF+ CVQ+GA+R++VSPFFLFPGRHWQQ                       
Sbjct  124  ELAEPSIKDAFSICVQKGAKRVVVSPFFLFPGRHWQQ-----------------------  160

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
                    DV+NDRI HCL H  G+ADEC VCAGTGKC+LY 
Sbjct  161  --------DVVNDRIKHCLGHAQGDADECEVCAGTGKCKLYN  194



>ref|XP_004291767.1| PREDICTED: sirohydrochlorin ferrochelatase-like isoform 3 [Fragaria 
vesca subsp. vesca]
Length=199

 Score =   108 bits (271),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 6/74 (8%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQ-----QDIPSLTAEAAKLHPGIPF  389
            ELAEPSI DAFN+CV+QGA RIIVSPFFL PGRHW      QDIPSLTAEAAK H G+ +
Sbjct  106  ELAEPSIHDAFNSCVEQGANRIIVSPFFLLPGRHWNQTVILQDIPSLTAEAAKKH-GVSY  164

Query  388  IITAPLGVHELLVD  347
            ++TAPLG+H LLVD
Sbjct  165  MVTAPLGLHPLLVD  178


 Score = 40.4 bits (93),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = -2

Query  752  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSR  579
             R +     + +   + PS+T  ++    +   NGG  G+     VGD   VI+VDHGSR
Sbjct  22   NRTNPNPTLNLLNWHRSPSRTRNMS----IESGNGGL-GQSKLDGVGDRDAVIVVDHGSR  76

Query  578  RKESNLML  555
            RKESNLML
Sbjct  77   RKESNLML  84



>gb|EMT21287.1| Sirohydrochlorin ferrochelatase [Aegilops tauschii]
Length=78

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+IK+A   CVQQGA R+IVSP+FL PGRHW+QDIPSL +EA+K H  +P+IITAP
Sbjct  3    ELAEPTIKEALGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAP  62

Query  373  LGVHELLVD  347
            LG+HEL+VD
Sbjct  63   LGLHELMVD  71



>gb|EYU44776.1| hypothetical protein MIMGU_mgv1a015745mg [Erythranthe guttata]
Length=147

 Score = 80.9 bits (198),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRR  576
             R+   AI  FVK+ + PSK+ Y   RLCLA ANGG FR  +N + VGDGVIIVDHGSRR
Sbjct  28   ARSPNFAIHQFVKLHRDPSKSKYSPSRLCLASANGGGFRKVQNGVDVGDGVIIVDHGSRR  87

Query  575  KESNLMLRTGRAFYQR  528
            KESNLML    A ++ 
Sbjct  88   KESNLMLNEFVAMFRE  103


 Score = 65.1 bits (157),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFP  461
            ELAEPSIKDAFN+CVQQGA+R+IVSPFFLFP
Sbjct  116  ELAEPSIKDAFNSCVQQGAKRVIVSPFFLFP  146



>ref|WP_002650018.1| cbiX protein [Blastopirellula marina]
 gb|EAQ82176.1| cbiX protein [Blastopirellula marina DSM 3645]
Length=152

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI  AF  CV QGA  +IV P+FL PGRHW +DIP L A+AA  HPG+  ++TAP
Sbjct  51   ELAEPSIAAAFARCVAQGAGLVIVHPYFLSPGRHWSEDIPRLAAQAAAQHPGVRHMVTAP  110

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            LG+H+ + +++ +RI+ CL+   G    C VC    +C+L +
Sbjct  111  LGLHQKMAEIMAERIEVCLARCRGEDVACGVCDEQTRCRLLD  152



>ref|XP_003063280.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52416.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=139

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+AEPSI  AF  CV++GA  + VSPFFL PGRHWQ+DIP LTA AA  HPG+ + + AP
Sbjct  47   EIAEPSIDVAFARCVERGATLVAVSPFFLSPGRHWQEDIPKLTAAAAGKHPGVKYFVAAP  106

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVC  278
            +G+H L+  +++ R++ C+ H+     +C +C
Sbjct  107  IGLHPLMSTIVDSRLETCVKHLTEGGGKCDLC  138



>ref|XP_010530527.1| PREDICTED: uncharacterized protein LOC104807109 isoform X3 [Tarenaya 
hassleriana]
Length=190

 Score =   105 bits (261),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  442  DIPSLTAEAAKLHPGIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGK  263
            DIPSLTA+ AK  PGI ++ITAPLG+H LLVDV+NDRI HCL H  G+ADEC VCAGTGK
Sbjct  124  DIPSLTADVAKEFPGIAYLITAPLGLHNLLVDVVNDRIKHCLGHAQGDADECEVCAGTGK  183

Query  262  CQLYE  248
            C+LY 
Sbjct  184  CKLYN  188


 Score = 32.7 bits (73),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = -2

Query  734  AIPDFVKVRKFPSKT-GYLAPRLCLAIA-NGGFRGERNCIKVGDGVIIVDHGSRRKESNL  561
            A+P  VK +K  +K    +    C A + N GF   RN I  GDG+IIVDHGS R ESNL
Sbjct  43   ALPGSVKFQKLHTKNRQRMCSLSCFATSENVGFF--RNGIGDGDGIIIVDHGSHRHESNL  100

Query  560  ML  555
            ML
Sbjct  101  ML  102



>gb|KHN12062.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=80

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+DAF +C++QG   IIV PF LFPGRHW QDIPSL+AE  K HP + + +TAP
Sbjct  12   ELAEPSIRDAFESCIEQGVHHIIVCPFILFPGRHWSQDIPSLSAEVVKEHPDVSYNVTAP  71

Query  373  LGVHELLV  350
            +G+HEL V
Sbjct  72   VGLHELFV  79



>ref|WP_014437036.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis]
 ref|YP_005445715.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis 
NBRC 102666]
 dbj|BAM03818.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis 
NBRC 102666]
Length=178

 Score = 94.4 bits (233),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I  A++ACV++GARRI++ PFFL  G+HW +DIPSLT++AA+ HPG  + I  P
Sbjct  53   ELAMPDIAAAYDACVRRGARRIVILPFFLAQGKHWTRDIPSLTSQAAEKHPGTAYQIAEP  112

Query  373  LGVHELLVDVINDRID  326
            LG+ +L++D++  R+D
Sbjct  113  LGIDDLILDLLKKRLD  128


 Score = 35.0 bits (79),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 19/28 (68%), Gaps = 1/28 (4%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLML-RTGRAFYQR  528
            GVIIVDHGSRR +SN  L    R F QR
Sbjct  13   GVIIVDHGSRRAQSNASLEEVARLFAQR  40



>ref|XP_007151006.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
 gb|ESW23000.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
Length=143

 Score = 71.2 bits (173),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            ELAEPSI+DAF +CVQQGA RIIVSPFFL PGRHW Q
Sbjct  107  ELAEPSIRDAFQSCVQQGANRIIVSPFFLSPGRHWSQ  143


 Score = 54.3 bits (129),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  698  SKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            SK+  L+  LCL+  NG FR     +  GD VIIVDHGSRRKESN ML
Sbjct  38   SKSRNLSGFLCLSAQNGSFRENSGEVGHGDAVIIVDHGSRRKESNFML  85



>gb|KHN23513.1| hypothetical protein glysoja_029802 [Glycine soja]
Length=169

 Score = 72.0 bits (175),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            ELAEPSI+DAF +CV+QGA RIIVSPFFLFPGRHW Q
Sbjct  125  ELAEPSIRDAFQSCVEQGAHRIIVSPFFLFPGRHWSQ  161


 Score = 50.1 bits (118),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 6/67 (9%)
 Frame = -2

Query  737  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGG-FRGERNCIKVGDGVIIVDHGSRR  576
            G  P +V ++   S      PR     LCL+  NGG FR     +  GD  IIVDHGSRR
Sbjct  21   GTNPSWVPLKSSNSLCCSSKPRNLSRFLCLSTQNGGGFRENSGEVGRGDAAIIVDHGSRR  80

Query  575  KESNLML  555
            KESNLML
Sbjct  81   KESNLML  87



>ref|XP_005536035.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79749.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=175

 Score = 90.1 bits (222),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+AEP++ D F ACV+ GAR I+V P+FL PGRH   DIP++ AEAA  H  + + +TAP
Sbjct  88   EMAEPTLDDGFRACVEAGARHIVVVPYFLAPGRHSTTDIPNMAAEAASKHAHVTYTVTAP  147

Query  373  LGVHELLVDVINDR  332
            LGVHE + +V+ +R
Sbjct  148  LGVHESIGNVVIER  161


 Score = 30.0 bits (66),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -2

Query  614  GDGVIIVDHGSRRKESNLML  555
            G  +++VDHGSRRKE+N  L
Sbjct  46   GHALLLVDHGSRRKEANEAL  65



>ref|XP_007508641.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20258.1| predicted protein [Bathycoccus prasinos]
Length=226

 Score = 89.0 bits (219),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQ-QGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPG---IPFI  386
            ELA PSI DAF   ++ +  R+I+V+PFFL PGRH ++DIP L  EAA+ + G   + ++
Sbjct  117  ELASPSIADAFRELIETKNCRKIVVAPFFLSPGRHVKEDIPRLVEEAAEEYRGKYELEYM  176

Query  385  ITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCA  275
            + AP+ +H L+  +I++R++ CL   +  A EC VC 
Sbjct  177  VAAPIALHPLMTTIIHERVEKCLEVNEKGAGECDVCG  213


 Score = 30.0 bits (66),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 6/41 (15%)
 Frame = -2

Query  674  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLR  552
            RL + + +G F  E+       G+++VDHGSR K SN  L 
Sbjct  43   RLRIVVNSGDFNEEKV------GIVLVDHGSRAKSSNEQLE  77



>gb|KDO55191.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=221

 Score = 73.6 bits (179),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQ  443
            ELAEPSIKDAF +CVQQGA R+IVSPFFLFPGRHW Q
Sbjct  167  ELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQ  203


 Score = 45.1 bits (105),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 10/67 (15%)
 Frame = -2

Query  728  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLRT  549
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML+ 
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  548  GRAFYQR  528
              A ++ 
Sbjct  148  FVAMFRE  154



>emb|CBJ30308.1| sirohydrochlorin ferrochelatase, putative chloroplast precursor 
[Ectocarpus siliculosus]
Length=215

 Score = 86.3 bits (212),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI++AF+ CV  GA+++++ PFFL PGRH   DIP+L   AAK HPG+ ++++ P
Sbjct  127  ELAEPSIEEAFDRCVAAGAQKVVLHPFFLSPGRHVTSDIPALMVAAAKRHPGVGWVVSEP  186

Query  373  LGVHELLVDVINDRIDHCLS  314
            LG+ EL+  V++  +   ++
Sbjct  187  LGLQELMPRVMHAAVSESVA  206


 Score = 30.4 bits (67),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLML  555
            GVI+ DHGSRR+ +N ML
Sbjct  88   GVIVCDHGSRRENANTML  105



>ref|XP_001698709.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
 gb|EDO99391.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
Length=234

 Score = 79.0 bits (193),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+AEP+I  A   C ++GA  ++++P+FL  GRH Q+DIP+L  EA   HPG+  II  P
Sbjct  132  EIAEPTIAQAVGRCAERGASTVVIAPYFLSRGRHIQEDIPALVREAQAEHPGLKCIIADP  191

Query  373  LGVHELLVDVINDRIDHCLSHID  305
            +G+  L+V +I++R+   L   D
Sbjct  192  IGIDPLMVQLISNRVASALEGGD  214


 Score = 33.5 bits (75),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLRTGRAFY  534
            GV+IVDHGSR++ SN ML    A Y
Sbjct  93   GVVIVDHGSRKRASNDMLHEFGALY  117



>ref|XP_005643741.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19197.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=132

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI  A + C  +G R+I+++P+FL  GRH   DIP+L AEA K HP +  +I  P
Sbjct  51   ELAEPSIGTAVSRCASEGFRKIVIAPYFLSRGRHITSDIPALVAEAQKAHPEVECVIAEP  110

Query  373  LGVHELLVDVINDRIDHCL  317
            +G+  L+  VI +R+   L
Sbjct  111  IGIDPLMAQVIENRVAGAL  129


 Score = 30.0 bits (66),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLR  552
             V++VDHGS+R E+N ML 
Sbjct  14   AVVLVDHGSKRAEANEMLE  32



>ref|XP_005711482.1| unnamed protein product [Chondrus crispus]
 emb|CDF41188.1| unnamed protein product [Chondrus crispus]
Length=289

 Score = 80.1 bits (196),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+A P+I D    CVQ GA  +IV PFFL PGRH   D+P+L AEAA  +  + F + +P
Sbjct  212  EIASPTIADGMEQCVQNGAEHVIVVPFFLSPGRHATTDVPNLAAEAAAQNRNVSFEVRSP  271

Query  373  LGVHELLVDVINDR  332
            +G H  +VDVI DR
Sbjct  272  IGTHPGIVDVILDR  285


 Score = 28.5 bits (62),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query  677  PRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            PR  +A+ N   +   +  +    +++VDHGS+R  +N ML
Sbjct  152  PRF-VAVTNNPSKPVESQTRQSSALLLVDHGSKRASANEML  191



>ref|WP_026174408.1| hypothetical protein [Alicyclobacillus pohliae]
Length=131

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + C++QGA R+IV P+FL  G H QQD+P    +AA+ HP IP  +   
Sbjct  43   ELAEPDIPTGIDLCIEQGAERVIVVPYFLLTGSHVQQDLPKWVGDAARKHPDIPIRVAES  102

Query  373  LGVHELLVDVINDRIDHCL  317
            LG H +L +++ +R+D  L
Sbjct  103  LGYHPILNEIVLERVDALL  121



>gb|EWM29197.1| Cobalamin (vitamin B12) biosynthesis CbiX [Nannochloropsis gaditana]
Length=257

 Score = 73.2 bits (178),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI  AF  CV++GA  II  PFFL  GRH  +DIP+L  EAA + PG+ + ++ P
Sbjct  158  ELCEPSIATAFGRCVERGATFIICHPFFLSRGRHVAEDIPNLLEEAASIFPGVEWALSQP  217

Query  373  LGVHELLVDVINDRIDHCLSH  311
            LG+   +  ++   ++ C++ 
Sbjct  218  LGLQADIPRLMQQAVEECIAE  238


 Score = 33.1 bits (74),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLRT  549
            GVI+VDHGSRRKE+N  L +
Sbjct  119  GVIVVDHGSRRKEANEALES  138



>ref|WP_019395087.1| hypothetical protein [Bacillus endophyticus]
Length=258

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I++AF  C++QGA +I+  P  L    H ++DIP +    A+ HP I  +   P
Sbjct  42   ELAEPTIEEAFARCIRQGATKIVAVPILLLTAGHAKKDIPEILLSLAEAHPEIEVVYGTP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
             GVH+ LVDV+ DRI    S ID +A    V  G+
Sbjct  102  FGVHDKLVDVLMDRIREANSMIDKDATVLLVGRGS  136



>ref|WP_015745553.1| NUDIX hydrolase [Candidatus Methylomirabilis oxyfera]
 ref|YP_003207892.1| NUDIX hydrolase [Candidatus Methylomirabilis oxyfera]
 emb|CBE70093.1| NUDIX hydrolase (modular protein) [Candidatus Methylomirabilis 
oxyfera]
Length=318

 Score = 77.4 bits (189),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EP+I+  F+ACV  GA  +IV P+FL  G+H    IP L  +AA  HPGI + IT P
Sbjct  43   ELGEPTIQQGFDACVADGADEVIVHPYFLSAGKHVAVGIPDLVRQAAGRHPGITYRITRP  102

Query  373  LGVHELLVDVINDRI  329
            LGVH  + +VI +RI
Sbjct  103  LGVHPKIGEVILERI  117


 Score = 28.5 bits (62),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLR  552
             ++IVDHGSRR+ SN +LR
Sbjct  4    ALLIVDHGSRREGSNDLLR  22



>ref|XP_005851931.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
 gb|EFN59829.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
Length=158

 Score = 75.9 bits (185),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I+ A   C   GARR++V+P+FL  GRH QQDIP+L A AA  HP +  ++  P
Sbjct  71   ELAEPTIEQAVGRCAAAGARRVVVAPYFLSRGRHVQQDIPALAAAAAAAHPSVECVVAEP  130

Query  373  LGVHELLVDVINDRI  329
            +G+  L+  +I  R+
Sbjct  131  IGIDSLMAQLIESRV  145


 Score = 28.9 bits (63),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLRTGRAFYQR  528
            GV++VDHGS++ E+N  L      Y++
Sbjct  32   GVVVVDHGSKKAEANDALLEFAELYKK  58



>ref|WP_039740278.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
 gb|AJE02421.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
Length=127

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I++  +ACV +GA R+++ P+FLF G H Q+D+P   AEA + HP + F +   LGVH
Sbjct  47   PTIQEGVDACVAKGAERVLLMPYFLFVGAHVQEDLPEEMAEARRRHPNVAFAMGGHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +V  DRI   ++
Sbjct  107  RKLAEVAADRIAEAIA  122



>ref|WP_033020593.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 gb|KFX32988.1| sirohydrochlorin ferrochelatase [Geobacillus sp. G1w1]
Length=248

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA RIIV P  L    H ++DIP+    A + HP +  +  +P
Sbjct  42   ELAEPDIITGVDRCVAQGATRIIVIPLLLLSAGHAKRDIPAALELAKQRHPAVEIVCGSP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVH+ ++D+I DRI  C   +DG +
Sbjct  102  FGVHDAMIDIIIDRISECAPSLDGES  127



>ref|WP_015718893.1| sirohydrochlorin cobaltochelatase [Geobacter sp. M18]
 ref|YP_004197300.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M18]
 gb|ADW12024.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M18]
Length=127

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV QGA RI++ P+FL+ G H Q+D+P    EA K +PG+  ++   LGVH
Sbjct  47   PNIQQGVDACVAQGAERILLVPYFLYMGAHVQEDLPEELEEAKKRYPGVEMVLGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
            + L +V+ +R+   L+
Sbjct  107  DKLAEVVVERVAESLT  122



>ref|WP_039646717.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
 gb|KIE43341.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
Length=127

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV QGA R+++ P+FLF G H Q+D+P   AEA   +P + F +   LGVH
Sbjct  47   PNIQQGIDACVAQGAERVLLMPYFLFVGAHVQEDLPEEMAEARTRYPAVEFAMGGHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +V  DRI   L+
Sbjct  107  RKLAEVAADRIAEALA  122



>ref|WP_010943630.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens]
 ref|NP_954042.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 ref|YP_006891912.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens KN400]
 gb|AAR36392.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 gb|ADI85755.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens KN400]
Length=127

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P I+   +ACV QGA R+++ P+FLF G H Q+D+P   AEA   +P + F +   LGVH
Sbjct  47   PDIQQGIDACVAQGAERVLLMPYFLFVGAHVQEDLPEEMAEARTRYPAVEFAMGGHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +V  DRI   L+
Sbjct  107  RKLAEVAADRIAEALA  122



>gb|KIH76331.1| sirohydrochlorin cobaltochelatase [Geoalkalibacter ferrihydriticus 
DSM 17813]
Length=135

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV QGA+R+++ P+FLF G H  +D+P+   EAA+ +PG+   +  PLGVH
Sbjct  47   PNIQKGIDACVAQGAQRVLLYPYFLFAGAHVLEDLPAEMEEAARRYPGLVMALGEPLGVH  106

Query  361  ELLVDVINDRIDHCLSHIDGNA  296
              L +++ +RI+  ++    +A
Sbjct  107  AKLGEIVCERIEDAMTRAGWDA  128



>ref|WP_026842098.1| sirohydrochlorin cobaltochelatase [Geobacter bremensis]
Length=127

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P   A+A K HPGI  ++   LGVH
Sbjct  47   PNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLPEELAQARKRHPGIEMVLGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
            + L +V+ +RI   L+
Sbjct  107  DKLAEVVVERIAETLT  122



>ref|WP_011735221.1| sirohydrochlorin cobaltochelatase [Pelobacter propionicus]
 ref|YP_900977.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Pelobacter 
propionicus DSM 2379]
 gb|ABK98919.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Pelobacter 
propionicus DSM 2379]
Length=127

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+ EPSI+   + CV +GA RI++ P+FLF G H Q D+P    EA K HPG+   +   
Sbjct  43   EMHEPSIQQGIDTCVARGAERILLMPYFLFMGAHVQHDLPEEIEEAKKRHPGLVMEMGGH  102

Query  373  LGVHELLVDVINDRIDHCLSHI  308
            LG H  L ++ N+RI   L  +
Sbjct  103  LGAHPKLAEIENERIGEALDRL  124



>ref|XP_005703681.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
 gb|EME27161.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
Length=178

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+P + +AF  CV+  AR I V PFFLFPGRH   DIP +    +     +   +  P
Sbjct  95   ELAKPDLMEAFMRCVENNARSITVCPFFLFPGRHSTVDIPEMAKNCSSQFHNVTCRVVEP  154

Query  373  LGVHELLVDVINDR  332
            LGVHE LVD++ +R
Sbjct  155  LGVHEKLVDIVLER  168



>ref|WP_031405718.1| sirohydrochlorin ferrochelatase [Geobacillus vulcani]
Length=248

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA RIIV P  L    H + DIP+    A + +P +  I+ AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRIIVIPLLLLSAGHAKHDIPAALDIAKQRYPSVEIILGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D+I DRI    + +DG +
Sbjct  102  FGVHETMIDIIIDRISEQSAPLDGES  127



>ref|WP_015838817.1| sirohydrochlorin cobaltochelatase [Geobacter sp. M21]
 ref|YP_003023391.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M21]
 gb|ACT19633.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M21]
Length=127

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P    EA + HPGI  ++   LGVH
Sbjct  47   PNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLPEELDEAKRRHPGIEMVLGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
            + L +V+ +RI   L+
Sbjct  107  DKLAEVVVERIAETLT  122



>gb|EZP78485.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
stearothermophilus NUB3621]
Length=248

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    N CVQ+GA RI+V P  L    H + DIP    +A + HP +  +   P
Sbjct  42   ELAEPDIITGINICVQKGATRIVVLPLLLLSAGHAKHDIPEAIRQAKQRHPHVEIVYGKP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++DV+ DRI      +DG +
Sbjct  102  FGVHETMIDVVIDRIYEQGVPLDGKS  127



>ref|WP_033024693.1| sirohydrochlorin ferrochelatase [Geobacillus sp. CAMR5420]
 gb|KDE50252.1| sirohydrochlorin ferrochelatase [Geobacillus sp. CAMR5420]
Length=248

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D+I DRI    + +DG +
Sbjct  102  FGVHETMIDIIIDRISEQSAPLDGES  127



>ref|WP_006562971.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Oscillochloris 
trichoides]
 gb|EFO79723.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Oscillochloris 
trichoides DG-6]
Length=281

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI   F+ CV  GA+ I+  P FL PGRH ++D+P L A A + HP +      P
Sbjct  39   ELAEPSIGAGFDLCVAAGAQEIVALPLFLGPGRHQKRDVPELLAAAQREHPHVQVRYGTP  98

Query  373  LGVHELLVDVINDRIDHCLSH  311
            +G H+ LVD + DR    +  
Sbjct  99   VGPHQRLVDALADRASTAMGQ  119



>ref|WP_004513845.1| sirohydrochlorin cobaltochelatase [Geobacter metallireducens]
 ref|YP_006719439.1| sirohydrochlorin cobaltochelatase [Geobacter metallireducens 
GS-15]
 gb|EHP85526.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
metallireducens RCH3]
 gb|ABB30719.2| sirohydrochlorin cobaltochelatase [Geobacter metallireducens 
GS-15]
Length=127

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I++  +ACV +GARR+++ P+FLF G H Q+D+P   A+A + +P + F +   LGVH
Sbjct  47   PNIQEGIDACVAKGARRVLLMPYFLFVGAHVQEDLPEEMAQARERYPKVEFAMGPHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +V  +RI   L+
Sbjct  107  RKLAEVEVERIAEALT  122



>ref|WP_012531975.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis]
 ref|YP_002140335.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis Bem]
 gb|ACH40539.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis Bem]
Length=127

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA+RI++ P+FL+ G H  +D+P    +A K HPGI  ++   LGVH
Sbjct  47   PNIQQGVDACVAKGAQRILLVPYFLYMGAHVLEDLPEELDQARKRHPGIEMVLGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
            + L +V+ +RI   L+
Sbjct  107  DKLAEVVVERIAETLT  122



>ref|WP_033005041.1| sirohydrochlorin ferrochelatase [Geobacillus sp. WSUCF1]
Length=248

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  102  FGVHEAMIDIVIDRISEQSAPLDGES  127



>gb|EPR29416.1| Sirohydrochlorin cobaltochelatase [Geobacillus sp. WSUCF1]
Length=263

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  57   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  116

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  117  FGVHEAMIDIVIDRISEQSAPLDGES  142



>ref|WP_015373928.1| hypothetical protein [Geobacillus sp. GHH01]
 ref|YP_007400744.1| hypothetical protein GHH_c04280 [Geobacillus sp. GHH01]
 gb|AGE20993.1| hypothetical protein GHH_c04280 [Geobacillus sp. GHH01]
Length=248

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  102  FGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|WP_013146355.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 ref|YP_003252419.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 ref|YP_003672571.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
 ref|YP_004131053.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
 ref|YP_004980946.1| ferrochelatase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|ACX77937.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 gb|ADI27994.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
 gb|ADU92910.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
 gb|AEV17846.1| Ferrochelatase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|EQB96456.1| sirohydrochlorin ferrochelatase [Geobacillus sp. A8]
 gb|ESU72823.1| sirohydrochlorin ferrochelatase [Geobacillus sp. MAS1]
Length=248

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  102  FGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|WP_011229916.1| sirohydrochlorin ferrochelatase [Geobacillus kaustophilus]
 ref|YP_146265.1| hypothetical protein GK0412 [Geobacillus kaustophilus HTA426]
 dbj|BAD74697.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
Length=248

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  102  FGVHEAMIDIMIDRISEQSAPLDGES  127



>dbj|GAM09629.1| sirohydrochlorin ferrochelatase [Geobacter sp. OR-1]
Length=128

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+  P+I+   +ACV QGA RI++ P+FLF G H ++D+P   A+A + +P + F +   
Sbjct  44   EMHLPNIQQGIDACVAQGAERILLMPYFLFIGAHVREDLPEEMAQAQERYPNVEFAMGNH  103

Query  373  LGVHELLVDVINDRIDHCLS  314
            LGVH  L +V+ +RI   L+
Sbjct  104  LGVHRKLAEVVVERIAEGLT  123



>dbj|GAD14749.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
kaustophilus GBlys]
Length=267

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  61   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  120

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  121  FGVHEAMIDIMIDRISEQSAPLDGES  146



>ref|WP_036220089.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 gb|KEK13633.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=246

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA  I V P  L   +H +QDIP   AEA KL+P I F    P
Sbjct  42   ELATPTIAEGIAKCVRQGATMIAVMPILLLAAQHAKQDIPREIAEAQKLYPHIQFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDTLQARI  116



>dbj|GAJ60479.1| hypothetical protein B23_3724 [Geobacillus thermoleovorans B23]
Length=263

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  57   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAP  116

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  117  FGVHEAMIDIMIDRISEQSAPLDGES  142



>ref|WP_036119918.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Lysinibacillus]
 gb|KER42336.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|KHK51545.1| sirohydrochlorin ferrochelatase [Lysinibacillus sp. A1]
Length=246

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA  I V P  L   +H +QDIP   AEA KL+P I F    P
Sbjct  42   ELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPREIAEAQKLYPHIQFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDTLQARI  116



>ref|WP_008178094.1| hypothetical protein [Bacillus sp. B14905]
 gb|EAZ85251.1| hypothetical protein BB14905_11410 [Bacillus sp. B14905]
Length=246

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA  I V P  L   +H +QDIP   AEA KL+P I F    P
Sbjct  42   ELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPREIAEAQKLYPHIQFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDTLQARI  116



>ref|WP_036145522.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|KGA84556.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
Length=246

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA  I V P  L   +H +QDIP   AEA KL+P I F    P
Sbjct  42   ELATPTIAEGIANCVRQGATMIAVMPILLLAAQHAKQDIPREIAEAQKLYPHIQFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDTLQARI  116



>ref|WP_025949077.1| sirohydrochlorin ferrochelatase [Geobacillus thermocatenulatus]
Length=248

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRHHPSVDILCGAP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++ DRI    + +DG +
Sbjct  102  FGVHEAMIDIMIDRISEQSAPLDGES  127



>ref|WP_033009575.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
 gb|KFL16446.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
 gb|KFX32371.1| sirohydrochlorin ferrochelatase [Geobacillus stearothermophilus]
Length=248

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + C  QGA R+IV P  L    H +QDIP+    A + HP +  +  AP
Sbjct  42   ELAEPDIATGVDRCAAQGATRVIVIPLLLLSAGHAKQDIPAALKAAKQRHPSLEIVCGAP  101

Query  373  LGVHELLVDVINDRI  329
             GVH+ ++D+I DRI
Sbjct  102  FGVHDAMIDIIIDRI  116



>ref|WP_013877513.1| sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius]
 ref|YP_004589395.1| sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius 
C56-YS93]
 gb|AEH49314.1| Sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius 
C56-YS93]
Length=248

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I    + CVQ+GA RIIV P  L    H + DIP    +AA+ HP +  ++  P
Sbjct  42   ELAVPDIATGIDICVQKGATRIIVLPILLLSAGHAKHDIPEAIRQAARRHPHVDIVLGKP  101

Query  373  LGVHELLVDVINDRI  329
             GVH+ ++D++ DRI
Sbjct  102  FGVHQTMIDIVADRI  116



>ref|WP_003252999.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Geobacillus]
 ref|YP_003990645.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y4.1MC1]
 gb|ADP76034.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y4.1MC1]
 gb|EID42917.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidans 
TNO-09.020]
 dbj|GAJ43041.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=248

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I    + CVQ+GA RIIV P  L    H + DIP    +AA+ HP +  ++  P
Sbjct  42   ELAVPDIATGIDICVQKGATRIIVLPILLLSAGHAKHDIPEAIRQAARRHPHVDIVLGKP  101

Query  373  LGVHELLVDVINDRI  329
             GVH+ ++D++ DRI
Sbjct  102  FGVHQTMIDIVADRI  116



>ref|WP_012546612.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii]
 ref|YP_002248993.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii 
DSM 11347]
 gb|ACI21913.1| sirohydrochlorin cobaltochelatase [Thermodesulfovibrio yellowstonii 
DSM 11347]
Length=125

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            PS+ +A   CV++GA+RII+ PFFL  G H   DIP +     KL+P +  + T PLG  
Sbjct  47   PSVDEAITKCVEEGAKRIIIHPFFLSSGSHVSFDIPKIIENIKKLYPQLEVLCTNPLGKS  106

Query  361  ELLVDVINDRIDHCLSHI  308
            + LV VI D I+  L  I
Sbjct  107  KKLVYVIKDLIEENLERI  124



>ref|WP_025116673.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
Length=246

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA  I V P  L   +H +QDIP    EA KL+P I F    P
Sbjct  42   ELATPTIAEGITNCVRQGATMIAVMPILLLAAQHAKQDIPREIVEAQKLYPHIQFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDTLQARI  116



>ref|WP_038084991.1| hypothetical protein [Tumebacillus flagellatus]
 gb|KEO84412.1| hypothetical protein EL26_04740 [Tumebacillus flagellatus]
Length=123

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E   PSI +   ACV+QGA+R+ V PFFL PG H   D+P+    A + HPG+ F +  P
Sbjct  43   EGTSPSIPEGIAACVRQGAKRVAVIPFFLLPGGHVSDDLPAFVEAARREHPGVEFRMGRP  102

Query  373  LGVHELLVDVINDRI  329
            LG HE +  ++ ++I
Sbjct  103  LGGHERVRQLLWEQI  117



>ref|WP_029281449.1| hypothetical protein [Bacillus indicus]
 gb|KEZ50032.1| hypothetical protein AZ46_0204805 [Bacillus indicus LMG 22858]
Length=261

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI++ F ACV+ GA +I V P  L    H ++DIP   AEAA L P +      P
Sbjct  43   ELAEPSIEEGFAACVRNGAEKIAVVPLLLLTAAHAKEDIPKEVAEAASLFPHVEVTYGKP  102

Query  373  LGVHELLVDVINDRI  329
            +GVHE L + +  R+
Sbjct  103  IGVHEKLAESVLKRV  117



>ref|WP_028842031.1| hypothetical protein [Thermodesulfovibrio islandicus]
Length=125

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            PS+ +A   CV++GA+RII+ PFFL  G H   DIP +     KL+P +  + T PLG  
Sbjct  47   PSVDEAITKCVEEGAKRIIIHPFFLSSGSHVSFDIPKIIENIKKLYPQLEVLSTNPLGKS  106

Query  361  ELLVDVINDRIDHCLSHI  308
            + LV VI D I+  L  I
Sbjct  107  KKLVYVIKDLIEENLERI  124



>ref|WP_020958631.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
 ref|YP_008416363.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
 gb|AGT30819.1| sirohydrochlorin ferrochelatase [Geobacillus sp. JF8]
Length=248

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EP I    + CV QGA R+IV P  L    H + DIP+    A + HP +  +  AP
Sbjct  42   ELTEPDIVTGVDLCVTQGATRVIVIPLLLLSAGHAKYDIPAALEAAKRRHPSLEIVCGAP  101

Query  373  LGVHELLVDVINDRI  329
             GVHE ++D+I DRI
Sbjct  102  FGVHETMIDIIIDRI  116



>ref|WP_034284565.1| sirohydrochlorin ferrochelatase [Bacillus sp. 72]
Length=249

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL+EPSI +    CVQ+GA  II  PF L    H ++DIP    +AA+ +P +      P
Sbjct  42   ELSEPSIAEGLARCVQKGATEIIAMPFLLLTAGHAKKDIPEELKKAAQHYPNLMIRYGRP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
            LGVHE +VDV+ DR+           D C +  G G
Sbjct  102  LGVHEHIVDVLIDRMKEAAPF---QEDACVLLVGRG  134



>ref|XP_009040729.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
 gb|EGB04623.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
Length=161

 Score = 66.2 bits (160),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI++AF+A V QG   ++  PFFL PGRH  +D+P L   A   HPG+  ++T  
Sbjct  52   ELASPSIEEAFDALVAQGCDLVVCHPFFLSPGRHATEDVPELLEAAKAKHPGVRAVMTPI  111

Query  373  LGVHELLVDVINDRI  329
             G    L+D+++  +
Sbjct  112  TGAAPGLLDLVDATV  126


 Score = 28.5 bits (62),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLRTGRAFYQR  528
            GV++VDHGS+R+ +N  L T  A Y  
Sbjct  11   GVMVVDHGSKREAANERLITLCAAYAE  37



>ref|WP_028409577.1| sirohydrochlorin ferrochelatase [Bacillus sp. 171095_106]
Length=255

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H +QDIP    +  + +P +  +   P
Sbjct  42   ELAAPTIEQGFEACIEQGATRIAIVPLLLLKAAHAKQDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_011886753.1| sirohydrochlorin ferrochelatase [Geobacillus thermodenitrificans]
 ref|YP_001124511.1| ferrochelatase [Geobacillus thermodenitrificans NG80-2]
 gb|ABO65766.1| Ferrochelatase [Geobacillus thermodenitrificans NG80-2]
Length=248

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA RIIV P  L    H + DIP+    A + HP +  +   P
Sbjct  42   ELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIPAALELAKQRHPSLEIVCGTP  101

Query  373  LGVHELLVDVINDRI  329
             GVHE ++D+I DRI
Sbjct  102  FGVHESMIDIIIDRI  116



>ref|WP_029761480.1| sirohydrochlorin ferrochelatase [Geobacillus thermodenitrificans]
Length=248

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA RIIV P  L    H + DIP+    A + HP +  +   P
Sbjct  42   ELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIPAALELAKQRHPSLEIVCGTP  101

Query  373  LGVHELLVDVINDRI  329
             GVHE ++D+I DRI
Sbjct  102  FGVHESMIDIIIDRI  116



>ref|WP_008881209.1| sirohydrochlorin ferrochelatase [Geobacillus sp. G11MC16]
 gb|EDY04929.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. G11MC16]
Length=248

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP I    + CV QGA RIIV P  L    H + DIP+    A + HP +  +   P
Sbjct  42   ELAEPDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIPAALELAKQRHPSLEIVCGTP  101

Query  373  LGVHELLVDVINDRI  329
             GVHE ++D+I DRI
Sbjct  102  FGVHESMIDIIIDRI  116



>ref|WP_004228345.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis]
 gb|EFI68907.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis ZC1]
 gb|EKU41931.1| sirohydrochlorin ferrochelatase [Lysinibacillus fusiformis ZB2]
Length=246

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +   +C+++GA  I V P  L   +H + DIP   A+A KL+P + F    P
Sbjct  42   ELATPTIAEGIASCIRKGATAIAVMPILLLAAQHAKYDIPKEMAKAQKLYPYVKFTYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
            LG+HE L+D +  RI   +  +  N++   +  G G
Sbjct  102  LGIHEQLIDTLQARI---IEKLQPNSNASVLLIGRG  134



>ref|WP_036125151.1| sirohydrochlorin ferrochelatase, partial [Lysinibacillus sphaericus]
Length=236

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +   +C+++GA  I V P  L   +H +QDIP   A+A K +P + F    P
Sbjct  32   ELATPTIAEGIESCIRKGATAIAVMPILLLAAQHAKQDIPKEVAKAQKQYPSVKFTYGEP  91

Query  373  LGVHELLVDVINDRI  329
            LG+HE L+D +  RI
Sbjct  92   LGIHERLIDSLQARI  106



>ref|WP_035741568.1| cobalamin biosynthesis protein CbiX, partial [Frankia sp. BMG5.12]
Length=123

 Score = 66.2 bits (160),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            +LA P I   + A V  G   II  PFFLF G H  +DIP   A A   HPG  + IT P
Sbjct  45   DLAHPDIAQGYAALVDAGCSEIIAHPFFLFEGNHTARDIPDALAAAQSAHPGTRWTITLP  104

Query  373  LGVHELLVDVINDRIDHCL  317
            LG+H  +V  +  RI+  L
Sbjct  105  LGLHPGVVHAVRARIEDAL  123


 Score = 27.3 bits (59),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 9/18 (50%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLML  555
            G++++ HGSRR E+N M+
Sbjct  3    GLLVIGHGSRRDEANAMV  20



>ref|WP_012749140.1| sirohydrochlorin ferrochelatase [Geobacillus sp. WCH70]
 ref|YP_002948592.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. WCH70]
 gb|ACS23326.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. WCH70]
Length=248

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I    + CVQ+GA RI+V P  L    H + DIP    +A + HP +  ++  P
Sbjct  42   ELAYPDIVTGIDICVQKGATRIVVLPILLLSAGHAKHDIPEAIRQAKQRHPHLEIVLGKP  101

Query  373  LGVHELLVDVINDRIDHCLSHID  305
             GVHE ++D++ DRI      +D
Sbjct  102  FGVHETMIDIVVDRIKEQAVSLD  124



>dbj|BAO45352.1| cobalamin biosynthesis protein CbiX [gamma proteobacterium Hiromi1]
Length=130

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 6/75 (8%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPG-----IPF  389
            ELAEPSI +    CV+ GA R++V P+FL  GRH  +DIP+   EA +LHP       P+
Sbjct  45   ELAEPSIPEGIGQCVEAGADRVVVLPYFLSAGRHVSEDIPAEVEEARRLHPKASIVLAPY  104

Query  388  IITAPLGVHELLVDV  344
            + +AP GV  LLV++
Sbjct  105  LGSAP-GVSRLLVEL  118



>sp|P61817.1|SIRB_BACME RecName: Full=Sirohydrochlorin ferrochelatase [Bacillus megaterium]
 emb|CAD48922.1| ferrochelatase [Bacillus megaterium]
Length=266

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  53   ELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIQKVYERYPQVEVLYGEP  112

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  113  FGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  146



>ref|WP_039237066.1| sirohydrochlorin ferrochelatase [Bacillus thermotolerans]
 gb|KIA67967.1| Sirohydrochlorin ferrochelatase [Bacillus thermotolerans]
 gb|KIG04798.1| Sirohydrochlorin ferrochelatase [Bacillaceae bacterium MTCC 8252]
Length=255

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I     +CV+QGA  IIV PF L    H ++DIP    +     P + F    P
Sbjct  42   ELAEPTIAQGVASCVEQGADEIIVFPFLLLAAGHAKKDIPHELKKVKGQFPAVTFYYAQP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            +GVHE L+D++ +R++     I+ +     V  G+   Q
Sbjct  102  IGVHEALIDILIERMEETGESIEPDDSVLIVGRGSSDTQ  140



>ref|WP_028396246.1| sirohydrochlorin ferrochelatase [Bacillus sp. FJAT-14578]
Length=252

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI+  F  CV++GA +I   P  L    H ++DIP + +   K +PG+  +   P
Sbjct  42   ELAEPSIEQGFRRCVERGATKIYAVPVLLLTAVHAKEDIPKILSTLRKQYPGVDVVYGRP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GVHE + +++ +RI      ID   D   +  G G
Sbjct  102  FGVHESITEILYERIMETNVSID--EDSLVLLVGRG  135



>ref|WP_029565580.1| hypothetical protein [Bacillus cibi]
 gb|KEZ54190.1| hypothetical protein GS18_0204495 [Bacillus cibi]
Length=261

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI++ F ACV++GA +I V P  L    H ++DIP    EAA L P +      P
Sbjct  43   ELAEPSIEEGFAACVRKGAGKIAVVPLLLLTAAHAKEDIPKEVKEAASLFPHVEVTYGKP  102

Query  373  LGVHELLVDVINDRI  329
            +GVHE L + +  R+
Sbjct  103  IGVHEKLAESVLKRV  117



>ref|WP_020463526.1| cobalamin biosynthesis protein CbiX [Frankia sp. EAN1pec]
 ref|YP_001510351.1| cobalamin (vitamin B12) biosynthesis protein CbiX [Frankia sp. 
EAN1pec]
 gb|ABW15445.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Frankia sp. 
EAN1pec]
Length=153

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+A P I + + A V+ G   I+  PFFLF G H  +DIP   A A   HPG  + +T P
Sbjct  64   EIARPDIAEGYAALVRTGCSEIVAHPFFLFDGNHTSRDIPDALAAAQTDHPGTSWTVTQP  123

Query  373  LGVHELLVDVINDRIDHCL  317
            LG+H  +V  +  RI+  L
Sbjct  124  LGLHPGVVRAVQARIEDAL  142



>ref|WP_018505183.1| hypothetical protein [Frankia sp. BCU110501]
Length=185

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+A P I + + A V+ G   I+  PFFLF G H  +DIP   A A   HPG  + +T P
Sbjct  93   EIARPDIAEGYAALVRTGCSEIVAHPFFLFDGNHTSRDIPDALAAAQADHPGTSWTVTRP  152

Query  373  LGVHELLVDVINDRIDHCLSHI  308
            LG+H  +V  +  RI+  L  +
Sbjct  153  LGLHPGVVRAVQARIEDALHQV  174



>ref|WP_018393061.1| hypothetical protein [Bacillus sp. 37MA]
Length=249

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL++PSI +    CVQ+GA  +I  PF L    H ++DIP    +AA+ +P +      P
Sbjct  42   ELSDPSIAEGLARCVQKGATEVIAMPFLLLTAGHAKKDIPEELKKAAQHYPNLMIRYGRP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
            LGVHE +VDV+ DR+           D C +  G G
Sbjct  102  LGVHEHIVDVLIDRMKEAAPF---QEDACVLLVGRG  134



>ref|WP_027716685.1| sirohydrochlorin cobaltochelatase [Desulfuromonas sp. TF]
Length=135

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA R+++ P+FLF G H  +D+P   A+A + +PG+  I+  PL VH
Sbjct  47   PNIQSGIDACVVRGASRVLLYPYFLFAGAHVLEDLPEEMAQAKERYPGLEMILGRPLEVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +++ +RI   LS
Sbjct  107  PKLGEIVCERIWESLS  122



>ref|WP_016765792.1| sirohydrochlorin ferrochelatase [Bacillus megaterium]
 gb|KFN06813.1| cbiX family protein [Bacillus megaterium]
 gb|KGJ85623.1| sirohydrochlorin ferrochelatase [Bacillus megaterium NBRC 15308 
= ATCC 14581]
Length=255

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>gb|KIG09584.1| Sirohydrochlorin ferrochelatase [Bacillaceae bacterium MTCC 10057]
Length=255

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I     +CV+QGA  IIV PF L    H ++DIP    +     P + F    P
Sbjct  42   ELAEPTIAQGVASCVEQGADEIIVFPFLLLAAGHAKKDIPHELKKVKGQFPAVTFYYAQP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQ  257
            +GVHE L+D++ +R++     I  +     V  G+   Q
Sbjct  102  IGVHEALIDILIERMEETGESIGPDDSVLIVGRGSSDTQ  140



>ref|WP_035350149.1| sirohydrochlorin ferrochelatase, partial [Fictibacillus gelatini]
Length=237

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I++    C+ QGA +I V P  L    H ++DIP    +A   +P + F    P
Sbjct  42   ELAEPTIEEGIKRCIHQGATKIAVVPILLLTATHAKEDIPGEIEKAMNKYPDVQFSYGRP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVH  ++DV+ +R+    + ID +A
Sbjct  102  FGVHSKIIDVLMERVKSQKAKIDDDA  127



>ref|WP_016991507.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans]
Length=246

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI +   +C+++GA  I V P  L   +H + DIP   A+A +L+P + F    P
Sbjct  42   ELATPSIAEGIASCIRKGATAIAVMPILLLAAQHAKHDIPKEMAKAQELYPYVKFTYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE L+D +  RI
Sbjct  102  LGIHERLIDTLQARI  116



>ref|WP_018567673.1| cobalamin biosynthesis protein CbiX [Streptomyces sp. PsTaAH-124]
Length=306

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL+ P + DA    V++GARR    P  L    H + DIP+  A   + HPGI +    P
Sbjct  47   ELSPPPLGDAVTELVERGARRFAAVPLMLVSAGHAKGDIPAALAREKERHPGISYTYGRP  106

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSV  281
            LG H  L+ V+  R+D  L   DG+  E +V
Sbjct  107  LGPHPALLRVLERRLDEALRGTDGDRSEVTV  137



>ref|WP_013085292.1| sirohydrochlorin ferrochelatase [Bacillus megaterium]
 ref|YP_003600063.1| sirohydrochlorin ferrochelatase [Bacillus megaterium DSM 319]
 gb|ADF41713.1| sirohydrochlorin ferrochelatase [Bacillus megaterium DSM 319]
Length=255

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELASPAIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_033580478.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
Length=255

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELAYPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_028412599.1| sirohydrochlorin ferrochelatase [Bacillus sp. 278922_107]
Length=255

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELAYPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILVERINE--TNVDKHEDSMVLLVGRG  135



>ref|XP_010678615.1| PREDICTED: uncharacterized protein LOC104894137 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 49.3 bits (116),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPF  473
            ELA+PSIKDAF+ CVQQGA R+I+SPF
Sbjct  98   ELADPSIKDAFDLCVQQGANRVIISPF  124


 Score = 42.7 bits (99),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = -2

Query  683  LAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  555
            L+P LC  +           +   DGVIIVDHGSRRKESN++L
Sbjct  34   LSPSLCFPMDQKSVHEGAFGVGQKDGVIIVDHGSRRKESNILL  76



>ref|WP_013059579.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
 ref|YP_003565340.1| sirohydrochlorin ferrochelatase [Bacillus megaterium QM B1551]
 gb|ADE71906.1| sirohydrochlorin ferrochelatase [Bacillus megaterium QM B1551]
Length=255

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F AC++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELASPTIEQGFEACIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI    +++D + D   +  G G
Sbjct  102  FGVDERIVDILVERIKE--TNVDKHEDSMVLLVGRG  135



>ref|WP_036078574.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans]
 gb|KGR83547.1| sirohydrochlorin ferrochelatase [Lysinibacillus boronitolerans 
JCM 21713 = 10a = NBRC 103108]
Length=246

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+P+I +   +C+++GA  I V P  L   +H + DIP   A+A +L+P + F    P
Sbjct  42   ELAKPTIAEGIASCIRKGATAIAVMPILLLAAQHAKHDIPKEMAKAQELYPFVKFTYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE L+D +  RI
Sbjct  102  LGIHERLIDTLQARI  116



>ref|WP_017436092.1| sirohydrochlorin ferrochelatase [Geobacillus caldoxylosilyticus]
 dbj|GAJ40902.1| sirohydrochlorin cobaltochelatase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=248

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EP I    + CVQ+GA RIIV P  L    H + DIP    +A + HP +  +   P
Sbjct  42   ELVEPDIITGIDICVQKGATRIIVLPLLLLSAGHAKHDIPEALRQAKQRHPHVEIVCGKP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNA  296
             GVHE ++D++  RI      +DG +
Sbjct  102  FGVHETMIDIVIARIHEQGVPLDGKS  127



>gb|AHN23033.1| sirohydrochlorin ferrochelatase [Lysinibacillus varians]
Length=249

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I      C +QGA  I + P  L   +H + DIP    +A K +P + F    P
Sbjct  42   ELAEPTIAQGIENCFRQGATDIAIMPILLLAAQHAKHDIPKEIDKAQKQYPTVHFTYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHID  305
            LGVHELL+D +  RI     H +
Sbjct  102  LGVHELLIDTLQKRILETQLHFN  124



>ref|WP_024364856.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=249

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I      C +QGA  I + P  L   +H + DIP    +A K +P + F    P
Sbjct  42   ELAEPTIAQGIENCFRQGATDIAIMPILLLAAQHAKHDIPKEIDKARKQYPTVHFTYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHID  305
            LGVHELL+D +  RI     H +
Sbjct  102  LGVHELLIDTLQKRILETQLHFN  124



>ref|WP_011602248.1| cobalamin biosynthesis protein CbiX [Frankia alni]
 ref|YP_711282.1| sirohydrochlorin cobaltochelatase [Frankia alni ACN14a]
 emb|CAJ59686.1| putative Sirohydrochlorin cobaltochelatase [Frankia alni ACN14a]
Length=154

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E++ P I + ++     G   I+V PFFLF G H ++D+P+   EA   HP   +I++ P
Sbjct  64   EVSRPDIGEGYDTLADAGCTEIVVYPFFLFGGNHTRRDLPAALEEARGRHPTTRWILSEP  123

Query  373  LGVHELLVDVINDRIDHCLSHIDGNAD  293
            LG+H  +V+ +  R+D  L  +   AD
Sbjct  124  LGLHTCVVEAVRARLDDTLRALVDAAD  150



>ref|WP_033398315.1| cobalamin biosynthesis protein CbiX, partial [Desulfospira joergensenii]
Length=118

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            +  EP +++     VQ+GA++I + PFF+  G H  QD+P    +A K HPG+ FIIT  
Sbjct  44   QFTEPGLEEVMETLVQRGAKKIFIFPFFIAVGTHVLQDLPECIEKAQKTHPGVDFIITRH  103

Query  373  LGVHELLVDVINDRI  329
            LG  E + DVI + +
Sbjct  104  LGALESIEDVILNEV  118



>ref|WP_012292364.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 ref|YP_001696343.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus C3-41]
 gb|ACA38213.1| Sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus C3-41]
 gb|EWH30636.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus CBAM5]
Length=246

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA RI + P  L   +H ++DIP   A+A KL P I F    P
Sbjct  42   ELATPTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPIEIAKAQKLFPHILFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDSLQARI  116



>ref|WP_036166469.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
Length=246

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I +    CV+QGA RI + P  L   +H ++DIP   A+A KL P I F    P
Sbjct  42   ELATPTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPIEIAKAQKLFPHILFSYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LG+HE ++D +  RI
Sbjct  102  LGIHERIIDSLQARI  116



>gb|EXX87131.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX88821.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX89714.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
Length=305

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I+    ACV QGA R+++ P  LF   H +  IP+    A K +PG+ F    P
Sbjct  42   ELARPDIQQGIAACVSQGAERVVLVPIILFAAGHAKLHIPAEIDRAKKRYPGVEFAYGRP  101

Query  373  LGVHELLVDVINDRIDHC-LSHIDGNAD  293
            +G+H+ +VD++  R+    L   DG  D
Sbjct  102  IGIHQKVVDILQSRLSEAGLPEGDGERD  129


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = -3

Query  550  LAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPL  371
            + EPS  +    C++ GA++I V P+FLF G   ++ I ++TAE A+LHP     +    
Sbjct  173  VTEPSFPEGLERCLRLGAKKIYVLPYFLFTGILIKR-IEAMTAEFAQLHPEARVELAGYF  231

Query  370  GVHELLVDVINDRIDHCLSHIDGNA-DECSVC  278
            G H  LV+++ DR+       +G A   C +C
Sbjct  232  GFHPQLVELLLDRVAEA---AEGRAFMNCDMC  260



>ref|WP_036581629.1| sirohydrochlorin cobaltochelatase, partial [Paenibacillus darwinianus]
Length=297

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P I+    ACV QGA R+++ P  LF   H +  IP+    A K +PG+ F    P
Sbjct  42   ELARPDIQQGIAACVSQGAERVVLVPIILFAAGHAKLHIPAEIDRAKKRYPGVEFAYGRP  101

Query  373  LGVHELLVDVINDRIDHC-LSHIDGNAD  293
            +G+H+ +VD++  R+    L   DG  D
Sbjct  102  IGIHQKVVDILQSRLSEAGLPEGDGERD  129


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -3

Query  550  LAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPL  371
            + EPS  +    C++ GA++I V P+FLF G   ++ I ++TAE A+LHP     +    
Sbjct  173  VTEPSFPEGLERCLRLGAKKIYVLPYFLFTGILIKR-IEAMTAEFAQLHPEARVELAGYF  231

Query  370  GVHELLVDVINDRI  329
            G H  LV+++ DR+
Sbjct  232  GFHPQLVELLLDRV  245



>ref|WP_025752730.1| sirohydrochlorin ferrochelatase [Bacillus flexus]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I+  F  C++QGA RI + P  L    H + DIP    +  + +P +  +   P
Sbjct  42   ELASPTIEQGFEVCIEQGATRIAIVPLLLLTAAHAKHDIPEEIHKVYERYPQVEVLYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
             GV E +VD++ +RI+   +++D + D   +  G G
Sbjct  102  FGVDERIVDILLERINE--TNVDKHEDSMVLLVGRG  135



>ref|WP_036197389.1| sirohydrochlorin ferrochelatase [Lysinibacillus sinduriensis]
 gb|KGR78434.1| sirohydrochlorin ferrochelatase [Lysinibacillus sinduriensis 
BLB-1 = JCM 15800]
Length=252

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+PSI +  +ACV +GA  I + P  L    H +QDIP    +A KL+P + F  + P
Sbjct  42   ELADPSIVEGVSACVAKGATEIAIIPILLLTANHAKQDIPHEINKAQKLYPKVSFTFSKP  101

Query  373  LGVHELLVDVINDRI  329
             G+ + L+D + +R+
Sbjct  102  FGIQKKLIDSLQERV  116



>ref|WP_012645135.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii]
 ref|YP_002535507.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
daltonii FRC-32]
 gb|ACM18406.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii FRC-32]
Length=127

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA RI++ P+FL+ G H  +D+P+   EA + HP +   +   LGVH
Sbjct  47   PNIQKGIDACVARGAERILLLPYFLYLGAHVLEDLPAELEEARQRHPQVEMAMGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +++ +RI   L+
Sbjct  107  HKLAEIVVERIAQSLT  122



>ref|WP_009740585.1| cobalamin biosynthesis protein CbiX [Frankia sp. QA3]
 gb|EIV94194.1| hypothetical protein FraQA3DRAFT_3936 [Frankia sp. QA3]
Length=153

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E++ P I + ++     G   I+V PFFLF G H ++D+P+   EA   HP   +I++ P
Sbjct  63   EVSRPDIDEGYDNLADAGCTEIVVYPFFLFGGNHTRRDLPAALEEARGRHPTTRWILSEP  122

Query  373  LGVHELLVDVINDRIDHCLSHIDGNAD  293
            LG+H  +++ +  R+D  L  +   AD
Sbjct  123  LGLHACVIEAVRARLDDTLRELVDAAD  149



>ref|WP_035505420.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Halobacillus]
 emb|CDQ28088.1| Sirohydrochlorin ferrochelatase [Halobacillus trueperi]
 emb|CDQ19787.1| Sirohydrochlorin ferrochelatase [Halobacillus dabanensis]
 emb|CDQ22247.1| Sirohydrochlorin ferrochelatase [Halobacillus karajensis]
Length=251

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = -3

Query  580  VEKSPILC*ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHP  401
            +E   I   ELA+P + +  +  VQ+GA +I++ P  L    H+ QDIP    +A + +P
Sbjct  33   IETYEICFLELADPDVLEGIHRLVQKGATKIVILPVLLLSAGHYYQDIPEEIHKAKEKYP  92

Query  400  GIPFIITAPLGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
             + F    PLG+ + +VDV+ DRID     +D   +   V  G+
Sbjct  93   HVSFTYGQPLGIQDRIVDVLVDRIDAIPQELDETVNIILVGRGS  136



>ref|WP_018393297.1| MULTISPECIES: hypothetical protein [Bacillus]
Length=240

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL++PSI +    CV++GA  II  PF L    H ++DIP    +AA+ +P +      P
Sbjct  42   ELSDPSIAEGIAKCVKRGATEIIAMPFLLLTAGHAKKDIPEELKKAAQQYPDLMIRYGRP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTG  266
            LGVHE +VDV+ +R+           D C +  G G
Sbjct  102  LGVHEHIVDVLIERMKEAAPF---QEDACVLLVGRG  134



>ref|WP_013075784.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae]
 ref|YP_003589642.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae 
DSM 2912]
 gb|ADG06498.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Kyrpidia tusciae 
DSM 2912]
Length=130

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+  PSI +    C+ QGA R+++ P+FL  G+H  +D+P +  EA + HPGI   +   
Sbjct  44   EITPPSIPEGIERCINQGAGRVVIVPYFLHLGKHVLRDLPRIIEEAGRRHPGIQIGLGGH  103

Query  373  LGVHELLVDVINDRIDHCLSHID  305
            LG    L  ++ +R +  L+ +D
Sbjct  104  LGYDPRLALIVEERAEQALAAMD  126



>ref|WP_025649473.1| sirohydrochlorin ferrochelatase [Bacillus methylotrophicus]
Length=261

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHQRIE  118



>ref|WP_007611315.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
 gb|EIF13120.1| SirB [Bacillus sp. 5B6]
Length=261

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIESGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_011434989.1| cobalamin biosynthesis protein CbiX [Frankia sp. CcI3]
 ref|YP_479642.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Frankia sp. 
CcI3]
 gb|ABD09913.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Frankia sp. 
CcI3]
 gb|ETA04378.1| hypothetical protein CcI6DRAFT_00152 [Frankia sp. CcI6]
 gb|EYT90220.1| hypothetical protein ThrDRAFT_04168 [Frankia sp. Thr]
 gb|KDA44924.1| hypothetical protein BMG523Draft_00048 [Frankia sp. BMG5.23]
 gb|KEZ38122.1| CbiX protein [Frankia sp. CeD]
 gb|KFB06575.1| CbiX protein [Frankia sp. Allo2]
Length=157

 Score = 63.5 bits (153),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+A+P I   +      G   I+  PFFLF G H ++DIP+    A   HP   ++++ P
Sbjct  55   EIAQPDIATGYATLADAGCTEIVAYPFFLFDGNHTRRDIPAALEGARCRHPTTRWVLSEP  114

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSV  281
            LG+H  +VD +  R+D  L  +   AD  ++
Sbjct  115  LGLHASVVDAVRARLDDTLRLLVREADAATL  145


 Score = 26.2 bits (56),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLR  552
            G++++ HGSRR E+N  +R
Sbjct  3    GLLVIGHGSRRDEANATVR  21



>ref|WP_024085290.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 ref|YP_008949971.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens LFB112]
 gb|AHC42091.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens LFB112]
Length=261

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKMTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_027410743.1| sirohydrochlorin ferrochelatase [Anoxybacillus tepidamans]
Length=248

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA+P +      CVQQGA RI+V P  L    H + DIP    +A + +P +  ++  P
Sbjct  42   ELADPDMMTGIERCVQQGATRIVVIPVLLLAAGHAKHDIPEAIQKALQRYPYLNIVLEQP  101

Query  373  LGVHELLVDVINDRIDH  323
             GVHE +V +I +RI  
Sbjct  102  FGVHEKMVQIIGERISE  118



>ref|WP_010857495.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus]
 gb|EON74343.1| sirohydrochlorin ferrochelatase [Lysinibacillus sphaericus OT4b.31]
Length=240

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I +   +C+Q+GA  I + P  L   +H + DIP    +A   +P + F    P
Sbjct  42   ELAEPTITEGIASCIQRGATAIAIMPILLLAAQHAKYDIPIEIEKAKIQYPTVRFTYGEP  101

Query  373  LGVHELLVDVINDRI  329
            LGVHELL+D ++ R+
Sbjct  102  LGVHELLIDTLHARV  116



>ref|WP_038457957.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 gb|AHZ15527.1| SirB [Bacillus amyloliquefaciens SQR9]
 gb|AIW37347.1| sirohydrochlorin ferrochelatase [Bacillus subtilis]
Length=261

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIESGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>dbj|BAQ12015.1| sirohydrochlorin cobaltochelatase [Bacillus sp. OxB-1]
Length=257

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 47/95 (49%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI      C++QGA  II  P  L    H + DIP    +A   +PGIP     P
Sbjct  42   ELAEPSIGQGIVRCIEQGATEIIAVPVLLLHAGHAKYDIPQALEQAIAPYPGIPLYYGEP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
             GVH  LV+V+ DR+      I  +A    V  G+
Sbjct  102  FGVHPQLVEVLVDRMVETAGGIPDDASVLIVGRGS  136



>ref|WP_036841580.1| sirohydrochlorin ferrochelatase, partial [Pontibacillus marinus]
Length=240

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL +P+++      VQQGA  II+ P  L    H+ +D+P       K +P + F    P
Sbjct  42   ELTDPTVQQGMERLVQQGATSIIIVPVLLLSAGHYFKDLPHEVEGFKKQYPNVTFRYAKP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            LGV E ++DV+ +RI+   S  + N D   V  G+
Sbjct  102  LGVQERIIDVLVERIEEVRSEPETNIDVLLVGRGS  136



>ref|WP_015417442.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 ref|YP_007497192.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5036]
 emb|CCP21526.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5036]
Length=261

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPTEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_033574587.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
Length=261

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPTEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_013780850.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Mahella australiensis]
 ref|YP_004463242.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Mahella australiensis 
50-1 BON]
 gb|AEE96420.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Mahella australiensis 
50-1 BON]
Length=138

 Score = 63.5 bits (153),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            +   P I++A NA V +G +RI++ P FLFPG H Q DIP+L     K +P    +++  
Sbjct  50   QFEHPDIEEAVNAMVGKGIKRIVLVPLFLFPGNHMQIDIPTLIDRMKKHYPNTEIVLSGY  109

Query  373  LGVHELLVDVINDRIDHCLSHIDG  302
            +G  + + D++ D+    ++ ++G
Sbjct  110  IGNDDRIADIVIDKALEGVARLNG  133


 Score = 25.8 bits (55),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -2

Query  611  DGVIIVDHGSRRKESNLMLRT  549
            DG++I+ HGSR  E++ +L++
Sbjct  10   DGILILAHGSRASEASYVLQS  30



>ref|WP_015388252.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 ref|YP_007445698.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens IT-45]
 gb|AGF27817.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens IT-45]
 gb|ERK83708.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens UASWS 
BA1]
Length=261

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_017417755.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_003154360.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 gb|EKE46971.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum M27]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_007409741.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus]
 ref|YP_007186297.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum AS43.3]
 ref|YP_008412516.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5033]
 gb|EJD66604.1| sirohydrochlorin ferrochelatase [Bacillus sp. 916]
 gb|AFZ90627.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum AS43.3]
 emb|CDG29489.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5033]
 gb|AHK49100.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
 gb|AIW29782.1| sirohydrochlorin ferrochelatase [Bacillus subtilis]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_012117524.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 ref|YP_001421139.1| SirB [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 ref|YP_008726864.1| sirB [Bacillus amyloliquefaciens CC178]
 gb|ABS73908.1| SirB [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 gb|AGZ56286.1| sirB [Bacillus amyloliquefaciens CC178]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_032874854.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 gb|KFX38674.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_014417735.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillus subtilis 
group]
 ref|YP_005420850.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
 ref|YP_006328436.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens Y2]
 ref|YP_008626849.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum NAU-B3]
 emb|CCG49534.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
 gb|AFJ61711.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens Y2]
 emb|CDH95988.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum NAU-B3]
 gb|KFI16158.1| sirohydrochlorin ferrochelatase [Bacillus subtilis]
 gb|AIU81693.1| Sirohydrochlorin ferrochelatase [Bacillus methylotrophicus]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_032871435.1| sirohydrochlorin ferrochelatase [Bacillus sp. UNC69MF]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_029973487.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillales]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_020955802.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 ref|YP_008420927.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5113]
 emb|CDG25795.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens subsp. 
plantarum UCMB5113]
 gb|ERH58848.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens EGD-AQ14]
 gb|EYB38165.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens EBL11]
 gb|AJC24013.1| sirohydrochlorin ferrochelatase [Bacillus sp. Pc3]
Length=261

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_025851338.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
 gb|KDN94507.1| sirohydrochlorin ferrochelatase [Bacillus amyloliquefaciens]
Length=261

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAEIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>ref|WP_025715977.1| sirohydrochlorin cobaltochelatase [Paenibacillus sp. 1-18]
Length=361

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL  PSI D   ACV++GA R+++ P  LF   H + DIP     A   HP + F+   P
Sbjct  42   ELTRPSIADGVQACVKRGATRVVLVPIILFAAGHAKIDIPMAIDRAKARHPQVEFVYGRP  101

Query  373  LGVHELLVDVINDRIDH  323
            +GVHE +V ++  R+  
Sbjct  102  IGVHEKIVSILQSRLKE  118


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -3

Query  550  LAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPL  371
            + +PS  D    CV+ GA++IIV P+FLF G   ++ I  +T E A+ HP +   I    
Sbjct  184  VTQPSFSDGLERCVRLGAKKIIVLPYFLFTGVLIKR-IGEMTEEFAEAHPELQVEIGGYF  242

Query  370  GVHELLVDVINDRIDHCL-SHIDGNADEC  287
            G H  LV+++ +R +  L   +  N D C
Sbjct  243  GFHPQLVELVLERANEGLFGKVAANCDNC  271



>ref|WP_033407066.1| cobalamin biosynthesis protein CbiX [Thiothrix disciformis]
Length=121

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI DA +ACV QGA  I++ P+FL  GRH  +D+P+L  E +  +P + F     
Sbjct  45   ELAEPSIPDAIDACVAQGATEIVIVPYFLSAGRHVAEDVPALVKERSLHYPQVRFEYVKH  104

Query  373  LG  368
            LG
Sbjct  105  LG  106



>ref|WP_035661689.1| hypothetical protein [Bacillus akibai]
 dbj|GAE33518.1| sirohydrochlorin ferrochelatase [Bacillus akibai JCM 9157]
Length=275

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I+D   AC+ +GA +I V P  L    H + DIP    E  K +P I F    P
Sbjct  43   ELAEPTIQDGVEACINKGATKIAVVPVLLLTAAHAKVDIPEAIDEMKKRYPSISFKYGRP  102

Query  373  LGVHELLVDVINDRI  329
            +G+   ++D+I +R+
Sbjct  103  IGIESTVIDIIKNRL  117



>gb|AIU76979.1| sirohydrochlorin ferrochelatase [Bacillus subtilis]
Length=261

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL EPSI+  F ACV+QGA  I   P  L    H + DIP+  A AA LHP I      P
Sbjct  43   ELQEPSIEAGFEACVRQGATHIAAVPLLLLTAAHAKHDIPAGIARAAALHPDIKVTYGVP  102

Query  373  LGVHELLVDVINDRID  326
            +GV + +V  ++ RI+
Sbjct  103  IGVDDEVVKAVHHRIE  118



>gb|KGX91813.1| sirohydrochlorin ferrochelatase [Pontibacillus marinus BH030004 
= DSM 16465]
Length=272

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL +P+++      VQQGA  II+ P  L    H+ +D+P       K +P + F    P
Sbjct  42   ELTDPTVQQGMERLVQQGATSIIIVPVLLLSAGHYFKDLPHEVEGFKKQYPNVTFRYAKP  101

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGT  269
            LGV E ++DV+ +RI+   S  + N D   V  G+
Sbjct  102  LGVQERIIDVLVERIEEVRSEPETNIDVLLVGRGS  136



>ref|WP_011936979.1| sirohydrochlorin cobaltochelatase [Geobacter uraniireducens]
 ref|YP_001228823.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
uraniireducens Rf4]
 gb|ABQ24250.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
uraniireducens Rf4]
Length=127

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -3

Query  541  PSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGVH  362
            P+I+   +ACV +GA RI++ P+FL+ G H  +D+P+   EA   +P +   +   LGVH
Sbjct  47   PNIQKGIDACVARGAERILLIPYFLYMGAHVLEDLPAELEEARVRYPRVEMAMGKHLGVH  106

Query  361  ELLVDVINDRIDHCLS  314
              L +++ DRI   L+
Sbjct  107  RKLAEIVVDRIAESLT  122



>ref|WP_003349638.1| sirohydrochlorin ferrochelatase [Bacillus methanolicus]
 gb|EIJ77754.1| cobalamin biosynthesis CbiX protein [Bacillus methanolicus MGA3]
 gb|AIE59852.1| Sirohydrochlorin ferrochelatase [Bacillus methanolicus MGA3]
Length=253

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I++A+  CVQ+GA RI+V P  L    H ++DIP+      K  P +  +   P
Sbjct  42   ELAAPTIEEAYEKCVQRGATRIVVLPVLLLTAVHAKEDIPNELERIRKRFPNVEMVYGRP  101

Query  373  LGVHELLVDVINDRI  329
            +GVH  ++D++ +R+
Sbjct  102  IGVHHHMIDILIERL  116



>ref|WP_036151054.1| sirohydrochlorin ferrochelatase [Lysinibacillus odysseyi]
 gb|KGR87766.1| sirohydrochlorin ferrochelatase [Lysinibacillus odysseyi 34hs-1 
= NBRC 100172]
Length=246

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEP+I     ACV+QGA  I V+P  L    H  +DIP    EA +  P + F I   
Sbjct  42   ELAEPTIMQGVAACVEQGATEIAVAPILLLTANHLNEDIPREIQEAKRKFPEVTFSIGQA  101

Query  373  LGVHELLVDVINDRIDHCLSHIDG  302
            LG+ + LV+V+  R++       G
Sbjct  102  LGIDDRLVNVLEQRLNESGESYTG  125



>ref|WP_002708045.1| cobalamin biosynthesis protein CbiX [Thiothrix nivea]
 gb|EIJ34103.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Thiothrix 
nivea DSM 5205]
Length=137

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELAEPSI +    C+ QGA  + + PFFL  GRH   D+P L  E  + HP I   +   
Sbjct  44   ELAEPSIPNGIQQCINQGATSVTIMPFFLSAGRHVVNDVPELVREKQREHPNIQIRMAPY  103

Query  373  LGVHELLVDVI  341
            LGV  L+ ++I
Sbjct  104  LGVSSLMPELI  114



>ref|WP_027140169.1| cobalamin biosynthesis protein CbiX [Frankia sp. CN3]
Length=131

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = -3

Query  544  EPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAPLGV  365
             P I D + A V  G   I+  PFFLF G+H  +DIP   A A   HP   + +T PLG+
Sbjct  55   RPDIADGYAALVTAGCTEIVAHPFFLFAGKHTARDIPDALAAAQARHPHTTWTVTEPLGL  114

Query  364  HELLVDVINDRI  329
            H  +V  +  RI
Sbjct  115  HPGVVATVRARI  126


 Score = 27.3 bits (59),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -2

Query  608  GVIIVDHGSRRKESNLMLR  552
            G++++ HGSRR+E+N  +R
Sbjct  3    GLLVIGHGSRREEANATVR  21



>dbj|BAL52372.1| cobalamin (vitamin B12) biosynthesis CbiX protein [uncultured 
planctomycete]
Length=147

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            E+AEP+I      C++ G   +I+ P+FL  GRH ++D+ S  A+AA  +P   F +   
Sbjct  51   EIAEPTIAQGIARCLEHGVSSVILVPYFLSAGRHVREDLESARAQAAHQYPQAKFFLAEA  110

Query  373  LGVHELLVDVINDRIDHCLSH  311
            LG H+LLV+++  RI   L +
Sbjct  111  LGPHDLLVELMVLRIQEVLKN  131



>dbj|GAF66320.1| hypothetical protein BTS2_3220 [Bacillus sp. TS-2]
Length=261

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL +PSI +    CV QGA  I V P  L    H ++DIP   ++A +L+P I F    P
Sbjct  43   ELEQPSILEGIKNCVDQGATVIAVMPILLLTAGHAKEDIPKEISKARELYPSIKFKYGRP  102

Query  373  LGVHELLVDVINDR-IDHCLSH--IDGNADE  290
             GV +L+VDV+  R I   L    IDG + E
Sbjct  103  FGVEKLIVDVLKQRLIATGLKEEAIDGKSKE  133



>emb|CEI81445.1| Sirohydrochlorin ferrochelatase [Oceanobacillus oncorhynchi]
Length=258

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 12/102 (12%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA PSI+   ++CV+QGA +I V P  L    H +QDIP    +A K +P I F     
Sbjct  43   ELASPSIQTGIDSCVRQGAAQIAVVPVLLLSAGHAKQDIPKEIEQAEKRYPDITFTYGKV  102

Query  373  LGVHELLVDVINDRIDHCLSHIDGNADECSVCAGTGKCQLYE  248
            +GV   ++D++N R+            E      TGK  +YE
Sbjct  103  MGVDPAIIDLLNKRL------------EMGGLKQTGKSPVYE  132



>ref|WP_003348076.1| sirohydrochlorin ferrochelatase [Bacillus methanolicus]
 gb|EIJ80924.1| sirohydrochlorin ferrochelatase [Bacillus methanolicus MGA3]
Length=229

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            ELA P+I++A+  CVQ+GA +I+V P  L    H ++DIP+      K  P +  +   P
Sbjct  42   ELAAPTIEEAYEKCVQRGATKIVVLPVLLLTAVHAKEDIPNELERIRKRFPNVEMVYGRP  101

Query  373  LGVHELLVDVINDRI  329
            +GVH  ++D++ +R+
Sbjct  102  IGVHHHMIDILIERL  116



>ref|WP_020469001.1| hypothetical protein [Zavarzinella formosa]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -3

Query  553  ELAEPSIKDAFNACVQQGARRIIVSPFFLFPGRHWQQDIPSLTAEAAKLHPGIPFIITAP  374
            EL  P I D    CV+ GA R+I+ P+FL  G H  +D+ +   E  K HPG  F +  P
Sbjct  53   ELCPPDIIDGGGICVEAGATRVILLPYFLSAGIHVVEDLTAARDELMKRHPGREFTVAEP  112

Query  373  LGVHELLVDVINDR  332
            LG H LL D++ +R
Sbjct  113  LGRHPLLTDIMLER  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2785043752688