BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25293_g1_i2 len=1284 path=[40:0-190 231:191-226 4831:227-230
4835:231-236 277:237-275 316:276-302 343:303-385 426:386-388
429:389-547 588:548-552 593:553-610 651:611-631 672:632-668
709:669-704 745:705-810 851:811-822 863:823-881 922:882-966
1007:967-1021 1062:1022-1033 1074:1034-1053 1094:1054-1217
1258:1218-1283]

Length=1284
                                                                      Score     E

gb|KHG22236.1|  Purine permease 1 -like protein                         403   1e-134   
gb|KDP41439.1|  hypothetical protein JCGZ_15846                         400   2e-133   
ref|XP_002285717.1|  PREDICTED: purine permease 1                       395   1e-131   Vitis vinifera
ref|XP_002285718.1|  PREDICTED: purine permease 1                       388   7e-129   Vitis vinifera
ref|XP_002513994.1|  purine transporter, putative                       388   9e-129   Ricinus communis
ref|XP_007018134.1|  Purine permease 3                                  387   2e-128   
gb|KHG06856.1|  Purine permease 1 -like protein                         385   3e-127   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                  383   6e-127   Vitis vinifera
gb|KHG13700.1|  Purine permease 3 -like protein                         382   2e-126   
ref|XP_011006371.1|  PREDICTED: purine permease 3                       381   6e-126   
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                   379   2e-125   Populus trichocarpa [western balsam poplar]
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg                378   6e-125   
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                  377   3e-124   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg                376   3e-124   
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                  376   3e-124   
emb|CDP19267.1|  unnamed protein product                                375   1e-123   
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                  375   1e-123   
emb|CDP01126.1|  unnamed protein product                                374   3e-123   
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                  372   4e-122   
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                  371   8e-122   
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                  370   1e-121   
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                  370   1e-121   
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                  369   6e-121   
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg             368   7e-121   
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                  367   1e-120   
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg             367   2e-120   
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1       367   2e-120   
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                  365   9e-120   
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                  365   1e-119   
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                  365   1e-119   
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg             363   7e-119   
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                  360   6e-118   
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                  360   1e-117   
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                  360   2e-117   
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg             359   2e-117   
emb|CDP08377.1|  unnamed protein product                                359   2e-117   
ref|XP_002893512.1|  ATPUP3                                             358   3e-117   
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                  359   5e-117   
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg                357   7e-117   
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                  357   1e-116   
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                  357   2e-116   
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                  353   5e-115   
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                  353   5e-115   
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                  352   1e-114   
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                  352   2e-114   
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                  349   1e-113   
emb|CDX94595.1|  BnaC07g10630D                                          349   1e-113   
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                  349   1e-113   
ref|NP_174143.1|  purine permease 3                                     348   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                  348   2e-113   
ref|XP_009102926.1|  PREDICTED: purine permease 3                       348   3e-113   
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                  348   3e-113   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2       348   3e-113   
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                  348   3e-113   
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                     352   5e-113   
ref|XP_007018133.1|  Purine permease 3, putative                        350   5e-113   
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                  348   6e-113   
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                  347   9e-113   
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g             347   1e-112   
gb|AES73111.2|  purine permease-like protein                            347   2e-112   
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1       346   4e-112   
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                  345   4e-112   
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                  345   4e-112   
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                  345   5e-112   
ref|XP_010098679.1|  Purine permease 3                                  346   5e-112   
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                  344   8e-112   
gb|KDP40942.1|  hypothetical protein JCGZ_24941                         343   2e-111   
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                  343   2e-111   
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                  343   2e-111   
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                  343   3e-111   
ref|XP_003602860.1|  Purine permease                                    346   3e-111   
ref|XP_008812219.1|  PREDICTED: purine permease 3-like                  343   4e-111   
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                  342   2e-110   
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                  341   2e-110   
emb|CDP11456.1|  unnamed protein product                                341   2e-110   
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                  341   2e-110   
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                  340   3e-110   
gb|ADP30798.1|  nicotine uptake permease 1                              339   8e-110   
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g             339   9e-110   
ref|XP_010460596.1|  PREDICTED: purine permease 3                       339   1e-109   
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                  340   1e-109   
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                  338   2e-109   
ref|XP_007042880.1|  Purine permease 3                                  341   2e-109   
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                  339   2e-109   
ref|XP_002531513.1|  purine transporter, putative                       339   2e-109   Ricinus communis
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                  338   2e-109   
gb|KDP40961.1|  hypothetical protein JCGZ_24960                         342   2e-109   
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    337   3e-109   
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg             337   5e-109   
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                  337   5e-109   
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                  337   6e-109   
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                    336   1e-108   
ref|XP_009109745.1|  PREDICTED: purine permease 1                       336   2e-108   
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg                336   2e-108   
gb|KGN64615.1|  hypothetical protein Csa_1G071290                       336   2e-108   
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                  335   3e-108   
gb|EPS67422.1|  hypothetical protein M569_07351                         334   4e-108   
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                  335   4e-108   
ref|XP_003615204.1|  Purine permease                                    335   7e-108   
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                  335   7e-108   
emb|CDY27947.1|  BnaCnng05320D                                          334   9e-108   
emb|CDY35722.1|  BnaC03g58430D                                          334   1e-107   
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                  334   1e-107   
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                    333   1e-107   
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                  333   2e-107   
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                  334   2e-107   
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                  333   2e-107   
ref|XP_007042882.1|  Purine permease 3 isoform 2                        333   2e-107   
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                  332   8e-107   
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                  332   8e-107   
gb|EPS65699.1|  hypothetical protein M569_09078                         330   1e-106   
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                  331   1e-106   
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                  330   2e-106   
ref|XP_010460601.1|  PREDICTED: purine permease 1                       330   3e-106   
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1            330   5e-106   
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                  329   7e-106   
ref|XP_007042881.1|  Purine permease 3 isoform 1                        328   9e-106   
gb|AES73112.2|  purine permease-like protein                            329   1e-105   
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                  329   2e-105   
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                  328   3e-105   
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg             328   6e-105   
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360             326   1e-104   
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                  326   1e-104   
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                  325   3e-104   
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1       325   4e-104   
ref|NP_174144.1|  purine permease 1                                     325   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAF64547.1|AF078531_1  purine permease                               325   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                  323   1e-103   
ref|XP_010413821.1|  PREDICTED: purine permease 2                       323   1e-103   
emb|CDY17197.1|  BnaA05g09910D                                          323   1e-103   
ref|XP_002881298.1|  ATPUP2                                             323   4e-103   
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg             322   6e-103   
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg             322   8e-103   
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2            321   1e-102   
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                  321   1e-102   
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                  322   1e-102   
emb|CDY12422.1|  BnaC08g09110D                                          319   1e-101   
emb|CDY29741.1|  BnaA01g19250D                                          318   3e-101   
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2       318   4e-101   
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                  318   6e-101   
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                  317   7e-101   
ref|XP_010549316.1|  PREDICTED: purine permease 3                       315   1e-100   
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1       317   7e-100   
emb|CDY16284.1|  BnaC01g23190D                                          315   8e-100   
gb|KCW51603.1|  hypothetical protein EUGRSUZ_J01095                     312   8e-100   
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                  313   2e-99    
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                  312   3e-99    
ref|NP_973592.1|  purine permease 2                                     310   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                  310   2e-98    
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    309   5e-98    
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                  307   3e-97    
gb|EMT19524.1|  Purine permease 3                                       306   5e-97    
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                  305   2e-96    
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                         306   2e-96    
gb|EAZ09425.1|  hypothetical protein OsI_31698                          305   4e-96    Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                       305   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100          304   8e-96    Sorghum bicolor [broomcorn]
dbj|BAD19737.1|  putative purine permease                               303   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                  303   2e-95    
dbj|BAJ86755.1|  predicted protein                                      302   3e-95    
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                  303   3e-95    
ref|NP_001131978.1|  uncharacterized protein LOC100193377               302   3e-95    Zea mays [maize]
ref|NP_180931.2|  purine permease 2                                     302   4e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAC69140.1|  hypothetical protein                                    301   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                  300   2e-94    
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                  299   6e-94    
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1       299   6e-94    
dbj|BAK04933.1|  predicted protein                                      299   9e-94    
ref|NP_001063425.1|  Os09g0467400                                       298   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EEC84724.1|  hypothetical protein OsI_31699                          298   1e-93    Oryza sativa Indica Group [Indian rice]
ref|NP_001147096.1|  PUP1                                               298   3e-93    Zea mays [maize]
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                  297   3e-93    
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...    295   2e-92    
emb|CDP16579.1|  unnamed protein product                                289   2e-91    
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                  293   3e-91    
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                  290   2e-90    
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890          288   6e-90    
ref|XP_010234594.1|  PREDICTED: purine permease 3-like isoform X2       288   1e-89    
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                  287   1e-89    
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                  287   9e-89    
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                    283   2e-88    
dbj|BAJ87663.1|  predicted protein                                      284   1e-87    
dbj|BAJ88843.1|  predicted protein                                      284   2e-87    
dbj|BAJ94351.1|  predicted protein                                      283   2e-87    
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090          282   2e-87    
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                  282   3e-87    
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                  281   5e-87    
emb|CDY15687.1|  BnaA07g08580D                                          278   2e-86    
ref|XP_004158055.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    277   3e-86    
emb|CDX90135.1|  BnaA08g18490D                                          273   2e-84    
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624              275   3e-84    
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090          274   3e-84    Sorghum bicolor [broomcorn]
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1       270   1e-82    
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                  270   1e-82    
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660          269   2e-82    
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg             268   3e-82    
gb|EPS72255.1|  hypothetical protein M569_02503                         264   4e-82    
gb|EPS58788.1|  hypothetical protein M569_16026                         265   2e-81    
ref|XP_002301070.2|  hypothetical protein POPTR_0002s09980g             265   5e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                  263   1e-80    
gb|ABR16841.1|  unknown                                                 264   2e-80    Picea sitchensis
ref|XP_009631999.1|  PREDICTED: purine permease 1-like                  263   5e-80    
emb|CDP01096.1|  unnamed protein product                                263   7e-80    
ref|XP_010098677.1|  Purine permease 3                                  256   1e-78    
gb|EPS74474.1|  hypothetical protein M569_00285                         258   1e-78    
emb|CDY35721.1|  BnaC03g58420D                                          258   1e-78    
ref|XP_009762898.1|  PREDICTED: purine permease 3-like                  256   1e-77    
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                  251   8e-77    
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                  253   2e-76    
gb|KCW66597.1|  hypothetical protein EUGRSUZ_F00391                     248   1e-75    
ref|XP_002513954.1|  purine transporter, putative                       251   2e-75    Ricinus communis
ref|XP_011016754.1|  PREDICTED: purine permease 1-like                  243   1e-72    
ref|XP_009801738.1|  PREDICTED: purine permease 1-like isoform X1       241   4e-72    
ref|XP_004252530.1|  PREDICTED: purine permease 1-like                  241   2e-71    
gb|EEE69873.1|  hypothetical protein OsJ_29687                          240   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006360267.1|  PREDICTED: purine permease 1-like                  240   3e-71    
gb|EPS58881.1|  hypothetical protein M569_15932                         238   1e-70    
ref|XP_006360266.1|  PREDICTED: purine permease 1-like                  238   2e-70    
ref|XP_009801739.1|  PREDICTED: purine permease 1-like isoform X2       231   9e-69    
ref|XP_010418647.1|  PREDICTED: purine permease 2-like                  229   1e-68    
ref|XP_010939716.1|  PREDICTED: purine permease 1-like isoform X1       233   4e-68    
ref|XP_009789614.1|  PREDICTED: purine permease 1-like                  229   6e-68    
ref|XP_008779125.1|  PREDICTED: purine permease 1-like                  228   1e-67    
ref|XP_009801740.1|  PREDICTED: purine permease 1-like isoform X3       225   4e-67    
ref|XP_004985414.1|  PREDICTED: purine permease 3-like                  224   4e-65    
emb|CBI19192.3|  unnamed protein product                                218   2e-63    
dbj|BAG88745.1|  unnamed protein product                                216   1e-62    Oryza sativa Japonica Group [Japonica rice]
gb|EMS63809.1|  Purine permease 3                                       214   5e-62    
ref|XP_003602861.1|  Purine permease                                    210   1e-60    
gb|KHN08969.1|  Purine permease 1                                       207   2e-60    
ref|XP_009380885.1|  PREDICTED: purine permease 1-like                  206   2e-59    
ref|XP_006661331.1|  PREDICTED: purine permease 3-like                  205   6e-59    
gb|ABR16480.1|  unknown                                                 207   2e-58    Picea sitchensis
ref|XP_002977418.1|  hypothetical protein SELMODRAFT_417454             206   4e-58    
tpg|DAA40289.1|  TPA: hypothetical protein ZEAMMB73_258363              201   2e-57    
gb|EAZ09428.1|  hypothetical protein OsI_31702                          200   3e-57    Oryza sativa Indica Group [Indian rice]
gb|EEE69876.1|  hypothetical protein OsJ_29691                          200   5e-57    Oryza sativa Japonica Group [Japonica rice]
gb|EEC84725.1|  hypothetical protein OsI_31703                          197   3e-56    Oryza sativa Indica Group [Indian rice]
dbj|BAJ96346.1|  predicted protein                                      201   4e-56    
ref|NP_001063426.2|  Os09g0467500                                       197   4e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959528.1|  PREDICTED: purine permease 2-like                  197   5e-56    
emb|CDP05635.1|  unnamed protein product                                192   3e-55    
ref|XP_006826553.1|  hypothetical protein AMTR_s02825p00003100          194   4e-55    
gb|EMS56378.1|  hypothetical protein TRIUR3_06439                       199   5e-55    
ref|XP_002977419.1|  hypothetical protein SELMODRAFT_417455             197   7e-55    
ref|XP_002465736.1|  hypothetical protein SORBIDRAFT_01g044690          196   2e-54    Sorghum bicolor [broomcorn]
ref|XP_004959524.1|  PREDICTED: purine permease 2-like                  191   8e-54    
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770          195   8e-54    
dbj|BAJ95836.1|  predicted protein                                      195   9e-54    
gb|KHN08292.1|  Purine permease 1                                       188   1e-53    
ref|XP_002993859.1|  hypothetical protein SELMODRAFT_236829             192   2e-53    
ref|XP_002991403.1|  hypothetical protein SELMODRAFT_236291             192   5e-53    
ref|XP_002975003.1|  hypothetical protein SELMODRAFT_232471             189   9e-53    
emb|CDY72169.1|  BnaCnng76300D                                          186   4e-52    
gb|EAY88839.1|  hypothetical protein OsI_10311                          191   5e-52    Oryza sativa Indica Group [Indian rice]
gb|KDP45955.1|  hypothetical protein JCGZ_11858                         190   6e-52    
ref|NP_001049213.1|  Os03g0187800                                       190   6e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959529.1|  PREDICTED: purine permease 2-like                  186   9e-52    
ref|XP_004979831.1|  PREDICTED: purine permease 3-like                  188   2e-51    
ref|XP_010941200.1|  PREDICTED: probable purine permease 11             188   3e-51    
ref|NP_001136854.1|  hypothetical protein                               188   4e-51    Zea mays [maize]
gb|EYU34538.1|  hypothetical protein MIMGU_mgv1a019697mg                179   2e-50    
ref|XP_010247689.1|  PREDICTED: probable purine permease 11             184   9e-50    
ref|XP_010100973.1|  hypothetical protein L484_010628                   184   1e-49    
ref|XP_003558629.1|  PREDICTED: purine permease 3-like                  184   1e-49    
ref|XP_008225353.1|  PREDICTED: probable purine permease 9              184   1e-49    
ref|XP_003561966.2|  PREDICTED: purine permease 3-like                  184   1e-49    
ref|XP_008651823.1|  PREDICTED: purine permease 3                       183   2e-49    
ref|XP_004985416.1|  PREDICTED: purine permease 3-like                  183   2e-49    
ref|XP_004985415.1|  PREDICTED: purine permease 3-like                  183   3e-49    
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...    182   4e-49    
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...    182   4e-49    
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...    182   4e-49    
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein    181   5e-49    
emb|CDP13405.1|  unnamed protein product                                182   6e-49    
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400          182   8e-49    Sorghum bicolor [broomcorn]
ref|XP_007155747.1|  hypothetical protein PHAVU_003G228300g             181   1e-48    
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like        181   1e-48    
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like        181   1e-48    
emb|CDY46618.1|  BnaA09g27450D                                          176   2e-48    
ref|XP_004246178.1|  PREDICTED: probable purine permease 11             181   2e-48    
gb|KGN66057.1|  hypothetical protein Csa_1G569340                       180   2e-48    
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...    180   3e-48    
ref|XP_002973993.1|  hypothetical protein SELMODRAFT_232165             179   3e-48    
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...    180   4e-48    
ref|XP_004295379.1|  PREDICTED: probable purine permease 9-like         179   7e-48    
ref|XP_002983502.1|  hypothetical protein SELMODRAFT_118529             177   1e-47    
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg             179   1e-47    
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...    180   2e-47    
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...    177   2e-47    
ref|XP_006373040.1|  hypothetical protein POPTR_0017s07610g             173   3e-47    
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg             177   4e-47    
ref|XP_004245857.1|  PREDICTED: probable purine permease 11             177   4e-47    
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g             177   5e-47    
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg             177   5e-47    
ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        176   5e-47    
ref|XP_010055380.1|  PREDICTED: probable purine permease 11             176   5e-47    
dbj|BAJ95311.1|  predicted protein                                      177   6e-47    
ref|XP_006358633.1|  PREDICTED: probable purine permease 11-like        176   7e-47    
ref|NP_001241384.1|  uncharacterized protein LOC100819409               176   8e-47    
ref|XP_006651115.1|  PREDICTED: purine permease 3-like                  176   8e-47    
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like        176   9e-47    
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             176   1e-46    
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like        176   1e-46    
gb|AFK45074.1|  unknown                                                 175   1e-46    
ref|XP_011007507.1|  PREDICTED: probable purine permease 10             176   1e-46    
ref|XP_010091777.1|  hypothetical protein L484_003837                   176   2e-46    
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...    174   2e-46    
gb|KHN21034.1|  Putative purine permease 9                              175   3e-46    
ref|XP_009400212.1|  PREDICTED: probable purine permease 11             174   3e-46    
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...    174   4e-46    
emb|CDP06315.1|  unnamed protein product                                174   6e-46    
tpg|DAA43787.1|  TPA: hypothetical protein ZEAMMB73_057798              172   6e-46    
ref|XP_007138880.1|  hypothetical protein PHAVU_009G245400g             174   7e-46    
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...    173   9e-46    
ref|XP_010098678.1|  Purine permease 1                                  174   1e-45    
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...    173   1e-45    
gb|EMT19164.1|  hypothetical protein F775_05921                         173   1e-45    
gb|AGV54805.1|  purine permease 4-like protein                          174   1e-45    
gb|EMT19334.1|  Purine permease 3                                       171   1e-45    
ref|XP_007138881.1|  hypothetical protein PHAVU_009G245500g             173   2e-45    
ref|XP_007025158.1|  Purine permease 10                                 173   2e-45    
ref|XP_008450060.1|  PREDICTED: probable purine permease 10 isofo...    171   2e-45    
ref|XP_004492883.1|  PREDICTED: probable purine permease 11-like ...    172   2e-45    
gb|AFK38153.1|  unknown                                                 171   3e-45    
ref|XP_004492882.1|  PREDICTED: probable purine permease 11-like ...    172   3e-45    
gb|KEH37326.1|  triose-phosphate transporter family protein             172   3e-45    
ref|XP_010110511.1|  hypothetical protein L484_023343                   172   4e-45    
ref|XP_008450056.1|  PREDICTED: probable purine permease 10 isofo...    171   5e-45    
gb|KEH37325.1|  triose-phosphate transporter family protein             171   5e-45    
ref|XP_010091784.1|  hypothetical protein L484_003844                   172   6e-45    
ref|XP_009759913.1|  PREDICTED: probable purine permease 4              171   7e-45    
ref|XP_008652813.1|  PREDICTED: purine permease 2-like                  167   1e-44    
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like        170   1e-44    
ref|XP_002462516.1|  hypothetical protein SORBIDRAFT_02g027110          168   2e-44    
dbj|BAG93087.1|  unnamed protein product                                169   2e-44    
ref|XP_009766627.1|  PREDICTED: probable purine permease 11 isofo...    169   2e-44    
ref|XP_004166556.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    169   2e-44    
ref|XP_009766626.1|  PREDICTED: probable purine permease 11 isofo...    169   2e-44    
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg             169   3e-44    
gb|EEC73811.1|  hypothetical protein OsI_08525                          169   3e-44    
gb|KHN26582.1|  Putative purine permease 4                              169   4e-44    
dbj|BAD07671.1|  putative purine permease                               169   5e-44    
ref|NP_001047783.1|  Os02g0689200                                       169   5e-44    
ref|XP_008444266.1|  PREDICTED: probable purine permease 10             168   6e-44    
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                  168   6e-44    
ref|XP_010655638.1|  PREDICTED: probable purine permease 10 isofo...    167   6e-44    
ref|XP_009421222.1|  PREDICTED: probable purine permease 11             168   7e-44    
ref|XP_008225352.1|  PREDICTED: probable purine permease 10             168   7e-44    
ref|XP_007025152.1|  Purine permease 10 isoform 1                       168   7e-44    
gb|KDP37934.1|  hypothetical protein JCGZ_04577                         169   7e-44    
ref|XP_009604157.1|  PREDICTED: probable purine permease 11 isofo...    167   8e-44    
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             167   8e-44    
ref|XP_009604158.1|  PREDICTED: probable purine permease 11 isofo...    167   9e-44    
ref|XP_002298513.2|  hypothetical protein POPTR_0001s34550g             168   1e-43    
gb|EAZ24234.1|  hypothetical protein OsJ_07985                          169   1e-43    
ref|XP_003534853.1|  PREDICTED: probable purine permease 4-like         168   1e-43    
gb|ADN34099.1|  purine transmembrane transporter                        167   1e-43    
ref|XP_002272204.1|  PREDICTED: probable purine permease 10 isofo...    167   2e-43    
ref|XP_009608566.1|  PREDICTED: probable purine permease 10 isofo...    167   3e-43    
ref|XP_009608565.1|  PREDICTED: probable purine permease 9 isofor...    167   3e-43    
ref|XP_008229522.1|  PREDICTED: probable purine permease 11             166   3e-43    
ref|XP_007214484.1|  hypothetical protein PRUPE_ppa020615mg             165   4e-43    
gb|KHN40504.1|  Putative purine permease 11                             164   4e-43    
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...    166   4e-43    
ref|NP_193556.1|  putative purine permease 9                            165   5e-43    
ref|XP_009782581.1|  PREDICTED: probable purine permease 10 isofo...    166   6e-43    
ref|XP_002320858.2|  purine permease family protein                     165   6e-43    
ref|XP_009782582.1|  PREDICTED: probable purine permease 10 isofo...    166   6e-43    
ref|XP_010680002.1|  PREDICTED: probable purine permease 11             166   7e-43    
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...    166   7e-43    
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...    166   8e-43    
ref|XP_004151104.1|  PREDICTED: probable purine permease 9-like i...    164   8e-43    
ref|XP_008371579.1|  PREDICTED: probable purine permease 10             166   9e-43    
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       164   1e-42    
ref|XP_010058075.1|  PREDICTED: probable purine permease 4              165   1e-42    
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like        164   2e-42    
emb|CAN64869.1|  hypothetical protein VITISV_041328                     164   2e-42    
gb|KHN31656.1|  Putative purine permease 9                              164   2e-42    
sp|O49726.2|PUP9_ARATH  RecName: Full=Probable purine permease 9;...    165   2e-42    
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like        164   2e-42    
ref|XP_006841264.1|  hypothetical protein AMTR_s00135p00104240          162   2e-42    
ref|XP_006602140.1|  PREDICTED: probable purine permease 9-like i...    164   2e-42    
ref|XP_004151103.1|  PREDICTED: probable purine permease 9-like i...    164   2e-42    
ref|XP_009622283.1|  PREDICTED: probable purine permease 4 isofor...    164   2e-42    
ref|XP_010052098.1|  PREDICTED: probable purine permease 9              164   3e-42    
ref|XP_004508992.1|  PREDICTED: probable purine permease 10-like        166   3e-42    
ref|XP_007139692.1|  hypothetical protein PHAVU_008G051100g             164   4e-42    
gb|KCW75957.1|  hypothetical protein EUGRSUZ_D00325                     164   4e-42    
ref|XP_006602139.1|  PREDICTED: probable purine permease 9-like i...    164   6e-42    
ref|XP_007212398.1|  hypothetical protein PRUPE_ppa016371mg             162   6e-42    
ref|XP_003551463.1|  PREDICTED: probable purine permease 9-like i...    164   7e-42    
ref|XP_003525599.1|  PREDICTED: probable purine permease 10-like        162   8e-42    
ref|XP_009115035.1|  PREDICTED: probable purine permease 4              163   9e-42    
ref|XP_010519027.1|  PREDICTED: probable purine permease 4              162   9e-42    
ref|XP_009115032.1|  PREDICTED: probable purine permease 4              162   1e-41    
ref|XP_004293485.1|  PREDICTED: probable purine permease 9-like i...    162   1e-41    
ref|XP_010538524.1|  PREDICTED: probable purine permease 10             162   1e-41    
ref|XP_007025155.1|  Drug/metabolite transporter superfamily prot...    160   1e-41    
ref|XP_008226761.1|  PREDICTED: probable purine permease 10             162   1e-41    
ref|XP_004135778.1|  PREDICTED: probable purine permease 10-like        160   1e-41    
ref|XP_004293484.1|  PREDICTED: probable purine permease 9-like i...    162   1e-41    
ref|XP_002462517.1|  hypothetical protein SORBIDRAFT_02g027120          159   1e-41    
ref|XP_004307271.1|  PREDICTED: probable purine permease 11-like        163   2e-41    
ref|XP_002870060.1|  purine permease family protein                     161   2e-41    
ref|XP_006307602.1|  hypothetical protein CARUB_v10009226mg             162   2e-41    
ref|XP_003532171.1|  PREDICTED: probable purine permease 9-like         162   2e-41    
ref|XP_002263453.2|  PREDICTED: probable purine permease 4              161   2e-41    
ref|XP_007146627.1|  hypothetical protein PHAVU_006G056200g             162   2e-41    
gb|ACU17999.1|  unknown                                                 162   3e-41    
gb|KDP28910.1|  hypothetical protein JCGZ_14681                         160   4e-41    
ref|XP_009775721.1|  PREDICTED: probable purine permease 11             160   5e-41    
ref|XP_010439889.1|  PREDICTED: probable purine permease 9              160   5e-41    
emb|CDP09375.1|  unnamed protein product                                160   6e-41    
gb|KDP20127.1|  hypothetical protein JCGZ_05896                         160   9e-41    
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                  160   9e-41    
ref|XP_010517569.1|  PREDICTED: probable purine permease 9              160   1e-40    
ref|XP_010460900.1|  PREDICTED: probable purine permease 4              159   1e-40    
ref|XP_009799236.1|  PREDICTED: probable purine permease 4              160   1e-40    
ref|XP_011096513.1|  PREDICTED: probable purine permease 9              159   1e-40    
gb|KEH31564.1|  purine permease                                         160   1e-40    
ref|XP_002274345.2|  PREDICTED: probable purine permease 10             159   2e-40    
ref|XP_009622284.1|  PREDICTED: probable purine permease 4 isofor...    159   2e-40    
ref|XP_008450621.1|  PREDICTED: probable purine permease 11 isofo...    157   2e-40    
ref|XP_004248514.2|  PREDICTED: probable purine permease 4              158   2e-40    
ref|XP_004248513.1|  PREDICTED: probable purine permease 4              159   3e-40    
ref|XP_010100975.1|  hypothetical protein L484_010630                   164   3e-40    
ref|XP_010926345.1|  PREDICTED: purine permease 1-like isoform X2       155   3e-40    
ref|XP_010499636.1|  PREDICTED: probable purine permease 4 isofor...    158   3e-40    
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg             157   3e-40    
ref|XP_006355608.1|  PREDICTED: probable purine permease 6-like i...    158   4e-40    
gb|EYU35321.1|  hypothetical protein MIMGU_mgv1a008781mg                157   4e-40    
ref|XP_008225422.1|  PREDICTED: probable purine permease 9              158   4e-40    
ref|XP_006355607.1|  PREDICTED: probable purine permease 6-like i...    158   4e-40    
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...    158   4e-40    
ref|XP_010092275.1|  hypothetical protein L484_021136                   158   5e-40    
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg             157   5e-40    
ref|XP_007052418.1|  Purine permease 11 isoform 2                       157   5e-40    
ref|XP_009591151.1|  PREDICTED: probable purine permease 11             157   6e-40    
ref|XP_010478523.1|  PREDICTED: probable purine permease 4 isofor...    157   7e-40    
ref|XP_007025157.1|  Purine permease 10, putative                       157   7e-40    
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...    156   8e-40    
ref|XP_011085269.1|  PREDICTED: probable purine permease 10             156   9e-40    
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                  156   9e-40    
ref|XP_007052417.1|  Purine permease 11 isoform 1                       157   9e-40    
ref|XP_006579668.1|  PREDICTED: probable purine permease 11-like        155   9e-40    
gb|KCW71838.1|  hypothetical protein EUGRSUZ_E00319                     155   9e-40    
ref|XP_010677220.1|  PREDICTED: probable purine permease 11             157   1e-39    
ref|XP_002890908.1|  hypothetical protein ARALYDRAFT_473325             157   1e-39    
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg             156   1e-39    
emb|CBI30830.3|  unnamed protein product                                159   1e-39    
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...    156   1e-39    
ref|XP_002519731.1|  purine transporter, putative                       156   1e-39    
ref|XP_010434561.1|  PREDICTED: probable purine permease 9              156   1e-39    
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                  155   2e-39    
ref|XP_004295378.1|  PREDICTED: probable purine permease 9-like         156   2e-39    
ref|XP_008364183.1|  PREDICTED: probable purine permease 9              156   2e-39    
ref|XP_010666510.1|  PREDICTED: probable purine permease 9              158   2e-39    
ref|XP_002447006.1|  hypothetical protein SORBIDRAFT_06g026780          156   2e-39    
ref|XP_010674209.1|  PREDICTED: probable purine permease 11 isofo...    155   2e-39    
ref|XP_008383506.1|  PREDICTED: probable purine permease 9              156   2e-39    
ref|XP_009407088.1|  PREDICTED: probable purine permease 4              157   2e-39    
ref|XP_010674210.1|  PREDICTED: probable purine permease 11 isofo...    155   2e-39    
ref|XP_011007506.1|  PREDICTED: probable purine permease 9 isofor...    154   3e-39    
ref|XP_008364779.1|  PREDICTED: probable purine permease 11 isofo...    155   3e-39    
ref|NP_564365.1|  purine permease 4                                     155   3e-39    
ref|XP_010663907.1|  PREDICTED: probable purine permease 11             155   3e-39    
ref|XP_011083977.1|  PREDICTED: probable purine permease 5              155   4e-39    
ref|XP_008364778.1|  PREDICTED: probable purine permease 11 isofo...    155   4e-39    
ref|XP_006282809.1|  hypothetical protein CARUB_v10006525mg             155   4e-39    
ref|XP_007149374.1|  hypothetical protein PHAVU_005G064800g             155   4e-39    
ref|XP_004233085.1|  PREDICTED: probable purine permease 10             155   5e-39    
ref|XP_004488889.1|  PREDICTED: probable purine permease 5-like         154   6e-39    
dbj|BAJ85920.1|  predicted protein                                      156   6e-39    
ref|XP_002529375.1|  purine transporter, putative                       154   6e-39    
ref|XP_010559253.1|  PREDICTED: probable purine permease 8              155   6e-39    
gb|KDO59449.1|  hypothetical protein CISIN_1g017963mg                   154   8e-39    
ref|XP_011089061.1|  PREDICTED: probable purine permease 4              154   8e-39    
ref|XP_010434560.1|  PREDICTED: probable purine permease 10             154   8e-39    
ref|XP_011007505.1|  PREDICTED: probable purine permease 9 isofor...    154   9e-39    
ref|XP_006453625.1|  hypothetical protein CICLE_v10008754mg             154   9e-39    
ref|XP_004488230.1|  PREDICTED: probable purine permease 4-like         153   9e-39    
ref|XP_008784692.1|  PREDICTED: probable purine permease 11             154   1e-38    
gb|EPS62038.1|  hypothetical protein M569_12755                         153   1e-38    
ref|XP_006449636.1|  hypothetical protein CICLE_v10015531mg             154   1e-38    
ref|XP_010439888.1|  PREDICTED: probable purine permease 10             154   1e-38    
dbj|BAJ88177.1|  predicted protein                                      155   1e-38    
ref|XP_010274633.1|  PREDICTED: probable purine permease 11             152   1e-38    
ref|XP_010517571.1|  PREDICTED: probable purine permease 10             154   1e-38    
ref|XP_006414134.1|  hypothetical protein EUTSA_v10025416mg             154   1e-38    
ref|XP_006857228.1|  hypothetical protein AMTR_s00065p00208130          151   2e-38    
ref|NP_193555.3|  purine permease 10                                    153   2e-38    
gb|EEC77872.1|  hypothetical protein OsI_17156                          153   2e-38    
ref|XP_006473996.1|  PREDICTED: probable purine permease 5-like         152   2e-38    
ref|XP_010052099.1|  PREDICTED: probable purine permease 9              154   3e-38    
emb|CDY08899.1|  BnaC08g11290D                                          153   3e-38    
ref|NP_001053690.1|  Os04g0587300                                       153   3e-38    
gb|KFK41670.1|  hypothetical protein AALP_AA2G157700                    153   3e-38    
ref|XP_004516108.1|  PREDICTED: probable purine permease 9-like         153   3e-38    
ref|XP_006467517.1|  PREDICTED: probable purine permease 9-like         153   3e-38    



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 229/352 (65%), Positives = 289/352 (82%), Gaps = 7/352 (2%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME +   T+R+ LL ++CIILSIGNCGGPL+ RLYF+ GGNRIWFSSWLQTAG P+I +P
Sbjct  1     MEVKDGGTIRKALLVINCIILSIGNCGGPLITRLYFIHGGNRIWFSSWLQTAGCPIILLP  60

Query  1071  LLVSY-HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             +  +Y HR R A  D +S+++ F +  P L IAA +LG+L G+DNYFYSYG+++LPVSTS
Sbjct  61    IACAYVHRSRTA--DPTSENKVFCMERP-LFIAAIVLGILSGLDNYFYSYGLSRLPVSTS  117

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SLI+A+QL FTAGFAFLLVKQKFTA+S NAV LLT+GA VL L + SDRPA ESNK Y+L
Sbjct  118   SLIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPANESNKEYIL  177

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GFVMT+AAAALYG ILPL+EL+Y KAK Q +S++LV+E Q++M  V T F TVGM++N D
Sbjct  178   GFVMTLAAAALYGFILPLVELTYKKAK-QEISYALVMEIQLVMCLVATAFCTVGMLVNND  236

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+VI REAREFELG TKYY++A+F+AI+WQFFF+GA+GV+   SSLLS ++++VLLPVTE
Sbjct  237   FKVIGREAREFELGETKYYIVAIFSAIIWQFFFLGAIGVVFCASSLLSGVVISVLLPVTE  296

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTS  199
             ILAV F++EKF+AEKG+SL LS+WGF+SYFYGDIK  K    + + ETEM S
Sbjct  297   ILAVFFFNEKFQAEKGVSLALSLWGFLSYFYGDIKRIK--TKKPTPETEMAS  346



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 278/349 (80%), Gaps = 4/349 (1%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             + TMRR LL L+C+ILSIGNCGGPL++RLYF+ GG R+W SSWL+TAG+P+IFIPLL+SY
Sbjct  12    KATMRRALLVLNCVILSIGNCGGPLIMRLYFIHGGKRVWLSSWLETAGWPIIFIPLLISY  71

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
               RR   S     + K F + P L +AA  +G+L G D+Y Y+YG+A+LPVSTSSLI+AT
Sbjct  72    FHRR---STTDPTTAKLFYMKPSLFLAATGIGILTGFDDYLYAYGVARLPVSTSSLIIAT  128

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FTAGFAFLLVKQKFT++S NAVVLLTVGA VL L   SDRP  ES K Y LGFVMT+
Sbjct  129   QLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLALHTSSDRPEHESKKEYNLGFVMTL  188

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
              AA LYGLILPL+EL+Y KAK Q +S++LV+E QMIM    T+  TVGM++N DF+VIPR
Sbjct  189   GAAVLYGLILPLVELTYRKAK-QEISYTLVMEIQMIMCLFATVVCTVGMLVNNDFKVIPR  247

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EA+EFELG TKYYV+ V++AI+WQ FF+GA+G++   SSL S +++AVLLPVTEILAVIF
Sbjct  248   EAKEFELGETKYYVIMVWSAIIWQCFFLGAIGIVFCASSLASGVVIAVLLPVTEILAVIF  307

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             Y EKF+AEKG++L LS+WGF+SYFYG+IK +KK N  S  ET  +S PT
Sbjct  308   YQEKFQAEKGVALALSLWGFLSYFYGEIKQSKKTNLTSEIETSESSIPT  356



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 284/349 (81%), Gaps = 6/349 (2%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME Q  + MR+ LL L+C+ILSIGNCGGP+++RLYF+RGG RIWFSSWL+TAG+P+I +P
Sbjct  1     MEAQLSSNMRKALLVLNCVILSIGNCGGPMVMRLYFVRGGERIWFSSWLETAGWPLILVP  60

Query  1071  LLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             L+++Y  RR   + + S ++ FF+  P L +A+A++GVL G D+Y Y+YG+AKLPVSTS+
Sbjct  61    LIITYIHRR---TKQGSHAKLFFMKPP-LFVASAVIGVLTGFDDYLYAYGVAKLPVSTSA  116

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+A+QL FTA FAFLLVKQKFT++S NA+ LL++GA VL L   SDRPA ESNK Y LG
Sbjct  117   LIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLG  176

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             FVMT+AAAALYG ILPL+EL+Y KAK QA+++SLV+E QM+M F  T+F TVGM++N DF
Sbjct  177   FVMTLAAAALYGFILPLVELTYKKAK-QAITYSLVMEIQMVMCFFATVFCTVGMLVNNDF  235

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + I REA+E+ELG  KYY++ V+  I+WQ FF+GA+GVI   SSL+  +++AVLLPVTEI
Sbjct  236   QAISREAKEYELGEAKYYLVVVWNGIIWQCFFLGAIGVIFSASSLVCGIVIAVLLPVTEI  295

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             LAVIF+ EKF+AEKG+SL LS+WGFVSYFYG+IK++KK  N +  ETE+
Sbjct  296   LAVIFFQEKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTP-ETEL  343



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 285/351 (81%), Gaps = 6/351 (2%)
 Frame = -1

Query  1257  LKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIF  1078
             +++E Q  +  R+ LL LSC+ILSIG+CGGPL++RLYF+RGG RIWFSSWL+TAG+P+I 
Sbjct  1     MEVEAQLSSNTRKALLVLSCVILSIGHCGGPLVMRLYFVRGGERIWFSSWLETAGWPLIL  60

Query  1077  IPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVST  898
             +PL+++Y  RR   + + S ++ FF+  P L +A+A++GVL  +D+Y Y+YG+AKLPVST
Sbjct  61    VPLIITYMHRR---TKQGSHAKLFFMKPP-LFVASAVIGVLTALDDYLYAYGVAKLPVST  116

Query  897   SSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYL  718
              +LI+A+QL FTA FAFLLVKQKFT++S NA+ LL++GA VL L   SDRPA ESNK Y 
Sbjct  117   IALIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYY  176

Query  717   LGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINK  538
             LGF MT+AAAALYG ILPL+EL+Y KAK QA+++SLV+E QM+M F  T F TVGM++N 
Sbjct  177   LGFFMTLAAAALYGFILPLVELTYKKAK-QAITYSLVMEIQMVMCFFATFFCTVGMLVNN  235

Query  537   DFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVT  358
             DF+ IPREA+E+ELG  KYY++ V+  I+WQ F++GA+GVI   SSL++ +++AVLLPVT
Sbjct  236   DFQAIPREAKEYELGEAKYYLVVVWNGIMWQCFYLGAIGVIFCASSLVAGIVLAVLLPVT  295

Query  357   EILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             EILAVIF+H+KF+AEKG+SL LS+WGFVSYFYG+IK++KK  N +  ETE+
Sbjct  296   EILAVIFFHDKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTP-ETEL  345



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score =   388 bits (997),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 220/356 (62%), Positives = 276/356 (78%), Gaps = 7/356 (2%)
 Frame = -1

Query  1254  KMEGQTRT-TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIF  1078
             K E Q  T T +R LL L+CI+LSIGNCGGPL++RLYF+ GG R+W SSWL+T G+P++ 
Sbjct  4     KQEPQANTSTTKRALLILNCILLSIGNCGGPLIMRLYFIHGGKRVWLSSWLETGGWPILL  63

Query  1077  IPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVST  898
             IPL +SY  RR      ++   K F + P L +AA  +GVL G+D+Y Y+YG+A+LPVST
Sbjct  64    IPLFISYLHRR-----STNPPTKLFYMKPRLFLAATFIGVLTGLDDYLYAYGVARLPVST  118

Query  897   SSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYL  718
             SSLI+ATQL FTA FAFLLVKQKFT+FS NAVVLLT GA VL L   SDRP  ES K Y 
Sbjct  119   SSLIIATQLAFTAAFAFLLVKQKFTSFSINAVVLLTAGAGVLALHTSSDRPGHESTKQYA  178

Query  717   LGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINK  538
             LGFVMT+ AAALYG ILPL+EL+Y K+K Q +S++LV+E QM+M    TIF T+GM++NK
Sbjct  179   LGFVMTLVAAALYGFILPLVELTYKKSK-QEISYTLVMEIQMVMCLFATIFCTIGMLVNK  237

Query  537   DFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVT  358
             DF VIPREAREF LG TKYYV+ V++AI+WQ FF+GA+GVI   SSLLS +++AVLLPVT
Sbjct  238   DFNVIPREAREFGLGETKYYVILVWSAIIWQCFFLGAIGVIFCASSLLSGILIAVLLPVT  297

Query  357   EILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             E+LAVIFY E F+AEKG++L LS+WGFVSYFYG++K +KK N    +E   +S+PT
Sbjct  298   EVLAVIFYQENFQAEKGVALALSLWGFVSYFYGEVKESKKKNLAPGSEMPRSSSPT  353



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 276/357 (77%), Gaps = 6/357 (2%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +  ++MRR LL ++C +L+IGNCGGPL++RLYF+ GG R+WFSSWL+T G+P+I  P+
Sbjct  5     EAEPNSSMRRALLVINCFVLAIGNCGGPLMMRLYFIHGGKRVWFSSWLETGGWPIILFPI  64

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
               +Y  RRR    + +   KFF + P L IA+A++G+L G D+Y Y+YG+A+LPVSTSSL
Sbjct  65    AWAYLHRRR---TQPTSRNKFFFMKPPLFIASAVIGILTGFDDYLYAYGVARLPVSTSSL  121

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+A QL FTAGFAFLLVKQKFT++S NAV LLT+GA VL L   SDRP  ESNK Y++GF
Sbjct  122   IIAAQLAFTAGFAFLLVKQKFTSYSINAVFLLTIGAGVLALNTSSDRPENESNKEYVMGF  181

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             +MT+AAA LYG ILPL+EL Y KAK Q +S++LV+E QM+M    T+  TVGM++N DF+
Sbjct  182   LMTIAAAVLYGFILPLVELMYKKAK-QEISYALVMEIQMVMCLFATVLCTVGMLVNNDFK  240

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VI REAREF LG TKYYV+A+ +AI+WQ FF+GA+GVI   SSL+S +++AVLLPVTEIL
Sbjct  241   VISREAREFGLGETKYYVVAISSAIIWQGFFLGAIGVIFCASSLVSGIMIAVLLPVTEIL  300

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAST  178
             AVIF  EKF+AEKG++L LS+WGFVSYFYG+IK TKK     + ETEM   PT   T
Sbjct  301   AVIFLKEKFQAEKGVALALSLWGFVSYFYGEIKQTKKKKR--ALETEMPPVPTSPET  355



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 288/362 (80%), Gaps = 8/362 (2%)
 Frame = -1

Query  1281  TSE*DLKALKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQ  1102
             T + ++K  K +G   TTMR+ LL ++CIILSIGNCG PL++RLYF+ GGNRIWF SWL+
Sbjct  11    TEQMEVKEPKHDG---TTMRKALLVINCIILSIGNCGSPLIMRLYFIHGGNRIWFLSWLE  67

Query  1101  TAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYG  922
             TAG P+  +P+  +Y  R R  +D +S  ++F++  P L +AA +LG++ G+DNYFYSYG
Sbjct  68    TAGCPITLLPIACAYMHRSRT-ADPTSGKKRFYMERP-LFLAAIVLGIITGLDNYFYSYG  125

Query  921   MAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPA  742
             +++LPVSTSSLI+A+QL FTAGFAFLLVKQKFTA+S NAV LLT+GA VL L + SDRP 
Sbjct  126   LSRLPVSTSSLIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPE  185

Query  741   GESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFS  562
              ESNK Y+LGFVMT+AAAALYG +LPL+EL+Y KAK Q +S++LV+E Q++M  V T F 
Sbjct  186   NESNKEYILGFVMTLAAAALYGFVLPLVELTYKKAK-QEISYALVMEIQLVMCLVATGFC  244

Query  561   TVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsali  382
             TVGM++N DF+VI +EAREFELG TKYYV+ +FTAI+ Q FF+GA+GV+   SS+LS ++
Sbjct  245   TVGMLVNNDFKVIGKEAREFELGETKYYVVVIFTAIINQCFFLGAIGVVFCASSMLSGVV  304

Query  381   vavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMT  202
             +AVLLPVTEILA+  ++EKF+AEKG+SL LS+WGFVSYFYG+IK +KK   +   E EM 
Sbjct  305   IAVLLPVTEILAIFSFNEKFQAEKGVSLALSLWGFVSYFYGEIKQSKKKKPD--PEIEMA  362

Query  201   SA  196
             S+
Sbjct  363   SS  364



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 278/348 (80%), Gaps = 6/348 (2%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E Q  + MR+ LL L+C+ILSIGNCGGPL++RLYF+ GG RIWFSSWL+T G+P+I +PL
Sbjct  4     EVQLSSNMRKALLVLNCVILSIGNCGGPLVMRLYFVLGGERIWFSSWLETVGWPLILVPL  63

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
             +++Y  RR   + + S ++ FF+  P L +A+A++GVL G D+Y Y+YG+AKLPVSTS+L
Sbjct  64    IITYMHRR---TKQDSHAKLFFMKPP-LFVASAVIGVLTGFDDYLYAYGVAKLPVSTSAL  119

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             IVA+QL FTA FAFLLVKQKFT++S NA+ LL++GA VL L   SDRP  ESNK Y LGF
Sbjct  120   IVASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPTNESNKEYYLGF  179

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             VMT+AAAALYG ILPL+EL+Y K K QA+++SLV+E QM+M F  T+F TVGM++N DF+
Sbjct  180   VMTLAAAALYGFILPLVELTYKKTK-QAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQ  238

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              I REA+E+ELG  KYY++ V+  I+WQ FF+ ++GVI   SSL+  +++ VLLPVTEIL
Sbjct  239   AISREAKEYELGEAKYYLVVVWNGIIWQCFFLVSIGVIFSASSLVCGIVITVLLPVTEIL  298

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             AVIF+ EKF+AEKG+SL LS+WGFVSYFYG+IK++KK  N +S ETE+
Sbjct  299   AVIFFREKFQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTS-ETEL  345



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/359 (59%), Positives = 280/359 (78%), Gaps = 6/359 (2%)
 Frame = -1

Query  1266  LKALKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFP  1087
             ++ +K      TTMR+ LL ++CIILSIGNC GPL++RLYF+ GG R+WFSSWL+T G+P
Sbjct  1     MEVVKESEPNTTTMRKALLVINCIILSIGNCAGPLMMRLYFIHGGKRVWFSSWLETGGWP  60

Query  1086  VIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLP  907
             +I  P+   +  R R    + S   K F + P L IAAA++G+L G+D+Y Y+YG+A+LP
Sbjct  61    IILFPIACVHFYRSR---TQPSSENKLFFMKPHLFIAAAVIGILTGLDDYLYAYGVARLP  117

Query  906   VSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNK  727
             VSTSSLI+A+QL FTAGFAF+LVKQKFT++S NAV LLT+G+ VL +   SDRPA ESN+
Sbjct  118   VSTSSLIIASQLAFTAGFAFVLVKQKFTSYSINAVFLLTIGSGVLAMHTSSDRPANESNR  177

Query  726   AYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMV  547
              Y+LGF+MTV A+ALYG ILPL+EL+Y KAK Q +S++LV+E QM+M    T   T+GM+
Sbjct  178   EYVLGFLMTVGASALYGFILPLVELTYKKAK-QEISYALVMEIQMVMCLFATGVCTIGML  236

Query  546   INKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlL  367
             +N DF+VI REARE+ELG TKYY++A+ +A++WQ FF+GA+GVI   SSLLS +I+AVLL
Sbjct  237   VNNDFKVIRREAREYELGETKYYIVAICSAMIWQCFFLGAIGVIFCASSLLSGIIIAVLL  296

Query  366   PVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             PVTEILAVIFY+E F AEKG++L LS+WGF+SYFYG+IK +K+  N+ + ETEM S P 
Sbjct  297   PVTEILAVIFYNESFHAEKGVALALSLWGFLSYFYGEIKQSKE--NKPALETEMASVPN  353



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 210/355 (59%), Positives = 282/355 (79%), Gaps = 9/355 (3%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             K E Q +TTM++ LL  +C++LSIGNCGGPL++RLYF+ GG R+W S+WL+T G+P+I I
Sbjct  4     KEETQVKTTMKKALLIFNCLVLSIGNCGGPLIMRLYFIHGGKRVWLSAWLETGGWPIILI  63

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             P+ +SY  RR      +  + + F + P L IAAA +GVL G+D+Y Y+YG+A+LPVSTS
Sbjct  64    PIALSYFHRR-----ATDPTTRLFYMKPPLFIAAATIGVLTGLDDYLYAYGVARLPVSTS  118

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             +LI+ATQL FTAGFAFLLVKQKFT++S NAVVLLTVGA VL +  GSD+PA ES++ Y+L
Sbjct  119   ALIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYIL  178

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYGLILPL+EL+Y K++ Q ++++LV+E QM+M  + T+F TVGM+INKD
Sbjct  179   GFIMTLVAAALYGLILPLVELTYKKSR-QEMNYTLVMEIQMVMCLLATVFCTVGMLINKD  237

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ IPREAR FELG  KYYV+ V++AI+WQ FF+GA+GVI   SSLLS ++++ LLP TE
Sbjct  238   FQAIPREARNFELGEVKYYVVLVWSAIIWQCFFLGAIGVIFSASSLLSGILISALLPATE  297

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             IL+VIF+ EKF+AEKG++L LS+WGFVSYFYG++K  KK   +  A  E + AP+
Sbjct  298   ILSVIFFQEKFQAEKGVALGLSLWGFVSYFYGEMKENKK---KKLAAPETSMAPS  349



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 280/355 (79%), Gaps = 9/355 (3%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             K E Q +TTM++ LL  +C+ILSIGNCGGPL++RLYF+ GG RIW S+WL+T G+P+I I
Sbjct  4     KEETQGKTTMKKTLLIFNCLILSIGNCGGPLIMRLYFIHGGKRIWLSAWLETGGWPIILI  63

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL +SY  RR      +  + K F + P L IAAA++GVL G+D+Y Y+YG+A+LPVSTS
Sbjct  64    PLAISYFHRR-----ATDPTTKLFYMKPPLFIAAAIIGVLTGLDDYLYAYGVARLPVSTS  118

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             +LI+ATQL FTAGFAFLLVKQKFT++S NAVVLLTVGA VL +  GSD+PA ES++ Y+L
Sbjct  119   ALIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYIL  178

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF++T+ AAALYG I+PL+EL+Y K++ Q ++++LV+E QMIM  + T+F TVGM+INKD
Sbjct  179   GFILTLVAAALYGFIMPLVELTYKKSR-QEMNYTLVMEIQMIMCLLATVFCTVGMLINKD  237

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ IPREAR +ELG  KYYV+ V++AI+WQ FF+GA+GVI   SSLLS +I+ VLLP TE
Sbjct  238   FQAIPREARNYELGEVKYYVVMVWSAIIWQCFFLGAIGVIFCASSLLSGIIITVLLPATE  297

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             ILAVIF+ EKF+ EKG++L LS+WGFVSYFYG++K  KK   +  A  E   AP+
Sbjct  298   ILAVIFFQEKFQVEKGVALGLSLWGFVSYFYGEMKENKK---KKPAAPETLMAPS  349



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 282/351 (80%), Gaps = 13/351 (4%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R+ L ++CIIL++GNCGGPL++RLYF+ GG RIWFSSWL+T G+P+I  PL+VSY RR
Sbjct  1     MKRVFLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPIILAPLIVSYTRR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR  +   +   + +L+ P + +AAA++GVL G D+Y Y+YG+AKLPVSTS+LIVA+QL 
Sbjct  61    RRTAA---AGKAELYLMKPRVFVAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLA  117

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FAFL+VKQ+FTA+S NAVVLLT+GAVVLGL    DRP GES+K Y++GF++TVAAA
Sbjct  118   FTAVFAFLMVKQEFTAYSVNAVVLLTLGAVVLGLHTSGDRPEGESSKEYMVGFLLTVAAA  177

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             ALYG ILP +EL+Y KAK QAVS++LVLE Q++M    T F TVGM++N DF+ I REAR
Sbjct  178   ALYGFILPAVELTYKKAK-QAVSYTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREAR  236

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              +ELG TKYY++ +++AIVWQ FF+GA+GVI Y SSLLS +++ VLLP TEILA+IFYHE
Sbjct  237   AYELGETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHE  296

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNT--------KKDNNESSA-ETEMT  202
             KF+AEKG+SLFLS+WGF+SYFYG++K           + N+++ A ETE+T
Sbjct  297   KFQAEKGLSLFLSLWGFISYFYGEMKKDKNKNKNNIDQSNDQTQATETELT  347



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 278/341 (82%), Gaps = 5/341 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +   +++R LL LSC++LSIG CGGPL++RLYF+ GGNR+W SSWL+T G+P+IFIP+
Sbjct  6     EEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGNRVWLSSWLETGGWPIIFIPI  65

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              ++Y+ RR   + E   ++ FF+  P L IA+A++G++ G+D+Y Y+YG+A+LPVSTS+L
Sbjct  66    ALAYYHRR---TTEGPSTKLFFMKLP-LFIASAVIGLITGLDDYLYAYGVARLPVSTSAL  121

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+A QL FTA FAFLLVKQKFT++STNAVVLLT+GA VLGL   +DRP GES+K Y+ GF
Sbjct  122   IIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTSADRPKGESDKQYIAGF  181

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             +MTVAAAALYG +LPL+EL+Y KAK Q ++++LVLE QM+M    TIF TVGM+I+ DF+
Sbjct  182   LMTVAAAALYGFVLPLVELTYKKAK-QTITYALVLEIQMVMCLFATIFCTVGMLIDNDFK  240

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VIPREAR F LG   YYV+ V +AIVWQ FF+GA+GVI   SSLLS +++AVLLP+TEIL
Sbjct  241   VIPREARNFGLGEGTYYVVLVLSAIVWQTFFLGAIGVIFCASSLLSGIVIAVLLPITEIL  300

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNE  226
             AVIFYHEKF+AEKG++L LS+WGFVSYFYG+IK +K+  NE
Sbjct  301   AVIFYHEKFQAEKGVALALSLWGFVSYFYGEIKYSKQRENE  341



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 283/351 (81%), Gaps = 13/351 (4%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R+LL ++CIIL++GNCGGPL++RLYF+ GG RIWFSSWL+T G+P++ +PLLVSY+RR
Sbjct  1     MKRVLLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPILLVPLLVSYNRR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR  +   S   + +L+ P + +AAA++GVL G D+Y Y+YG+AKLPVSTS+LI+A+QL 
Sbjct  61    RRTAA---SGKAELYLMKPRVFLAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLA  117

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FAFL+VKQ+FTA+S N+VVLLT+GAVVLGL    DRP GES+K Y++GF +TVAAA
Sbjct  118   FTAAFAFLMVKQEFTAYSVNSVVLLTLGAVVLGLHTNGDRPEGESSKEYMVGFFLTVAAA  177

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             AL G ILP +EL+Y KAK QAVS++LVLE Q++M    T F T+GM++N DF+ I REAR
Sbjct  178   ALCGFILPAVELTYKKAK-QAVSYTLVLEMQLVMCVFATSFCTLGMLVNNDFQAIAREAR  236

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              +ELG TKYY++ +++AIVWQ FF+GA+GVI Y SSLLS +++ VLLP TEILA+IFYHE
Sbjct  237   AYELGETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHE  296

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNT--------KKDNNESSA-ETEMT  202
             KF+AEKG+SLFLS+WGF+SYFYG++K           + N+++ A ETE+T
Sbjct  297   KFQAEKGLSLFLSLWGFISYFYGEMKKDKNKNKNNIDQSNDQTQATETELT  347



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 215/354 (61%), Positives = 279/354 (79%), Gaps = 7/354 (2%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             M       MR+ILL ++CI+L+IGNC GPL++RLYFL GGNRIWFSSWLQT G+P+I IP
Sbjct  1     MATHINERMRKILLVINCILLAIGNCCGPLIMRLYFLHGGNRIWFSSWLQTVGWPLILIP  60

Query  1071  LLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             L ++Y +RR       +  +K FLITP + +A+++ G+L GVDNY Y+YG +KLPVSTS+
Sbjct  61    LAIAYFQRRE------NNIKKLFLITPRIFLASSVFGILTGVDNYLYAYGNSKLPVSTST  114

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+ATQL FTA FAF LVKQKFTA S NA+VLLTVGAVVL LR+GSDRP GES+K Y+LG
Sbjct  115   LILATQLAFTAVFAFFLVKQKFTAHSINAIVLLTVGAVVLALRSGSDRPKGESSKEYILG  174

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             FV+T+ AAALYG ++P++EL+Y+KA  Q ++++LVLE QM++    + F+TVGM+IN DF
Sbjct  175   FVLTLLAAALYGFVMPMVELTYIKAT-QTITYALVLEVQMVICCFASAFATVGMIINNDF  233

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + I  EAR+F LG  KYY + V++AI+WQFFFVGA+GVISY SSLLS +I+AVLLPVTE+
Sbjct  234   KAISSEARQFGLGEGKYYNVLVWSAIIWQFFFVGAIGVISYSSSLLSGVIIAVLLPVTEV  293

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             LAVI +HEKF+ EKG++LFLSIWGF+SYFYG++K  KK+      E   T + T
Sbjct  294   LAVIIFHEKFQPEKGVALFLSIWGFISYFYGEMKQHKKEKQTLKLEMTNTQSST  347



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 267/338 (79%), Gaps = 10/338 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCG PLLIRLYF++GG RIW  SW+QTA +P+IFIPLL+SY  R++  +D  ++  K  
Sbjct  16    GNCGTPLLIRLYFVKGGQRIWLPSWIQTAAWPIIFIPLLISYFHRQK--TDPRAEDSKLI  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             ++   + IA A++G+L G+DNY Y+YG+A+LPVST+++I+A QLVF A FAFLLVKQKFT
Sbjct  74    IMKYPVFIATAVIGLLTGLDNYLYAYGIARLPVSTAAIIIAAQLVFVAFFAFLLVKQKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAV+LLTVG+ VLGL   SDRP GESNK Y+LGF+MT+AAAALYGLILP++EL Y+
Sbjct  134   AYSVNAVILLTVGSGVLGLHTSSDRPKGESNKLYVLGFIMTLAAAALYGLILPMVELMYM  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q +++SLVLE Q+IM F  T+F TVGM+INKDF+ I REAR +ELG  KYYV+ V 
Sbjct  194   KAK-QVITYSLVLEIQLIMCFFATVFCTVGMLINKDFQAIAREARAYELGEMKYYVVLVS  252

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AIV Q FF+GA+GVI   SSL+S +I+AV LPVTE+LAVIF++EKF+AEKG++LFLS+W
Sbjct  253   SAIVSQCFFLGAIGVIFCASSLVSGIIIAVSLPVTELLAVIFFNEKFQAEKGVALFLSLW  312

Query  282   GFVSYFYGDI-----KNTKKDNNESSAETEMTSAPTVA  184
             GF+SYFYGDI     K  K D    S  TEMT  P VA
Sbjct  313   GFISYFYGDIKKNKSKEEKSDQKNPSQATEMT--PVVA  348



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 282/366 (77%), Gaps = 12/366 (3%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +    ++R+LL LS ++LSIG CGGPL++RLYF+ GG R+W SS L+T G+PVI +P+
Sbjct  9     EQRKAAALKRLLLILSSVLLSIGTCGGPLIMRLYFIHGGKRVWLSSMLETGGWPVILVPI  68

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              ++Y+ RR+  +     ++ FF+  P L +A+A++GVL G+D+Y Y+YG+A+LPVSTS+L
Sbjct  69    AIAYYHRRKNQAPTDPPTKLFFMKLP-LFVASAVIGVLTGLDDYLYAYGVARLPVSTSAL  127

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+A QL FTA FAF+LVKQKFT++S NAVVLLTVGA VLGL   SDRP GESN  Y+LGF
Sbjct  128   IIAAQLAFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYMLGF  187

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             VMTVAAAALYG +LPL+EL Y KAK Q ++++LVLE QM+M    TIF TVGM++N DF+
Sbjct  188   VMTVAAAALYGFVLPLVELMYKKAK-QNITYALVLEIQMVMSLFATIFCTVGMLVNNDFK  246

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VIPREAR+FELG T YYV+ V +AIVWQ FF+GA+G+I   SSLLS +++AVLLPVTEI 
Sbjct  247   VIPREARKFELGETTYYVVLVVSAIVWQTFFLGAIGLIFCASSLLSGIVIAVLLPVTEIF  306

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTK----------KDNNESSAETEMTS  199
             AVIFYHEKF+AEKG+SL LS+WGFVSYFYG+IK+ K          K+NN+     ++ +
Sbjct  307   AVIFYHEKFQAEKGVSLALSLWGFVSYFYGEIKHNKQKKQADAVKEKENNKEGCTPDVEN  366

Query  198   APTVAS  181
               TV +
Sbjct  367   LQTVPN  372



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 276/355 (78%), Gaps = 10/355 (3%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             M+ Q  + + + LL ++C+IL+IGNCGGP+++RLYF++GG RIW SSWLQT GFP+I IP
Sbjct  1     MDAQVNSALSKALLVVNCLILAIGNCGGPIIMRLYFVKGGKRIWLSSWLQTVGFPIIAIP  60

Query  1071  LLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             LL+SY  RR+    E   ++   +  P L IAAA +G++ G+D+Y Y+YGMA+LPVSTSS
Sbjct  61    LLISYFHRRK---TEGPNTKLVLMKYP-LFIAAAAVGLVTGIDDYLYAYGMARLPVSTSS  116

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             +I+A+QL FTA FAFLLVKQKFTA+S NAVVLLTVGA VL + + SDRP GES K Y+LG
Sbjct  117   IIIASQLAFTAVFAFLLVKQKFTAYSVNAVVLLTVGAGVLAMHSSSDRPKGESTKMYVLG  176

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             F+MTVAAA LYG ILP++EL YLKAK QA++++LVLE Q++M    T+F TVGM+  KDF
Sbjct  177   FLMTVAAAVLYGFILPVVELMYLKAK-QAITYTLVLEIQLVMCLFATVFCTVGMIAKKDF  235

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + + REAR + LG  +YY++  ++A++WQFFF+G +GVI   SSLLSA+++AVLLPVTE+
Sbjct  236   QAMAREARAYALGEAEYYLVVTWSAVIWQFFFLGVIGVIFCASSLLSAIMIAVLLPVTEV  295

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTK-----KDNNESSAETEMT  202
             +AVI + EKF+AEKG++LFLS+WGFVSYFYG+IKN K     +     S  TEMT
Sbjct  296   IAVIVFQEKFQAEKGVALFLSLWGFVSYFYGEIKNKKSKEEIEGQKNDSQSTEMT  350



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 268/346 (77%), Gaps = 2/346 (1%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
             T++R+LL  + I++SIGNCGGPL++RLYF+ GGNR+W SSWL T G+P+I +PL +SY  
Sbjct  22    TLQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIH  81

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RRR  +D  SK++  F+  P L + +A++GVL GVDNY ++YGMA+LPVSTSSLI+A+QL
Sbjct  82    RRRTATD-GSKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQL  140

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTAGFA+LLVKQKFT+++ NAVVLLT+G  +L L +  DRP GE+N  Y+ GF+MT+ A
Sbjct  141   AFTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGA  200

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREA  511
             A LYGLILPLIEL Y K K Q ++++L+LE Q++M   GT+  T+GM+IN DF+ I RE 
Sbjct  201   AVLYGLILPLIELMYKKTK-QRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREG  259

Query  510   REFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYH  331
             REF LG TKYYV+ V + I+WQ FF+GA+GVI Y SSL S +++A+LLP  EILAV+F+ 
Sbjct  260   REFGLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFR  319

Query  330   EKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             EKF+ EKG+SL L++WGFVSYFYG+ K TKK  ++   + + ++ P
Sbjct  320   EKFQVEKGVSLALNLWGFVSYFYGEFKQTKKMKSKELQKAQASTTP  365



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   371 bits (952),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 267/344 (78%), Gaps = 12/344 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF+ GG R+W SS L+T G+PVI +P+ ++Y+ RR+  +     ++ FF
Sbjct  31    GTCGGPLIMRLYFIHGGKRLWLSSMLETGGWPVILVPIAIAYYHRRKNQAPTDPPTKLFF  90

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             +  P L +A+A++GVL G+D+Y Y+YG+A+LP+ST SLI+A+ LVFTA FAF+LVKQKFT
Sbjct  91    MKLP-LFVASAVIGVLTGLDDYLYAYGVARLPLSTLSLIIASHLVFTALFAFILVKQKFT  149

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S NAVVLLTVGA VLGL   SDRP GESN  Y+LGFVMTVAAAALYG +LPL+EL Y 
Sbjct  150   SYSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYMLGFVMTVAAAALYGFVLPLVELMYK  209

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q ++++LVLE QM+M    TIF TVGM++N DF+VIPREAR+FELG T YYV+ V 
Sbjct  210   KAK-QNITYALVLEIQMVMSLFATIFCTVGMLVNNDFKVIPREARKFELGETTYYVVLVV  268

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AIVWQ FF+GA+G+I   SSLLS +++AVLLPVTEI AVIFYHEKF+AEKG+SL LS+W
Sbjct  269   SAIVWQAFFLGAIGLIFCASSLLSGIVIAVLLPVTEIFAVIFYHEKFQAEKGVSLALSLW  328

Query  282   GFVSYFYGDIKNTK----------KDNNESSAETEMTSAPTVAS  181
             GFVSYFYG++K+ K          K+NN+     ++ +  TV +
Sbjct  329   GFVSYFYGEMKHNKQSKQADAVKEKENNKEGCTPDVENLQTVPN  372



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 268/346 (77%), Gaps = 2/346 (1%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
             T++R+LL  + I++SIGNCGGPL++RLYF+ GGNR+W SSWL T G+P+I +PL +SY  
Sbjct  22    TLQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIH  81

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RRR  +D  +K++  F+  P L + +A++GVL GVDNY ++YGMA+LPVSTSSLI+A+QL
Sbjct  82    RRRTATD-GTKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQL  140

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTAGFA+LLVKQKFT+++ NAVVLLT+G  +L L +  DRP GE+N  Y+ GF+MT+ A
Sbjct  141   AFTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGA  200

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREA  511
             A LYGLILPLIEL Y K K Q ++++L+LE Q++M   GT+  T+GM+IN DF+ I RE 
Sbjct  201   AVLYGLILPLIELMYKKTK-QRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREG  259

Query  510   REFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYH  331
             REF LG TKYYV+ V + I+WQ FF+GA+GVI Y SSL S +++A+LLP  EILAV+F+ 
Sbjct  260   REFGLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFR  319

Query  330   EKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             EKF+ EKG+SL L++WGFVSYFYG+ K TKK  ++   + + ++ P
Sbjct  320   EKFQVEKGVSLALNLWGFVSYFYGEFKQTKKMKSKELQKAQASTTP  365



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 258/332 (78%), Gaps = 5/332 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             GNCGGPL++RLYF+ GGNR+W SSWL + G+P+I IPL +SY HRRR A +   SK++  
Sbjct  25    GNCGGPLILRLYFIHGGNRVWLSSWLFSGGWPIILIPLAISYIHRRRTATAG--SKTKLI  82

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             F+  P L   +A++G L G+DNY ++YGMA+LPVSTSSLI+A+QL FTAGFA+LLVKQKF
Sbjct  83    FMREPLLLFGSAVIGALTGLDNYLFAYGMARLPVSTSSLIIASQLAFTAGFAYLLVKQKF  142

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T+++ N+VVLLT+G  +L L +  DRPAGESN  Y+ GF+MT+ AA LYGLILPLIEL Y
Sbjct  143   TSYTVNSVVLLTMGGAILALHSSGDRPAGESNGEYIAGFLMTLGAAVLYGLILPLIELMY  202

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              K K Q+++++L+LE Q++M   GT+  T+GM+IN DF+ IPRE REF LG TKYYV+ V
Sbjct  203   KKTK-QSLTYTLILEIQLVMAISGTVLCTIGMLINNDFQAIPREGREFGLGNTKYYVVLV  261

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
              + ++WQ FF+GA+GVI Y SSL S +++A+LLP  EILAVIF+ EKF+AEKG+SL L++
Sbjct  262   MSCVIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVIFFREKFQAEKGVSLALNL  321

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEM-TSAP  193
             WGFVSYFYG+ K TKK  +    + E+ T+ P
Sbjct  322   WGFVSYFYGEYKQTKKVKSIELQKAELGTTTP  353



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 276/347 (80%), Gaps = 5/347 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +    ++R LL LSC+ILSIG CGGPL++RLYF+ GG R+W SSWL+T G+P+IFIP+
Sbjct  8     EEKRNAALKRALLILSCVILSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPI  67

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              ++Y+ RR   + E   ++ FF+  P L IA+A++G+L G+D+Y Y+YG+A+LPVST++L
Sbjct  68    ALAYYHRR---TTEGPSTKLFFMKLP-LFIASAVIGLLTGLDDYLYAYGVARLPVSTAAL  123

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I A  LVFTA FAFLLVKQKFT++S N V LLT+GA VLGL   +DRP GES+K Y+ GF
Sbjct  124   ITAAHLVFTALFAFLLVKQKFTSYSINGVFLLTIGAAVLGLNTSADRPKGESDKQYIAGF  183

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             +MT ++AALYG +LPL+EL+Y KAK Q ++++LVLE Q++M    TIF TVGM+IN DF+
Sbjct  184   MMTFSSAALYGFVLPLVELTYKKAK-QTITYALVLEIQLVMCLFATIFCTVGMLINNDFK  242

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VIPREAR FELG ++YYV+ VF+AIVWQ FF+GA+G+I   SSLLS +++AVLLPVTEIL
Sbjct  243   VIPREARNFELGESRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEIL  302

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETE  208
             AVIFYHEKF+AEKG++L LS+WGFVSYFYG+ K +K+  +E   E E
Sbjct  303   AVIFYHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKESEMKNEKE  349



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score =   368 bits (945),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 275/347 (79%), Gaps = 5/347 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +    ++R LL LSC+ LSIG CGGPL++RLYF+ GG R+W SSWL+T G+P+IFIP+
Sbjct  6     EEKRNAALKRALLILSCVFLSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPI  65

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              ++Y+ RR   + E   ++ FF+  P L IA+A++G+L G+D+Y Y+YG+A+LPVST++L
Sbjct  66    ALAYYHRR---TTEGPSTKLFFMKLP-LFIASAVIGLLTGLDDYLYAYGVARLPVSTAAL  121

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I A  LVFTA FAFLLVKQKFT++S N V LLT+GA VLGL   +DRP GES+K Y+ GF
Sbjct  122   ITAAHLVFTALFAFLLVKQKFTSYSINCVFLLTIGAAVLGLNTSADRPKGESDKQYIAGF  181

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             +MT+++AALYG +LPL+EL+Y KAK Q ++++LVLE Q++M    TIF TVGM+IN DF+
Sbjct  182   MMTLSSAALYGFVLPLVELTYKKAK-QTITYALVLEIQLVMCLFATIFCTVGMLINNDFK  240

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VIPREAR FELG  +YYV+ VF+AIVWQ FF+GA+G+I   SSLLS +++AVLLPVTEIL
Sbjct  241   VIPREARNFELGERRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEIL  300

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETE  208
             AVIFYHEKF+AEKG++L LS+WGFVSYFYG+ K +K+  +E   E E
Sbjct  301   AVIFYHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKESEMKNERE  347



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 272/355 (77%), Gaps = 4/355 (1%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             + + Q   +++R LL  +C +L++GNCGGPL++RLYF+ GG R+W SS L+T G+P+IFI
Sbjct  4     EQQQQNTPSVKRTLLIFNCCLLAVGNCGGPLIMRLYFVHGGKRVWLSSCLETGGWPIIFI  63

Query  1074  PLLVSY-HRRRRACSDESS--KSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPV  904
             PLL+SY HRRR A  D S    S +F  + P L +A+A +G+L G D+Y Y+YG+A+LPV
Sbjct  64    PLLISYIHRRRLAALDPSGSPNSAQFIFMKPRLFLASAFIGILTGFDDYLYAYGVARLPV  123

Query  903   STSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKA  724
             STS+LI+A QL FTAGFAFLLVKQKFT++S NAVVLLT+G  VL L    DRPAGESNK 
Sbjct  124   STSALIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNKD  183

Query  723   YLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVI  544
             Y+ GF+MTVAAA +YG +LPL+EL+Y KA+ Q ++++LVLEFQ+IM    TI   +GM+I
Sbjct  184   YIAGFLMTVAAAVVYGFVLPLVELTYKKAR-QQITYTLVLEFQLIMSLFATIVCAIGMLI  242

Query  543   NKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLP  364
             N DF+VIPREA  F LG  +YY++ V +AI+WQ FF+GA+GVI   SSL S +++AVLLP
Sbjct  243   NNDFQVIPREAEAFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLP  302

Query  363   VTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTS  199
             VTEILAVI ++E+F+AEKG+SL L++WGF+SYFYG+IK+ K+   E     E TS
Sbjct  303   VTEILAVIIFNERFQAEKGVSLALNLWGFLSYFYGEIKHNKRKKLELQRYEETTS  357



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 274/337 (81%), Gaps = 5/337 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +   +++R LL LSC++LSIG CGGPL++RLYF+ GG R+W SSWL+T G+P+IFIP+
Sbjct  6     EEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPI  65

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              ++Y+ RR   + E   ++ FF+  P L IA+A++G++ G+D+Y Y+YG+A+LPVSTSSL
Sbjct  66    ALAYYHRR---TTEGPSTKLFFIKLP-LFIASAVIGLITGLDDYLYAYGVARLPVSTSSL  121

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+A QL FTA FAFLLVKQKFT++STNAVVLLT+GA VLGL   +DRP GES+K Y+ GF
Sbjct  122   IIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTNADRPKGESDKEYIAGF  181

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             +MTVAAAALYG +LPL+EL+Y KAK Q ++++LVLE QM+M    TIF TVGM+IN DF+
Sbjct  182   LMTVAAAALYGFVLPLVELTYKKAK-QTITYALVLEIQMVMCLFATIFCTVGMLINNDFK  240

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VI REAR F LG   YYV+ V +AIVWQ FF+GA+G+I   SSLLS +++AVLLP+TEIL
Sbjct  241   VILREARNFGLGKGTYYVVLVLSAIVWQTFFLGAIGIIFCASSLLSGIVIAVLLPITEIL  300

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK  238
             AVIFYHEKF+AEKG++L LS+WGFVSYFYG+IK +K+
Sbjct  301   AVIFYHEKFQAEKGVALALSLWGFVSYFYGEIKYSKQ  337



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 247/312 (79%), Gaps = 5/312 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYFL GG R+W SSWL+T G+P+IFIPL V+Y RRR A       S +  
Sbjct  28    GTCGGPLIMRLYFLHGGKRVWLSSWLETGGWPIIFIPLAVAYFRRRAA----EGPSARLI  83

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ PFL  AAA++GVL G+D+Y Y+YG+A+LPVSTS+L++ATQL FTAGFAFLLV+Q FT
Sbjct  84    LMDPFLFAAAAVIGVLTGLDDYLYAYGVARLPVSTSALLIATQLAFTAGFAFLLVRQLFT  143

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S N+V LLT+GA VL +   SDRPAGES   Y  GF MT+ AAALYG +LPL+EL+Y 
Sbjct  144   SYSVNSVFLLTMGAGVLAMHTSSDRPAGESKGEYYAGFFMTLGAAALYGFVLPLVELTYK  203

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q V++SLVLEFQ++M F  T F+TVGM++NKDF+ IP EAR F LG T+YYV+ V+
Sbjct  204   KAK-QTVTYSLVLEFQLVMCFFATAFNTVGMLVNKDFQAIPEEARNFTLGETRYYVVLVW  262

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             + I+WQFFF+GA+GVI Y SSL S +++AVLLP+TEIL VI +HEKF+ EK +SL LS+W
Sbjct  263   SGIIWQFFFLGAIGVIHYASSLFSGIMIAVLLPITEILGVICFHEKFQVEKAVSLVLSLW  322

Query  282   GFVSYFYGDIKN  247
             GFVSYFYG+ K 
Sbjct  323   GFVSYFYGEFKR  334



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   365 bits (937),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 274/357 (77%), Gaps = 12/357 (3%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME +  + M++ LL ++CI L+IGNCGGPL+ RLYF++GG RIW SSWLQT+ +P+I IP
Sbjct  1     MEPKVNSKMKKFLLVMNCIFLAIGNCGGPLISRLYFIKGGKRIWLSSWLQTSAWPIILIP  60

Query  1071  LLVSYHRRRRACSDESSKSR-----------KFFLITPFLSIAAALLGVLVGVDNYFYSY  925
             L +SY  R ++    S+              KF L+TP + IAA  +G+L G+DNY  +Y
Sbjct  61    LAISYFNRCKSQGKISTTVENNNNNDNNNNTKFILMTPRIFIAAVGMGILSGIDNYLSAY  120

Query  924   GMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRP  745
             G+AKLPVSTS+L++A+QL FTAGFAFLLVKQKF+A+S N++ LLT+GAVVL L A SDRP
Sbjct  121   GVAKLPVSTSALLIASQLAFTAGFAFLLVKQKFSAYSINSIYLLTLGAVVLALHAKSDRP  180

Query  744   AGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIF  565
              GES K Y+LGFV+T+ AAALYGLILPL EL Y KAK Q ++++LVLE Q +  F  T+ 
Sbjct  181   KGESKKEYILGFVLTLGAAALYGLILPLFELLYKKAK-QTITYTLVLEIQAVYCFFATVV  239

Query  564   STVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsal  385
              T+GM+INKDF+ + REA+ FELG  +YY++ V++AI+WQ FF+GA+GV+   SSL+SA+
Sbjct  240   CTIGMIINKDFQAMSREAKAFELGEGRYYIVIVWSAIIWQCFFLGAIGVVYSSSSLVSAI  299

Query  384   ivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAE  214
             ++ VLLPVTE+LAVIFY EKF AEKG+SL LS+WGF+SYFYGDIK +KK  N+S+ +
Sbjct  300   LITVLLPVTEVLAVIFYGEKFTAEKGVSLALSMWGFISYFYGDIKASKKTENQSTDD  356



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 254/336 (76%), Gaps = 11/336 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRR----------ACS  1033
             GNCGGPL+ RLYFL+GG RIW SSWL+T G+P++ IPL  SY  RRR          +  
Sbjct  25    GNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYFNRRREFRGKMILSTSTD  84

Query  1032  DESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGF  853
             +++  + KF L+TP + +A+  +G+L G DNY Y+YG+AKLPVSTS+L++A+QL FTAGF
Sbjct  85    NDNDNNAKFILMTPRIFVASIGIGILTGFDNYLYAYGVAKLPVSTSALLIASQLAFTAGF  144

Query  852   AFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGL  673
             AFLLVKQKFT++S N++ LLT+GAVVL L A  DRP GES K Y+LGF+MT+ AAALYGL
Sbjct  145   AFLLVKQKFTSYSINSIFLLTLGAVVLALHANGDRPNGESRKEYILGFIMTLGAAALYGL  204

Query  672   ILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELG  493
             ILPL EL Y KAK Q ++++LV+E Q +     T+  T+GM+INKDF+ + REA+ FELG
Sbjct  205   ILPLFELLYKKAK-QGITYTLVMEIQAVYCIFSTVVCTIGMIINKDFQAMSREAKSFELG  263

Query  492   VTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAE  313
               +YY++ +++AI+WQ FF+GA+GVI + SSL+S +++ VLLPVTEIL V+FY EKF  E
Sbjct  264   EARYYIVIIWSAILWQCFFLGAIGVIYFSSSLVSGILITVLLPVTEILGVVFYGEKFTPE  323

Query  312   KGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             KG+SL LSIWGF+SY YGDIK +KK     S E EM
Sbjct  324   KGVSLVLSIWGFISYLYGDIKASKKKKENQSKEQEM  359



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 205/335 (61%), Positives = 269/335 (80%), Gaps = 5/335 (1%)
 Frame = -1

Query  1242  QTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLV  1063
             +    M+++LL +SC +LSIG CGGPL++RLYF+ GG  IW SSWLQT G+P+IFIP+ +
Sbjct  8     KRNAVMKKLLLVISCTLLSIGTCGGPLVMRLYFIHGGKHIWLSSWLQTGGWPIIFIPIAI  67

Query  1062  SYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIV  883
              Y+ RR+    E   ++ FF+  P L +A+A++GVL G+D+Y Y+YG+A+LPVSTS+LI+
Sbjct  68    GYYHRRKT---EGPSTKLFFMKLP-LFMASAVIGVLTGLDDYLYAYGVARLPVSTSALII  123

Query  882   ATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVM  703
             A QL FTA FAF+LVKQKFT+FS NAVVLLT+G+ VLGL   SDRP GESNK Y+ GF M
Sbjct  124   AGQLAFTALFAFILVKQKFTSFSMNAVVLLTMGSAVLGLTISSDRPEGESNKEYIAGFFM  183

Query  702   TVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVI  523
              VAAA+LYG +LPLIEL+Y +AK Q V+++LVLE Q +M    T+F TVGM+IN DF+VI
Sbjct  184   MVAAASLYGFVLPLIELTYKRAK-QTVTYALVLEIQSVMCLFATLFCTVGMLINNDFKVI  242

Query  522   PREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAV  343
             PREAR+F+LG T+YY++ V +A VWQ FF+GA+G+I   SSLLS +++AVLLP+TEILAV
Sbjct  243   PREARKFDLGETRYYLVLVLSATVWQAFFLGAIGIIFCASSLLSGIVIAVLLPITEILAV  302

Query  342   IFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK  238
             IFYHEKF+ EKG+SL LS+WGFVSYFYG+IK+ K+
Sbjct  303   IFYHEKFQPEKGVSLALSVWGFVSYFYGEIKHNKQ  337



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 206/338 (61%), Positives = 258/338 (76%), Gaps = 13/338 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACS---DESSKS-  1015
             GNC GPL++RLYFL GG RIWFSSWL+ AG PVI IP+ VSY +RRR+ +    ESS S 
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLEAAGCPVILIPITVSYLQRRRSSTTTDHESSTSS  89

Query  1014  -------RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAG  856
                     K  L+ P +  A+A++G+L G+DNY Y+YG+A+LPVSTSSLI+A+QL FTA 
Sbjct  90    QPSNNDNNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  855   FAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYG  676
             FAFLLVKQK T++S NAV LLT+GAVVLGL    DRP  ES + YL+GF+MTV AA LYG
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPHNESARQYLVGFLMTVGAAVLYG  209

Query  675   LILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFEL  496
              +LPL+EL+Y +A+ Q ++++LVLE QM+M    T+  TVGMV+NKDF+ I +EAR + L
Sbjct  210   FVLPLMELTYKRAR-QEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTL  268

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G  KYY + V +A++WQ FF+GA+GVI  GSSLLSA+I+AVLLPVTEILAVIFY EKF+A
Sbjct  269   GEGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQA  328

Query  315   EKGISLFLSIWGFVSYFYGDIKNTKK-DNNESSAETEM  205
             EKG+SL LS+WGF SYFYG+IKN KK    E   ETEM
Sbjct  329   EKGVSLALSLWGFASYFYGEIKNNKKMKKREQLPETEM  366



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score =   360 bits (925),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 277/363 (76%), Gaps = 9/363 (2%)
 Frame = -1

Query  1263  KALKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPV  1084
             K  +   Q  + ++R LL  +C +L++GNCGGPL++RLYF+ GGNR+W SS+L+T G+P+
Sbjct  3     KEQQQHQQNTSAVKRTLLIFNCFLLAVGNCGGPLVMRLYFVHGGNRVWLSSFLETGGWPI  62

Query  1083  IFIPLLVSYHRRRRACSDE---SSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAK  913
             IFIPLL+SY RRRR  + +   S+ S +   + P L +A+A++G+L G D+Y Y+YG+A+
Sbjct  63    IFIPLLISYIRRRRLAALDPSGSADSSQIIFMKPRLFLASAVIGILTGFDDYLYAYGVAR  122

Query  912   LPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGES  733
             LPVSTS+LI+A QL FTAGFAFLLVKQKFT++S NAVVLLT+G  VL L    DRPAGES
Sbjct  123   LPVSTSALIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGES  182

Query  732   NKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVG  553
             NK Y+ GF+MTVAAA +YG ILPL+EL+Y KA+ Q ++++LVLE+Q+IM    TI   +G
Sbjct  183   NKDYIAGFLMTVAAAVVYGFILPLVELTYKKAR-QQITYTLVLEYQLIMSLFATIVCVIG  241

Query  552   MVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivav  373
             M+IN DF+VIPREA  F LG  +YY++ V +AI+WQ FF+GA+GVI   SSL S +++AV
Sbjct  242   MLINNDFQVIPREAETFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAV  301

Query  372   lLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNT-----KKDNNESSAETE  208
             LLPVTEILAVI ++EKF+AEK +SL L++WGFVSYFYG+IKN      +    E +A T+
Sbjct  302   LLPVTEILAVIIFNEKFQAEKAVSLALNLWGFVSYFYGEIKNNKKKKLELQRYEETASTQ  361

Query  207   MTS  199
             +T+
Sbjct  362   ITN  364



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 249/337 (74%), Gaps = 6/337 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRA-----CSDESSK  1018
             GNCGGPL+ RLYFL+GG RIW SSWL+T G+P++ IPL  SY  RRR       S   + 
Sbjct  25    GNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYFNRRREFQGKMLSTIDNN  84

Query  1017  SRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLV  838
             + K  L+TP + +A+  +GVL G DNY Y+YG+AKLPVSTS+L++A+QL FTA FAFLLV
Sbjct  85    NTKLILMTPRIFVASIGIGVLTGFDNYLYAYGVAKLPVSTSALLIASQLAFTAAFAFLLV  144

Query  837   KQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLI  658
             KQKFT++S N++ LLT GAVVL L A  DRP GES K Y+LGF+MT+ AAALYGLILPL 
Sbjct  145   KQKFTSYSINSIFLLTFGAVVLALHAKGDRPNGESKKEYVLGFIMTLGAAALYGLILPLF  204

Query  657   ELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYY  478
             EL Y KAK Q ++++LV+E Q +     T+  T+GM+INKDF+ + REA+ FELG  +YY
Sbjct  205   ELMYKKAK-QGITYTLVMEIQAVSCIFSTVVCTIGMIINKDFQAMSREAKSFELGEARYY  263

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
             ++ +++AI+WQ FF+GA+GVI   SSL+S +++ VLLP+TEIL V+FY EKF  EKG+SL
Sbjct  264   IVIIWSAIIWQCFFLGAIGVIYSSSSLVSGILITVLLPITEILGVVFYGEKFTPEKGVSL  323

Query  297   FLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTV  187
              LSIWGF+SY YGDIK +KK     S E EM    T 
Sbjct  324   VLSIWGFISYLYGDIKASKKKKENQSQEQEMIDKITC  360



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 247/316 (78%), Gaps = 8/316 (3%)
 Frame = -1

Query  1179  NCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFL  1000
             +C GPLL+RLYF+ GG  +W SSWL+T G+P+IFIPL V+Y RRR +       S +  L
Sbjct  28    SCAGPLLMRLYFIHGGASVWLSSWLETGGWPIIFIPLAVAYFRRRAS----EGPSARLVL  83

Query  999   ITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTA  820
             + PFL +AAA++GVL G+D+Y YSYG+A+LPVSTS+L++ATQL FTAGFAFLLV+Q FT+
Sbjct  84    MDPFLFVAAAVIGVLTGLDDYLYSYGVARLPVSTSALLIATQLAFTAGFAFLLVRQLFTS  143

Query  819   FSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLK  640
             +S     LLT+GA VL +   SDRPAGES  AY  GF MT+ AAALYGL+LPL+EL+Y K
Sbjct  144   YSI---FLLTIGAGVLAMHTSSDRPAGESKGAYYAGFFMTLGAAALYGLVLPLVELTYKK  200

Query  639   AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFT  460
             AK QAV++SLVLE Q++M F  T F T+GM++NKDF+ IPREAR F LG  +YYV+ V  
Sbjct  201   AK-QAVTYSLVLEIQLVMCFFATAFCTIGMLVNKDFQAIPREARNFGLGEAQYYVVLVSN  259

Query  459   AIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWG  280
             AIVWQFFF+GA+GVI Y SSL S +++A+L+PVTEIL VI +HEKF+AEKG+SL LS+WG
Sbjct  260   AIVWQFFFLGAIGVIFYASSLFSGIMIAILIPVTEILGVICFHEKFQAEKGVSLALSLWG  319

Query  279   FVSYFYGDIKNTKKDN  232
             F SYFYG+ K  K++ 
Sbjct  320   FASYFYGEFKRAKEEK  335



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 262/337 (78%), Gaps = 6/337 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY  RRR  ++  S+   FF
Sbjct  16    GNCGGPLIMRLYFNNGGQRIWFSTFLETAGFPVIFIPLLFSYIHRRR--NNNGSEPTSFF  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L  AA  +G+L G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KFT
Sbjct  74    LIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLTVGA VLG+   +D+PA E+ K Y+ GF+MTVAAA +Y LILPL+EL+Y 
Sbjct  134   PFTINAVVLLTVGAAVLGMHTETDKPAHETRKQYVTGFLMTVAAAVMYSLILPLVELAYQ  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q +S++LVLE QM++ F+ +I S +GM I  DF+ +P+EA+EF+LG   +YV+AVF
Sbjct  194   KAK-QPMSYTLVLEVQMVLCFLASIVSLIGMSIAGDFKALPKEAKEFKLGEAVFYVVAVF  252

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+W
Sbjct  253   SAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLW  312

Query  282   GFVSYFYGDIKNTKKD---NNESSAETEMTSAPTVAS  181
             GFVSYFYG+IK+ K+      E S E E++S P   S
Sbjct  313   GFVSYFYGEIKSAKEKKRIQQEESQEPELSSMPRTIS  349



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 280/363 (77%), Gaps = 15/363 (4%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME Q  +T+R+ILL LSC +L+IGNCGGP+++RLYF++GG RIW SSWL+T G+P+ FIP
Sbjct  1     MEAQLNSTLRKILLVLSCFMLAIGNCGGPIIMRLYFVKGGKRIWLSSWLETGGWPITFIP  60

Query  1071  LLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             L +SY  RR+    E   ++   +  P   IA A++G+L G+D+Y Y+YG A+LPVST++
Sbjct  61    LTISYFHRRK---TEGPNTKLIQMKCPVF-IATAVIGLLTGLDDYLYAYGFARLPVSTAT  116

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             +IVAT L FTA FAFLLVKQKFTA+S NA+VLL+VG+ VL +   SDRP GES K Y+LG
Sbjct  117   IIVATHLGFTAFFAFLLVKQKFTAYSVNAIVLLSVGSGVLAMHTSSDRPKGESTKLYVLG  176

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             F+MT+AAAALYGL+LP++EL Y+KAK QA++++L+LE  ++M F  T+F TVGM++N+DF
Sbjct  177   FIMTLAAAALYGLVLPMVELMYIKAK-QAITYTLLLEINLVMCFFATVFCTVGMLVNRDF  235

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + +PREA+ +ELG  KYYV+  + AI+WQFFF+G +GVI   SSLLSA+I+A LLPVT  
Sbjct  236   QAMPREAKAYELGEAKYYVVVTWNAIIWQFFFLGVIGVIFCASSLLSAIIIASLLPVTGA  295

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTK-----KDN--NESSAETEMTSAP  193
             +AV+ + EKF  EKG++LFLS+WGFVSYFYG IK+ +     +D+  N+S A TEM+  P
Sbjct  296   IAVVAFDEKFPPEKGVALFLSLWGFVSYFYGAIKHKRLKEEIEDHKINQSQA-TEMS--P  352

Query  192   TVA  184
              VA
Sbjct  353   IVA  355



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 259/331 (78%), Gaps = 6/331 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY  RRR  S+       FF
Sbjct  16    GNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIARRR--SNNVGDDTSFF  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L I A  +G+L G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KFT
Sbjct  74    LIKPRLLIVAVFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLTVGA VLG+   +D+P  E++K Y++GF+MTVAAA +Y  ILPL+EL+Y 
Sbjct  134   PFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLMTVAAAVMYAFILPLVELAYQ  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA+ Q +S++LVLEFQ+I+ F+ +I S +GM I  DF+ +P+EAREF+LG   +YV+AVF
Sbjct  194   KAR-QPMSYTLVLEFQLILCFLASIVSVIGMFIAGDFKALPKEAREFKLGEALFYVVAVF  252

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+W
Sbjct  253   SAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLW  312

Query  282   GFVSYFYGDI---KNTKKDNNESSAETEMTS  199
             GFVSYFYG+I   K+ K+   E S ETE +S
Sbjct  313   GFVSYFYGEIKSGKDKKRIQQEESPETEQSS  343



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 258/336 (77%), Gaps = 21/336 (6%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF+ GG R+W SSWL+T G+P+IFIP+ ++Y  RR+        S K F
Sbjct  30    GTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYRRKT----EGPSTKLF  85

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+   L  A+A++G+L G+D+Y Y+YG+A+LP+STS+LI+A+ L FTA FAF+LVKQKFT
Sbjct  86    LMKLPLFTASAVIGILTGLDDYLYAYGVARLPISTSALILASHLAFTALFAFILVKQKFT  145

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS NA+VLLT+GAVVLGL   SDRP GESNK Y+ GF MTVAAAALYG +LPLIEL+Y 
Sbjct  146   LFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAALYGFVLPLIELTYK  205

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q ++++LVLE Q++M    T+F TVGM+I+ DF+VIPREAR+F+LG T+YYV+ VF
Sbjct  206   KAK-QTITYALVLEVQLVMCLFATLFCTVGMIIDNDFKVIPREARKFDLGETRYYVVLVF  264

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSLLS +++A L+PVT+ILAVIFYHEKF+AEKG+SL LS+W
Sbjct  265   SAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVIFYHEKFQAEKGVSLALSLW  324

Query  282   GFVSYFYGD----------------IKNTKKDNNES  223
             GF+SYFYG+                I   KKD  E+
Sbjct  325   GFISYFYGERKHNKQKEKEKKMETEIAEKKKDTPET  360



>gb|EYU21538.1| hypothetical protein MIMGU_mgv1a020196mg [Erythranthe guttata]
Length=353

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 267/338 (79%), Gaps = 2/338 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF+RGG RIWFSSWL+T G+P+I IPL+ +Y RRRR+ +  +  + K  
Sbjct  16    GNCGGPLIMRLYFIRGGERIWFSSWLETGGWPIILIPLIAAYIRRRRSTTAAADGAAKLI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L  AA+++G+L G+D+Y Y+ G+AKLP+ST++L+ AT LVFTA FAFLLVKQKFT
Sbjct  76    LMKPRLFSAASVIGILTGLDDYLYAKGVAKLPISTAALLAATHLVFTAAFAFLLVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAVVLLTVG VVLGL    DRP GES K Y++GF+M ++AAALYGLILP++EL Y 
Sbjct  136   AYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFIMALSAAALYGLILPVVELMYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK QA++++L++E Q+++ F  T+F TVGM+IN DF+ I REA+E+ELG  KYY++ ++
Sbjct  196   KAK-QALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISREAKEYELGEMKYYLVVIW  254

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+G +GVI Y SSLLS +I+ V +P+T+IL V  Y+EKF+AEKGI+LFLS+W
Sbjct  255   SAIIWQLFFLGVVGVIFYSSSLLSGIIITVTIPITQILGVFIYNEKFQAEKGIALFLSLW  314

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVASTQAV  169
             GF+SYF+G+I    K++NE++ +   T+    +S Q +
Sbjct  315   GFISYFFGEITK-NKNSNENNDQIRTTTETGRSSRQII  351



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 208/350 (59%), Positives = 274/350 (78%), Gaps = 6/350 (2%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             + E + RT M+R+LL  +C++L+IG  GGPL++RLYFL GG+R+W SS+L+TAGFP++ +
Sbjct  5     RNEDKDRT-MKRLLLITNCLLLTIGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLMLL  63

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL VSY RRRR  +  +SK +   +  P L+ A+A +G+L G+D+Y Y+YG+A+LPVSTS
Sbjct  64    PLAVSYFRRRRTAAAGTSKPKLISMKPPLLA-ASAFIGILTGLDDYLYAYGVARLPVSTS  122

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             +LI+ATQL FTA FAFLLV+QKFTA+S NAVVLLTVGA VL L    DRP GES K Y++
Sbjct  123   ALIIATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVM  182

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GFVMTV AAALYG ILPL+EL Y K K Q +++SLV+E Q +M F  T+F  +GM+IN D
Sbjct  183   GFVMTVIAAALYGFILPLVELVYKKIK-QPLTYSLVMEIQFVMCFSATLFCLLGMIINND  241

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+VIPREA++FE G   YY + V +AI+WQ FF+GA+GVI   SSL S +++AVLLPVTE
Sbjct  242   FKVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTE  301

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK---DNNESSAE  214
             +LAVIFY EKF+AEKG+SL LS+WG VSYFYG+IK++KK    N+++ AE
Sbjct  302   VLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMKMKNSDTEAE  351



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 256/312 (82%), Gaps = 5/312 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF+ GG R+W SSWL+T G+P+IFIP+ ++Y  RR+    E   ++ FF
Sbjct  30    GTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYRRKT---EGPSTKLFF  86

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             +  P  + A+A++GVL G+D+Y Y+YG+A+LP+STS+LI+A+ L FTA FAF+LVKQKFT
Sbjct  87    MKLPLFT-ASAVIGVLTGLDDYLYAYGVARLPISTSALILASHLAFTALFAFILVKQKFT  145

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FS NA+VLLT+GAVVLGL   SDRP GESNK Y+ GF MTVAAAALYG +LPLIEL+Y 
Sbjct  146   SFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAALYGFVLPLIELTYK  205

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q ++++LVLE Q++M    T+F TVGM+I+ DF+VIP+EAR+F+LG T+YYV+ VF
Sbjct  206   KAK-QTITYALVLEVQLVMCLFATLFCTVGMLIDNDFKVIPKEARKFDLGETRYYVVLVF  264

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSLLS +++A L+PVT+ILAVIFYHEKF+AEKG+SL LS+W
Sbjct  265   SAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVIFYHEKFQAEKGVSLALSLW  324

Query  282   GFVSYFYGDIKN  247
             GF+ YFYG+ K+
Sbjct  325   GFIFYFYGERKH  336



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 202/350 (58%), Positives = 265/350 (76%), Gaps = 11/350 (3%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  ++R+ L L+CI+LS+G CG PL++RLYF+RGG R+W  SWL+   +P++ +PL  +Y
Sbjct  10    RKGLKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAY  69

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
              RRR A       + +  L+  FL  AAA +GVL+G+DNYFY+YG+ +LPVSTS+L++AT
Sbjct  70    SRRRSA----EGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIAT  125

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FTAGFAFLLV+Q+FT+ S N++ LLT+GA VL +   SDRPAGES  AY  GF MT+
Sbjct  126   QLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTL  185

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
              AAALYGL+LPL+EL Y KAK QAV++SLVLE Q++M F  T F TV M++NKDF+ IPR
Sbjct  186   GAAALYGLVLPLVELMYKKAK-QAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPR  244

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EAR +ELG  +YYV+ V+TAI+ QFFF+GA+GVI Y SSL SA+I+A LLP TEILAVI 
Sbjct  245   EARNYELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVIC  304

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESS------AETEM  205
             + EKF+AEKG++L LS+WGF SYFYG+ K  KK+   ++      AETEM
Sbjct  305   FQEKFQAEKGVALALSLWGFASYFYGEFKLAKKEKEATAGTVIKPAETEM  354



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 250/320 (78%), Gaps = 1/320 (0%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPLLIRLYFL GG RIWFSSWL+TAG+P++ +PLL SY  RR     E   S + F
Sbjct  42    GNCGGPLLIRLYFLHGGKRIWFSSWLETAGWPILLLPLLFSYSYRRSQDQGEERGSTRLF  101

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L  A+A+LG++ G+D+Y Y+YG+++LPVSTS+LI +TQL+FTA FAF LV+Q FT
Sbjct  102   LIKPRLFAASAILGIITGLDDYLYAYGLSRLPVSTSALIASTQLIFTAIFAFFLVRQTFT  161

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S N++V+LT+GA+V+ L  GSDRP+ ESN  Y  GF MT+ A+ALYGL+LPL+EL+Y 
Sbjct  162   SYSINSIVMLTIGALVMALHTGSDRPSNESNTQYYTGFFMTIGASALYGLVLPLVELTYK  221

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K+  Q +++SLV+E Q+++    T F ++GM++N DF+ IP++A E+E+G  KYY++ V+
Sbjct  222   KSN-QLITYSLVIEMQLVISIFATAFCSLGMLVNNDFKSIPKDASEYEIGEAKYYLVIVW  280

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+G +GVI  GSS+L  +I+A ++PVTEILAVIF  EKF+AEKGISL L +W
Sbjct  281   SAILWQLFFLGLVGVIFCGSSMLGGIIIAAVIPVTEILAVIFCREKFKAEKGISLALCLW  340

Query  282   GFVSYFYGDIKNTKKDNNES  223
             GF SYFYG+IK   K N+E+
Sbjct  341   GFTSYFYGEIKGPSKKNSET  360



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 271/349 (78%), Gaps = 6/349 (2%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
              TTMR+ILL ++C++L++G CGGPL++RLY++ GG+R+WFSSWLQTAG+P   IPL + Y
Sbjct  7     NTTMRKILLLINCLVLAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILY  66

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
               RR+      S S K + ITP + IA+ ++G++ GVD++ YS+G +KLPVSTSSL++A 
Sbjct  67    FYRRKT----ESSSAKLYFITPRIFIASFIIGIVTGVDDFLYSWGGSKLPVSTSSLLLAA  122

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FTA  AF +VK KFT +S NAVVLLTVGAV+LG+R+  DRP G ++KAY+LGF+MT+
Sbjct  123   QLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTL  182

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
              AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T+F TVGM+ N DF+ I R
Sbjct  183   LAAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATVFCTVGMIANNDFQAISR  241

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EA++F LG  +YY + ++T I+WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAV+F
Sbjct  242   EAKQFNLGEARYYTVIIWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             + E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  +TEMT   T
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSP-KTEMTMMHT  349



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 255/338 (75%), Gaps = 13/338 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRA---CSDESSKS-  1015
             GNC GPL++RLYFL GG RIWFSSWL+TAG PVI IP+ VSY +RRR+      ESS S 
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLETAGCPVILIPITVSYLQRRRSGTTTDHESSTSS  89

Query  1014  -------RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAG  856
                     K  L+ P +  A+A++G+L G+DNY Y+YG+A+LPVSTSSLI+A+QL FTA 
Sbjct  90    QPSNNDDNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  855   FAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYG  676
             FAFLLVKQK T++S NAV LLT+GAVVLGL    DRP  ES + YL+GF+MT+ AA LYG
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPDNESARQYLVGFLMTIGAAVLYG  209

Query  675   LILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFEL  496
              +LPL+EL+Y +A+ Q ++++LVLE QM+M    T+  TVGMV+NKDF+ I +EAR + L
Sbjct  210   FVLPLMELTYKRAR-QEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTL  268

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G  KYY + V +A++WQ FF+GA+GVI  GSSLLSA+I+AVLLPVTEILAVIFY EKF+A
Sbjct  269   GEGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQA  328

Query  315   EKGISLFLSIWGFVSYFYGDI-KNTKKDNNESSAETEM  205
             EKG+SL LS+WGF SYFYG+I    K    E   ETEM
Sbjct  329   EKGVSLALSLWGFASYFYGEIKNKKKMKKREQLPETEM  366



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 274/355 (77%), Gaps = 6/355 (2%)
 Frame = -1

Query  1251  MEGQTRTT-MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             ME Q  +  MRRILL ++C+IL++G CGGPL++RLY++ GG+RIW SSWLQT G+P+  +
Sbjct  1     MEHQGLSAYMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLV  60

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL + Y  RR+    ++    KF+ ITP + IA+ ++G+  GVD++ YS+G +KLPVSTS
Sbjct  61    PLALLYLYRRKIKGPDA----KFYFITPRIFIASFIIGIATGVDDFLYSWGGSKLPVSTS  116

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SL++A QL FTA  AF +VK KFT +STNAVVLLTVGA++LG+RA  DRP G ++KAY+L
Sbjct  117   SLLLAAQLAFTAIGAFFIVKLKFTPYSTNAVVLLTVGAILLGIRANGDRPEGVTSKAYIL  176

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F TVGM+ NKD
Sbjct  177   GFIMTLLAAALYGVILPCIELMYLKAK-QAITATLVLEIQMVMCFAATAFCTVGMIANKD  235

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ + REA++F LG  +YY + V+TAI+WQ FFVG +GVI   SSL+S +++AVLLPVTE
Sbjct  236   FQAMSREAKQFNLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTE  295

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             +LAVIF++EKF  EKG++LFLS+WGFVSYFYG+ + TKK  N+SS    M +  T
Sbjct  296   VLAVIFFNEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSSQTEIMATTHT  350



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 270/345 (78%), Gaps = 4/345 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M R L+ ++CIIL+IGNCGGPL++RLYF  GG+RIWFS++L+TAGFP+IFIPL  SY  R
Sbjct  1     MARALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR+ S+E   +R FFLI P L +AA L+G+L G DNY Y+YG+A LPVST++LI+A+QL 
Sbjct  61    RRSNSNEGENTR-FFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLA  119

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             F A F++ +V  KFT F+ NAVVLLTVGA VLG+   +D+P  E++K Y++GF++TVAAA
Sbjct  120   FIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAA  179

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
              +Y  +LPL+EL+Y KAK Q +S++LVLE QMI+ F+ ++ S +GM+I  DF+ +P EAR
Sbjct  180   VMYAFLLPLVELAYQKAK-QPMSYTLVLEVQMILCFLASLVSLIGMLIAGDFKALPNEAR  238

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
             EF+LG   +YV+AV +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHE
Sbjct  239   EFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHE  298

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             KF+ EKG+SL LS+WGFVSYFYG+IK  K    +   E ++ S P
Sbjct  299   KFQKEKGLSLALSLWGFVSYFYGEIKADKDKRIQE--EAQLNSLP  341



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 275/355 (77%), Gaps = 7/355 (2%)
 Frame = -1

Query  1251  MEGQ-TRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             ME Q   TTMRRILL ++C+IL++G CGGPL++RLY++ GG+R+WFSSWLQTAG+P   I
Sbjct  1     MENQGLSTTMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLI  60

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL + Y  RR+        + K++LITP + IA+ ++GV+ G+D++ YS+G +KLPVSTS
Sbjct  61    PLAILYFYRRKT----EGINAKYYLITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTS  116

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SL++A QL FTA  AF +VK KFT +S NAVVLLTVG V+LG+R+  DRP G ++KAY+L
Sbjct  117   SLLLAAQLAFTAVGAFFIVKLKFTPYSINAVVLLTVGVVLLGVRSNGDRPEGVTSKAYIL  176

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F TVGM+ N D
Sbjct  177   GFMMTLLAAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATAFCTVGMIANND  235

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ I REA++F LG  +YY + V+T I+WQ FFVG +GVI   SSL+S +++AVLLPVTE
Sbjct  236   FQAISREAKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTE  295

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             +LAV+F+ E F  EKG++LFLS+WGFVSYFYG+ + TKK+ N+S  ++EMT+  T
Sbjct  296   VLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKEKNKSP-KSEMTTMRT  349



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 252/318 (79%), Gaps = 3/318 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY  RRR  S+    S  FF
Sbjct  16    GNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYITRRR--SNNVGDSTSFF  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L IAA ++G+L G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KFT
Sbjct  74    LIKPRLLIAAVIVGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLTVGA VLG+   +D+P  E++K Y+ GF++TVAAA +Y  ILPL+EL+Y 
Sbjct  134   PFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYITGFLITVAAAVMYAFILPLVELAYQ  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q +S++LVLEFQ+I+  + +I S +GM I  DF+ +P+EAREF+LG   +YV+AVF
Sbjct  194   KAK-QTMSYTLVLEFQLILCLLASIVSVIGMFIAGDFKALPKEAREFKLGEALFYVVAVF  252

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+W
Sbjct  253   SAIIWQGFFLGAIGLIFSTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSLW  312

Query  282   GFVSYFYGDIKNTKKDNN  229
             GFVSYFYG+IK+ +    
Sbjct  313   GFVSYFYGEIKSGEDKRR  330



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 276/358 (77%), Gaps = 7/358 (2%)
 Frame = -1

Query  1251  MEGQ-TRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             ME Q   T MRRILL ++C+IL++G CGGPL++RLY++ GG+RIW SSWLQT G+P+  +
Sbjct  1     MEHQGLSTNMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTIV  60

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL + Y  RR+    ++    KF+ ITP + +A+ ++G+  GVD++ YS+G +KLPVSTS
Sbjct  61    PLAILYLYRRKIEGPDA----KFYFITPRIFVASFIIGIATGVDDFLYSWGGSKLPVSTS  116

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SL++A QL FTA  AF +VK K T +STNAVVLLTVGAV+LG+RA  DRP G ++KAY+L
Sbjct  117   SLLLAAQLAFTAIGAFFIVKLKLTPYSTNAVVLLTVGAVLLGIRANGDRPEGVTSKAYIL  176

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYG+ILP IEL YLKAK Q+++ +LVLE QM+M F  T F TVGM+ NKD
Sbjct  177   GFIMTLLAAALYGIILPCIELMYLKAK-QSITATLVLEIQMVMCFAATAFCTVGMIANKD  235

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ + REA++F LG  +YY + V+TAI+WQ FFVG +GVI   SSL+S +++AVLLPVTE
Sbjct  236   FQAMSREAKQFNLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTE  295

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             +LAV+F++EKF  EKG++LFLS+WGFVSYFYG+ + TKK  N+SS ETE+ +     S
Sbjct  296   VLAVVFFNEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSS-ETEIMATTHTES  352



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 270/345 (78%), Gaps = 4/345 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M R L+ ++CIIL+IGNCGGPL++RLYF  GG+RIWFS++L+TAGFP+IFIPL  SY  R
Sbjct  1     MARALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR+ ++E   +R FFLI P L +AA L+G+L G DNY Y+YG+A LPVST++LI+A+QL 
Sbjct  61    RRSNNNEGENTR-FFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLA  119

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             F A F++ +V  KFT F+ NAVVLLTVGA VLG+   +D+P  E++K Y++GF++TVAAA
Sbjct  120   FIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAA  179

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
              +Y  +LPL+EL+Y KAK Q +S++LVLE QMI+ F+ ++ S VGM+I  DF+ +P EAR
Sbjct  180   VMYAFLLPLVELAYQKAK-QPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEAR  238

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
             EF+LG   +YV+AV +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHE
Sbjct  239   EFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHE  298

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             KF+ EKG+SL LS+WGFVSYFYG+IK  K    +   E ++ S P
Sbjct  299   KFQKEKGLSLALSLWGFVSYFYGEIKADKDKRIQE--EAQLNSLP  341



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 273/348 (78%), Gaps = 6/348 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             TTMRRILL ++C+IL++G CGGPL++RLY++ GG+R+WFSSWLQTAG+P   IPL + Y 
Sbjct  8     TTMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S ++ +F ITP + IA+ ++GV+ GVD++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRK---TEGSNAKLYF-ITPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAVVLLTVGAV+LG+R+  DRP G ++KAY+LGF+MT+ 
Sbjct  124   LAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T+F T+GM+ N DF+ I +E
Sbjct  184   AAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISKE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + V+T I+WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAV+F+
Sbjct  243   AKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  +TEMT   T
Sbjct  303   RENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSP-KTEMTMMHT  349



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/317 (60%), Positives = 249/317 (79%), Gaps = 4/317 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   GPLL+RLYFL+GG R W SSWLQT G+P++FIPL +SY  R   C     +  K +
Sbjct  37    GTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHR---CRCGGGRPIKLY  93

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A  +LG+LVG+D++ Y+YG++ LPVSTSS+++++QL FTA FAF +VKQKFT
Sbjct  94    LMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTALFAFFMVKQKFT  153

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FS NAVVLL++GAV+LGL A  DRP GESN  Y LGF MT+AAA LYG ILPL+EL+Y 
Sbjct  154   SFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYGFILPLVELTYA  213

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q VS++LV+E Q+ MGF  T+F TVGM++N DF VIPREAREFELG   YYVL V+
Sbjct  214   KAK-QVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHVIPREAREFELGEATYYVLLVW  272

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQF F+G +G I YGS+LL+ +I+AVL+PV+++LAV+F+HE F AEKG++L L++W
Sbjct  273   SAILWQFVFLGTVGAIFYGSALLAGIIMAVLVPVSQVLAVVFFHEPFSAEKGVALALALW  332

Query  282   GFVSYFYGDIKNTKKDN  232
             GF SYFYG+   +KK N
Sbjct  333   GFASYFYGEFLKSKKKN  349



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 272/348 (78%), Gaps = 6/348 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL ++C+IL++G CGGPL++RLY++ GG+R+W SSWLQTAG+P+  IPL + Y 
Sbjct  8     TNMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S + KF+ ITP + IA+ ++G++ G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRKI---EGSNA-KFYFITPRIFIASFIIGLVTGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAVVLLTVGAV+LG+R+  DRP G ++KAY+LGF+MT+ 
Sbjct  124   LAFTAVGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F TVGM+IN DF+ I RE
Sbjct  184   AAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATAFCTVGMIINNDFQAISRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + ++TAI+WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAV+FY
Sbjct  243   AKQFNLGEARYYTVVIWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFY  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  E E T+  T
Sbjct  303   RENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSP-EIETTTMHT  349



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score =   352 bits (903),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 202/350 (58%), Positives = 265/350 (76%), Gaps = 11/350 (3%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  ++R+ L L+CI+LS+G CG PL++RLYF+RGG R+W  SWL+   +P++ +PL  +Y
Sbjct  130   RKGLKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAY  189

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
              RRR A       + +  L+  FL  AAA +GVL+G+DNYFY+YG+ +LPVSTS+L++AT
Sbjct  190   SRRRSA----EGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIAT  245

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FTAGFAFLLV+Q+FT+ S N++ LLT+GA VL +   SDRPAGES  AY  GF MT+
Sbjct  246   QLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTL  305

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
              AAALYGL+LPL+EL Y KAK QAV++SLVLE Q++M F  T F TV M++NKDF+ IPR
Sbjct  306   GAAALYGLVLPLVELMYKKAK-QAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPR  364

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EAR +ELG  +YYV+ V+TAI+ QFFF+GA+GVI Y SSL SA+I+A LLP TEILAVI 
Sbjct  365   EARNYELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVIC  424

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESS------AETEM  205
             + EKF+AEKG++L LS+WGF SYFYG+ K  KK+   ++      AETEM
Sbjct  425   FQEKFQAEKGVALALSLWGFASYFYGEFKLAKKEKEATAGTVIKPAETEM  474



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 256/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             MR+ LL ++ I+L+IG CGGPLL+R YF+ GG R WFSSWL T G+P+I  P+  +Y  R
Sbjct  1     MRKALLVINGIVLAIGKCGGPLLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR    E +   K FL+ P L +A+A++G+L GVD+Y YSYG+A LPVST S+++A+QL 
Sbjct  61    RR---TEPTSKNKLFLMRPPLFVASAVIGILTGVDDYLYSYGVALLPVSTCSIVIASQLA  117

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FAF+LVKQKFT++S NAV LLTVGA VL LRA SDRP  ESN+ Y LGF+MT+AAA
Sbjct  118   FTAAFAFILVKQKFTSYSVNAVFLLTVGAGVLALRASSDRPDTESNRKYALGFIMTLAAA  177

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             ALYG +LPL+EL Y K K Q +S++LV+E +M+     T F TVGM++N DF+VIPREAR
Sbjct  178   ALYGFVLPLVELMYKKTK-QEMSYALVMEIEMVNCLFATGFCTVGMLVNNDFKVIPREAR  236

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
             EF+LG TKYYV+A+++AI+WQFFF+GA GVI   SSL+S +I+AV+LPV EILAVIFY E
Sbjct  237   EFDLGETKYYVVAIWSAIMWQFFFLGATGVIFCASSLVSGIIIAVVLPVIEILAVIFYKE  296

Query  327   KFEAEKGISLFLSIWGFVSYFYGD  256
              F+AEKG++L LS+WGF+SYFYG+
Sbjct  297   NFQAEKGVALALSVWGFISYFYGN  320


 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGP L+R YF+ GG R WFSSWL T G+P+I  P+  +Y  R   C  E +   K F
Sbjct  319   GNCGGPFLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYR---CRTEPTSKNKLF  375

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVST  898
             L+ P L IA+A++G+L GVD+Y Y+YG+A LPVST
Sbjct  376   LMKPPLFIASAVIGILTGVDDYLYAYGVALLPVST  410



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 269/358 (75%), Gaps = 6/358 (2%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME Q  + M+++LL ++CIIL++G CG PLL+RLYF++GGNRIW S+WLQT  +P+ FIP
Sbjct  1     MEPQVSSKMKKVLLVINCIILAVGTCGTPLLLRLYFIKGGNRIWLSTWLQTVAWPINFIP  60

Query  1071  LLVSYHRRRRACSDESSKSR----KFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPV  904
             L +SY  RR+   +    +     K  L+TP +  A   +GVL G  NYFYSYG AK+PV
Sbjct  61    LAISYFYRRKININNDINNNNDNIKVILMTPRIFAATIGIGVLQGFANYFYSYGSAKVPV  120

Query  903   STSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKA  724
             STS L+ ATQL FTAGFAFL+VK KFT++S NAV LLTVGAV+L L +G D+P GE  K 
Sbjct  121   STSGLLFATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKE  180

Query  723   YLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVI  544
             Y+LGF+M +AAAAL GLI PL+EL Y KA  QA++++LVLEFQ +  FV TI +T+GM+I
Sbjct  181   YILGFIMILAAAALTGLIFPLVELIYKKAH-QAITYTLVLEFQTVYCFVATIVATIGMII  239

Query  543   NKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLP  364
             NKDF+ I  EA+EFELG  +YY L ++ AI+ QF+F+G +GVI   SSL+S ++++VLLP
Sbjct  240   NKDFQAISTEAKEFELGEGRYYNLIIWGAIILQFYFLGTIGVIYSASSLVSGILISVLLP  299

Query  363   VTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
             +TE+LAV FY EKF AEKG+SL LS+WGF+SYFYGD+K +KK  N+S  ETEM  + T
Sbjct  300   ITEVLAVFFYGEKFSAEKGVSLALSLWGFLSYFYGDMKKSKKKENQSP-ETEMIDSKT  356



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score =   347 bits (891),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 268/355 (75%), Gaps = 5/355 (1%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME Q  + M+++LL ++CIIL++G CG PLL+RLYF++GGNRIW S+WLQT  +P+ FIP
Sbjct  1     MEPQVSSKMKKVLLVINCIILAVGTCGTPLLMRLYFIKGGNRIWLSTWLQTVAWPINFIP  60

Query  1071  LLVSYHRRRRACSDESSKS---RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVS  901
             L +SY  RR+   +    +    K  L+TP + +A   +GVL G  NYFY+YG AKLPVS
Sbjct  61    LAISYFYRRKININNDINNNNNMKVILMTPRIFVATIGIGVLQGFANYFYAYGTAKLPVS  120

Query  900   TSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAY  721
             TS L+ ATQL FTAGFAFL+VK KFT++S NAV LLTVGAV+L L +G D+P GE  K Y
Sbjct  121   TSGLLFATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEY  180

Query  720   LLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVIN  541
             +LGF+MT+AAAAL GLI PL+EL Y KA  QA++++LVLEFQ +  FV TI +T+GM+IN
Sbjct  181   ILGFIMTLAAAALSGLIFPLVELIYKKAH-QAITYTLVLEFQTVYCFVATIVATIGMIIN  239

Query  540   KDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPV  361
             KDF+ I  EA+ FELG  +YY L +++AI+ QF+F+G +GVI   SSL+S ++++VLLP+
Sbjct  240   KDFQAISTEAKAFELGEGRYYNLIIWSAIILQFYFLGTIGVIYSASSLVSGILISVLLPI  299

Query  360   TEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSA  196
             TE+LAV  Y EKF AEKG+SL LS+WGF+SYFYGDIK +KK   E S ETEM  +
Sbjct  300   TEVLAVFIYGEKFSAEKGVSLALSLWGFLSYFYGDIKESKK-KEEQSPETEMIDS  353



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 275/353 (78%), Gaps = 3/353 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             EG+   TM+R+LL ++C++L++G  GGPL++RLYFLRGGNR+W S +L+TAGFP++  PL
Sbjct  6     EGEKNRTMKRLLLIINCLLLAVGTTGGPLVMRLYFLRGGNRVWLSCFLETAGFPLMVPPL  65

Query  1068  LVSYHRRRR-ACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             ++SY RRRR A +  ++K R   +  P L+ A+A +GVL G+D+Y Y+YG+A+LPVSTS+
Sbjct  66    ILSYLRRRRGAVAAGTAKPRLVSMNIPLLA-ASAFIGVLTGLDDYLYAYGVARLPVSTSA  124

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+ATQL FTA FAFLLV+QKFT++S NAVVLLT+GAVVL L A  DRP GES KAY++G
Sbjct  125   LIIATQLGFTAFFAFLLVRQKFTSYSVNAVVLLTIGAVVLALHASGDRPHGESVKAYVMG  184

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             FVMTV AAALYG +LPL+EL Y K K Q +++SLV+E Q ++ F  T+F  +GM++N DF
Sbjct  185   FVMTVIAAALYGFVLPLVELVYKKCK-QPITYSLVMEIQFVLCFSATLFCGIGMIVNNDF  243

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + IP EA++F+ G   YY + V +AI+WQ FF+GA+GVI   SSLLS +++AVLLPVTE+
Sbjct  244   KAIPIEAKKFKHGEVNYYTVLVASAILWQAFFLGAIGVIFCASSLLSGILIAVLLPVTEV  303

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             LAVI Y EKF+AEKG+SL LS+WG VSYFYG+IK+ KK     S++ E T  P
Sbjct  304   LAVILYREKFKAEKGVSLLLSLWGMVSYFYGEIKHDKKMKKRKSSDIEATEMP  356



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 267/358 (75%), Gaps = 9/358 (3%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             K +   +  M + LL ++C+IL++GN GGPL++RLYF+ GG R+W S+ L+TAGFP++ I
Sbjct  5     KEQQVAKKKMNKFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLMLI  64

Query  1074  PLLVSY-----HRRRRACSDE---SSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGM  919
             PL +SY     HR +   S+    +S+ +    + P +  AAA +G+L G+D+Y Y+YG+
Sbjct  65    PLTISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAYGV  124

Query  918   AKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAG  739
             A+LPVSTSSLI+A+QL FTA FAFLLVKQKFTAF+ NAV LLTVGA VL +   SDRPAG
Sbjct  125   ARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRPAG  184

Query  738   ESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFST  559
              S K Y +GF  TVAA+ALYG +LP +EL Y K K Q +++SLV+EFQ +M    TIF T
Sbjct  185   VSAKQYAIGFSTTVAASALYGFVLPAVELVYKKIK-QPITYSLVMEFQFVMCMFATIFCT  243

Query  558   VGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliv  379
             +GM+IN DF++IPREAR F LG + YYV+ V  AI+WQ FF+GA+GV+   SSLLS +++
Sbjct  244   IGMIINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGILI  303

Query  378   avlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             AVLLP+TE+LAV+FY EKF+AEKG+SL LS+WGFVSYFYG+IK+ K +  + S E EM
Sbjct  304   AVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKRSLEIEM  361



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/362 (56%), Positives = 270/362 (75%), Gaps = 10/362 (3%)
 Frame = -1

Query  1260  ALKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVI  1081
             A ++E + +  M+RILL ++C IL++GN GGPL++RLYF+ GGNR+W SS+L+TAGFP++
Sbjct  2     AERIEEEKQRKMKRILLIINCFILALGNSGGPLIMRLYFIHGGNRVWLSSFLETAGFPLM  61

Query  1080  FIPLLVSYHRRRR-----ACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMA  916
              +PL VSY +RRR     A + ES K      + P L +A A +G++ G+D+Y Y+YG+A
Sbjct  62    LLPLTVSYIKRRRLHRRNAATTESGK-LNLISMKPPLFLAVAFIGIITGLDDYLYAYGVA  120

Query  915   KLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGE  736
             +LPVSTS+LI+A+QL FTA FAFLLVKQKFTAFS NAVVLLT+GA VL +    DRP GE
Sbjct  121   RLPVSTSALIIASQLGFTAVFAFLLVKQKFTAFSINAVVLLTIGAGVLAMHTSGDRPNGE  180

Query  735   SNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTV  556
             S K Y++GF+ TVAAAALYG +LPLIEL Y K K Q +++SLV+E Q +M    T+F  V
Sbjct  181   STKQYVIGFITTVAAAALYGFVLPLIELVYKKTK-QPLTYSLVMEIQFVMCMFATLFCAV  239

Query  555   GMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliva  376
             GM++N DF+VIPREA+ F LG   YY + V +AI+WQ FF+GA+GVI   SSLLS +++A
Sbjct  240   GMIVNNDFKVIPREAKIFGLGEKTYYFVLVVSAIMWQAFFLGAVGVIFCASSLLSGILIA  299

Query  375   vlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNT---KKDNNESSAETEM  205
             VLLP+TE+LAVIFY E F+AEK +SL LS+WGFVSYFYG+ K +   KK N +   +   
Sbjct  300   VLLPLTEVLAVIFYKEHFQAEKAVSLILSLWGFVSYFYGEFKESKELKKKNPDLETQLAQ  359

Query  204   TS  199
             TS
Sbjct  360   TS  361



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/352 (58%), Positives = 273/352 (78%), Gaps = 7/352 (2%)
 Frame = -1

Query  1251  MEGQ-TRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             ME Q   TTMRRILL ++C+IL+IG CGGPL++RLY++ GG+R+WFSSWLQTAG+P  FI
Sbjct  1     MEHQGLSTTMRRILLLINCLILAIGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTFI  60

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL + Y  RR+        + K++LITP + IA+ ++G + G+D++ YS+G +KLPVSTS
Sbjct  61    PLAILYFNRRKT----EGINAKYYLITPRIFIASFIIGFVTGLDDFLYSWGGSKLPVSTS  116

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SL++A QL FTA  AF +VK KFT +S NAVVLLT+GAV+LG+R+  DRP G ++KAY++
Sbjct  117   SLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYII  176

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F TVGM+ N D
Sbjct  177   GFMMTLLAAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATAFCTVGMIANND  235

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ I REA++F LG  +YY + V+T I+WQ FFVG +GVI   SSL+S +++AVLLPVTE
Sbjct  236   FQAISREAKQFNLGEARYYTVVVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTE  295

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTS  199
             +LAV+F+ E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  +TEM +
Sbjct  296   VLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKLKNKSP-KTEMAT  346



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 272/348 (78%), Gaps = 6/348 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             TTMRRILL +SC+IL++G CGGPL++RLY++ GG+RIW SSWLQT G+P+ FIPL   Y+
Sbjct  8     TTMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTFIPLAFLYY  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S + KF+L+TP + IAA ++G+  G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRKI---EGSNA-KFYLMTPRIFIAAFVIGIATGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK K + FS NAVVLLTVGAV+LG+R+  DRP G ++K Y++GF+MT+ 
Sbjct  124   LAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL Y+KAK QA++ +LVLE QMIM F  T F TVGM+ NKDF+ + RE
Sbjct  184   AAALYGVILPCIELIYMKAK-QAITATLVLEIQMIMSFAATAFCTVGMIANKDFQAMSRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + V TA +W+ FFVG +GVI   SSL+S +++AVLLPVTE+LAVIF+
Sbjct  243   AKQFNLGEARYYTVIVCTAAIWECFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
              EKF  EKG++LFLS+WGFVSYFYG+ + TKK+ N+S  E EMT+  T
Sbjct  303   KEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKEKNKSP-EAEMTTTHT  349



>ref|XP_009762239.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 206/348 (59%), Positives = 273/348 (78%), Gaps = 8/348 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL ++C+IL++G CGGPL++RLY++ GG+R+WFSSWLQT G+P+  IPL + Y 
Sbjct  8     TKMRRILLLINCLILAVGVCGGPLMMRLYYVGGGSRVWFSSWLQTGGWPLTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR++   ++    K  LITP + IA+ +LGV  G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRKSKGADA----KVCLITPQIFIASFVLGVGTGIDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAV+LLTVGAV+LG+R+  D+PAG ++KAY+LGF+MT+ 
Sbjct  124   LGFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPAGVTSKAYVLGFIMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F T+GMV NKDF+ I RE
Sbjct  184   AAALYGIILPSIELIYLKAK-QAITVTLVLEIQMVMCFAATTFCTIGMVANKDFQAISRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A +F LG  +YY + ++TAI+WQ FFVGA+GVI   S+L+S +I+AVLLPVTE+LA++F+
Sbjct  243   AIQFNLGEARYYTVIIWTAILWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
              EKF  EKG+SLFLS+WGFVSYFYG+ +  KK  N+ S ETEMT  PT
Sbjct  303   SEKFSGEKGVSLFLSLWGFVSYFYGEFRLMKKQKNKRS-ETEMT--PT  347



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 241/309 (78%), Gaps = 6/309 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF+ GG R+W SS LQT G+P+I +P   S++RRRR      + + KFF
Sbjct  42    GNCGGPLIMRLYFINGGKRVWLSSCLQTVGWPIILLPAAFSFYRRRR-----QNPAAKFF  96

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              I PFL +A A++G+L G++ Y Y+YG+A+LPVST++LI A+QL FTA FA+LLVKQKFT
Sbjct  97    EIKPFLILAFAVVGILTGLNAYSYTYGVARLPVSTAALITASQLAFTAAFAYLLVKQKFT  156

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAV LLT G  VL L    DRP GES+K YL+GF+M+V AA +YG ILPL+EL+Y 
Sbjct  157   AYSLNAVALLTAGGAVLALHTSGDRPEGESSKEYLMGFLMSVGAALIYGFILPLMELAYK  216

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q +++SLVLE QM+M F  T F  VGM+INKDF+ +PREA++FELG TKYYV+ V 
Sbjct  217   KAK-QELTYSLVLEVQMVMCFFATAFCIVGMIINKDFQAVPREAKKFELGETKYYVVLVC  275

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+GV+   SSLLS +++AVLLPVTE+  VIFY E F AEKG+SL LS+W
Sbjct  276   SAIIWQGFFLGAVGVVYCASSLLSGIVIAVLLPVTEVFGVIFYKESFPAEKGLSLVLSLW  335

Query  282   GFVSYFYGD  256
             GF SYFYG+
Sbjct  336   GFASYFYGE  344



>ref|XP_009605309.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 202/345 (59%), Positives = 269/345 (78%), Gaps = 6/345 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL ++C+IL++G CGGPL++RLY++ GG+R+W SSWLQT G+P+  IPL + Y 
Sbjct  8     TKMRRILLLVNCLILAVGVCGGPLMMRLYYVGGGSRVWLSSWLQTGGWPLTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR++       + KF LITP + I + ++GV  G+DN+ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRKS----EGANAKFCLITPQIFIVSFVIGVGTGIDNFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAV+LLTVGAV+LG+R+  D+P G ++KAY+LGF+MT+ 
Sbjct  124   LGFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPEGVTSKAYVLGFIMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK QA++ +LVLE Q++M F  T F T+GMV NKDF+ I RE
Sbjct  184   AAALYGVILPSIELIYLKAK-QAITVTLVLEIQIVMCFAATAFCTIGMVANKDFQAISRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A +F L   +YY + V+TAI+WQ FFVGA+GVI   S+L+S +I+AVLLPVTE+LA++F+
Sbjct  243   ANQFNLEEARYYTVIVWTAIIWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTS  199
              EKF  EKG+SLFLS+WGFVSYFYG+ K  KK  N+SS +TEMT+
Sbjct  303   SEKFSGEKGVSLFLSLWGFVSYFYGEFKQMKKQKNKSS-DTEMTT  346



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 252/323 (78%), Gaps = 5/323 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYFL GG  +W SS+LQTAG+P++  PL+VSY  RR   S++ S++ K  
Sbjct  36    GNCGGPLIQRLYFLEGGKAVWISSFLQTAGWPLVLFPLIVSYMYRR---SNKGSRT-KLI  91

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              I+P L +A A++G+L G+D++  +YG++ LPVSTS+LI+ATQL FTAGFA++LVKQKFT
Sbjct  92    YISPRLFLACAVIGLLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYILVKQKFT  151

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+ LL++GAVVL + A SDRP  E+ + YLLGF MT+ A+ALYG +LPLIEL+Y 
Sbjct  152   PFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLIELTYK  211

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q ++++LV+E Q+++ F  T F  +GM+++KDFE IPREA EFELG  KYYV+ VF
Sbjct  212   KAK-QTITYTLVMEMQIVISFFATGFCAIGMLLHKDFEAIPREASEFELGRVKYYVVNVF  270

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA+ WQ FF+GA+GV+  GSSLLS +I+A LLPVTE L V+FYHEKF  EKGISL LS+W
Sbjct  271   TAVFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKGISLVLSLW  330

Query  282   GFVSYFYGDIKNTKKDNNESSAE  214
             GF+SYFYG+++  KK +  S  E
Sbjct  331   GFISYFYGELQQNKKKSRTSEFE  353



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 255/337 (76%), Gaps = 16/337 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY---HRRRRAC--------  1036
             GNCGGPL++RLYF  GG R+W SS+L+TAGFP+IFIPL  S+   +R R +C        
Sbjct  16    GNCGGPLMMRLYFNNGGKRVWLSSFLETAGFPIIFIPLFSSFLKRNRNRTSCIITSSSSS  75

Query  1035  SDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAG  856
             SDE ++   FFL+ P L  A+  +G++ G+DNY Y+YG+A LPVSTSSLI+A+QL FTA 
Sbjct  76    SDEKTR---FFLMRPRLFAASGFIGIITGLDNYLYAYGLAFLPVSTSSLIIASQLAFTAL  132

Query  855   FAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYG  676
             FAFLLVKQKFT FS NAVVLLTVGA VL L  G D+P+ ES K Y+LGFV+TVAAA LY 
Sbjct  133   FAFLLVKQKFTPFSVNAVVLLTVGAGVLALHTGGDKPSNESQKDYMLGFVLTVAAAVLYA  192

Query  675   LILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFEL  496
              ILP IEL+Y KA+ Q +SF+LVLE QM+M    ++F  VGM+I+ DF+ IPREAR F L
Sbjct  193   FILPFIELTYKKAR-QEMSFTLVLEVQMVMCLFASVFCLVGMLISDDFKAIPREARSFGL  251

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G   YYV+  FTAI+WQ FF+GA+GVI   SSL+S ++++VLLP+TE+LAV+ + E+F+A
Sbjct  252   GERVYYVVIAFTAIIWQGFFLGAIGVIFCASSLVSGVLISVLLPLTEVLAVVCFKERFQA  311

Query  315   EKGISLFLSIWGFVSYFYGDIKNTK-KDNNESSAETE  208
             EKG+SL LS+WGFVSYFYG+ K++K   + +S A TE
Sbjct  312   EKGVSLVLSLWGFVSYFYGEAKHSKVHKDGQSEARTE  348



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 201/344 (58%), Positives = 270/344 (78%), Gaps = 6/344 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             TT RRILL ++C+IL++G CGGPL++RLY++ GG+R+WFSSWLQTAG+P   IPL + Y 
Sbjct  8     TTTRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S ++ +F ITP + IA+ ++GV+ GVD++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRK---TEDSNAKLYF-ITPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAVVLLTVGAV+LG+R+  DRP G ++K+Y+LGF+MT+ 
Sbjct  124   LAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKSYILGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T+F T+GM+ N DF+ I RE
Sbjct  184   AAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + V+T I+WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAV+F+
Sbjct  243   AKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMT  202
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  + EMT
Sbjct  303   RENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSP-KIEMT  345



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 260/363 (72%), Gaps = 11/363 (3%)
 Frame = -1

Query  1257  LKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIF  1078
             +  + Q  T MRR LL  +C +L++G CGGPL++RLYFL GGNR+W SS+LQT G P+IF
Sbjct  1     MDQQQQNTTAMRRPLLVFNCFLLAVGTCGGPLIMRLYFLHGGNRVWLSSFLQTGGCPIIF  60

Query  1077  IPLLVSY-HRRRRACSD------ESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGM  919
             IPLL+SY HRRRR  +       E + S +   + P L +A++++G++ G  ++ Y+YG+
Sbjct  61    IPLLISYIHRRRRPRAQYSLNPSEPTNSTEMIFMKPRLFLASSVIGIITGFVDFLYAYGV  120

Query  918   AKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAG  739
             A+LPVSTS+LI A QL FTAGFAF LVKQKFT +S NAVVL+T G  +L L    DR AG
Sbjct  121   AQLPVSTSALIRACQLAFTAGFAFWLVKQKFTPYSINAVVLVTAGGAILALHTSGDRRAG  180

Query  738   ESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFST  559
             E+N+ Y+ GF+ TVAAA +YG ILPL+ELSY +A+ Q ++++LVLE Q  M    T+  T
Sbjct  181   EANRDYIAGFLTTVAAAVVYGFILPLVELSYKRAR-QQITYTLVLEVQFFMSLFATLVCT  239

Query  558   VGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliv  379
             + MVIN DF+VIP EA  F LG  KYYV+ V +AI+WQ FF+G +GVI   SS  S +++
Sbjct  240   IAMVINNDFQVIPTEAEAFGLGKAKYYVILVLSAIIWQSFFLGVVGVIFCSSSFFSEIVI  299

Query  378   avlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNN---ESSAETE  208
             AVLLPVTEILAVI ++EKF+AEK ISL L++WGFVSYFYG+IK+ KK      +  AET 
Sbjct  300   AVLLPVTEILAVIIFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKLELQRRAETT  359

Query  207   MTS  199
              T 
Sbjct  360   TTQ  362



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/334 (58%), Positives = 252/334 (75%), Gaps = 9/334 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-----HRRRRACSDE---  1027
             GN GGPL++RLYF+ GG R+W S+ L+TAGFP++ IPL +SY     HR +   S+    
Sbjct  29    GNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLMLIPLTISYIQRFRHRHKPLPSNTISI  88

Query  1026  SSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAF  847
             +S+ +    + P +  AAA +G+L G+D+Y Y+YG+A+LPVSTSSLI+A+QL FTA FAF
Sbjct  89    ASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAYGVARLPVSTSSLIIASQLGFTAFFAF  148

Query  846   LLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLIL  667
             LLVKQKFTAF+ NAV LLTVGA VL +   SDRPAG S K Y +GF  TVAA+ALYG +L
Sbjct  149   LLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRPAGVSAKQYAIGFSTTVAASALYGFVL  208

Query  666   PLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVT  487
             P +EL Y K K Q +++SLV+EFQ +M    TIF T+GM+IN DF++IPREAR F LG +
Sbjct  209   PAVELVYKKIK-QPITYSLVMEFQFVMCMFATIFCTIGMIINNDFKMIPREARNFGLGES  267

Query  486   KYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKG  307
              YYV+ V  AI+WQ FF+GA+GV+   SSLLS +++AVLLP+TE+LAV+FY EKF+AEKG
Sbjct  268   IYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGILIAVLLPLTEVLAVVFYKEKFQAEKG  327

Query  306   ISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             +SL LS+WGFVSYFYG+IK+ K +  + S E EM
Sbjct  328   VSLVLSLWGFVSYFYGEIKHAKAEKKKRSLEIEM  361



>ref|XP_008812219.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
 ref|XP_008812222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=357

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 250/317 (79%), Gaps = 8/317 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLL+RLYFL+GG+R W SSWL+T G+P++FIPL +SY  RR           K +
Sbjct  36    GTTGGPLLLRLYFLKGGSRKWLSSWLETGGWPLLFIPLAISYAHRRGG-----GGPTKLY  90

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A  +LG+LVG+D++ Y+YGM+ LPVST+S++V+T L FTA FAFL+VKQKFT
Sbjct  91    LMTPPLFLACTVLGLLVGLDDFLYAYGMSCLPVSTASILVSTHLGFTALFAFLIVKQKFT  150

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FSTNAVVLL++GAV+LGL A  DRP GESN  Y LGF MT+AAA LYG++LPL+EL+Y 
Sbjct  151   SFSTNAVVLLSIGAVILGLHASGDRPKGESNTLYYLGFAMTLAAAMLYGVVLPLVELTYA  210

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q VS++LV+E Q++MGF  T+F TVGM++NKDF+ IP+EAR+F LG  +YYVL V+
Sbjct  211   KAK-QVVSYTLVMEMQLVMGFFATVFCTVGMLVNKDFQAIPKEARDFGLGEVRYYVLLVW  269

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +A++WQFF++G +G I YGS+LL+ +I+A ++PVTE+LAVI +HE F   KG++  L++W
Sbjct  270   SALMWQFFYLGTVGAIFYGSALLAGIIIAAMIPVTEVLAVILFHEPFSGGKGVA--LALW  327

Query  282   GFVSYFYGDIKNTKKDN  232
             GF SYFYG+ + +KK  
Sbjct  328   GFASYFYGEFQESKKKK  344



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 247/317 (78%), Gaps = 4/317 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G    PLL+RLYFL+GG R W SSWLQT G+P++FIPL++SY  RRR C     +  K +
Sbjct  37    GTAVSPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLVISYAHRRR-CG--GGRPTKLY  93

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LITP L ++  +LG LVG+D++ Y+YGM+ LPVSTSS++++TQL FTA FAF +VKQKFT
Sbjct  94    LITPPLFLSCTVLGFLVGLDDFLYAYGMSYLPVSTSSILISTQLGFTALFAFFIVKQKFT  153

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FS NAVVLL++GAV+LGL A  DRP GESN  Y  GF MT+AAA LYG ILPL+EL+Y 
Sbjct  154   SFSVNAVVLLSIGAVILGLHASGDRPKGESNTLYYWGFFMTLAAAVLYGFILPLVELTYA  213

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q VS++LV+E Q++MGF  T+F TVGM++N DF  IPREA+E ELG  +YY L ++
Sbjct  214   KAK-QVVSYTLVIEMQLVMGFFATVFCTVGMLVNNDFHAIPREAQECELGELRYYELLIW  272

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQFFF+G +G I YGS+LL+ +I+AVL+PVTE+LAV+F+HE F   KG++L L++W
Sbjct  273   SAILWQFFFLGTVGAIFYGSALLAGIIMAVLIPVTEVLAVVFFHEPFSGGKGVALALALW  332

Query  282   GFVSYFYGDIKNTKKDN  232
             GFVSYFYG+   +KK  
Sbjct  333   GFVSYFYGEFLESKKKK  349



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 270/348 (78%), Gaps = 6/348 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL ++C+IL++G CGGPL++RLY++ GG+R+W SSWLQTAG+P+  IPL + Y 
Sbjct  8     TNMRRILLVINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S + KF+ ITP + IA+ ++GV+ G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRKV---EGSNA-KFYFITPRIFIASFVIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FT+  AF +VK KFT +S NAV+LLTVGAV+LG+R+  DRP G ++KAY+LGF+MT+ 
Sbjct  124   LAFTSVGAFFIVKLKFTPYSINAVILLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL YLKAK Q ++ +LVLE QM+M F  T F TVGM+ N DF+ + RE
Sbjct  184   AAALYGVILPCIELIYLKAK-QVITATLVLEIQMVMCFAATAFCTVGMIANNDFQAMSRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + V+T+I+WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAV+F+
Sbjct  243   AKQFNLGEARYYTVIVWTSIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPT  190
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N+S  + EM +  T
Sbjct  303   RENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSP-QIEMKTTHT  349



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 247/322 (77%), Gaps = 3/322 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYFL GG RIW + WLQTA +P+I IPL+ SY  RR+    E     K  
Sbjct  25    GACGGPLIMRLYFLHGGKRIWLTGWLQTAAWPLILIPLVASYCNRRK--KPEGGSPTKLV  82

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI     I+  ++G LVG+ N+ YS+G+  LPVST+SLI+ATQLVFTA  AF+LV QKF 
Sbjct  83    LIDLRTLISGVIIGCLVGLTNHLYSFGVGHLPVSTNSLILATQLVFTAFSAFILVGQKFN  142

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A++ NA+VLLT+G+VVL + AGS+RP GE NK Y+LGF++T+AAAAL G +LPLIEL+Y+
Sbjct  143   AYTVNAIVLLTLGSVVLAIHAGSERPKGEKNKMYVLGFILTLAAAALSGCLLPLIELTYM  202

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK QA+S++LV+EFQ ++    T+FSTVGM++N DF+ I +EARE++LG TKYY++ V+
Sbjct  203   KAK-QAISYTLVMEFQSVVCISATVFSTVGMLVNNDFKEISQEAREYQLGETKYYLVLVW  261

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AIVWQ F VG  G+I   SSL S +++A LLP+TE+LAVIFYHEKF+AEKGI+L LS+W
Sbjct  262   CAIVWQCFTVGFTGIIFCASSLFSGIMLAALLPITEVLAVIFYHEKFQAEKGIALALSLW  321

Query  282   GFVSYFYGDIKNTKKDNNESSA  217
             GF+S+FYG IK+ KK     +A
Sbjct  322   GFISHFYGAIKHGKKQQIPEAA  343



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 202/344 (59%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL +SC+IL++G CGGPL++RLY++ GG+RIW SSWLQT G+P+  IPL + Y+
Sbjct  8     TNMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYY  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S + KF+L+TP + IA+ ++GV  G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRK---TEGSNA-KFYLMTPRIFIASFIIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK K + FS NAVVLLTVGAV+LG+R+  DRP G ++K Y++GF+MT+ 
Sbjct  124   LAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL Y+KAK QA++ +LVLE QMIM F  T F TVGM+ NKDF+ + RE
Sbjct  184   AAALYGVILPCIELIYMKAK-QAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F LG  +YY + V TA +WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAVIF+
Sbjct  243   AKQFNLGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMT  202
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N +S E EMT
Sbjct  303   KENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKN-TSPEAEMT  345



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 275/356 (77%), Gaps = 7/356 (2%)
 Frame = -1

Query  1251  MEGQ-TRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             ME Q   TTMRRILL ++C+IL++  CGGPL++RLY++ GG+RIWFSSWLQTAG+P+  I
Sbjct  1     MEHQGLSTTMRRILLLINCLILAVDICGGPLMMRLYYVEGGSRIWFSSWLQTAGWPITLI  60

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL++ Y  R++        + K++LITP + IA+ ++GV+ G+D++ YS+G +KLPVSTS
Sbjct  61    PLVILYFYRQKT----EGTNAKYYLITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTS  116

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             SL++A QL FTA  AF +VK KFT +S NAVVLLT+GAV+LG+R+  DRP G ++KAY++
Sbjct  117   SLLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYII  176

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+ AAALYG+ILP IEL YLKAK QA++ +LVLE QM+M F  T F TVGM++N +
Sbjct  177   GFMMTLLAAALYGVILPCIELIYLKAK-QAITATLVLEIQMVMCFAATAFCTVGMIVNNN  235

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ I REA++F LG  +YY + V+T IVW  FFVG +GVI   SSL+S +++AVLLPVTE
Sbjct  236   FKAISREAKQFNLGEARYYTVIVWTTIVWLCFFVGVIGVIYCSSSLMSGVMIAVLLPVTE  295

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTV  187
             +LAV+F+ E F  EKG++LFL +WGFVS FYG+ + TKK  N+ S ++EMT+  TV
Sbjct  296   VLAVVFFRENFLVEKGLALFLCLWGFVSCFYGEFRQTKKQKNK-SLKSEMTTTRTV  350



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score =   339 bits (870),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 201/344 (58%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T MRRILL +SC+IL++G CGGPL++RLY++ GG+RIW SSWLQT G+P+  IPL + Y+
Sbjct  8     TNMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYY  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+    E S + KF+L+TP + IA+ ++GV  G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRK---TEGSNA-KFYLMTPRIFIASFVIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK K + FS NAVVLLTVGAV+LG+R+  DRP G ++K Y++GF+MT+ 
Sbjct  124   LAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             AAALYG+ILP IEL Y+KAK QA++ +LVLE QMIM F  T F TVGM+ NKDF+ + RE
Sbjct  184   AAALYGVILPCIELIYMKAK-QAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSRE  242

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             A++F +G  +YY + V TA +WQ FFVG +GVI   SSL+S +++AVLLPVTE+LAVIF+
Sbjct  243   AKQFNVGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFF  302

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMT  202
              E F  EKG++LFLS+WGFVSYFYG+ + TKK  N +S E EMT
Sbjct  303   KENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKN-TSPEAEMT  345



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score =   339 bits (869),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 253/329 (77%), Gaps = 5/329 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL++RLYF+ GGNRIW SS+L+TA FP+I IPL +S+  R    S  S K +   
Sbjct  16    GTSGGPLVMRLYFIHGGNRIWLSSFLETAAFPLILIPLTISHLHR---TSHHSPKPKLVS  72

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             +  P L +A+A++G+L G+D+Y Y+ G+A+LPVSTSSLI A+ L FTA FAFLLVK +FT
Sbjct  73    IKLP-LFLASAVIGILTGLDDYLYACGIARLPVSTSSLIQASHLAFTAVFAFLLVKHRFT  131

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NA+VLLTV AVVL LR+G DRP+GES + Y++GFVM +AAAALYG +LPL+EL Y 
Sbjct  132   AYSVNAIVLLTVAAVVLALRSGGDRPSGESTRQYVIGFVMILAAAALYGFVLPLMELVYK  191

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             ++K Q V++SLV+E Q +M F  T+F T+GM+IN DF+VI REA++++LG TKYYV+ V 
Sbjct  192   RSK-QRVTYSLVMEIQFVMCFFATLFCTIGMLINNDFKVIWREAKDYKLGETKYYVVLVG  250

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQFFF+GA+GVI   SSL S +I+A  LPVTE+L VI Y E FEAEKG++L LS+W
Sbjct  251   SAIMWQFFFLGAIGVIFCSSSLFSGIIIAAFLPVTEVLGVIVYKENFEAEKGVALLLSLW  310

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSA  196
             GFVSYFYG+IK  ++ N +   ETE+  +
Sbjct  311   GFVSYFYGEIKQEREKNKKGCPETELPQS  339



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 199/332 (60%), Positives = 262/332 (79%), Gaps = 7/332 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY HRRR     E++ S  F
Sbjct  16    GNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRRNNNGGENATS--F  73

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FLI P L  AA ++G+L G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KF
Sbjct  74    FLIKPRLLGAAIVIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKF  133

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T F+ NAVVLLTVGA VLG+   +DRP  E++K Y++GF++TVAAA +Y  ILPL+EL+Y
Sbjct  134   TPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVIGFLVTVAAAVVYAFILPLVELAY  193

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              KAK Q +S++LVLE QMI+ F+ +I S +GM I  DF+ +P+EA+EF+LG   +YV+AV
Sbjct  194   QKAK-QPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEFKLGEALFYVVAV  252

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             F+AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+
Sbjct  253   FSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSL  312

Query  285   WGFVSYFYGDIK---NTKKDNNESSAETEMTS  199
             WGFVSYFYG+IK   + K+   E S ETE +S
Sbjct  313   WGFVSYFYGEIKSDNDKKRIQQEESQETERSS  344



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 239/311 (77%), Gaps = 5/311 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL+RLY+L GG+ +W SSWL+T G+P IF+ L V+Y RRR A       S +  
Sbjct  46    GTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYLRRRSA----EGPSARLV  101

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ PFL  A+A++GVL G+D+Y Y+YG+A+LP STS+L++ATQL FTAGFAFLLV+Q+FT
Sbjct  102   LMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQLAFTAGFAFLLVRQQFT  161

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S N+V LLTV A VL L A SDRPAGES++ Y  GF MT+ AAALYG +LPL+EL+Y 
Sbjct  162   SYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGAAALYGFVLPLVELTYK  221

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK QAV++SLVLE Q++M F  T F TVGM++NKDF+ IP EA+ +ELG   YYV+ V 
Sbjct  222   KAK-QAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQAIPTEAKNYELGEALYYVVLVG  280

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AI WQFFF+G +GVI   SSL S +++AVLLPVTEILA+I + E F+A KG+SL LS+W
Sbjct  281   NAIAWQFFFLGVIGVIFCASSLFSGIMIAVLLPVTEILAIICFRETFQAAKGVSLALSLW  340

Query  282   GFVSYFYGDIK  250
             G  SYFYG+ K
Sbjct  341   GLASYFYGEFK  351



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 253/334 (76%), Gaps = 4/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RRRR    E  +    F
Sbjct  20    GNCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLIIFPLLFSFLRRRRL---EEQEKTSLF  76

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  77    LMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  136

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL + + SD+ A +++K Y++ F+MTV AA LY  ILPL+ELSY 
Sbjct  137   PFTINAIVLLTVGAVVLAINSDSDKLANDTHKEYVVAFLMTVGAALLYAFILPLVELSYK  196

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K++ Q V+++LVLEFQM++ FV T F  VGM++  DF+VI REAR+F+LG + YYV+ VF
Sbjct  197   KSR-QRVTYTLVLEFQMVLCFVATCFCFVGMLVAGDFKVIAREARDFKLGESLYYVVVVF  255

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KG++L LS+W
Sbjct  256   TAVIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLW  315

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             G VSYFYG IK+ +K   + + ET+++  P   S
Sbjct  316   GSVSYFYGQIKSEEKTKAQETQETQLSQLPVTNS  349



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 264/344 (77%), Gaps = 5/344 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +    ++R LL L+C +L++GN GGPL++RLYFL+GG  +W SS L+TAG+P + +PL
Sbjct  79    EEKMSKGLKRSLLVLNCALLALGNVGGPLIMRLYFLKGGKGVWTSSCLETAGWPFMVMPL  138

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
               SY  RRR    +   + + F I P L + +A++G+L GVD++ Y+YG+A+LPVSTS+L
Sbjct  139   TFSYLYRRR----KEGPATELFFIKPPLFLVSAVVGLLTGVDDFLYAYGVARLPVSTSAL  194

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I++TQL FTA FAFLLVKQKFT+F+ N+V LLTVGAVVL L+  SDRPA ESN+ Y LGF
Sbjct  195   IISTQLAFTAAFAFLLVKQKFTSFTINSVFLLTVGAVVLALQTSSDRPANESNRQYYLGF  254

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              MT+AA+ LYG +LP IEL+Y KAK Q +++SLV+E QM+M F  T+F T+GM+ +K+FE
Sbjct  255   FMTLAASMLYGFVLPAIELTYKKAK-QTITYSLVMEMQMVMSFSATVFCTIGMLFHKEFE  313

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              IPREA +FELG + YY++ + +AI+WQFFF+GA+GVI  GSSLLS +I+A LLPVTE L
Sbjct  314   AIPREASKFELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESL  373

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSA  217
             AV+F+HEKF+ EK IS+ LS+WG +SYFYG+++  KK+     A
Sbjct  374   AVLFFHEKFQVEKAISVVLSLWGSLSYFYGELQKNKKNQASERA  417



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 246/317 (78%), Gaps = 4/317 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+   PLL+RLYFL+GG+R W S WLQT G+P+IFIPL +SY  RR       +K    +
Sbjct  36    GSTVSPLLLRLYFLKGGSRKWLSGWLQTGGWPLIFIPLAISYAHRRGGGGGGGTK---LY  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A  +LG+L+G+D+Y Y+YGM+ LPVSTSS++++TQL FTA FAF +VKQKFT
Sbjct  93    LMTPPLFLACTVLGLLIGLDDYLYAYGMSYLPVSTSSILISTQLGFTALFAFFIVKQKFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FSTNAVVLL++GAV+LGL A  DRP GESN  Y LGF MT+AAA LY  ILPL+EL+Y 
Sbjct  153   SFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYAFILPLVELTYA  212

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q VS++LV+E Q++MGF  T+F TVGM+++KDF+ I REAR+F LG  +YYVL V+
Sbjct  213   KAK-QVVSYTLVMEMQLVMGFFATVFCTVGMLVSKDFQAISREARDFVLGEVRYYVLLVW  271

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQFFF+G +G I YGS+LL+ +I+AVL+PV E+LAVIF+HE F   KG++L L++W
Sbjct  272   SAILWQFFFLGTVGAIFYGSALLAGIIIAVLIPVAEVLAVIFFHESFSGGKGVALVLALW  331

Query  282   GFVSYFYGDIKNTKKDN  232
             G  SYFYG+   +KK  
Sbjct  332   GLASYFYGEFLESKKKK  348



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +  +T+ + LL ++  +L+IGNCGGPL+ RLYFL+GG  +W SS+LQTAG+P I  PL
Sbjct  39    EEKMSSTLNKFLLIVNGTMLAIGNCGGPLIQRLYFLKGGKGVWISSFLQTAGWPFIIFPL  98

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              VSY  RR     +++ S K + ITP L IA A++GVL G+D++  +YG++ LPVSTS+L
Sbjct  99    FVSYIHRR----SKNAGSTKLYYITPRLFIACAVIGVLTGLDDFLAAYGVSLLPVSTSAL  154

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+ATQL FTAGFA++LVKQKFT F+ NA+ LL++GAVVL L A SDRP  E+N  YL GF
Sbjct  155   IIATQLGFTAGFAYVLVKQKFTPFTVNAIFLLSIGAVVLVLHASSDRPPHETNGQYLSGF  214

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              MT+ A+ALYG +LPLIEL+Y KA  Q ++++LV+E Q+++ F  T F T GM+++KDF 
Sbjct  215   FMTLGASALYGFVLPLIELTYKKAN-QTITYTLVMEMQLVISFFATAFCTTGMLLHKDFA  273

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              IPREA EFELG  KYYV+ +  AI WQ FF+GA+GV+  GSSLLS +I+A LLPVTE L
Sbjct  274   AIPREASEFELGKAKYYVVLMVNAIFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTETL  333

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESS  220
             AV FYHEKF  EKGISL LS+WGF+ YFYG+++  KK    S 
Sbjct  334   AVFFYHEKFRVEKGISLVLSLWGFMFYFYGELQRNKKKKQTSE  376



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 263/337 (78%), Gaps = 6/337 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY HRR+     E++ S  F
Sbjct  16    GNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRKNNNGGENATS--F  73

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FLI P L  AA  +G+L G DNY Y+YG+A LPVST++LI+A+QL   A F+F +VK KF
Sbjct  74    FLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLACIAIFSFFMVKHKF  133

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T F+ NAVVLLTVGA VLG+   +DRP  E++K Y+LGF++TVAAA +Y  ILPL+EL+Y
Sbjct  134   TPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVLGFLVTVAAAVVYAFILPLVELAY  193

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              KAK Q +S++LVLE QMI+ F+ +I S +GM I  DF+ +P+EA+EF+LG   YYV+AV
Sbjct  194   QKAK-QPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEFKLGEVLYYVVAV  252

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             F+AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+
Sbjct  253   FSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSL  312

Query  285   WGFVSYFYGDIK--NTKKDNNESSAETEMTSAPTVAS  181
             WGFVSYFYG+IK  N K+   +   E++ T  P+++S
Sbjct  313   WGFVSYFYGEIKSDNDKRRIQQEEKESQETELPSLSS  349



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 251/323 (78%), Gaps = 5/323 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYFL+GG  +W SS+LQTAG+P++  PL+VSY  RR   S++ S++ K  
Sbjct  153   GNCGGPLIQRLYFLKGGKAVWISSFLQTAGWPLVLFPLIVSYMYRR---SNKGSRT-KLI  208

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              I+P L +A A++G+L G+D++  +YG++ LPVSTS+LI+ATQL FTAGFA++LVKQKFT
Sbjct  209   YISPRLFLACAVIGLLTGLDDFLTAYGVSLLPVSTSALIIATQLGFTAGFAYILVKQKFT  268

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+ LL++GAVVL + A SDRP  E+ + YLLGF MT+ A+ALYG +LPLIEL+Y 
Sbjct  269   PFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLIELTYK  328

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q ++++LV+E Q+++ F  T F  +GM+++KDFE IPREA EFELG  KYYV+ VF
Sbjct  329   KAK-QTITYTLVMEMQVVISFFATAFCAIGMLLHKDFEAIPREASEFELGRLKYYVVNVF  387

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA+ WQ FF+GA+GV+   SSLLS +I+A LLPVTE L V+FYHEKF  EK ISL LS+W
Sbjct  388   TAVFWQLFFMGAVGVVFCDSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKAISLVLSLW  447

Query  282   GFVSYFYGDIKNTKKDNNESSAE  214
             GFVSYFYG+++  KK +  S  E
Sbjct  448   GFVSYFYGELQQNKKKSRTSELE  470



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 252/333 (76%), Gaps = 24/333 (7%)
 Frame = -1

Query  1251  MEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIP  1072
             ME +  T  +RI L ++CIIL+IGNCGGPL++RLYF+ GG RIWFSSWL+T G+PVI IP
Sbjct  1     MEVEKPTAEKRIFLIINCIILAIGNCGGPLIMRLYFIHGGKRIWFSSWLETGGWPVILIP  60

Query  1071  LLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
             L+VSY RRRR      +   K  L+ P L +AAA++G+L G D+Y Y+YG+AKLPVSTSS
Sbjct  61    LIVSYTRRRR-----PNPGAKLILMKPRLFVAAAVIGILTGFDDYLYAYGVAKLPVSTSS  115

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+A+QL FTA FA+ LVKQKFTA+S NAVVLLTV                    A  +G
Sbjct  116   LIIASQLAFTAVFAYFLVKQKFTAYSINAVVLLTV------------------GAAVXVG  157

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             F  T AAAALYGLILP++E +Y KAK Q V+++LV+E Q++M F  T+  TVGM+INKDF
Sbjct  158   FFRTGAAAALYGLILPVVEYTYKKAK-QPVTYTLVMEIQLVMCFFATVVCTVGMIINKDF  216

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             + I REA+ F LG  +YY++  ++AI+WQ FF+GA+GVI Y SSLLS ++++VLLP TE+
Sbjct  217   QAIGREAKGFGLGEARYYIVVGWSAIIWQCFFLGAIGVIFYASSLLSGILISVLLPATEV  276

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDI  253
             LAVIFYHEKF+AEKG+SLFLS+WGF+SYF+G+I
Sbjct  277   LAVIFYHEKFQAEKGVSLFLSLWGFISYFFGEI  309



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 191/330 (58%), Positives = 251/330 (76%), Gaps = 5/330 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+IRLYF  GG RIWFSS+LQT GFP+I  PLL S+ RRRR    E  +   FF
Sbjct  19    GNCGGPLMIRLYFHNGGERIWFSSFLQTVGFPLILFPLLFSFLRRRRL---EEQEKTSFF  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+L+G DNY YSYG+A LPVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  76    LMKPRLFIASVVVGLLMGFDNYLYSYGLAYLPVSTASLIISAQLGFTALFAFFMVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL L + SD+ A E++K Y++GF+M V AA LY  ILPL+EL+Y 
Sbjct  136   PFTINAIVLLTVGAVVLALNSESDKLANETHKEYVVGFLMVVGAALLYAFILPLVELTYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K++ Q ++++LVLEFQM++ FV T F  VGM+   DF+VI REAR F+LG + YYV+ VF
Sbjct  196   KSR-QRITYTLVLEFQMVLCFVATCFCLVGMLAAGDFKVIAREARGFKLGESLYYVVIVF  254

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++++ LLPVT ILAVI + EKF+A KG++L LS+W
Sbjct  255   TAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVILAVICFREKFQAGKGVALALSLW  314

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             G VSYFYG IK+ K    E+ A ++++  P
Sbjct  315   GSVSYFYGQIKSEKTKGQETQA-SQLSQLP  343



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 197/357 (55%), Positives = 269/357 (75%), Gaps = 5/357 (1%)
 Frame = -1

Query  1257  LKMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIF  1078
             ++ E      MRR LL ++C++LS+G CGGPL++RLYF+ GG R+WF+SWLQT G+P+  
Sbjct  1     MEEEANLSINMRRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRLWFNSWLQTGGWPLTI  60

Query  1077  IPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVST  898
             IPL++ Y  RR+    ++    KF+ ITP + IA+ ++GV  GVD Y YS+G +KLPVST
Sbjct  61    IPLVILYFYRRKTKGSDT----KFYYITPRIFIASFIIGVFTGVDAYLYSWGGSKLPVST  116

Query  897   SSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYL  718
             SSL++A QL FTA  ++ + K KFT++S NAVVLLT+GAV+LG+R+  DRP G ++K Y+
Sbjct  117   SSLLIAAQLAFTAIGSYFIAKIKFTSYSINAVVLLTLGAVLLGMRSNGDRPEGVTSKEYV  176

Query  717   LGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINK  538
             +GF+MT+ AAALYGLILP IEL YLKAK QA++ +LVLE QM+M F  T F T+GM+ NK
Sbjct  177   IGFIMTLLAAALYGLILPCIELIYLKAK-QAITATLVLEIQMVMAFAATAFCTIGMIANK  235

Query  537   DFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVT  358
             DF+ I REA+ F LG  +YY++ +++AI+WQ FFVGA+GVI   SSL+S +++AVLLP+T
Sbjct  236   DFQAISREAKHFNLGEGRYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVMIAVLLPIT  295

Query  357   EILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTV  187
             E+L VIF+ EKF AEKG+SLFLS+WGFVSYFYG+ K  KK   +   E EMT+   +
Sbjct  296   EVLGVIFFDEKFSAEKGLSLFLSLWGFVSYFYGEFKQAKKVEKKKIQENEMTTTTQI  352



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score =   337 bits (864),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 250/334 (75%), Gaps = 4/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RRRR    E +     F
Sbjct  18    GNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRRRLVKQEKTS---LF  74

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ + G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  75    LMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFCMVKQKFT  134

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLT+ AVVL + + S + A E++K Y++GF+MTV AA LY  ILPL+ELSY 
Sbjct  135   PFTINAIVLLTLSAVVLAINSDSYKLANETHKEYVVGFLMTVGAALLYAFILPLVELSYK  194

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K++ Q V+++LVLEFQM++ FV T F  VGM++  DF+VI REAR+F+LG + YYV+ VF
Sbjct  195   KSR-QGVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKLGESLYYVVVVF  253

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KGI+L LS+W
Sbjct  254   TAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGIALTLSLW  313

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             G VSYFYG  K+ +K   + + ET+++  P   S
Sbjct  314   GSVSYFYGQFKSGEKTKAQETQETQLSQLPVTDS  347



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 248/329 (75%), Gaps = 4/329 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G CGGPLL RLY+  GG RIWF S+L TAGFPVI IPLL S+ HRR R  + E++K    
Sbjct  16    GTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLLFSFLHRRNRTETTENAKKEGI  75

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
              L+   L IA+ ++G+L G+DNY Y+YG+A LPVSTSSLI+ TQL F A FAFL+VKQKF
Sbjct  76    ILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFLMVKQKF  135

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T FS NAVVLLTVG  +L L +  D+PA ES K Y++GF+MTV AA LY  ILPL+EL+Y
Sbjct  136   TPFSINAVVLLTVGIGILALHSDGDKPAHESRKEYVIGFLMTVVAAVLYAFILPLVELTY  195

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLA  469
              KA+ Q ++F+LVLE Q++M   G++F  VGM+I+ DF+VI REAREF++G +  YY L 
Sbjct  196   KKAR-QEITFTLVLEMQLVMCIAGSVFCLVGMIIDGDFKVIAREAREFKIGGSMFYYSLI  254

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+LAV+ + EKF+AEKG++L LS
Sbjct  255   VITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVALLLS  314

Query  288   IWGFVSYFYGDIKNTKKDNNESS-AETEM  205
             +WGFVSYFYG+ K+ KK   ++   ETE+
Sbjct  315   LWGFVSYFYGEFKSGKKVLEKAQPPETEL  343



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 244/328 (74%), Gaps = 3/328 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL RLY+  GG RIWF S+L TAGFPVI +PL  S+  RR   + E+++  K  
Sbjct  16    GTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILVPLFFSFLSRRNRNNSETAEKPKLI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+   L IA+ ++G+L G+DNY Y+YG+A LPVSTSSLI+ TQL F A FAF +VKQKFT
Sbjct  76    LMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS NAVVLLTVG VVL L +  D+PA E++K Y++GF+MTV AA LY  ILPL+EL+Y 
Sbjct  136   PFSINAVVLLTVGIVVLALHSSGDKPANETHKEYVVGFLMTVIAAVLYAFILPLVELTYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLAV  466
             KA+ Q ++F LVLE QM+M    T F  VGM+I+ DF+VI REAREF++G +  YY L +
Sbjct  196   KAR-QEITFPLVLEIQMVMCLAATCFCVVGMIIDGDFKVISREAREFKIGGSAFYYTLIM  254

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
              T IVWQ FF+GA+GV+   SSL SA++++VLLPVTE+LAVI + EKF+AEKG+SLFLSI
Sbjct  255   ITGIVWQGFFLGAIGVVFCASSLASAVLISVLLPVTEVLAVICFREKFQAEKGVSLFLSI  314

Query  285   WGFVSYFYGDIKNTKKD-NNESSAETEM  205
             WGFVSYFYG+ K+ KK        ETE+
Sbjct  315   WGFVSYFYGEYKSGKKVLEKHQPPETEL  342



>gb|EYU38177.1| hypothetical protein MIMGU_mgv1a023817mg [Erythranthe guttata]
Length=357

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 265/342 (77%), Gaps = 6/342 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY----HRRRRACSDESSKS  1015
             GN GGPL++RLYF+RGG RIWFSSWL+T G+P+I IPLL +Y     RRRR+ +  +  +
Sbjct  16    GNSGGPLIMRLYFIRGGKRIWFSSWLETGGWPIILIPLLAAYISRRRRRRRSTTTAADGA  75

Query  1014  RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVK  835
              K FL+ P L  AA+ +G+L G+D+Y Y+ G+A+LP+ST++L+ AT LVFTA FAFLLVK
Sbjct  76    AKLFLMKPRLFSAASAIGILTGLDDYLYAKGVAELPISTAALLAATHLVFTAAFAFLLVK  135

Query  834   QKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIE  655
             QKFTA+S NAVVLLTVG VVLGL    DRP GES K Y++GF M ++AA LYG ILP++E
Sbjct  136   QKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFFMALSAAGLYGFILPVVE  195

Query  654   LSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYV  475
             L Y KAK QA++++L++E Q+++ F  T+F TVGM+IN DF+ I REA+E+ELG  KYY+
Sbjct  196   LMYKKAK-QALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISREAKEYELGEMKYYL  254

Query  474   LAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLF  295
             + +++AI+WQ FF+G +GVI Y SSLL A+I+ V +P+T+IL V  Y+EKF+AEKGI+LF
Sbjct  255   VVIWSAIIWQLFFLGVVGVIFYSSSLLCAIIITVTIPITQILGVFIYNEKFQAEKGIALF  314

Query  294   LSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVASTQAV  169
             LS+WGF+SYF+G+I  T K++NE++ +T  T+    +S Q +
Sbjct  315   LSLWGFISYFFGEITKT-KNSNENNDQTRTTTETDRSSRQII  355



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 260/359 (72%), Gaps = 8/359 (2%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             + + QT   MRR LL  +C +L++G CGGPLL+RLYFL GGNR+W S++L+T G P+IFI
Sbjct  3     QQQQQTTPAMRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFI  62

Query  1074  PLLVSY-HRRRRACS----DESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKL  910
             PLL+SY HRRRR        ES+ S +   +   L +A+ ++G++ G  ++ Y+YG+A++
Sbjct  63    PLLISYIHRRRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARI  122

Query  909   PVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESN  730
             PVSTS+LI A QL FTAGFAF LVKQKFTA+S N+VVL+T G  +L L    DR AGESN
Sbjct  123   PVSTSALIRACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESN  182

Query  729   KAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGM  550
             + Y+ GF+ TVAA+ +YG ILPL+EL+Y KA+ Q ++++LVLE Q+IM    T+  ++ M
Sbjct  183   REYIEGFLTTVAASVVYGFILPLVELTYKKAR-QQITYTLVLEVQLIMSLFATLVCSIAM  241

Query  549   VINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavl  370
             +IN DF++I  EA  F LG  KYYV+ V +AI+WQ FF+G +GVI   SS  S +I+AVL
Sbjct  242   LINNDFQMIAMEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVL  301

Query  369   LPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK--DNNESSAETEMTS  199
             LPVTEILAV+ ++EKF+AEK ISL L++WGFVSYFYG+IK+ KK   N E     E T+
Sbjct  302   LPVTEILAVVTFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKNLELQRRAETTT  360



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 250/334 (75%), Gaps = 4/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RRRR    E +     F
Sbjct  19    GNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRRRLVEQEKTS---LF  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ + G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +V+QKFT
Sbjct  76    LMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVRQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL + + SD+ A E++K Y++GF+MTV AA LY  ILPL+ELSY 
Sbjct  136   PFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILPLVELSYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K++ Q V+++LVLEFQM++ F  T F  VGM++  DF+VI REAR+F+LG + YYV+ VF
Sbjct  196   KSR-QGVTYTLVLEFQMVLCFAATCFCLVGMLVAGDFKVIAREARDFKLGESLYYVVVVF  254

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KG++L LS+W
Sbjct  255   TAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLW  314

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             G VSYFYG  K+ +K     + ET+++  P   S
Sbjct  315   GSVSYFYGQFKSDEKIKARETQETQLSQLPLTDS  348



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 250/326 (77%), Gaps = 7/326 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             MR I L ++  +L++G+C GPL++RLYF RGGNRIWFSSWL++AGFP+I IPL+ SY   
Sbjct  1     MRMIFLIMNAALLTVGSCAGPLIMRLYFTRGGNRIWFSSWLESAGFPIILIPLIYSY---  57

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
                C+   +       + P L  AAA++GVL G+DNY Y+YG+AKLPVSTSSLI+A+QL 
Sbjct  58    ---CAGRGTHPSGIISMNPKLCSAAAVVGVLAGLDNYLYAYGVAKLPVSTSSLIIASQLG  114

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FA+L+VKQKFTAFS NAVVLLTV A +L L +  DRP GESN  Y  GFV+T+AAA
Sbjct  115   FTAVFAYLIVKQKFTAFSINAVVLLTVAAGILALHSNGDRPKGESNGDYYTGFVLTLAAA  174

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             ALYGL+LPL+EL+Y K   Q +++  VL+FQ ++GF  T+  T+GM ++ DF  IP EAR
Sbjct  175   ALYGLMLPLVELAYAKTG-QDLNYDAVLKFQFVLGFFATLACTIGMAVSGDFPAIPTEAR  233

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              F+LG  +YY + V +AI+WQ FF+G +GVI Y S+LLS ++++VLLP TEILAV+F+ E
Sbjct  234   GFQLGEGRYYAVVVSSAIIWQCFFLGNIGVIFYSSALLSGVLISVLLPPTEILAVLFFRE  293

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIK  250
             KF+AEKG+SLFLS++GFVSYFYG+ K
Sbjct  294   KFQAEKGVSLFLSLFGFVSYFYGEYK  319



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 258/348 (74%), Gaps = 3/348 (1%)
 Frame = -1

Query  1242  QTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLV  1063
             Q    +RR L+ L+C+++++GN G PLL+RLY+  GG R W SSWL+TAG+P IF+PLL+
Sbjct  18    QMSKGLRRALIVLNCVLMALGNTGSPLLLRLYYRSGGKRQWLSSWLETAGWPFIFVPLLI  77

Query  1062  SYHRRRRACSDESSKSR--KFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
             +Y  RRR C          K F ITP L +A A +G++ G D++ Y+YG++ LPVSTSSL
Sbjct  78    TYLHRRRRCQLRPGNCHPTKLFFITPRLFLACAFIGLITGFDDFLYAYGLSFLPVSTSSL  137

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             +++TQL FTA FAFL+VKQKFT +S N+V LLTVGAVVLGL   SDRP   +   Y LGF
Sbjct  138   LISTQLAFTAFFAFLIVKQKFTPYSINSVALLTVGAVVLGLHVSSDRPDNVTRGQYHLGF  197

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             ++T+ AAALYGLILPL+EL Y K+K QA++++LV+E Q++MGF  T F TVGM++NKDF+
Sbjct  198   ILTLGAAALYGLILPLVELMYSKSK-QAITYTLVMEMQLVMGFFATAFCTVGMLVNKDFQ  256

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              IPREAR FELG  +YYV+ V++A+ WQFFF+G +G+I   ++LL+ +++A+ +PVTE+L
Sbjct  257   AIPREARHFELGEFRYYVVLVWSAVFWQFFFLGTVGIIFCVNTLLAGILIALFIPVTEVL  316

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
              V+F+ E F +EKGI+L LS+WG  SY YG+ +  K   ++++   ++
Sbjct  317   GVVFFKENFSSEKGIALVLSLWGLASYSYGEYRQEKDKKDKAAPSNQV  364



>ref|XP_003615204.1| Purine permease [Medicago truncatula]
 gb|AES98162.1| purine permease [Medicago truncatula]
Length=364

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 266/347 (77%), Gaps = 4/347 (1%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             K E   + +M+++LL L+ I+L+IG CGGPL++RLYF+ GG R+W SS+L+T+ FP+I I
Sbjct  8     KEEESKKRSMKKLLLILNSILLAIGTCGGPLVMRLYFIHGGKRVWLSSFLETSAFPIILI  67

Query  1074  PLLVSY--HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVS  901
             PL +S+  +R R    + ++ +  F  + P L IA+A++GVL G+D+Y Y+ G+ +LPVS
Sbjct  68    PLTISHVHNRYRYQNPNGNNNNNNFVSMKPPLFIASAVIGVLTGLDDYLYACGIKRLPVS  127

Query  900   TSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGS-DRPAGESNKA  724
             TSSLI ++ L FTA FAF LVK KFTA+S N++VLLT+G+VVL L +   DR  GES K 
Sbjct  128   TSSLIQSSHLAFTAVFAFFLVKHKFTAYSVNSIVLLTLGSVVLALNSDGGDRLVGESTKD  187

Query  723   YLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVI  544
             Y++GFVM +A+AALYG +LPL+EL Y K+K Q +++SLV+E Q++M F  T+F  VGM+I
Sbjct  188   YVIGFVMILASAALYGFVLPLLELVYKKSK-QVITYSLVMEIQLVMCFFATLFCVVGMII  246

Query  543   NKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLP  364
             + DF+VIPREAR+F+LG TKYYV+ V++AI+WQFFF+GA+GVI   SSLLS +I+A  LP
Sbjct  247   DNDFKVIPREARDFKLGETKYYVVLVWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLP  306

Query  363   VTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNES  223
             +TEILAVI Y EKF+AEKG++L LS+WGFVSYFY +IK  KK  N  
Sbjct  307   ITEILAVIVYKEKFQAEKGVALVLSLWGFVSYFYDEIKEAKKMKNRE  353



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score =   335 bits (859),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 244/339 (72%), Gaps = 11/339 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF+ GG RIW  S LQT G PVI IPL ++Y +RR+    E+    K  
Sbjct  37    GNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPVILIPLAIAYFQRRKIQGPEA----KIV  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              IT    IA+A +G++VG+D Y  S+G AKLPVSTS+LI ATQL FTA FA L+VKQK T
Sbjct  93    FITRQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQLAFTALFAVLIVKQKLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+STN+VVLL  GA  L LRA  DRPAGES K Y+LGFVMT   A LYGL+LPLIEL Y+
Sbjct  153   AYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMTFVGAVLYGLMLPLIELIYM  212

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K+K QAV++  VLE QM++G   T+F T+GM+INKDF+ IPREA ++ +G +KYY++ V 
Sbjct  213   KSK-QAVTYITVLEIQMVLGISATVFCTIGMIINKDFQAIPREASQYTIGESKYYMVLVL  271

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AI+WQF  +G +GVI Y SSLLS +I A LLPVTE+LAVI +HEKF+AEKG+++FL++W
Sbjct  272   CAIIWQFALMGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFHEKFQAEKGVAIFLALW  331

Query  282   GFVSYFYGDIKN------TKKDNNESSAETEMTSAPTVA  184
             GFVSYFYG+ +        K   NES    ++    T A
Sbjct  332   GFVSYFYGEYEQGKKEKKMKMKKNESQISQQLDMGQTGA  370



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score =   334 bits (856),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 251/334 (75%), Gaps = 3/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQT+G P+I +PLL+S+  R R    E +K+   F
Sbjct  18    GNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLISFLTRHRKQEQEDTKT-TLF  76

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ + G+L+G DNY Y+YG+A LPVSTSSLI+++QL FTA FAF +VKQ+FT
Sbjct  77    LIKPPLFLASVVFGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFT  136

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLT+GA  L L A  D+   E+ K Y++GF MTVAAA LY  +LPL+EL+Y 
Sbjct  137   PFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFAMTVAAAVLYAFVLPLVELTYK  196

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV-  466
             KA  Q +S++LVLE Q+++  V T F  VGM+ + DF+ + REAREF+LG +KYY + V 
Sbjct  197   KAS-QRISYTLVLEMQLVLCVVATCFCLVGMLADGDFKELRREAREFKLGGSKYYCVVVA  255

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             FTA++WQ FF+G++G+I   SSL+S ++++ LLP+TE+LAV+F+ EKF+AEKG+SLFLS+
Sbjct  256   FTAVIWQGFFLGSIGMIFCASSLVSGVLISTLLPLTEVLAVLFFREKFQAEKGVSLFLSL  315

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVA  184
             WGFVSYFYG I++ K+   + +  +++    +VA
Sbjct  316   WGFVSYFYGKIQSEKEKRTQEAQLSQLQVTESVA  349



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 245/333 (74%), Gaps = 7/333 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRR---RACSDESSKSR  1012
             G CGGPLL RLY+  GG RIWF S+L TAGFPVI IPL  S+  RR   R  S+ + K++
Sbjct  16    GTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLFFSFLSRRNHNRNNSETAEKTK  75

Query  1011  KFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQ  832
                + TP L IA+ ++G+L G+DNY Y+YG+A LPVSTSSLI+ TQL F A FAF +VKQ
Sbjct  76    LILMETP-LFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVKQ  134

Query  831   KFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIEL  652
             KFT FS NAVVLLTVG VVL L +  D+PA E++K Y++GF+MTV AA LY  ILPL+E 
Sbjct  135   KFTPFSINAVVLLTVGIVVLALHSNGDKPANETHKEYVVGFLMTVIAAVLYAFILPLVEF  194

Query  651   SYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYV  475
             +Y KA+ Q ++F LVLE QM+M    T F  VGM+I+ DF+VI REAREF++G +  YY 
Sbjct  195   TYKKAR-QEITFPLVLEIQMVMCIAATCFCVVGMIIDGDFKVISREAREFKIGGSAFYYT  253

Query  474   LAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLF  295
             L V T IVWQ FF+GA+GV+   SSL S ++++VLLPVTE+LAVI + EKF+AEKG+SLF
Sbjct  254   LIVITGIVWQGFFLGAIGVVFCASSLASGVLISVLLPVTEVLAVICFREKFQAEKGVSLF  313

Query  294   LSIWGFVSYFYGDIKNTKKD-NNESSAETEMTS  199
             LSIWGFVSYFYG+ K+ KK        ETE+ S
Sbjct  314   LSIWGFVSYFYGEYKSGKKVLEKHQPPETELPS  346



>ref|XP_004490401.1| PREDICTED: purine permease 1-like [Cicer arietinum]
Length=361

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 262/347 (76%), Gaps = 5/347 (1%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  M+++LL ++ I+L+IG CGGPL++RLYF+ GG R W SS+L+T+GFP+I +PL +S 
Sbjct  15    RRNMKKLLLVINSILLAIGTCGGPLVMRLYFIHGGKRAWLSSFLETSGFPIILLPLTIS-  73

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
             H   R  +   + +R F  + P L + +A++G+L G+D+Y Y+ G+A+LPVSTSSLI ++
Sbjct  74    HIHHRYHNRNCNSNRNFISMKPPLFLFSAIIGILTGLDDYLYACGIARLPVSTSSLIQSS  133

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
              L FTA FAF+LV+ KFTA+S N +VLLT+G+VVL +R+      GES   Y++GFVM +
Sbjct  134   HLAFTAVFAFILVRHKFTAYSVNCIVLLTLGSVVLAVRSNGGGGDGESRGEYVIGFVMIL  193

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             ++AALYG +LPL+EL Y K K Q V++SLV+E Q +M F  T+F  +GM+I+KDF+VIPR
Sbjct  194   SSAALYGFVLPLMELVYKKTK-QVVTYSLVMEIQFVMCFFATLFCILGMIIDKDFKVIPR  252

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EAREF LG TKYYV+ V +AI+WQFFF+GA+GVI Y SSLLS +I+A  LPVTEI+AVI 
Sbjct  253   EAREFNLGETKYYVVLVCSAIMWQFFFLGAIGVIFYASSLLSGIIIAAFLPVTEIMAVIV  312

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSA  196
             Y E F AEKG++L LS+WGFVSYFYG+IK  +K  N+   ETE+  +
Sbjct  313   YKENFHAEKGVALVLSLWGFVSYFYGEIKEARKMKNK---ETELPQS  356



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 255/335 (76%), Gaps = 3/335 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDE-SSKSRKF  1006
             GNCGGPL++RLYF  GG RIWFSS+L+TAGFPVI IPL  SY  R R  ++  +S++  F
Sbjct  17    GNCGGPLIMRLYFNNGGKRIWFSSFLETAGFPVILIPLFFSYLNRLRRNNNNGTSENISF  76

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FLI P L  AA L+GVL G DNY Y+YG+A LPVST++LI+A+QL F A F++ +V  KF
Sbjct  77    FLIKPRLLFAAVLVGVLSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVNHKF  136

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T ++ NAVVLLTVGA VLG+   +D+P  E++K Y++GF+MTVAAA +Y  ILPL+EL+Y
Sbjct  137   TPYTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVIGFLMTVAAAVMYAFILPLVELAY  196

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              KAK Q +S++LVLE Q+++    ++ S +GM I  DF+ +P EAREF+LG   +YV+ V
Sbjct  197   QKAK-QPMSYTLVLEVQLVLCLFASLVSLIGMFIAGDFKALPIEAREFKLGEALFYVVVV  255

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             F+AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+
Sbjct  256   FSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSL  315

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             WGFVSYFYG+IK + K+      ETE+ S P   S
Sbjct  316   WGFVSYFYGEIK-SDKEKKRIQQETELASLPRTIS  349



>ref|XP_006338103.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=354

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 236/309 (76%), Gaps = 5/309 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF+ GG RIW  S LQT G P+I IPL ++Y +RR+    E+    K  
Sbjct  17    GNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPIILIPLAIAYFQRRKIQGPEA----KIV  72

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              IT    IA+A +G++VG+D Y  S+G AKLPVSTS+LI ATQL FTA FA L+VKQK T
Sbjct  73    FITRQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQLAFTALFAVLIVKQKLT  132

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+STN+VVLL  GA  L LRA  DRPAGES K Y+LGFVMT   A LYGL+LPLIEL Y+
Sbjct  133   AYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMTFIGAVLYGLMLPLIELIYM  192

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q V+++ VLE QM++G   T+F T+GM+INKDF+ IPREA ++ +G +KYY++ V+
Sbjct  193   KAK-QTVTYTTVLEIQMVLGISATVFCTIGMIINKDFQAIPREASQYAIGESKYYMVLVW  251

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AI+WQF  +G +GVI Y SSLLS +I A LLPVTE+LAVI +HEKF+AEKG+++FL++W
Sbjct  252   CAIIWQFALLGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFHEKFQAEKGVAIFLALW  311

Query  282   GFVSYFYGD  256
             GFVSYFYG+
Sbjct  312   GFVSYFYGE  320



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 249/330 (75%), Gaps = 4/330 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+CGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RRRR    E  +    F
Sbjct  49    GDCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRRL---EEQEKTSLF  105

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+LVG DNY YSYG+A +PVST SLI++ QL FTA FAF +VKQK T
Sbjct  106   LMKPPLFIASVVVGLLVGFDNYLYSYGLAYIPVSTESLIISAQLGFTALFAFFMVKQKIT  165

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL + + SD+ A E++K Y++GF+MTV AA LY  ILPL+ELSY 
Sbjct  166   PFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILPLVELSY-  224

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K   Q V+++LVLEFQM++ FV T F  VGM++  DF+VI REAR+F+LG + YYV+ VF
Sbjct  225   KKSCQRVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKLGESLYYVVVVF  284

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KG++L LS+W
Sbjct  285   TAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLW  344

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             G VSYFYG  K+ +K+  + + ET+++  P
Sbjct  345   GSVSYFYGQFKSEEKNKAQKTQETQLSQLP  374



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 255/334 (76%), Gaps = 4/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+CGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RRR  C +E  ++   F
Sbjct  16    GSCGGPLMLRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRR--CLEEQ-ETTSLF  72

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+L+G DNY YSYG+A +PVST++LI++ QL FTA FAF +VKQKFT
Sbjct  73    LMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTAALIISAQLGFTALFAFFMVKQKFT  132

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL + + SD+ A E++K Y++GF+MT  AA LY  ILPL+EL+Y 
Sbjct  133   PFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTAGAALLYAFILPLVELAYK  192

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K++ Q V+++LVLEFQM++ FV T F  VGM+ + DF+VI REAR+F+LG + YYV+ VF
Sbjct  193   KSR-QRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREARDFKLGESLYYVVVVF  251

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KG++L LS+W
Sbjct  252   TAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALALSLW  311

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             G VSYFYG IK+ +K   + + ET+++  P   S
Sbjct  312   GSVSYFYGQIKSEEKTKAQETQETQLSQLPVTDS  345



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 256/340 (75%), Gaps = 5/340 (1%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  ++R LL L+C +L+ GN GGPL+++LYFL+GG  +W SS L+TAG+P + +PL  SY
Sbjct  2     RKGLKRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSY  61

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
               RRR    +     + F I P L +A+A++G+L GVD++ Y+YG+A+LPVST +LI++T
Sbjct  62    LYRRR----KEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIIST  117

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FT  FAFLLVKQKFT+F+ N+V LL +GAVVL L   SD PA ESN+ Y  GF MT+
Sbjct  118   QLAFTVAFAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTL  177

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             AA+ALYG +LP IEL+Y KAK Q +S+SLV+E QM+M F  T+F T+GM+ +K+ E IPR
Sbjct  178   AASALYGFVLPAIELTYKKAK-QTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPR  236

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EA +FELG + YY++ + +AI+WQFFF+GA+GVI  GSSLLS +I+A LLPVTE LAV+F
Sbjct  237   EASKFELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLF  296

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSA  217
             +HEKF+ EK IS+ LS+WG +SYFYG+++  KK+     A
Sbjct  297   FHEKFQVEKAISVVLSLWGSLSYFYGELQKNKKNQASERA  336



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score =   332 bits (851),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 256/350 (73%), Gaps = 8/350 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HR  1051
             MRR LL  +C +L++G CGGPLL+RLYFL GGNR+W S++L+T G P+IFIPLL+SY HR
Sbjct  1     MRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHR  60

Query  1050  RRRACSD----ESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIV  883
             RRR        ES+ S +   +   L +A+ ++G++ G  ++ Y+YG+A++PVSTS+LI 
Sbjct  61    RRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIR  120

Query  882   ATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVM  703
             A QL FTAGFAF LVKQKFTA+S N+VVL+T G  +L L    DR AGESN+ Y+ GF+ 
Sbjct  121   ACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLT  180

Query  702   TVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVI  523
             TVAA+ +YG ILPL+EL+Y KA+ Q ++++LVLE Q+IM    T+  ++ M+IN DF++I
Sbjct  181   TVAASVVYGFILPLVELTYKKAR-QQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMI  239

Query  522   PREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAV  343
               EA  F LG  KYYV+ V +AI+WQ FF+G +GVI   SS  S +I+AVLLPVTEILAV
Sbjct  240   AMEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAV  299

Query  342   IFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK--DNNESSAETEMTS  199
             + ++EKF+AEK ISL L++WGFVSYFYG+IK+ KK   N E     E T+
Sbjct  300   VTFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKNLELQRRAETTT  349



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score =   332 bits (851),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 246/341 (72%), Gaps = 5/341 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR--RRACSDESSKSRK  1009
             G CGGPLL RLY+ +GG+RIWF S+L TAG P+I IPL VS+ RR  R   + E+++  K
Sbjct  17    GTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRRSNRNHNNSETAEKAK  76

Query  1008  FFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQK  829
              F++   L IA+ ++G+L+G+DNY Y+YG+A LPVSTSSLIV TQL F A F+FL+VKQK
Sbjct  77    VFVMETPLFIASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIVGTQLAFNAIFSFLMVKQK  136

Query  828   FTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FT FS NAVVLLTVG  +L L    DRPAG S K Y++GF++T+ AA LY  ++PL+EL+
Sbjct  137   FTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLIAAVLYAFLMPLVELT  196

Query  648   YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVL  472
             Y K + Q ++F+LVLE QM+M    T F  VGMV+  DF  IPREAREF +G +  YY L
Sbjct  197   YKKVR-QEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREAREFMIGSSLFYYTL  255

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              V   IVWQ FF+GALGV+   SSL S + V+VLLPVTE+LAV+ + EKF+AEKG++L L
Sbjct  256   IVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCFREKFQAEKGVALLL  315

Query  291   SIWGFVSYFYGDIKNTKK-DNNESSAETEMTSAPTVASTQA  172
             S+WGFVSYFYG+ K+ KK  ++  S ETE+   P   S  A
Sbjct  316   SLWGFVSYFYGEFKSGKKIIDSPKSPETELPPLPVSGSDVA  356



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 244/319 (76%), Gaps = 6/319 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G C GP+++RLYF+ GG+ +WFSSW +T G+PVIF+PL++SY RR  A ++ +       
Sbjct  11    GGCAGPMVMRLYFIHGGSLVWFSSWQETGGWPVIFVPLVISYLRRLTAEANAAP-----V  65

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI   L +AAA++GVL GVDNY Y++G+ KLPVSTSSL++ATQL FTA F FL+VK +FT
Sbjct  66    LINLRLFLAAAVIGVLTGVDNYIYAFGLEKLPVSTSSLVIATQLAFTALFGFLIVKLRFT  125

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAVVLLTVGA VL + A  DRPAGES  AY LGF +T+ AAALYG +LPL+EL+Y 
Sbjct  126   AYSINAVVLLTVGAAVLAISASGDRPAGESRGAYWLGFFLTLGAAALYGFVLPLVELAYR  185

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA L+ ++++LV+E Q++M F  T F TVGM  NK+F+ I RE RE++LG   YYV+ V 
Sbjct  186   KANLE-MTYTLVMEVQLVMCFFATAFCTVGMFFNKEFQKIRREEREYKLGSATYYVVVVL  244

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             + + WQ FF+GA+GVI Y SSL+S +I+A+ +PV E+L VIFY EKF ++KG+SL LS+W
Sbjct  245   SCLAWQGFFLGAIGVIHYSSSLVSGIIIAITIPVNELLGVIFYGEKFGSQKGVSLGLSLW  304

Query  282   GFVSYFYGDIKNTKKDNNE  226
             GF+SYFYG+ K+ KK NN+
Sbjct  305   GFLSYFYGEYKSRKKANND  323



>ref|XP_006357924.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 259/349 (74%), Gaps = 6/349 (2%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             KME Q  + M++ILL ++ I L++G CG PL+IRLYF++GG RIW S WLQT  +P+  I
Sbjct  4     KMEPQVNSRMKKILLIINSIFLAVGICGAPLIIRLYFIKGGKRIWLSCWLQTVAWPINLI  63

Query  1074  PLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             PL +SY  RR      ++ S K  L+TP + +A   +G+L G  NY Y+YG+A+LPVSTS
Sbjct  64    PLAISYLYRR-----NNNNSSKLILMTPHIFMATIGIGILQGFSNYSYAYGVAELPVSTS  118

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
              L+ +TQL FTA FAF++V+ KFT++S N+V LLT+GAV+L L +G DRP GES K Y+L
Sbjct  119   GLLCSTQLAFTAFFAFIIVRLKFTSYSVNSVFLLTIGAVILALHSGGDRPEGESKKLYIL  178

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GF+MT+AAAAL GLI PL+EL Y KA+ QA++++ VLEFQ++  FV T+FST+GM+IN D
Sbjct  179   GFIMTLAAAALAGLIFPLVELIYKKAQ-QAITYTFVLEFQIVYCFVATLFSTIGMIINND  237

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ I  EA+ FELG  +YYV+ + +AI+WQF+ +G++GVI   SSL+  ++++VLLP+TE
Sbjct  238   FQAISGEAKTFELGEGRYYVVIILSAIIWQFYSLGSIGVIYSASSLVCGILISVLLPLTE  297

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETE  208
             +LAVI Y E F AEKGISL LS+WGFVSYFYGD K   K  N  S E E
Sbjct  298   VLAVILYRENFSAEKGISLALSLWGFVSYFYGDYKANNKRKNNQSPEIE  346



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 188/338 (56%), Positives = 257/338 (76%), Gaps = 6/338 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+++LL ++CIIL++G CGGPL++RLYF++GG RIW SSWLQTA +P+ FIPL++SY  R
Sbjct  1     MKKVLLVINCIILAVGTCGGPLVMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             R+     ++ + K  L+TP + +A   +G+L G  NYFY+YG+ KLPVSTS L+ ATQL 
Sbjct  61    RK-----NNSTTKLILMTPRIFMATIGIGILQGFTNYFYAYGIGKLPVSTSGLLFATQLA  115

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FAFL+VK KFT +S N+V LLT GAVVL LR+G D+P GE  K Y+LGFVMT+A+A
Sbjct  116   FTAFFAFLIVKLKFTPYSVNSVFLLTTGAVVLALRSGGDQPEGEPRKEYILGFVMTLASA  175

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             AL GLI PL+EL Y K + Q ++++ VLEFQ +  FV T+ +T+GM+INKDF+ I REA+
Sbjct  176   ALTGLIFPLVELIYKKTQ-QTITYTFVLEFQTLYCFVATVLATIGMIINKDFQAISREAK  234

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              FELG  KYY++ +++AI+ QF+F+G++GVI   SSL+  ++++VLLP+TE+LAV  Y E
Sbjct  235   TFELGEDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVCGILLSVLLPLTEVLAVFLYGE  294

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAE  214
             KF AEKG+SL LS+WGF SYFYGD   T+  N   + E
Sbjct  295   KFNAEKGVSLALSLWGFASYFYGDYNKTENSNQSPAIE  332



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 247/331 (75%), Gaps = 5/331 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G CGGPLL RLY+  GG RIWF S+L TAG P+I IPLLVS+ +RR+R  ++  +K+  F
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLVSFLNRRKRNKAENVAKTELF  75

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
              + TP L +A+ ++G+L+G+DNY Y+YG+A LPVSTSSLI+ TQL F A FAFLLVKQKF
Sbjct  76    LMETP-LFVASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFLLVKQKF  134

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T FS NAVVLLTVG  +L L +  D+PA ES+K Y++GF+MTV AA LY  ILPL+EL+Y
Sbjct  135   TPFSVNAVVLLTVGTGILALHSDGDKPANESHKEYVVGFLMTVIAAVLYAFILPLVELTY  194

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLA  469
              KA+ Q ++F LVLE QM+M    T F  VGM I  DF+VI +EAREF++G +  YY L 
Sbjct  195   KKAR-QEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIGGSAFYYALI  253

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+LAV+ + EKF+AEK +SL LS
Sbjct  254   VITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKCVSLLLS  313

Query  288   IWGFVSYFYGDIKNTKK-DNNESSAETEMTS  199
             +WGFVSYFYG+ K+ KK  +     ETE+ +
Sbjct  314   LWGFVSYFYGEFKSGKKVVDKPQQTETELPT  344



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/335 (54%), Positives = 247/335 (74%), Gaps = 4/335 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQT+G P+I +PLL S+  R R   ++       F
Sbjct  18    GNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLF  77

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L+G DNY Y+YG+A LPVSTSSLI+++QL FTA FAF +VKQ+FT
Sbjct  78    LIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFT  137

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLT+GA  L L A  D+   E+ K Y++GFVMTVAAA LY  +LPL+EL+Y 
Sbjct  138   PFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYK  197

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV-  466
             KA  Q +S++LVLE Q+++  V T    VGM+ + DF+ + REAREF+LG +K+Y L V 
Sbjct  198   KAS-QRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKELGREAREFKLGGSKHYCLVVA  256

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             FTA++WQ FF+G++G+I   SSL+S ++++ LLP+TE+LAV+F+ EKF+A KG+SLFLS+
Sbjct  257   FTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQAAKGVSLFLSL  316

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             WGFVSYFYG I++ K+     + E E++  P   S
Sbjct  317   WGFVSYFYGKIQSEKEKKK--TQEAELSQLPATES  349



>ref|XP_003519187.1| PREDICTED: purine permease 1-like [Glycine max]
Length=344

 Score =   329 bits (843),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 267/345 (77%), Gaps = 8/345 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HR  1051
             M+RILL ++ I+L+ G  GG L++RLYF+ GG RIW SS+L+TA FP+I +P+++SY H+
Sbjct  2     MKRILLLINTILLATGTSGGALVMRLYFIHGGKRIWLSSFLETAAFPIIILPIIISYIHK  61

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RRR       +S     I P L +A+AL+G+L G+D+Y Y+ G+A+LPVST SLI A+ L
Sbjct  62    RRR------HRSSALISIKPPLFLASALIGLLTGLDDYLYACGVARLPVSTFSLIQASHL  115

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTA FAFLLV+ +FT +S N+VVLLTV AVVL LR+  DRPAGES++ Y++GFVM +AA
Sbjct  116   AFTAVFAFLLVRHRFTPYSVNSVVLLTVAAVVLALRSSGDRPAGESSRQYVIGFVMILAA  175

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREA  511
             AALYG +LPL+EL Y K++ Q +++SLV+E Q+++ F  T+F TVGM+IN DF+VIPREA
Sbjct  176   AALYGFVLPLMELVYKKSR-QRITYSLVMEIQLVLCFFATLFCTVGMIINNDFKVIPREA  234

Query  510   REFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYH  331
             R+F+LG TKYYV+ V++AI+WQFFF+GA+GVI   SSLLS +I+A  LPVTE+LAVI Y 
Sbjct  235   RDFKLGETKYYVVLVWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPVTEVLAVIVYK  294

Query  330   EKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSA  196
             E F AEKG++L LS+WGFVSYFYG+IK  ++ N     ET++  +
Sbjct  295   ESFHAEKGVALVLSLWGFVSYFYGEIKQDREKNKNRCPETDLPQS  339



>ref|XP_007042881.1| Purine permease 3 isoform 1 [Theobroma cacao]
 gb|EOX98712.1| Purine permease 3 isoform 1 [Theobroma cacao]
Length=338

 Score =   328 bits (842),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 256/340 (75%), Gaps = 5/340 (1%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  ++R LL L+C +L+ GN GGPL+++LYFL+GG  +W SS L+TAG+P + +PL  SY
Sbjct  2     RKGLKRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSY  61

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
               RRR    +     + F I P L +A+A++G+L GVD++ Y+YG+A+LPVST +LI++T
Sbjct  62    LYRRR----KEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIIST  117

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FT  FAFLLVKQKFT+F+ N+V LL +GAVVL L   SD PA ESN+ Y  GF MT+
Sbjct  118   QLAFTVAFAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTL  177

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             AA+ALYG +LP IEL+Y KAK Q +S+SLV+E QM+M F  T+F T+GM+ +K+ E IPR
Sbjct  178   AASALYGFVLPAIELTYKKAK-QTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPR  236

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EA +FELG + YY++ + +AI+WQFFF+GA+GVI  GSSLLS +I+A LLPVTE LAV+F
Sbjct  237   EASKFELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLF  296

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSA  217
             +HEKF+ EK IS+ LS+ G +SYFYG+++  KK+    +A
Sbjct  297   FHEKFQVEKAISVVLSLLGSLSYFYGELQKNKKNQASDTA  336



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 260/349 (74%), Gaps = 9/349 (3%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R LL ++C+ILS+G C  PL++RLYF+ GG R+W S++LQTAGFP++ IPL +SY +R
Sbjct  13    MKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLMLIPLAISYIKR  72

Query  1047  RR------ACSDESSKSRKFFLIT--PFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
              R        +  S    K  +I+  P +  AAA +G+L G+D+Y ++YG+A+LPVSTS+
Sbjct  73    HRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAYGVARLPVSTSA  132

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+A+QL FTA FAFL+VK+KFTAF+ NAVVLLTVGA VL +   SDRPAG S K Y + 
Sbjct  133   LIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRPAGVSAKQYWIS  192

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             F  TVAA+ALYG ILP +EL Y K K Q V++S V+EFQ +     T+F  +GM+ N DF
Sbjct  193   FSTTVAASALYGFILPSVELVYKKIK-QPVTYSFVMEFQFVTCMFATLFCAIGMIANNDF  251

Query  531   EVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEI  352
             +VIP+EAR F LG + YYV+ V +AI+WQ FF+GA+GVI   SSLLS +++AVLLP+TE+
Sbjct  252   KVIPKEARNFGLGESTYYVVLVVSAIMWQAFFLGAIGVIFCASSLLSGILIAVLLPLTEV  311

Query  351   LAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             LAV+FY EKF+AEKG+SL LS+WGFVSYFYG+IK+ K +  + S E +M
Sbjct  312   LAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKCSLEIKM  360



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 244/334 (73%), Gaps = 6/334 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLL+RLYF RGGNRIW SSWL+T G+P+   PLL SY  RR    ++ ++    F
Sbjct  44    GESGGPLLMRLYFNRGGNRIWLSSWLETGGWPIFLFPLLFSYLHRRSKLGEQGAR---LF  100

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              + P L +A+A LG+L G+ +Y Y+YGM++LPVST SLI ++QL F A F+FLLV+Q+FT
Sbjct  101   FMKPRLFVASASLGLLTGLVDYLYAYGMSRLPVSTISLINSSQLAFNALFSFLLVRQRFT  160

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS N+VVLLT+GA+VLGL + SDRP  E+   Y +GF +++ AA LYGL+LP++E +Y 
Sbjct  161   PFSINSVVLLTIGAIVLGLHSSSDRPKDEAKDQYYMGFFVSIGAAVLYGLLLPMVEFTYK  220

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             +AK QA+++ LV+E QM+M    T F TVGM++NKDF+ I  EARE ELGV KYYV+ V 
Sbjct  221   RAK-QAITYPLVMEIQMVMSIFATAFCTVGMLVNKDFKAIGSEAREHELGVVKYYVVLVC  279

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI WQFF++GA+GVI Y SSL++ +  A LLP+ EILAVIFY EKF+ EKGISL L++W
Sbjct  280   SAIFWQFFYLGAVGVIFYASSLVAGITSATLLPILEILAVIFYKEKFKGEKGISLTLALW  339

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             GF SYFYG++K   + + +   E+E    P  +S
Sbjct  340   GFTSYFYGELKGNNQQDQK--PESEPHQCPNSSS  371



>ref|XP_004252714.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=356

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 264/348 (76%), Gaps = 5/348 (1%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
              M+R LL ++C++LS+G CGGPL++RLYF+ GG RIWF+SWLQT G+P+  IPL++ Y  
Sbjct  11    NMKRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRIWFNSWLQTGGWPLTIIPLVILYFY  70

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RR+    ++    K +  TP + IA+ ++G+  G D Y YS+G +KLPVSTSSL++A QL
Sbjct  71    RRKIEGSDT----KLYYTTPRIFIASFVIGIFTGFDAYLYSWGGSKLPVSTSSLLIAAQL  126

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTA  A+ +VK KFT++S NAVVLLT+GAV+LG+R+  DRP G ++K Y++GF+MT+ A
Sbjct  127   AFTAIGAYFIVKIKFTSYSINAVVLLTLGAVLLGIRSNGDRPEGVTSKEYVIGFIMTLLA  186

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREA  511
             AALYGLILP IEL YLKAK QA++ +LVLE QM+M F  T F T+GM+ NKDF+ I RE 
Sbjct  187   AALYGLILPCIELMYLKAK-QAITATLVLEIQMVMCFASTAFCTIGMIANKDFQAISRET  245

Query  510   REFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYH  331
             ++F LG  +YY++ +++AI+WQ FFVGA+GVI   SSL+S +++AVLLP+TEIL VIF+ 
Sbjct  246   KKFNLGEARYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVLIAVLLPITEILGVIFFD  305

Query  330   EKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTV  187
             EKF +EKG+SLFLS+WGFVSYFYG+ K  KK   +   E EMT+   +
Sbjct  306   EKFSSEKGLSLFLSLWGFVSYFYGEFKQAKKVEKKKIQENEMTTTTQI  353



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 255/336 (76%), Gaps = 3/336 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSR-KF  1006
             GNCGGPL+ RLY+  GG RIWFSS+LQTAG P+IF+PLL S+ RRRR   +E  +++  F
Sbjct  36    GNCGGPLITRLYYRNGGKRIWFSSFLQTAGCPIIFLPLLFSFLRRRRRRKEEEEEAKTPF  95

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FLI P L  A+ ++G+L G DNY YSYG+A LPVST+SLI+++QL FTA FAF +VKQKF
Sbjct  96    FLIKPPLFFASVVIGLLTGFDNYLYSYGLAYLPVSTASLIISSQLAFTALFAFFMVKQKF  155

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T F  NAVVLLT+GA +L L    D+ A E++K Y++GF+MTVAAA LY  ILPL+EL+Y
Sbjct  156   TPFVINAVVLLTLGAGILALHTDGDKLAKETHKEYVVGFLMTVAAAILYAFILPLVELTY  215

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYY-VLA  469
              KA+ Q +S++LVLE QM++ FV T F  VGM+ + DF+VI +EAR+F+ G + YY V+ 
Sbjct  216   KKAR-QQISYTLVLEIQMVLCFVATCFCLVGMLADGDFKVIAKEARDFKHGGSSYYTVVV  274

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VFTAI+WQ FF+G++G+I   SSL+S ++++ LLP+TE+LAV+ + EKF+AEKG+SLFLS
Sbjct  275   VFTAIIWQGFFLGSIGIIFCASSLVSGILISALLPLTEVLAVLCFREKFQAEKGLSLFLS  334

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             +WGF+SYFYG IK+ KK     +  T++   P   S
Sbjct  335   LWGFLSYFYGQIKSEKKKTPTQAQGTQLPQLPITDS  370



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 246/341 (72%), Gaps = 9/341 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-----HRRRRACSDESSK  1018
             G CGGPLL RLYF  GG RIWF S+LQTAG P+I +PL+ S+       R    ++ + K
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLQTAGCPIILLPLVASFLRRRRSNRNSNNAENTPK  75

Query  1017  SRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLV  838
             ++ F + TP L IA+ ++G+L G+DNY YSYG+A LPVSTSSLI+ TQL F A FAFLLV
Sbjct  76    TKIFLMETP-LFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLV  134

Query  837   KQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLI  658
             KQKFT FS NAVVLLTVG  +L L +  D+PA ES+K Y++GF+MTV AA LY  ILPL+
Sbjct  135   KQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHKQYVIGFLMTVVAAVLYAFILPLV  194

Query  657   ELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-Y  481
             EL+Y KA+ Q ++F LV E QM+M    T+F  VGM I  DF+VI REAREF++G +  Y
Sbjct  195   ELTYKKAR-QEITFPLVFEIQMVMCVAATLFCLVGMFIVGDFKVIAREAREFKIGGSVFY  253

Query  480   YVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGIS  301
             Y L V T IVWQ FF+GA+G++   SSL S ++++VLLPVTE+LAV+ + EKF+AEKG+S
Sbjct  254   YALIVITGIVWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVS  313

Query  300   LFLSIWGFVSYFYGDIKNTKKD-NNESSAETEMTSAPTVAS  181
             L LS+WGFVSYFYG+IK+ KK  +     ETE+   P   S
Sbjct  314   LLLSLWGFVSYFYGEIKSGKKVLDKPQPPETELPILPVSDS  354



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 258/329 (78%), Gaps = 9/329 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             GNCGGPL++RLYF  GG RIWFS++L+TAGFPVIFIPLL SY HRRR     E++ S  F
Sbjct  16    GNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRRNNNGGENATS--F  73

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FLI P L  AA  +G+L G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KF
Sbjct  74    FLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSFFMVKHKF  133

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T F+ NAVVLLTVGA VLG+   +D+P  E++K Y+ GF++TVAAA +Y  ILPL+EL+Y
Sbjct  134   TPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVTGFLVTVAAAVVYAFILPLVELAY  193

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              KAK Q +S++LVL  QMI+ F+ +I S +GM I  DF+ +P+EA+EF+LG   +YV+AV
Sbjct  194   QKAK-QPLSYTLVL--QMILCFLASIVSLIGMSIAGDFKALPKEAKEFKLGEVLFYVVAV  250

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             F+AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYHEKF+AEKG+SL LS+
Sbjct  251   FSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEKGLSLALSL  310

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTS  199
             WGFVSYFYG+IK+   DN++   + E +S
Sbjct  311   WGFVSYFYGEIKS---DNDKKRIQQEESS  336



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 189/341 (55%), Positives = 249/341 (73%), Gaps = 6/341 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G CGGPLL RLY+  GG RIWF S+L TAG P+I IPLL S+ +RR R  ++  +K+  F
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRNKAENVAKTELF  75

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
              + TP L IA+ ++G+L+G+DNY Y+YG+  LPVSTSSLI+ TQL F A FAFLLVKQKF
Sbjct  76    LMETP-LFIASTVIGLLIGLDNYLYAYGLRYLPVSTSSLIIGTQLAFNALFAFLLVKQKF  134

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T FS NAVVLLTVG  +L L +  D+PA ES++ Y++GF+MTV AA LY  ILPL+EL+Y
Sbjct  135   TPFSINAVVLLTVGTGILALHSDGDKPANESHREYVVGFLMTVIAAVLYAFILPLVELTY  194

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLA  469
              KA+ Q ++F LVLE QM+M    T F  VGM I  DF+VI +EAREF++G +  YY L 
Sbjct  195   KKAR-QEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIGGSAFYYALI  253

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V T I+WQ FF+GA+G++   SSL S ++++VLLP+TE+LAV+ + EKF+AEK  SL LS
Sbjct  254   VITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPMTEVLAVVCFREKFQAEKCASLLLS  313

Query  288   IWGFVSYFYGDIKNTKK-DNNESSAETEM-TSAPTVASTQA  172
             +WGFVSYFYG+ K+ KK  +     ETE+ T+ P V+ + A
Sbjct  314   LWGFVSYFYGEFKSGKKVVDKPQQTETELPTTLPAVSDSVA  354



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 248/341 (73%), Gaps = 6/341 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G CGGPLL RLY+  GG RIWF S+L TAG P+I IPLL S+ +RR R  ++  +K+  F
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRNKAENVAKTELF  75

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
              + TP L IA+ ++G+L+G+DNY Y+YG+A L VSTSSLI+ TQL F A FAFLLVKQKF
Sbjct  76    LMETP-LFIASIVIGLLIGLDNYLYAYGLAYLQVSTSSLIIGTQLAFNALFAFLLVKQKF  134

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T FS NAVVLLTVG  +L L +  D PA ES+K Y++GF+MTV AA LY  ILPL+EL+Y
Sbjct  135   TPFSVNAVVLLTVGTGILALHSDGDLPANESHKEYVVGFLMTVIAAVLYAFILPLVELTY  194

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFEL-GVTKYYVLA  469
              KA+ Q ++F LVLE QM+M    T F  VGM I  DF+VI +EAREF++ G   YY L 
Sbjct  195   KKAR-QEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIRGSAFYYALI  253

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+LAV+ + EKF+AEKG+SL LS
Sbjct  254   VITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVSLLLS  313

Query  288   IWGFVSYFYGDIKNTK-KDNNESSAETEM-TSAPTVASTQA  172
             +WGFVSYFYG+ K+ K   +     ETE+ T+ P V+ + A
Sbjct  314   LWGFVSYFYGEFKSGKIVVDKPQQTETELPTTLPAVSDSVA  354



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 241/336 (72%), Gaps = 7/336 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY----HRRRRACSDESSKS  1015
             G CGGPLL RLYF  GG RIWF S+L TAGFP+I IPLLVS+       R   + E+ + 
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRSNRNPNNAENKRK  75

Query  1014  RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVK  835
              K FL+   L IA+ ++G+L G+DNY YSYG+A LPVSTSSLI+ TQL F A FAFLLVK
Sbjct  76    TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  834   QKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIE  655
             QKFT FS NAVVLLTVG  +L L +  D+PA ES K Y++GF+MTV AA LY  ILPL+E
Sbjct  136   QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  654   LSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YY  478
             L+Y KA+ Q ++F LVLE QM+M    T F  +GM I  DF+VI REAREF++G +  YY
Sbjct  196   LTYKKAR-QEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYY  254

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
              L V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+ AV+ + EKF+AEKG+SL
Sbjct  255   ALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSL  314

Query  297   FLSIWGFVSYFYGDIKNTKK-DNNESSAETEMTSAP  193
              LS+WGFVSYFYG+ K+ KK  +     ETE+   P
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVVDKPQPPETELPILP  350



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 241/336 (72%), Gaps = 7/336 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY----HRRRRACSDESSKS  1015
             G CGGPLL RLYF  GG RIWF S+L TAGFP+I IPLLVS+       R   + E+ + 
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRGNRNPNNAENKRK  75

Query  1014  RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVK  835
              K FL+   L IA+ ++G+L G+DNY YSYG+A LPVSTSSLI+ TQL F A FAFLLVK
Sbjct  76    TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  834   QKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIE  655
             QKFT FS NAVVLLTVG  +L L +  D+PA ES K Y++GF+MTV AA LY  ILPL+E
Sbjct  136   QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  654   LSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YY  478
             L+Y KA+ Q ++F LVLE QM+M    T F  +GM I  DF+VI REAREF++G +  YY
Sbjct  196   LTYKKAR-QEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYY  254

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
              L V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+ AV+ + EKF+AEKG+SL
Sbjct  255   ALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSL  314

Query  297   FLSIWGFVSYFYGDIKNTKK-DNNESSAETEMTSAP  193
              LS+WGFVSYFYG+ K+ KK  +     ETE+   P
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVVDKPQPPETELPILP  350



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 241/325 (74%), Gaps = 6/325 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CG PL++RLYF++GG RIW S WLQT  +P+ FIPL +SY  RR      ++ S K  
Sbjct  16    GTCGAPLIMRLYFIKGGKRIWLSCWLQTVAWPINFIPLAISYLYRR-----NNNNSSKLI  70

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP + +A   +G+L G+ NYFYSYG+AKLPVST+ L+++TQL F A FAF++VK K T
Sbjct  71    LMTPRIFMATIGIGILQGLSNYFYSYGVAKLPVSTNGLLISTQLAFIAFFAFIIVKLKLT  130

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S N+V LLT+GAVVL L +G DRP GE+NK Y+LGF+MT+A+AAL GLI PL+EL Y 
Sbjct  131   SYSINSVFLLTIGAVVLALHSGGDRPEGETNKEYILGFIMTLASAALTGLIFPLVELIYK  190

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA+ QA++++ VLEFQ +  FV T+FST+GMVIN DF+ I  EA+ FELG  +YYV+ + 
Sbjct  191   KAQ-QAITYTFVLEFQTVYCFVATVFSTIGMVINNDFQAISGEAKAFELGEGRYYVVIIC  249

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AIV QF+F+G +GVI   SSL+S ++   LLPV E+LAV  Y EKF AEKGISL LS+W
Sbjct  250   IAIVLQFYFLGTIGVIYSASSLVSGILATFLLPVNEVLAVFLYSEKFSAEKGISLALSLW  309

Query  282   GFVSYFYGDIKNTKKDNNESSAETE  208
             GF SYFYGD K  KK  N+ S ET+
Sbjct  310   GFASYFYGDYKENKKRKNDQSPETK  334



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 250/337 (74%), Gaps = 10/337 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+CGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+  RRR    E  +    F
Sbjct  20    GSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLSRRRL---EEQEKTSLF  76

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  77    LMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  136

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL   + SD+ A E++K Y++GF+MT  AA LY  ILPL+EL+Y 
Sbjct  137   PFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAALLYAFILPLVELAYK  196

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREARE---FELGVTKYYVL  472
             K++ Q V+++LVLEFQM++ FV T F  VGM+ + DF+VI REARE   F+LG + YYV+
Sbjct  197   KSR-QRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREAREARDFKLGESLYYVV  255

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              VFTA++WQ FFVGA+G+I   SSL+S ++V+ LLPVT +LAVI + EKF+A KG++L L
Sbjct  256   VVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVALAL  315

Query  291   SIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             S+WG VSYFYG IK+ +K   +   ET+++  P   S
Sbjct  316   SLWGSVSYFYGQIKSEEKTKAQ---ETQLSQLPVTDS  349



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 250/335 (75%), Gaps = 4/335 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQT+G P+I +PLL S+  R R   ++       F
Sbjct  18    GNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLF  77

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L+G DNY Y+YG+A LPVSTSSLI+++QL FTA FAF +VKQ+FT
Sbjct  78    LIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTAFFAFFMVKQRFT  137

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLT+GA  L L A  D+   E+ K Y++GFVMTVAAA LY  +LPL+EL+Y 
Sbjct  138   PFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYK  197

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV-  466
             KA  Q +S++LVLE Q+++ FV T F  VGM+ + DF+ + REAREF+LG +K+Y L V 
Sbjct  198   KAS-QRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELGREAREFKLGGSKHYCLVVA  256

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             FTA++WQ FF+G++G+I   SSL+S ++++ LLP+TE+LAV+F+ EKF+AEKG+SLFLS+
Sbjct  257   FTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQAEKGVSLFLSL  316

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             WGFVSYFYG I++ K+     + E E++  P   S
Sbjct  317   WGFVSYFYGKIQSEKEKKK--TQEAELSQLPATES  349



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 250/345 (72%), Gaps = 17/345 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+ RR R C DE  K+  FF
Sbjct  18    GNCGGPLMMRLYFSNGGQRIWFSSFLQTVGCPLIIFPLLFSFIRRLR-CLDEQEKT-PFF  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IAA L+G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  76    LMKPPLFIAAILVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLTVGAVVL L + SD+ A E++K Y++GF+MT+ AA LY  ILPL+EL+Y 
Sbjct  136   PFTINAVVLLTVGAVVLALNSDSDKLANETHKEYVVGFLMTIGAALLYAFILPLVELTY-  194

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE-----------VIPREAREFEL  496
             K   Q ++++L LEFQM++ F  T F  VGM+   DF+           VI  EAR+F+L
Sbjct  195   KKSCQRITYTLALEFQMVLCFFATCFCLVGMLAAGDFKVKHALFIFKNRVIAGEARDFKL  254

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G + YYV+ VFTA++WQ FFVGA+G+I   SSL+S ++++ LLPVT ILAVI + EKF+A
Sbjct  255   GESLYYVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVILAVICFQEKFQA  314

Query  315   EKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
              KG++L LS+WG VSYFYG +K+ +K   +   ET+++  P   S
Sbjct  315   GKGVALALSLWGSVSYFYGQMKSEEKTKAQ---ETQLSQLPVTDS  356



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 246/337 (73%), Gaps = 10/337 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDE----SSKS  1015
             G CGGPLL RLY+  GG RIWF S+L TAGFP+I IPL VS+  RRR C+ +    ++K+
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSFLSTAGFPIILIPLFVSFLNRRR-CNRKNVANAAKT  74

Query  1014  RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVK  835
               F + TP L +A+ ++G+L G+DNY YSYG+A LPVSTSSLIV TQL F A F+FLLVK
Sbjct  75    ELFLMETP-LFVASIVIGLLSGLDNYLYSYGLAYLPVSTSSLIVGTQLAFNALFSFLLVK  133

Query  834   QKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIE  655
             QKFT FS NAVVLLTVG  +L L +  D+PA ES++ Y++GF+MT+ AA LY  ILPL+E
Sbjct  134   QKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVIGFLMTLIAAVLYAFILPLVE  193

Query  654   LSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFEL-GVTKYY  478
             L+Y KA+ Q ++F LVLE QM+M    T F  VGM I  DF+VI +EAREF++ G   YY
Sbjct  194   LTYKKAR-QEITFQLVLEIQMVMCLAATGFCVVGMFIVGDFKVIAKEAREFKIGGPVFYY  252

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
              L V T I+ Q F +GA+GV+   SSL S ++++VLLPVTE+LAV+ + EKF+AEKG+SL
Sbjct  253   ALIVITGIIMQGFSLGAIGVVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVSL  312

Query  297   FLSIWGFVSYFYGDIKNTKK--DNNESSAETEMTSAP  193
             FLS+WGFVSYFYG+ K+ KK   +     ETE+ + P
Sbjct  313   FLSMWGFVSYFYGEFKSGKKVVVDKPQQPETELPTLP  349



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 244/340 (72%), Gaps = 7/340 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY----HRRRRACSDESSKS  1015
             G CGGPLL RLY+  GG RIWF S L TAG P+I IPL  S+       R   + E+++ 
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSSLSTAGCPIILIPLFFSFLSRHRSNRNRNNSENAEK  75

Query  1014  RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVK  835
              K FL+   L IA+ ++G+L G+DNY Y+YG+A LPVSTSSLI+ TQL F A FAF +VK
Sbjct  76    TKIFLMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVK  135

Query  834   QKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIE  655
             QKFT FS NAVVLLTVG  +L L +  D+PA ES+K Y++GF+MTV AA LY  ILPL+E
Sbjct  136   QKFTPFSINAVVLLTVGTGILALHSDGDKPAKESHKEYVVGFLMTVIAAVLYAFILPLVE  195

Query  654   LSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YY  478
             L+Y KA+ Q ++F+LVLE QM+M    T F  VGM+I+ DF+VI REAREF++G +  YY
Sbjct  196   LTYKKAR-QEITFTLVLEIQMVMCLAATCFCLVGMLIDGDFKVIAREAREFKIGGSAFYY  254

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
              L V T I+WQ FF+GA+G++   SSL S ++++VLLPVTE+LAV+ + EKF+A+KG++L
Sbjct  255   TLIVMTGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQADKGVAL  314

Query  297   FLSIWGFVSYFYGDIKNTKKD-NNESSAETEMTSAPTVAS  181
              LS+WGFVSYFYG+ K+ KK    E   ETE+ S P   S
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVLEKEQPPETELPSLPVTDS  354



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 248/346 (72%), Gaps = 15/346 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQT+G P+I +PLL S+  R R   ++       F
Sbjct  18    GNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRHRQQQEQEEPKTTLF  77

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L+G DNY Y+YG+A LPVSTSSLI+++QL FTA FAF +VKQ+FT
Sbjct  78    LIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFTALFAFFMVKQRFT  137

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLT+GA  L L A  D+   E+ K Y++GFVMTVAAA LY  +LPL+EL+Y 
Sbjct  138   PFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAVLYAFVLPLVELAYK  197

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF-----------EVIPREAREFEL  496
             KA  Q +S++LVLE Q+++  V T    VGM+ + DF           + + REAREF+L
Sbjct  198   KAS-QRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKNQEFDFLFTVQELGREAREFKL  256

Query  495   GVTKYYVLAV-FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFE  319
             G +K+Y L V FTA++WQ FF+G++G+I   SSL+S ++++ LLP+TE+LAV+F+ EKF+
Sbjct  257   GGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEKFQ  316

Query  318   AEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             A KG+SLFLS+WGFVSYFYG I++ K+   + + E E++  P   S
Sbjct  317   AAKGVSLFLSLWGFVSYFYGKIQSEKE--KKKTQEAELSQLPATES  360



>ref|XP_006358992.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=358

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 234/320 (73%), Gaps = 4/320 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF+ GG RIW SSWLQT   P+I IPL +SY  RR+    ES  + + F
Sbjct  28    GNCGGPLISRLYFIHGGQRIWLSSWLQTIACPLILIPLSISYFHRRKI---ESPATARIF  84

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +T    I +  +G++ G+D YF S+G AKLPVSTSSLI ATQL FTA FA LLVKQK T
Sbjct  85    SLTRREIIGSTGVGIIAGLDGYFISWGPAKLPVSTSSLINATQLAFTALFAVLLVKQKLT  144

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S  +V LL  GA  L LR   DRPAG S K Y++GFVMTV  A  +GL++ LIEL Y+
Sbjct  145   VYSKLSVFLLIAGAATLALRGKGDRPAGVSVKEYVIGFVMTVMGAVCFGLMVSLIELIYI  204

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK  A+S+++VLE Q+I+G   T+F T+GM+IN DF+ IP+EA E+E+G  KYY++ V+
Sbjct  205   KAK-NAISYTMVLEIQLIIGVSATVFCTIGMIINNDFQAIPKEASEYEIGEAKYYLVLVW  263

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AI+WQ   +G +GVI Y SSLLS +I A LLPVTEILA++ +HEKF+ EKG+++FL++ 
Sbjct  264   CAIIWQLALMGLVGVIFYSSSLLSGIIGAFLLPVTEILAIVLFHEKFQVEKGVAIFLALC  323

Query  282   GFVSYFYGDIKNTKKDNNES  223
             GFVSYFYG+I+ +KK+  ++
Sbjct  324   GFVSYFYGEIEQSKKEKQDN  343



>ref|XP_009148632.1| PREDICTED: purine permease 2-like [Brassica rapa]
Length=376

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 264/353 (75%), Gaps = 8/353 (2%)
 Frame = -1

Query  1236  RTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY  1057
             R  M+  L+ ++CIIL+IGNCGGPL+ RLYF  GG RIWFSS+LQTAG P+I  PLL S+
Sbjct  29    RKKMKTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSF  88

Query  1056  HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVAT  877
               RR+      + +  FFLI P L +A+ ++G+L GVDNY Y+YG+A LPVSTSSL++++
Sbjct  89    RLRRK-----EATTTPFFLIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISS  143

Query  876   QLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTV  697
             QL FTA FAF +VKQKFT F  NAVVLLT+GA +L L    D+ A E++K Y++GF+MT+
Sbjct  144   QLAFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTL  203

Query  696   AAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             AAA LY  +LPL+EL+Y KA+ + +S++LVLE QM++ FV T F  VGM+ + DF+ + R
Sbjct  204   AAAILYAFVLPLVELTYKKAR-KRISYTLVLEMQMVLCFVATCFCLVGMLADGDFKELAR  262

Query  516   EAREFELG-VTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVI  340
             EAR+F+LG  T YYV+ VFTAI+WQ FF+G++G+I   SSL+S +++  LLP+TE+LAV 
Sbjct  263   EARDFKLGRSTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVF  322

Query  339   FYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             F+ EKF+AEKG+SLFLS+WGFVSYFYG IK+  K   +   E +++  P + S
Sbjct  323   FFREKFQAEKGLSLFLSLWGFVSYFYGQIKSENKTETQDQ-EAQLSQLPGIDS  374



>emb|CDY12422.1| BnaC08g09110D [Brassica napus]
Length=376

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 248/336 (74%), Gaps = 9/336 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQTAG P+I  PLL S+  RR+      + +  FF
Sbjct  48    GNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSFRLRRK-----EATTTPFF  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L GVDNY Y+YG+A LPVSTSSL++++QL FTA FAF +VKQKFT
Sbjct  103   LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQLAFTAFFAFFMVKQKFT  162

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F  NAVVLLT+GA +L L    D+ A E++K Y++GF+MT+AAA LY  +LPL+EL+Y 
Sbjct  163   PFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAAAILYAFVLPLVELTYK  222

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELG--VTKYYVLA  469
             KA+ Q +S++LVLE Q+++ FV T F  VGM+ + DF+ + REAR+F+LG   T YYV+ 
Sbjct  223   KAR-QRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREARDFKLGGSTTYYYVVV  281

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VFTAI+WQ FF+G++G+I   SSL+S +++  LLP+TE+LAV F+ EKF+AEK ISLFLS
Sbjct  282   VFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQAEKSISLFLS  341

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             +WGFVSYFYG IK   K       E +++  P + S
Sbjct  342   LWGFVSYFYGQIKAENKTETPDQ-EAQLSQLPVIDS  376



>emb|CDY29741.1| BnaA01g19250D [Brassica napus]
Length=377

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 250/335 (75%), Gaps = 8/335 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQTAG P+I  PLL S+  RR+      + +  FF
Sbjct  48    GNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSFRLRRK-----EATTTPFF  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L GVDNY Y+YG+A LPVSTSSL++++QL FTA FAF +VKQKFT
Sbjct  103   LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQLAFTAFFAFFMVKQKFT  162

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F  NAVVLLT+GA +L L    D+ A E++K Y++GF+MT+AAA LY  +LPL+EL+Y 
Sbjct  163   PFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAAAILYAFVLPLVELTYK  222

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELG-VTKYYVLAV  466
             KA+ + +S++LVLE QM++ F  T F  VGM+ + DF+ + REAR+F+LG  T YYV+ V
Sbjct  223   KAR-KRISYTLVLEMQMVLCFGATCFCLVGMLADGDFKELAREARDFKLGRSTYYYVVVV  281

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             FTAI+WQ FF+G++G+I   SSL+S +++  LLP+TE+LAV F+ EKF+AEKG+SLFLS+
Sbjct  282   FTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQAEKGLSLFLSL  341

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             WGFVSYFYG IK+  K   +   E +++  P + S
Sbjct  342   WGFVSYFYGQIKSENKTETQDQ-EAQLSQLPGIDS  375



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 248/335 (74%), Gaps = 2/335 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             + Q    ++R L+ L+C++L +G+ GGPLL RLYF  GG+R W +SWL+T G+P+I +PL
Sbjct  14    DPQMSKALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPL  73

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              +SY  RRR  SD    ++ FFL TP L +A A+LG+L G D++ Y+YG++ LPVSTS++
Sbjct  74    FISYLYRRRLASDHHHPTKLFFL-TPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAI  132

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             +++TQL FTA FAFL+VKQKFT +S N++ LL+VGAV+LGL   SDRP   S   YL+GF
Sbjct  133   LISTQLAFTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGF  192

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              +T+  AALYGL+LPL+EL+Y KA  Q ++++LV+E Q++MGF  T F T+GM++NKDFE
Sbjct  193   FLTLGTAALYGLVLPLVELTYRKAS-QVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFE  251

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              I REAR++ LG  KYYV+ V+ AI+WQ FF+G +GVI   ++LL+ +I+AVL+PV E+ 
Sbjct  252   AIQREARQYGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELF  311

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNT  244
               IF HEKF +EKG+SL L +WG  SY YG+ +  
Sbjct  312   GAIFLHEKFTSEKGVSLALCLWGLASYSYGEYREN  346



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   318 bits (814),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 255/352 (72%), Gaps = 10/352 (3%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             E +  T M+++LL L+C +L+IG   GPL++RLY++ GG  IW SSWL+T G+PV+ +PL
Sbjct  41    EPEMSTKMKKLLLILNCFMLAIGISAGPLIMRLYYIHGGKSIWLSSWLETGGWPVMILPL  100

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
             LV+Y RRRR     +    K F I       AA++G++ G  +Y Y+YG+  +PVSTSSL
Sbjct  101   LVAYFRRRR-----TDPEAKLFYIKANTFCYAAIVGLVAGSADYCYAYGVKHIPVSTSSL  155

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             I+ATQL FTA FAF+LV+QKFTAFS NAV LLT GA+VL L AG+DRPAGES   Y +GF
Sbjct  156   ILATQLAFTAVFAFILVRQKFTAFSVNAVALLTFGAIVLALHAGNDRPAGESKAQYFVGF  215

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
               T+A++AL+ L+LP+IEL+Y + K  AV++SLV+E Q+++ F  T   TVGM+ + D++
Sbjct  216   FFTLASSALFALMLPMIELTYRRVKHTAVNYSLVMEIQLVLSFSATALCTVGMLASGDYK  275

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
                RE +E++LG   Y+V+ + +AIVWQFF++GA GVI YGSSLLS +I+AV LP+TEI 
Sbjct  276   GYAREVQEYKLGNAMYFVVLIISAIVWQFFYLGAAGVIYYGSSLLSGIIIAVALPITEIA  335

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKD-----NNESSAETE  208
             A+ FYHEKF+ EKG+SL LS+WGF SYFYG+ K  KK      NN +S + E
Sbjct  336   AIFFYHEKFQVEKGVSLVLSLWGFFSYFYGEAKEMKKQKKRERNNTNSTDVE  387



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 173/326 (53%), Positives = 237/326 (73%), Gaps = 4/326 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL+R YF+ GG RIW SSWL+T G+P+   PL V Y +RRR   ++ ++     
Sbjct  33    GFCGGPLLLRQYFVXGGRRIWLSSWLETGGWPLFLFPLFVFYLQRRRRKGNQEAR---LL  89

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              + P L +A+A LG+L G+ +Y Y+YGM++LP ST++LI +TQL F A F+F++V+Q+FT
Sbjct  90    SMKPLLFVASAFLGILTGMIDYCYAYGMSRLPASTTALIGSTQLAFNAVFSFIIVRQRFT  149

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S NAVVLLT+GA+VLGL A  DRP  ES+  Y +G  MT+  AALYG +LP +EL+Y 
Sbjct  150   SYSINAVVLLTIGAIVLGLHASKDRPEKESSHQYYVGLFMTLGEAALYGFLLPXVELTYK  209

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK QA+++ LV+E QM+M    T+F TVGM++NKDF+ I REARE+ELG  KYYV+ V+
Sbjct  210   KAK-QAITYPLVMEIQMVMSIFATLFCTVGMIVNKDFQAISREAREYELGAVKYYVVLVW  268

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AI WQF+++GA+GV+   SSL+  +  AVLLPV EILAV+ + EKF AEKGI+L LS+W
Sbjct  269   CAIFWQFYYLGAIGVVFVASSLVGGITSAVLLPVLEILAVVLFREKFTAEKGIALVLSLW  328

Query  282   GFVSYFYGDIKNTKKDNNESSAETEM  205
             GF SYFYG  K  KK +     ++ +
Sbjct  329   GFTSYFYGQYKRKKKMSQTPQPDSNV  354



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 238/323 (74%), Gaps = 6/323 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GGNRIWFSS+L+TAGFPVI +PLL  Y +RRR  +  S     FF
Sbjct  16    GNCGGPLIMRLYFNNGGNRIWFSSFLETAGFPVILLPLLFFYLQRRRTDTKTS-----FF  70

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L +A+ ++GVL G DNY Y+YG+A LPVST++LI+A+QL F A F+F +VK KFT
Sbjct  71    LMKPRLLMASIIVGVLSGFDNYLYAYGLAFLPVSTAALIIASQLAFIAVFSFFMVKHKFT  130

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLT+GA VLG+   +D+P  ES+K Y++GF+M   AA +Y  ILPL+ELSY 
Sbjct  131   HFTINAVVLLTIGAAVLGMHTEADKPVEESHKQYVMGFIMAAGAAIMYAFILPLVELSYR  190

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA+ Q ++++LVLE QM++ F  +     GM    DF+ +P EA  F+LG + +Y++ +F
Sbjct  191   KAR-QPITYTLVLEVQMVLCFFASCVCIGGMYFAGDFKALPVEADNFKLGTSMFYLVVIF  249

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVI +HEKF  EK +SL LS+W
Sbjct  250   SAIIWQGFFLGAIGLIFSASSLVSGIMISVLLPITEVLAVIIFHEKFPPEKAVSLVLSLW  309

Query  282   GFVSYFYGDIKNTKKDNNESSAE  214
             GFVSYFYG++K+ K        E
Sbjct  310   GFVSYFYGEVKSEKAAKQSEEIE  332



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score =   317 bits (813),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 248/335 (74%), Gaps = 2/335 (1%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             + Q    ++R L+ L+C++L +G+ GGPLL RLYF  GG+R W +SWL+T G+P+I +PL
Sbjct  97    DPQMSKALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPL  156

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              +SY  RRR  SD    ++ FFL TP L +A A+LG+L G D++ Y+YG++ LPVSTS++
Sbjct  157   FISYLYRRRLASDHHHPTKLFFL-TPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAI  215

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             +++TQL FTA FAFL+VKQKFT +S N++ LL+VGAV+LGL   SDRP   S   YL+GF
Sbjct  216   LISTQLAFTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGF  275

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              +T+  AALYGL+LPL+EL+Y KA  Q ++++LV+E Q++MGF  T F T+GM++NKDFE
Sbjct  276   FLTLGTAALYGLVLPLVELTYRKAS-QVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFE  334

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              I REAR++ LG  KYYV+ V+ AI+WQ FF+G +GVI   ++LL+ +I+AVL+PV E+ 
Sbjct  335   AIQREARQYGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELF  394

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNT  244
               IF HEKF +EKG+SL L +WG  SY YG+ +  
Sbjct  395   GAIFLHEKFTSEKGVSLALCLWGLASYSYGEYREN  429



>emb|CDY16284.1| BnaC01g23190D [Brassica napus]
Length=377

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 245/336 (73%), Gaps = 10/336 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLYF  GG RIWFSS+LQTAG P I  PLL S+ RR+ A       +  FF
Sbjct  50    GNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPSILFPLLFSFLRRKEA------TTTPFF  103

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L +A+ ++G+L GVDNY Y+YG+A LPVSTSSL++++ L FTA FAF +VKQKFT
Sbjct  104   LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSHLAFTAFFAFFMVKQKFT  163

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F  NAVVLLT+GA +L L    D+ A E++K Y++GF MT+AAA LY  +LPL+EL+Y 
Sbjct  164   PFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFFMTLAAAILYAFVLPLVELTYK  223

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELG--VTKYYVLA  469
             KA+ Q +S++LVLE Q+++ FV T F  VGM+ + DF+ + REAR+F+LG   T YYV+ 
Sbjct  224   KAR-QRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREARDFKLGGSTTYYYVVV  282

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VFTAI+WQ FF+G++G+I   SSL+S +++  LLP+TE+LAV F+ EKF+AEK ISLFLS
Sbjct  283   VFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQAEKSISLFLS  342

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             +WGFVSYFYG IK   K       E +++  P + S
Sbjct  343   LWGFVSYFYGQIKAENKTETPDQ-EAQLSQLPVIDS  377



>gb|KCW51603.1| hypothetical protein EUGRSUZ_J01095 [Eucalyptus grandis]
Length=302

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 226/324 (70%), Gaps = 34/324 (10%)
 Frame = -1

Query  1158  IRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSI  979
             +RLYF+RG  R+W  SWL+   +P++ +PL  +Y RRR A    +    +  L+  FL  
Sbjct  1     MRLYFVRGKARMWLVSWLEMGAWPMLLLPLAAAYSRRRSAMGPAA----RLILMDRFLFA  56

Query  978   AAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavv  799
             AAA +GVL+G+DNYFY YG+ +LPVSTS+L++ATQL FTAGFAFLLV+Q FT+ S N   
Sbjct  57    AAAGIGVLMGLDNYFYVYGLGRLPVSTSALLIATQLAFTAGFAFLLVRQVFTSCSIN---  113

Query  798   lltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVS  619
                                  SN A   GF M++ AAALYG +LPL+EL+Y KAK QAV+
Sbjct  114   --------------------SSNGANYAGFFMSLGAAALYGFVLPLVELTYKKAK-QAVT  152

Query  618   FSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFF  439
             +SLVLE Q++M F  T F T+GM++NKDF+ IPREAR +ELG  +YYVL V+TAI+ QFF
Sbjct  153   YSLVLEIQLVMCFFATAFCTIGMLVNKDFQAIPREARSYELGEARYYVLLVWTAIINQFF  212

Query  438   FVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYG  259
             F+GA+GVI Y SSL SA+I+A LLPVTEILAVI + EKF+AEKG++L LS+WGF SYFYG
Sbjct  213   FLGAIGVIFYASSLFSAVIIAALLPVTEILAVICFQEKFQAEKGVALALSLWGFASYFYG  272

Query  258   DIKNTKKDNNESS------AETEM  205
             + K  KK+   ++      AETEM
Sbjct  273   EFKLVKKEKEATAGTVIKPAETEM  296



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 250/334 (75%), Gaps = 3/334 (1%)
 Frame = -1

Query  1242  QTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLV  1063
             QT   ++R L+ L+C++LS+GN GGPLL R+YF  GG+R W SSWL+T G+P+I +PL +
Sbjct  16    QTSKCLKRALVVLNCLLLSVGNTGGPLLSRVYFRHGGHRQWLSSWLETGGWPLILLPLSI  75

Query  1062  SYHRRRRA--CSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
             SY  RRR     D      K F +TP L +A A+LG+L+GVD++ Y+YG++ LPVSTS+L
Sbjct  76    SYLYRRRRRLAPDNHHHPTKLFFLTPRLFLACAVLGLLIGVDDFLYAYGLSFLPVSTSAL  135

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             ++++QL FTA FAFL+VKQKFT +S N+V LLTVGAV+LGL   SDRP   S   YL GF
Sbjct  136   LISSQLAFTASFAFLIVKQKFTPYSINSVALLTVGAVMLGLHTSSDRPDNVSEGQYLTGF  195

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              +T+  AALYGLILPL+EL+Y KA+ Q ++++LV+E Q++MGF  T   T+GM++NKDFE
Sbjct  196   FLTLGTAALYGLILPLVELTYRKAR-QVITYTLVMEMQLVMGFFATALCTIGMLVNKDFE  254

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
             VIPREAR++ LG  KYY++ V++AI+WQ FF+G +GVI   ++LL+ +I+AV +PV E+ 
Sbjct  255   VIPREARQYGLGEVKYYMVLVWSAILWQCFFLGTVGVIFCVNTLLAGIIIAVFIPVIELF  314

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKN  247
             A I  HEKF +EKG+SL L +WG  SY YG+ ++
Sbjct  315   AAILLHEKFTSEKGVSLALCLWGLASYSYGEYRD  348



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 245/333 (74%), Gaps = 7/333 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             GNCGGPL+ RLY+  GG RIW SS L+T GFP++ IPL      R+R+   DE ++    
Sbjct  16    GNCGGPLMSRLYYNNGGQRIWLSSLLETGGFPIMSIPLFFCLLDRKRKRNRDEKTR---L  72

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
              L+ P L  AAA+ G+L GVD+Y Y+YG++ LPVST+SLI+A+QL FTA FAF LVKQKF
Sbjct  73    ILMKPRLFAAAAVAGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFTAFFAFFLVKQKF  132

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             T FS NA+VLLT+GA VL L    D P  E++K Y+ GF++T+ AA LY  +LPL+ELSY
Sbjct  133   TPFSINAIVLLTLGAGVLALHTAGDVPPNETHKQYITGFLLTIGAAVLYAFVLPLVELSY  192

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
              KA  Q ++++LVLEFQ +M F  T+F   G+ I+ DF++IP EA+ F+LG T YYV+ V
Sbjct  193   KKAN-QPITYTLVLEFQFVMCFFATLFCATGLFISGDFKMIPAEAKTFKLGETLYYVVIV  251

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             F +++WQ FF+GA+GVI   SSL+S +++AVLLP+TEILAV+F+ EKF+AEKG+SL LS+
Sbjct  252   FASMMWQCFFLGAIGVIFCASSLVSGILIAVLLPLTEILAVVFFGEKFQAEKGVSLVLSL  311

Query  285   WGFVSYFYGDIKNTK--KDNNESSAETEMTSAP  193
             WGF SYFYG++K+ K  +DN  +  ET+M   P
Sbjct  312   WGFASYFYGEVKSDKERRDNERTREETDMDRVP  344



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 249/330 (75%), Gaps = 6/330 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWF S+LQT G P+IF PLL+S+ RRRR    E  ++  FF
Sbjct  18    GNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRRRC--LEEQETTPFF  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IAA ++G+LVG DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  76    LMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLT GAVVL L + SD+ A E++K Y++GF+MT+ AA LYG ILPL+ELSY 
Sbjct  136   PFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLYGFILPLVELSYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K+  Q ++++L LEFQM++ F  T    VGM+   DF+VI  EAR+F+LG + YYV+ VF
Sbjct  196   KSG-QRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVIAGEARDFKLGESLYYVVIVF  254

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TAI+WQ FFVGA+G+I   SSL+S ++V+ LLPVT ILAVI + EKF+A KG++L LS+W
Sbjct  255   TAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEKFQAGKGVALALSLW  314

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             G VSYFYG +K+ +K   +   +T+++  P
Sbjct  315   GSVSYFYGQVKSEEKTKAQ---DTQLSQLP  341



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 240/331 (73%), Gaps = 2/331 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLY+  GG  +W SS+L+T GFP++ IPLL  +  RRR     S  +    
Sbjct  16    GNCGGPLMSRLYYNNGGKSVWLSSFLETGGFPLMLIPLLFCFLNRRRNHGRNSDGNAGVI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L + AA+ G+L GVD+Y Y+YG++ LPVST+SLI+A+QL FTA FAF LVKQKFT
Sbjct  76    LMKPRLFMGAAVSGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFTAFFAFFLVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS NA+VLLT+GA VL L   SD PA E+ K Y+ GFV+TV AA LY  +LPLIELSY 
Sbjct  136   PFSINAIVLLTLGAGVLALHTASDIPANETKKQYVTGFVLTVGAAVLYAFVLPLIELSYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA+ Q +S+ +VLEFQ +M F  T+F   GM+I+ DF++IP+EA  F+LG + YYV+ V 
Sbjct  196   KAR-QTISYDVVLEFQFVMCFFATLFCFAGMLISGDFKMIPKEAETFQLGPSLYYVVLVG  254

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              +++WQ FF+GA+GVI   SSL+S +++AVLLPVTE+LAV+FYHE F +EKG+SL LS+W
Sbjct  255   ASLMWQCFFLGAIGVIFCASSLVSGILIAVLLPVTEVLAVVFYHETFSSEKGVSLVLSLW  314

Query  282   GFVSYFYGDIKNTKKDNNE-SSAETEMTSAP  193
             GF SYFYG+ K  K + +     ETEM   P
Sbjct  315   GFASYFYGEAKAGKAEKDGLIHEETEMGRLP  345



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 262/342 (77%), Gaps = 5/342 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+++LL ++CIIL++G CGGPL++RLYF++GG RIW SSWLQTA +P+ FIPL++SY  R
Sbjct  1     MKKVLLVINCIILAVGTCGGPLIMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             R+     ++ S K  L+TP + +A   +G+L G  NYFY+YG+AKLPVSTS L+ ATQL 
Sbjct  61    RKN---NNNNSSKLILMTPRVFMATIGIGILQGFTNYFYAYGVAKLPVSTSGLLFATQLA  117

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FTA FAFL+VK KFT +S N+V LLT+GAVVL LR+G D+P GE  K Y+LGF MT+A+A
Sbjct  118   FTAFFAFLIVKLKFTPYSVNSVFLLTIGAVVLALRSGGDQPEGEXKKKYVLGFGMTLASA  177

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             AL GLI PL+EL Y KA+ Q ++++ VLEFQ +  FV T+ +T+GM+IN+DF+ I RE +
Sbjct  178   ALTGLIFPLVELIYKKAQ-QTITYTFVLEFQTLYCFVATVLATIGMIINEDFQAISREVK  236

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              FELG  KYY++ +++AI+ QF+F+G++GVI   SSL+S ++++VLLP+TE+LAV  Y E
Sbjct  237   TFELGEDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVSGILISVLLPITEVLAVFLYGE  296

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKN-TKKDNNESSAETEM  205
             KF AEKG+SL LS+WGF SYFYGD +     +NN  S  TEM
Sbjct  297   KFNAEKGVSLALSLWGFASYFYGDYRGNNNTENNNQSPTTEM  338



>ref|XP_004237962.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=355

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 239/330 (72%), Gaps = 9/330 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL+ RLYFL GG RIW SSWL   G+P++ I L+++Y  R +    +++    FF
Sbjct  23    GYCGGPLISRLYFLHGGQRIWLSSWLACIGWPIVLIVLVIAYFYRLKTQGSDTN----FF  78

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              IT     ++A LG+LVG+  Y Y++G AKLPVSTS++I A QL FT  FAFL+VKQK T
Sbjct  79    CITRQEFTSSAALGILVGLAGYLYAWGPAKLPVSTSTVIYAAQLGFTVVFAFLIVKQKLT  138

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S NAVVLL VGA  L LRA SDRP GES K Y+LGFVMT+ AAA  GL LPL+EL Y+
Sbjct  139   SYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLAAASTGLALPLLELIYI  198

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK + V++ ++LE QMI+    + F TVGM++NKDF+VI REAREFELG  KYY++ ++
Sbjct  199   KAK-KDVTYIMILEIQMILNIFASAFCTVGMIVNKDFQVISREAREFELGKAKYYLVLIW  257

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQ   +G +GV+ YGSSLL  +++A+LLP+TE+L V+ YHE FE  KG+++FLS+W
Sbjct  258   SAIIWQLSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVVLYHETFEVTKGLAIFLSLW  317

Query  282   GFVSYFYGDIKNTKKDNNESSA----ETEM  205
             GFVSYFYG++K   K   E       +TEM
Sbjct  318   GFVSYFYGEMKQNHKKKREEEENPIPQTEM  347



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 235/322 (73%), Gaps = 4/322 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+  GPLL+R  FL GG R W SS LQ AG+P++  PL  S+  RRR+  D SS +   F
Sbjct  4     GSAFGPLLLRASFLHGGPRKWLSSLLQPAGWPLLLAPLSASFLSRRRSNKDGSSAT-PLF  62

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L++P L  A   +G+  G+D+  Y+YG+A LPVSTSS++++TQL FTA FA LLV+Q+FT
Sbjct  63    LMSPRLLAATVAVGLRTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFT  122

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             AFS NAVVLL+VGA +LG+ AG DRPAG +   Y  GF MT+ AAALYGL+LP++ELS  
Sbjct  123   AFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRAQYYAGFGMTLGAAALYGLMLPVMELSQA  182

Query  642   KAKLQ---AVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVL  472
             +   +   AV++ LV+E Q+++GF  T FS +GM++N DF  IPREAREF LG   YY+L
Sbjct  183   RHAARTGAAVTYILVMEMQIVIGFTATAFSAIGMLVNNDFHAIPREAREFGLGQIGYYLL  242

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
                +AIV+QFFF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KG++L L
Sbjct  243   LAASAIVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKGVALAL  302

Query  291   SIWGFVSYFYGDIKNTKKDNNE  226
             S+WGFVSY YG+I+   +D+++
Sbjct  303   SLWGFVSYLYGEIRAKAQDSDK  324



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 239/334 (72%), Gaps = 5/334 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGP++ RLYFL GG RIW SSWL   G+P+I I L+++Y  R +    + +    F 
Sbjct  23    GYCGGPVISRLYFLHGGQRIWLSSWLACIGWPIILIVLIIAYFYRLKTQGSDIN----FL  78

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              IT     ++A LG+LVG+  Y Y++G AKLPVSTS++I A QL FT  FAFL+VKQK T
Sbjct  79    CITLQEFTSSAALGILVGLAGYLYTWGPAKLPVSTSTVIYAAQLGFTVIFAFLIVKQKLT  138

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAVVLL VGA  L LRA SDRP GES K Y+LGFVMT+ AAA  GL LPL+EL Y+
Sbjct  139   AYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLAAASTGLALPLLELIYI  198

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             +AK + V++ ++LE QMI+    + F TVGM++NKDF+ I REA +FELG  KYY++ V+
Sbjct  199   RAK-KNVTYIMILEIQMILNIFASAFCTVGMIVNKDFQAISREASQFELGKAKYYLVLVW  257

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI+WQF  +G +GV+ YGSSLL  +++A+LLP+TE+L VI YHE F+  KG+++FLS+W
Sbjct  258   SAIIWQFSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVILYHETFQVTKGLAIFLSLW  317

Query  282   GFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             GFVSYFYG++K +KK       +TEM     + S
Sbjct  318   GFVSYFYGEMKQSKKKEESPIPQTEMVQTSPLIS  351



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 246/345 (71%), Gaps = 3/345 (1%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
             T+R  LL ++ +++ +G+ GGPL +R YFL GG R W S+ LQTAGFP++ +PL VS+ R
Sbjct  38    TLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFSR  97

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RRR   D +     FFL+TP L  A+A +G++ G+D+  Y+YG+A LPVSTSS++++TQL
Sbjct  98    RRRRRDDGAPAKAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSILISTQL  157

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTA FA LLV+Q+FTAFS NAV LL+ GA +LG+ AG DRPAG S   Y  GF MT+ A
Sbjct  158   AFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGFAMTLGA  217

Query  690   AALYGLILPLIELS---YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIP  520
             AALYGL+LP +ELS          AV+++LV+E Q+++G   T+FS VGM+ N D   IP
Sbjct  218   AALYGLLLPAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANHDLHAIP  277

Query  519   REAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVI  340
              EAREF+LG + YY+L   +A  +Q FF+G +G + +GS+LL+ +++ VL+PVTE+LAV+
Sbjct  278   GEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVTEVLAVV  337

Query  339   FYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
             F+HE F   KG++L LS+WGFVSYFYG+++ +K  ++     T +
Sbjct  338   FFHEPFNGTKGVALALSLWGFVSYFYGEVQTSKAHHHLPDKPTNV  382



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 235/318 (74%), Gaps = 8/318 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKS----  1015
             G+  GPLL+R YFLRGGNR W SS LQTAG+P++  PL  SY  RRR    E   +    
Sbjct  48    GSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRRRRREVEDDGAGAGA  107

Query  1014  --RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLL  841
                  FL+TP L +A+A++G++ GVD+  Y+YG+A LPVSTSS++++TQL FTA FA LL
Sbjct  108   AATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLL  167

Query  840   VKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPL  661
             V+Q+FTAFS NAVVLL+VGA +LG+ AG DRPAG S   Y  GF MT+AAAALYGL+LP+
Sbjct  168   VRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAMTLAAAALYGLVLPV  227

Query  660   IELS--YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVT  487
             +ELS  +  A   AV+++LV+E Q+++GFV T FS VGM++N DF  IP EA EF LG  
Sbjct  228   MELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIPGEAHEFGLGQA  287

Query  486   KYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKG  307
              YY+L   +A ++Q FF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KG
Sbjct  288   GYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKG  347

Query  306   ISLFLSIWGFVSYFYGDI  253
             ++L LS+WGFVSYFYG++
Sbjct  348   VALALSLWGFVSYFYGEV  365



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 235/318 (74%), Gaps = 8/318 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKS----  1015
             G+  GPLL+R YFLRGGNR W SS LQTAG+P++  PL  SY  RRR    E   +    
Sbjct  50    GSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRRRRREVEDDGAGAGA  109

Query  1014  --RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLL  841
                  FL+TP L +A+A++G++ GVD+  Y+YG+A LPVSTSS++++TQL FTA FA LL
Sbjct  110   AATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLL  169

Query  840   VKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPL  661
             V+Q+FTAFS NAVVLL+VGA +LG+ AG DRPAG S   Y  GF MT+AAAALYGL+LP+
Sbjct  170   VRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAMTLAAAALYGLVLPV  229

Query  660   IELS--YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVT  487
             +ELS  +  A   AV+++LV+E Q+++GFV T FS VGM++N DF  IP EA EF LG  
Sbjct  230   MELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIPGEAHEFGLGQA  289

Query  486   KYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKG  307
              YY+L   +A ++Q FF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KG
Sbjct  290   GYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKG  349

Query  306   ISLFLSIWGFVSYFYGDI  253
             ++L LS+WGFVSYFYG++
Sbjct  350   VALALSLWGFVSYFYGEV  367



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 251/353 (71%), Gaps = 12/353 (3%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
              M R L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+T G+P++ +P+ +S+  
Sbjct  18    AMHRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLLVPVALSF--  75

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
                       ++    L  P + +AA  LGV  GVD++ Y+YG+A LPVSTS+++++TQL
Sbjct  76    ---VARRARDRAAPVLLTPPRILLAAVALGVATGVDDFIYAYGLAYLPVSTSAILISTQL  132

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRP G +   Y LGF +T+ A
Sbjct  133   AFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFTLTLGA  192

Query  690   AALYGLILPLIELSYLKAKL---QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIP  520
             AALYGL+LPL+EL+Y +A     +AVS++LV+E Q++MGF  T F TVGM++NKDF+ IP
Sbjct  193   AALYGLVLPLVELAYKRAAAGGGRAVSYALVVEMQLVMGFFATAFCTVGMIVNKDFQAIP  252

Query  519   REAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVI  340
             REAR++ELG  +YY + V++A++WQ FF+GA+GVI    +LL+ +++AV +PVTE+ AVI
Sbjct  253   REARQYELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVI  312

Query  339   FYHEKFEAEKGISLFLSIWGFVSYFYGDI----KNTKKDNNESSAETEMTSAP  193
             F HEKF +EKG++L LS+WG  SY YG+     K  KK  + ++ E +  +AP
Sbjct  313   FLHEKFSSEKGVALVLSLWGLASYSYGEWSQARKAKKKREHAAAVEAQQPAAP  365



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 231/310 (75%), Gaps = 7/310 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGP+L RLYF +GG+R W S+WL+TAG+P++ +P+  SYH RR        +    F
Sbjct  38    GTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYHSRR-----ARDRGAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A A+LGVL G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+ T
Sbjct  93    LTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAV LLT+GAVVLGL A  DRPAG +   Y +GF +T+ AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYK  212

Query  642   KAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              A    +AV+++LV+E Q++MGF  T F TVG+++NKDF+ IPREA+++ELG  +YYV+ 
Sbjct  213   HAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVL  272

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VF A++W+FFFVGA+GVI    +LL+ +I+AV +P+TE+L VIF HEKF +EKG++L LS
Sbjct  273   VFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLS  332

Query  288   IWGFVSYFYG  259
             +WG  SY YG
Sbjct  333   LWGLASYSYG  342



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 233/325 (72%), Gaps = 3/325 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G+  GPLL+R YFLRGG R   S+ L  AG+P++ +PL  SY  RRRR   D  + +   
Sbjct  45    GSACGPLLLRAYFLRGGRRKGLSTLLPPAGWPLLLVPLCFSYCSRRRREEEDGGAATTPL  104

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             FL+TP L  A+A +G++ G+D+  Y+YG+A LPVSTSS++++TQL FTA FA LLV+Q+F
Sbjct  105   FLMTPRLLAASATVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRF  164

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
             TAFS NAVVLL+VGA +LG+  G DRPAG S   Y  GF MT+ AAALYGL+LP++ELS 
Sbjct  165   TAFSVNAVVLLSVGAAMLGMNTGGDRPAGVSRAQYYAGFAMTLGAAALYGLVLPVMELSQ  224

Query  645   LK--AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVL  472
              +  A   AV+++LV+E Q+++GFV T FS VGM++N DF  IP EA+ F LG   YY+L
Sbjct  225   ARHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIPGEAQGFGLGQAGYYLL  284

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
                +A ++Q FF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KG++L L
Sbjct  285   LAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKGVALAL  344

Query  291   SIWGFVSYFYGDIKNTKKDNNESSA  217
             S+WGFVSYFYG+++      +   A
Sbjct  345   SLWGFVSYFYGEVRAKAARPHSGEA  369



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 243/329 (74%), Gaps = 7/329 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R+L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+T G+P++ +P+  SY RR
Sbjct  22    MQRLLVALNCGMLTLGTTGGPLLSRLYFSKGGHRKWLSAWLETGGWPLLLLPVAASYLRR  81

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             R         S    L  P + +AAA LG+  G D++ Y+YG++ +PVSTS+++++TQL 
Sbjct  82    R-----AQDPSAPVVLAPPRILVAAAGLGLATGADDFLYAYGLSFVPVSTSAILISTQLA  136

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRPAG +   Y LGF++T+ +A
Sbjct  137   FTVLFAFLIVRQRLTALSVNAVALLTVGAVVLGLHVSSDRPAGVTRGQYWLGFLLTLGSA  196

Query  687   ALYGLILPLIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPRE  514
             ALYGL+LPLIEL+Y +A    + V+++LV+E Q++MGF  T F TVGM++N DF+ + RE
Sbjct  197   ALYGLVLPLIELTYKRAAGGGRVVTYALVMEMQLVMGFFATAFCTVGMIVNNDFQAMARE  256

Query  513   AREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFY  334
             AR FELG  +YY + V++AI+WQFFF+GA+GVI    +L + +++AV +PVTE+LAVIF 
Sbjct  257   ARAFELGEARYYTVLVWSAILWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLAVIFL  316

Query  333   HEKFEAEKGISLFLSIWGFVSYFYGDIKN  247
             HEKF +EKG++L LS+WG  SY YG+  +
Sbjct  317   HEKFSSEKGVALVLSLWGLASYSYGEYSD  345



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 236/327 (72%), Gaps = 9/327 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL +R YFL GG R W S++LQTAGFP++ +PL VS+ RR++A          FF
Sbjct  48    GTAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLVPLCVSFSRRKKAAGGT-----PFF  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A+A +G++ G+D+  Y+YG+A LPVSTSS++++TQL FTA FA LLV+Q+FT
Sbjct  103   LMTPRLLVASAGIGLMTGLDDLLYTYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFT  162

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A S NAVVLL+VGA +LG+ AG DRPAG S   Y  GF MT+ AAAL+GL+LP++ELS  
Sbjct  163   ASSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYSAGFAMTLGAAALFGLVLPVMELSQA  222

Query  642   KAKLQA----VSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYV  475
             +   +     V+++LV+E Q+++G   TIF+ VGM++N DF  IP EAR+F  G + YY+
Sbjct  223   RHAARPGAAPVTYTLVIEMQLVIGLTATIFTAVGMLVNNDFHAIPEEARQFGFGRSGYYL  282

Query  474   LAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLF  295
             L   +A  +Q FF+G +G I +GS+LL+ +I+ VL+PVTE+LAV+ + E F   KG++L 
Sbjct  283   LLAGSAATYQCFFLGTIGAIFFGSALLAGVIMTVLIPVTEVLAVMLFSEPFNGTKGVALA  342

Query  294   LSIWGFVSYFYGDIKNTKKDNNESSAE  214
             LS+WGFVSYFYG+++ +K ++    ++
Sbjct  343   LSLWGFVSYFYGEVQTSKANHQSDDSD  369



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 176/341 (52%), Positives = 247/341 (72%), Gaps = 8/341 (2%)
 Frame = -1

Query  1269  DLKALKMEGQTR-TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAG  1093
             D++A K     R   +RR L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+T G
Sbjct  2     DVEARKDAAPARGKAVRRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGG  61

Query  1092  FPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAK  913
             +P++ +P+  S+  RR        +     L  P + +AAA LGV  GVD++ Y+YG+A 
Sbjct  62    WPLLLVPVAASFGARR-----ARDRGAPVLLTPPRILLAAAGLGVATGVDDFVYAYGLAY  116

Query  912   LPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGES  733
             LPVSTS+++++TQL FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRP G +
Sbjct  117   LPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVT  176

Query  732   NKAYLLGFVMTVAAAALYGLILPLIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFST  559
                Y LGF +T+ AAALYGL+LPL+EL+Y +A    +AV+++LV+E Q++MGF  T F T
Sbjct  177   RGRYWLGFSLTLCAAALYGLVLPLVELAYRRAAGGGRAVTYALVVEMQLVMGFFATAFCT  236

Query  558   VGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliv  379
             VGMV+NKDF+ IPREAR++ELG  +YY++  + A++WQ FF+GA+GVI    +LL+ +++
Sbjct  237   VGMVVNKDFQAIPREARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILI  296

Query  378   avlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGD  256
             AV +PVTE+ AVIF HEKF +EKG++L LS+WG  SY YG+
Sbjct  297   AVFIPVTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGE  337



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 249/341 (73%), Gaps = 17/341 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWF S+LQT G P+IF PLL+S+ RRRR    E  ++  FF
Sbjct  18    GNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRRR--CLEEQETTPFF  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IAA ++G+LVG DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  76    LMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLT GAVVL L + SD+ A E++K Y++GF+MT+ AA LYG ILPL+ELSY 
Sbjct  136   PFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLYGFILPLVELSYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE-----------VIPREAREFEL  496
             K+  Q ++++L LEFQM++ F  T    VGM+   DF+           VI  EAR+F+L
Sbjct  196   KSG-QRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFKNRVIAGEARDFKL  254

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G + YYV+ VFTAI+WQ FFVGA+G+I   SSL+S ++V+ LLPVT ILAVI + EKF+A
Sbjct  255   GESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEKFQA  314

Query  315   EKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
              KG++L LS+WG VSYFYG +K+ +K   +   +T+++  P
Sbjct  315   GKGVALALSLWGSVSYFYGQVKSEEKTKAQ---DTQLSQLP  352



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 249/341 (73%), Gaps = 17/341 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG RIWF S+LQT G P+IF PLL+S+ RRRR    E  ++  FF
Sbjct  16    GNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRRR--CLEEQETTPFF  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IAA ++G+LVG DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  74    LMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLT GAVVL L + SD+ A E++K Y++GF+MT+ AA LYG ILPL+ELSY 
Sbjct  134   PFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLYGFILPLVELSYK  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE-----------VIPREAREFEL  496
             K+  Q ++++L LEFQM++ F  T    VGM+   DF+           VI  EAR+F+L
Sbjct  194   KSG-QRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFKNRVIAGEARDFKL  252

Query  495   GVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEA  316
             G + YYV+ VFTAI+WQ FFVGA+G+I   SSL+S ++V+ LLPVT ILAVI + EKF+A
Sbjct  253   GESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEKFQA  312

Query  315   EKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
              KG++L LS+WG VSYFYG +K+ +K   +   +T+++  P
Sbjct  313   GKGVALALSLWGSVSYFYGQVKSEEKTKAQ---DTQLSQLP  350



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 261/354 (74%), Gaps = 8/354 (2%)
 Frame = -1

Query  1242  QTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLV  1063
             Q    +RR L+ ++C++++IGN GGPLL+RLYF  GG R W S WL+T G+P+IF+PLLV
Sbjct  18    QMNKGLRRALIAVNCVLMAIGNAGGPLLLRLYFHSGGKRQWLSGWLETGGWPIIFLPLLV  77

Query  1062  SYHRRRRACSDES----SKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTS  895
             SY  RRR              K FLIT  L +  A LG+L+G+D++ Y+YG++ LPVSTS
Sbjct  78    SYLHRRRRLLRGHGHRHQPPTKLFLITRPLFLYCAALGLLLGLDDFLYAYGLSFLPVSTS  137

Query  894   SLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLL  715
             +L+++ QLVFTA FAF+LVKQKFT +S N+VVLLTVGAV+LGL   SDRP   +   Y +
Sbjct  138   ALLISAQLVFTAFFAFVLVKQKFTPYSINSVVLLTVGAVMLGLHVSSDRPNNVTRGEYYM  197

Query  714   GFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKD  535
             GFV+T+ AAA+YGL LPL+EL+Y KAK QA++++LV+E QM+MGF  T F TVGM++NKD
Sbjct  198   GFVLTLGAAAVYGLFLPLVELTYTKAK-QAITYTLVMEMQMVMGFFATAFCTVGMLVNKD  256

Query  534   FEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTE  355
             F+ IPREA+ +E G  +YYV+ V+ AI+WQF F+G +GVI   ++LL+ +++AV +PVTE
Sbjct  257   FQAIPREAKHYEQGEFRYYVVLVWCAILWQFLFLGTVGVIFCVNTLLAGVLIAVFIPVTE  316

Query  354   ILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             + AVIF+ EKF +EKG++L LS+WG  SY YG+ +  K+  N ++   +++S P
Sbjct  317   VFAVIFFKEKFGSEKGVALALSLWGLASYSYGEYREGKRSQNTAA---DLSSQP  367



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 224/325 (69%), Gaps = 9/325 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   GPLL+RLYFL GGNR W  SWL+TAG P +  PL V Y R R       +   +F 
Sbjct  50    GTIAGPLLLRLYFLHGGNRKWIPSWLETAGVPALLGPLTVLYLRER-------ASGVRFL  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
               T  L ++A + G+L G++N+ YS G++ LPVSTSSL+++TQL FTA FAFL+ KQKFT
Sbjct  103   APTKLLLLSAGI-GLLAGLNNFMYSLGLSFLPVSTSSLLLSTQLAFTAFFAFLIAKQKFT  161

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +STNAVVL+T+GAV+LGL    DRP G SNK YLLGF++T+ AA L G ILP  E+SY 
Sbjct  162   PYSTNAVVLMTLGAVLLGLTKSGDRPPGVSNKDYLLGFILTLGAAGLLGFILPCCEVSYA  221

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
              A+ + +++S+VL+FQ  + F  T+F T+GM+INKDF+ IPREA  FELG  KYY++ V 
Sbjct  222   TAR-KTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREANAFELGAVKYYMVLVS  280

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AIVWQ   VG LGV+   +SL + ++ A LLP+TEI AVI YHEKF  EKG++L L  W
Sbjct  281   IAIVWQMAVVGLLGVVFCTTSLFAGVLNATLLPLTEIAAVIVYHEKFTGEKGMALALCSW  340

Query  282   GFVSYFYGDIKNTKKDNNESSAETE  208
             GF+SYFYG  K  KK    S  E+ 
Sbjct  341   GFISYFYGSYKENKKQKALSETESR  365



>ref|XP_010234593.1| PREDICTED: purine permease 3-like isoform X1 [Brachypodium distachyon]
Length=375

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 229/327 (70%), Gaps = 3/327 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G   GPLL+R YF+ GG R W SS LQTAG+P++ +PL  S+  RRRR   D  S    F
Sbjct  46    GTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRHLQDHGSSCELF  105

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             F+ TP L  A+  +GV+ GVDN+FY+YG A LPVSTSS++++TQLVFTA FA LLV+Q+F
Sbjct  106   FM-TPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAAFALLLVRQRF  164

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
              A + NAVVLLTVGA +LG+ AG DRPAG S   Y  GF M + AAALYGL+LP +ELS 
Sbjct  165   AAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYGLLLPAMELSQ  224

Query  645   LK-AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              + A   AV+++LV+E Q+++G   + F  +GM+INKDF+ I  EARE ELG   YY+L 
Sbjct  225   ARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQGISGEARESELGEAGYYLLL  284

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
               TA V+Q F +G +G I YGS+LL+ +I+ V +PV+E+LAVIF+HE F   KGI+L LS
Sbjct  285   AGTAAVYQCFCLGTIGAIFYGSALLAGVIITVFIPVSEVLAVIFFHEPFSPTKGIALGLS  344

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETE  208
             +WG +SYFYGD++  +   +     TE
Sbjct  345   LWGLISYFYGDVRTKQALQSGKHLHTE  371



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   299 bits (765),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 234/322 (73%), Gaps = 4/322 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+  GPLL+R YFL GG R W SS LQTAG+P++  PL  S+  RRR+  D  S +   F
Sbjct  48    GSAFGPLLLRAYFLHGGTRKWLSSLLQTAGWPLLLAPLGASFLSRRRSNKDGGSAT-PLF  106

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L++P L  A   +G++ G+D+  Y+YG+A LPVSTSS++++TQL FTA FA LLV+Q+FT
Sbjct  107   LMSPRLLAATVAVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFT  166

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             AFS NAVVLL+VGA +LG+ AG DRPAG +   Y  GF MT+ AA +YG++LP++ELS  
Sbjct  167   AFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRPQYYAGFGMTLGAALIYGIVLPVMELSQA  226

Query  642   KAKLQ---AVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVL  472
             +   +   AV+++LV+E Q+++GF  T FS VGM++N DF  I  EAREF LG + YY+L
Sbjct  227   RHAARTGAAVTYTLVMEMQIVIGFTATAFSAVGMLVNNDFHAIRGEAREFGLGQSGYYLL  286

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
                +A V+QFFF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KG++L L
Sbjct  287   LAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKGVALAL  346

Query  291   SIWGFVSYFYGDIKNTKKDNNE  226
             S+WGFVSY YG+++   K +++
Sbjct  347   SLWGFVSYLYGEVRAKAKQSDK  368



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 229/310 (74%), Gaps = 7/310 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL+ RLYF +GG+R W S+WLQTAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR-----ARDRRAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A   LG L G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+FT
Sbjct  93    LTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAV LLT+GAVVLGL A  DRPAG ++  Y +GF +T+ AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYGLILPLVELAYK  212

Query  642   KAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              A    +AV+++LV+E Q++MGF  T F TVGMV+NKDF+ IPREA+++ELG  +YYV+ 
Sbjct  213   HAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQAIPREAKQYELGEARYYVVL  272

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VF A++W+FFFVGA+GVI    +LL+ +I+AV +P+TE+L VIF HEKF +EKG++L LS
Sbjct  273   VFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLS  332

Query  288   IWGFVSYFYG  259
             +WG  SY YG
Sbjct  333   LWGLASYSYG  342



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGP+L RLYF +GG+R W S+WL+TAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYLSRR-----ARDRGAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A A+LGVL G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+ T
Sbjct  93    LTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAV LLT+GAVVLGL A  DRPAG +   Y +GF +T+ AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYK  212

Query  642   KAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              A    +AV+++LV+E Q++MGF  T F TVG+++NKDF+ IPREA+++ELG  +YYV+ 
Sbjct  213   HAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVL  272

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             VF A++W+FFFVGA+GVI    +LL+ +I+AV +P+TE+L VIF HEKF +EKG++L LS
Sbjct  273   VFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLS  332

Query  288   IWGFVSYFYG  259
             +WG  SY YG
Sbjct  333   LWGLASYSYG  342



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 246/348 (71%), Gaps = 8/348 (2%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
              + G TRT +R  LL ++ +++ +G+ GGPL +R YFL GG R W S+ LQTAGFP++ +
Sbjct  14    HVAGTTRT-LRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLV  72

Query  1074  PLLVSYHRRRRAC----SDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLP  907
             PL VS+ RRRR       D +     FFL+TP L  A+A +G++ G+D+  Y+YG+A LP
Sbjct  73    PLCVSFSRRRRRRPRRPDDGAPAMAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLP  132

Query  906   VSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNK  727
             VSTSS++++TQL FTA FA LLV+Q+FTAFS NAV LL+ GA +LG+ AG DRPAG S  
Sbjct  133   VSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPA  192

Query  726   AYLLGFVMTVAAAALYGLILPLIELS---YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTV  556
              Y  GF MT+ AAALYGL+L  +ELS          AV+++LV+E Q+++G   T+FS V
Sbjct  193   QYGAGFAMTLGAAALYGLLLHAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAV  252

Query  555   GMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliva  376
             GM+ N D   IP EAREF+LG + YY+L   +A  +Q FF+G +G + +GS+LL+ +++ 
Sbjct  253   GMLANHDLHAIPGEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMT  312

Query  375   vlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDN  232
             VL+PVTE+LAV+F+HE F   KG++L LS+WGFVSYFYG+++ +K  +
Sbjct  313   VLIPVTEVLAVVFFHEPFNGTKGVALALSLWGFVSYFYGEVQTSKAHH  360



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 252/346 (73%), Gaps = 8/346 (2%)
 Frame = -1

Query  1269  DLKALKMEGQTR-TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAG  1093
             D++A K     R   MRR+L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+TAG
Sbjct  2     DVEARKDAAPARGKAMRRLLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETAG  61

Query  1092  FPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAK  913
             +P++ +P++ +Y            ++    L  P + +AA  LGV  GVD++ Y+YG++ 
Sbjct  62    WPLLLVPVVAAY-----VARRARDRAAPALLTPPRILLAAVGLGVATGVDDFIYAYGLSY  116

Query  912   LPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGES  733
             LPVSTS+++++TQL FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRP G +
Sbjct  117   LPVSTSAILISTQLAFTVLFAFLIVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVT  176

Query  732   NKAYLLGFVMTVAAAALYGLILPLIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFST  559
                Y LGF++T+ AAALYGL+LPL+EL+Y +A    +AV+++LV+E Q++MGF  T F T
Sbjct  177   RGQYWLGFILTLGAAALYGLVLPLVELAYRRAAGGGRAVTYALVIEMQLVMGFFATAFCT  236

Query  558   VGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsaliv  379
             VGM++NKDF+ IPREA+ FELG  +YY + V++A++WQ FF+GA+GVI    +LL+ +++
Sbjct  237   VGMIVNKDFQAIPREAKHFELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILI  296

Query  378   avlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTK  241
             AV +PVTE+ AVIF HEKF +EKG++L LS+WG  SY YG+  +++
Sbjct  297   AVFIPVTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEWSDSR  342



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 238/327 (73%), Gaps = 5/327 (2%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
             TMRR+L+  +C++L++G  GG LL RLYF +GG+R W S WLQT G+P++  P+  SY R
Sbjct  16    TMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLLPPVAASYVR  75

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RR   +   S         P + +AAA LG++ GVDN  Y++G+  LPVSTS+++++TQL
Sbjct  76    RR---ARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAILISTQL  132

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FT  FAFL+V+Q+ T  + NAV LLTVGAVVLGL   SDRPAG +   Y LGF +T+ A
Sbjct  133   AFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGFTLTLGA  192

Query  690   AALYGLILPLIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             A LYGL LPL+EL+Y  A    +AV+++LV+E Q++MGFV T F TVGM++NKDF+ IPR
Sbjct  193   AVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKDFQAIPR  252

Query  516   EAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIF  337
             EAR++ELG  +YY++  + A++WQ FF+GA+GVI    +LL+ +++AV +PVTE+ AVIF
Sbjct  253   EARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIF  312

Query  336   YHEKFEAEKGISLFLSIWGFVSYFYGD  256
              HEKF +EKG++L LS+WG  SY YG+
Sbjct  313   LHEKFSSEKGVALALSLWGLASYSYGE  339



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 206/254 (81%), Gaps = 1/254 (0%)
 Frame = -1

Query  981  IAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNav  802
            IA A +G+L G D+YFY YG A+LPVSTS++I+ATQL FTA FAFLLVKQKFTA+S NA+
Sbjct  7    IATACIGLLTGSDDYFYGYGAARLPVSTSAIIIATQLAFTALFAFLLVKQKFTAYSVNAI  66

Query  801  vlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAV  622
            VLLTVG+ VLGL A SDRP GESNK Y+LGF+M +AAAALYGLILP++ L Y+KAK Q +
Sbjct  67   VLLTVGSAVLGLHASSDRPKGESNKMYVLGFLMMLAAAALYGLILPMVGLMYMKAK-QPI  125

Query  621  SFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQF  442
            +++LVLE Q++M F  T F TVGM+IN DF+ I REARE+ELG TKYY++ V  AIV Q 
Sbjct  126  TYTLVLEIQLVMCFFATAFCTVGMLINNDFQAISREAREYELGETKYYIVLVSCAIVSQC  185

Query  441  FFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFY  262
            FF+GA+GVI   SSLLS +++AVLLPVTEILAVIF++EKF+AEK ++L LS+WGFVSYFY
Sbjct  186  FFMGAIGVIFCASSLLSGIMIAVLLPVTEILAVIFFNEKFQAEKAVALVLSLWGFVSYFY  245

Query  261  GDIKNTKKDNNESS  220
            GDI  TK +     
Sbjct  246  GDISKTKLEEERKD  259



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 238/335 (71%), Gaps = 12/335 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL---LVSYHRRRRACSDESSKSR  1012
             G+  GPLL+R YFL GGNR W SS LQTAG+P++   L    VS  RRR+A   + + + 
Sbjct  61    GSACGPLLLRAYFLHGGNRKWLSSLLQTAGWPLLLPALGFSFVSRRRRRKAT--KGATAA  118

Query  1011  KFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQ  832
               FL++P L  A   +G + G+D+  Y+YG+A LPVSTSS++++TQLVFTA FA LLV+Q
Sbjct  119   PLFLMSPRLLAATVAVGFMTGLDDLLYAYGLAYLPVSTSSILISTQLVFTAAFALLLVRQ  178

Query  831   KFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIEL  652
             +FTAFS NAVVLL+VGA +LG+ AG DRPAG +   Y+ GF MT+ AAALYGL+LP++EL
Sbjct  179   RFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTKGQYVAGFAMTLGAAALYGLVLPVMEL  238

Query  651   SYLKAKLQ---AVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKY  481
             S  +   +    V+++LV+E Q ++G   T FS VGM++N DF+ IP EAREF LG   Y
Sbjct  239   SQARHAARYGRPVTYALVMEMQAVIGLTATAFSAVGMLVNNDFQAIPGEAREFGLGQVGY  298

Query  480   YVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGIS  301
             Y+L   +A V+QFFF+G +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   KGI+
Sbjct  299   YLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFNGTKGIA  358

Query  300   LFLSIWGFVSYFYGDIK----NTKKDNNESSAETE  208
             L LS+WGFVSY YG+++     ++ D   ++  TE
Sbjct  359   LALSLWGFVSYLYGEVRAKAHKSESDKPPNTVHTE  393



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 245/354 (69%), Gaps = 10/354 (3%)
 Frame = -1

Query  1269  DLKALKMEGQTR--TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTA  1096
             D++A K +        M R L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+T 
Sbjct  2     DVEARKSDAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETG  61

Query  1095  GFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMA  916
             G+P++ IP+  S+  RR        +     L  P + +AAA LGV  G D++ Y++G+A
Sbjct  62    GWPLLVIPVAASFVARR-----ARDRGAPVLLAPPRILLAAAGLGVATGADDFIYAFGLA  116

Query  915   KLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGE  736
              LPVSTS+++++TQL FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRP G 
Sbjct  117   YLPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGV  176

Query  735   SNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQA---VSFSLVLEFQMIMGFVGTIF  565
             +   Y LGFV+T+ AAALYGL+LPL+EL+Y +A       V+++LV+E Q++MGF  T F
Sbjct  177   TRGQYWLGFVLTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAF  236

Query  564   STVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsal  385
              TVGMV+NKDF+ IPREAR ++LG  +YY +  ++A++WQ FF+GA+GVI    +LL+ +
Sbjct  237   CTVGMVVNKDFQAIPREARRYKLGEARYYAVLAWSAVLWQCFFLGAVGVIFCVHTLLAGI  296

Query  384   ivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNES  223
             ++AV +PVTE+ AVIF  E+F +EKG++L LS+WG  SY YG+    +    ++
Sbjct  297   LIAVFIPVTEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEWSEARAKKRKT  350



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 233/318 (73%), Gaps = 5/318 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  G PL+ RLYF+ GG R W ++W+QTA FP++ IPL +S   +  +     S+ R+  
Sbjct  35    GASGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLS---KISSTKTSQSQRRQSH  91

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L  P L++ +A +G+L+G+D+Y Y++G++ LP+STS+L+V+TQL FTA FAFL+V Q+FT
Sbjct  92    LTFP-LALQSASIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFT  150

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAVVLL++G+V+LG+RA SDRP G +   Y LGFV+T+ AAAL GL+ PLIEL Y+
Sbjct  151   AHTINAVVLLSLGSVLLGIRASSDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYV  210

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K+K Q V+F LV+E  ++M  V T F T+GMVINKDF+VI RE++EF LG  KY++  V 
Sbjct  211   KSK-QIVTFGLVMEMLLVMSVVATGFCTIGMVINKDFQVISRESKEFGLGEFKYHLTVVA  269

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             + I+WQ F +G+   I Y SSLL+ +++AV LP+T ILAVIF+HEKF AEKG++L L +W
Sbjct  270   SGILWQVFLIGSFSFILYTSSLLNGILLAVQLPLTSILAVIFFHEKFSAEKGMALVLCLW  329

Query  282   GFVSYFYGDIKNTKKDNN  229
             GF SY+YG+   +KK   
Sbjct  330   GFASYYYGEHIQSKKREE  347



>ref|XP_010234594.1| PREDICTED: purine permease 3-like isoform X2 [Brachypodium distachyon]
Length=375

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 236/334 (71%), Gaps = 6/334 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HRRRRACSDESSKSRKF  1006
             G   GPLL+R YF+ GG R W SS LQTAG+P++ +PL  S+  RRRR   D  S    F
Sbjct  46    GTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRHLQDHGSSCELF  105

Query  1005  FLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKF  826
             F+ TP L  A+  +GV+ GVDN+FY+YG A LPVSTSS++++TQLVFTA FA LLV+Q+F
Sbjct  106   FM-TPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAAFALLLVRQRF  164

Query  825   TAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
              A + NAVVLLTVGA +LG+ AG DRPAG S   Y  GF M + AAALYGL+LP +ELS 
Sbjct  165   AAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYGLLLPAMELSQ  224

Query  645   LK-AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              + A   AV+++LV+E Q+++G   + F  +GM+INKDF+ IP EAREFELG   YY+L 
Sbjct  225   ARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQEIPAEAREFELGEAGYYLLL  284

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V TA V+Q   +G +G I YGS+LL+ +++A+ +PV  +LAV+F+HE F A KGI+L LS
Sbjct  285   VGTASVFQCICLGTIGAIFYGSALLAGVVLAMFIPVNGMLAVLFFHEPFSATKGIALGLS  344

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTV  187
             +WG +SYFYGD++  +   ++   +TE    PTV
Sbjct  345   LWGLLSYFYGDVRTKQALQSDKHQDTEH---PTV  375



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 242/341 (71%), Gaps = 5/341 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL RLY+  GG RIWF S++ TAG PVIFIPL++S+ RRR   + E+ +  +  
Sbjct  16    GTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVIFIPLVLSFLRRRNRNNSENIEKTEIV  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+   + +A+ ++G+L+G+DNY ++YG+A LPVST+SLIV TQL F A F+F +VKQ FT
Sbjct  76    LMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQLGFNAIFSFFMVKQTFT  135

Query  822   AFSTNavvlltvgavvlglraGS-DRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY  646
              FS NAVVLLT G  +L LR G  +R A  S+K Y++GF++T+ AA LY  ILP +EL+Y
Sbjct  136   PFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLTAAVLYAFILPFVELTY  195

Query  645   LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK--YYVL  472
              K + Q ++F+LVLE Q++M    + F  VGM++  DF+VIP EAREF++G     YY+L
Sbjct  196   KKVR-QQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEAREFKVGGGSAFYYML  254

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              + T IV+Q  F+GA+GV+   SSL S ++++ LLPVTE+LAV+ + EKF+ EKG++L L
Sbjct  255   ILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVCFREKFQVEKGVALLL  314

Query  291   SIWGFVSYFYGDIKNTKKDNNESS-AETEMTSAPTVASTQA  172
             S+WGFVSYFYG+ K+ K+  N++   ETE+   P   S  A
Sbjct  315   SLWGFVSYFYGEFKSGKRIINKTQLQETELPPLPVSVSAVA  355



>ref|XP_004959525.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=409

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 245/350 (70%), Gaps = 8/350 (2%)
 Frame = -1

Query  1242  QTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLV  1063
             +++TTM R+L+ L+C +L++G  GG LL RLY++ GG R W S+ LQT G+P++ IPL  
Sbjct  65    RSKTTMGRLLVALNCTLLALGGTGGQLLSRLYYINGGQRQWLSAGLQTGGWPLLLIPLAG  124

Query  1062  SYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIV  883
             SY  RR        +     L  P   +AAA LGV+ GVD++ Y++G+  LPVSTS++++
Sbjct  125   SYASRR-----ARDRGAPVLLSPPRFLLAAAGLGVITGVDDFLYAWGLEFLPVSTSAILI  179

Query  882   ATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVM  703
             +TQLVFT  F+FL+V+ + TA + NAV LLTVG VVLGL   SDRP G +   Y LGFV+
Sbjct  180   STQLVFTVLFSFLIVRHRLTAATVNAVALLTVGGVVLGLHVSSDRPEGVTRGQYWLGFVL  239

Query  702   TVAAAALYGLILPLIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             T+ AAAL G+++PL+EL+Y  A    + +++S+ +E Q+++G V T F T GM++NKDF+
Sbjct  240   TLGAAALGGVLMPLVELAYKCAAGGGRVLTYSVAMELQLVIGLVATAFFTAGMIVNKDFQ  299

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              IP EA+ FELG  +YY + V+ A++WQFFF+GA+GVI    +LL+ +++AV +PVTE+ 
Sbjct  300   AIPSEAKRFELGEARYYTVLVWAAVLWQFFFLGAVGVIFCVHTLLAGILIAVFIPVTEVA  359

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTK-KDNNESSAETEMT  202
             AVIF HEKF +EKG++L LS+WG  SY YG+    + K N E+ AE + +
Sbjct  360   AVIFLHEKFSSEKGVALVLSLWGLASYSYGEWNEARAKKNTEAVAEAQAS  409



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 225/331 (68%), Gaps = 40/331 (12%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL+ RLY+  GG RIWFSS+LQTAG P+I +PLL S+  RR+       +   + 
Sbjct  20    GNCGGPLMTRLYYNNGGKRIWFSSFLQTAGCPIILLPLLFSFFLRRK------EEKTPYL  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI   L +A+ ++G+L G DNY Y+YG+A LPVSTSSLI+++QL FTA FAF LVK KFT
Sbjct  74    LIKRPLFLASIVIGLLTGFDNYLYAYGLAYLPVSTSSLILSSQLAFTALFAFFLVKHKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VL+T+G+ +L L    D+ A E++K Y++GF+MT+AA+ LY  +LPL+EL+Y 
Sbjct  134   PFTINAIVLITIGSGILALHTDGDKLAEETHKEYVIGFLMTLAASVLYAFVLPLVELTYK  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLAV  466
             KA+ Q +S++LVLE Q+++  V T F  VGM+ + DF+VI  EAREF+LG T+ YYV+ V
Sbjct  194   KAR-QEISYTLVLEMQIVLCSVATCFCLVGMLADGDFKVIANEAREFKLGGTRYYYVVVV  252

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             FTAI+WQ                             E+LA++F+ EKF+AEKG+SL LS+
Sbjct  253   FTAIIWQ-----------------------------ELLAILFFREKFQAEKGVSLGLSL  283

Query  285   WGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             WGFVSYFYG IK+   +N     ET+++  P
Sbjct  284   WGFVSYFYGQIKS---ENKTQDHETQLSQLP  311



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 228/333 (68%), Gaps = 9/333 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRAC-----SDESSK  1018
             G   GPLL+RLYFLRGG R W SS LQTAG+P++ +PL  S+  RRR         +   
Sbjct  49    GASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSFSSRRRRRRHRQGGGDDPI  108

Query  1017  SRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLV  838
             S   FL+TP L  A  ++G++ G DN+ Y+YG A LPVSTSS++++TQL FTA FA L+V
Sbjct  109   SGAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSSILISTQLAFTAAFALLVV  168

Query  837   KQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLI  658
             +Q+FTA + NA+VLL+VGA +LG+ +G DRPAG +   Y  GF   + AAALYGL+LP++
Sbjct  169   RQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAGFGTALGAAALYGLVLPVM  228

Query  657   ELSYLKAKLQA----VSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGV  490
             ELS      +A    ++++LV+E Q+++G   T F  VGM++NKDF+ IPREAR+ ELG 
Sbjct  229   ELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLVNKDFQAIPREARQSELGK  288

Query  489   TKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEK  310
               YY+L V TA V+Q F +G +G I YGS+L + +I+ V LPVTE+LAV+F+HE F   K
Sbjct  289   AGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLPVTEVLAVVFFHEPFSGTK  348

Query  309   GISLFLSIWGFVSYFYGDIKNTKKDNNESSAET  211
             G++L LS+WG  SYFYG++++   D    S+  
Sbjct  349   GVALGLSLWGLASYFYGEVRHMAPDAEHQSSSC  381



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 228/333 (68%), Gaps = 9/333 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRAC-----SDESSK  1018
             G   GPLL+RLYFLRGG R W SS LQTAG+P++ +PL  S+  RRR         +   
Sbjct  78    GASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSFSSRRRRRRHRQGGGDDPI  137

Query  1017  SRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLV  838
             S   FL+TP L  A  ++G++ G DN+ Y+YG A LPVSTSS++++TQL FTA FA L+V
Sbjct  138   SSAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSSILISTQLAFTAAFALLVV  197

Query  837   KQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLI  658
             +Q+FTA + NA+VLL+VGA +LG+ +G DRPAG +   Y  GF   + AAALYGL+LP++
Sbjct  198   RQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAGFGTALGAAALYGLVLPVM  257

Query  657   ELSYLKAKLQA----VSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGV  490
             ELS      +A    ++++LV+E Q+++G   T F  VGM++NKDF+ IPREAR+ ELG 
Sbjct  258   ELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLVNKDFQAIPREARQSELGK  317

Query  489   TKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEK  310
               YY+L V TA V+Q F +G +G I YGS+L + +I+ V LPVTE+LAV+F+HE F   K
Sbjct  318   AGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLPVTEVLAVVFFHEPFSGTK  377

Query  309   GISLFLSIWGFVSYFYGDIKNTKKDNNESSAET  211
             G++L LS+WG  SYFYG++++   D    S+  
Sbjct  378   GVALGLSLWGLASYFYGEVRHMAPDAEHQSSSC  410



>dbj|BAJ94351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 230/331 (69%), Gaps = 5/331 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSR--K  1009
             G   GPLL+R Y+L GG   W +S LQTAG+P++  PL VS+  RRR    E S +    
Sbjct  63    GTVSGPLLLRAYYLHGGTSKWLTSLLQTAGWPLLLPPLCVSFISRRRRRQSEESATEAAS  122

Query  1008  FFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQK  829
               L++  L  A   +G+++G+ NY Y+YG+A LPVSTSS++++TQL FTA FA L+V+ +
Sbjct  123   LSLMSAGLLAATIAIGLVIGLINYLYAYGLANLPVSTSSILISTQLAFTAVFALLVVRHR  182

Query  828   FTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FTAFS NAVVLL VGA +LGL  G DRPAG S   Y  GF MT+ +AALYGL+LPL+ELS
Sbjct  183   FTAFSVNAVVLLVVGAAMLGLNGGGDRPAGVSRAQYYAGFAMTLGSAALYGLVLPLMELS  242

Query  648   YLKAKLQA---VSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYY  478
               +   +A   V+++LVLE QM++G   T FS VGM++NKDF  IP EAR F+LG   YY
Sbjct  243   QARHAARAGAAVTYTLVLEIQMVIGITATAFSVVGMLVNKDFHEIPDEARRFDLGEAGYY  302

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
              + V +A  +Q FF+G +G I YGS+LL+ +I+ +L+ VTE+ AV+ +HE F   KG++L
Sbjct  303   FILVSSATAFQCFFIGMIGAIFYGSALLAGVIMTLLISVTEVFAVLLFHEPFNGTKGVAL  362

Query  297   FLSIWGFVSYFYGDIKNTKKDNNESSAETEM  205
              +SIWGF+SYFYG+I+  KK +N S+ + ++
Sbjct  363   AISIWGFISYFYGEIRTNKKQSNTSTDKEQL  393



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 220/313 (70%), Gaps = 8/313 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVS-----YHRRRRACSDESSK  1018
             G  GGPL+ RLYFL GG+++W S++L+T G+P++  PL  S      +++      +  +
Sbjct  29    GATGGPLISRLYFLHGGHKLWLSAFLETGGWPILLFPLAFSKFFNKTNKKNPQSQQQEGE  88

Query  1017  SRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLV  838
              R    +  FL    + +G+L GVD+Y Y++G++ LPVSTS+L++A+QL FTA FA ++V
Sbjct  89    ERTHITLPLFLQ--CSFIGLLTGVDDYMYAFGLSYLPVSTSALLIASQLAFTALFALIVV  146

Query  837   KQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLI  658
             + KFTAF TN+VVLLT+G+  LGL A  DRP G SN  Y LGF MT+ AAALYGL+LPLI
Sbjct  147   RHKFTAFLTNSVVLLTLGSAFLGLGANGDRPKGLSNGRYFLGFFMTLGAAALYGLVLPLI  206

Query  657   ELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYY  478
             EL Y +++ Q +++ LVLE Q++M    T F  VGM+INKDF+ IP+EAR F+LG   YY
Sbjct  207   ELMYARSR-QKITYMLVLEMQLVMSVFATAFCAVGMLINKDFQHIPKEARAFDLGAVGYY  265

Query  477   VLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISL  298
                V + + WQ FF+G +G+I   SS++S +++A L+P+TEILAVIFYHEKF  EK ++L
Sbjct  266   ATLVGSGVAWQLFFIGTVGLIFCASSVVSGIMIAFLIPITEILAVIFYHEKFTGEKAMAL  325

Query  297   FLSIWGFVSYFYG  259
              +S+WGF SY YG
Sbjct  326   IMSLWGFASYIYG  338



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 218/317 (69%), Gaps = 9/317 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   GPL +RLYFL GGNR W  SWLQTAG PV+  PL V Y R R       +   +F 
Sbjct  50    GTIAGPLFLRLYFLHGGNRKWIPSWLQTAGVPVLLGPLTVLYLRER-------ASGVRFL  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
               T  L ++A + G+LVG++++ YS+G++ LPVSTS+L+++TQL FTA FA L+ KQKFT
Sbjct  103   APTKLLLLSAGI-GILVGLNDFMYSHGLSFLPVSTSALLLSTQLGFTALFALLIAKQKFT  161

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T+GA +LGL    DR  G SN+ Y LGFV+T+ AA L G ILP  E++Y 
Sbjct  162   PYSINAVVLMTLGAALLGLSKSGDRLLGVSNRDYWLGFVLTLGAAGLLGFILPCCEVAYA  221

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
              A+ + +++S+VL+FQ  + F  T+F T+GM+INKDF+ IPREA  FELG  KYY++ V 
Sbjct  222   TAR-KTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREANAFELGAVKYYLVLVS  280

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              AIVWQ   VG LGV+   +SL + ++ A LLP+TE  AVI YHEKF  EKG++L L  W
Sbjct  281   IAIVWQMAGVGTLGVVFSTTSLFAGVLNATLLPLTETAAVIVYHEKFTGEKGMALALCSW  340

Query  282   GFVSYFYGDIKNTKKDN  232
             GF+SYFYG  K  KK +
Sbjct  341   GFISYFYGSYKEKKKQD  357



>ref|XP_003579811.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=365

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 168/314 (54%), Positives = 224/314 (71%), Gaps = 6/314 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLL RLY+ +GG R W S+WL+T G+P++  P+  SY  RR              
Sbjct  41    GTTGGPLLSRLYYSKGGQRQWLSAWLETGGWPLLLFPVSFSYLARR----ARDGPGAPLV  96

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L  P   +AAA LG+  G D++ Y+YG++ LPVSTS+++++TQL FT  FAFL+V+Q+ T
Sbjct  97    LTRPRTLMAAAALGLATGADDFIYAYGLSYLPVSTSAILISTQLAFTVFFAFLVVRQRLT  156

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             AFS NAV LLTVGAVVLGL A SDRPAG +   Y LGF +++ AAALYGL+LPLIEL+Y 
Sbjct  157   AFSVNAVALLTVGAVVLGLHASSDRPAGVTRGQYWLGFFLSLGAAALYGLVLPLIELAYK  216

Query  642   KAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
              A    + V+++LVLE Q++MGF  T F TVGMV+N DF+ I REAR FELG T+YYV+ 
Sbjct  217   HAAGGGREVTYALVLEMQLVMGFFATAFCTVGMVVNNDFQAISREARAFELGETRYYVVL  276

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
             V  A++WQFFF+GA+GVI    +L + +++AV +PVTE+L VIF HEKF +EKG++L LS
Sbjct  277   VSCAVLWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLGVIFLHEKFSSEKGVALVLS  336

Query  288   IWGFVSYFYGDIKN  247
             +WG  SY YG+  +
Sbjct  337   LWGLASYSYGEYSD  350



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 220/286 (77%), Gaps = 4/286 (1%)
 Frame = -1

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RRR+ ++E   +R FFLI P L +AA L+G+L G DNY Y+YG+A LPVST++LI+A+QL
Sbjct  14    RRRSNNNEGENTR-FFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQL  72

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              F A F++ +V  KFT F+ NAVVLLTVGA VLG+   +D+P  E++K Y++GF++TVAA
Sbjct  73    AFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAA  132

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREA  511
             A +Y  +LPL+EL+Y KAK Q +S++LVLE QMI+ F+ ++ S VGM+I  DF+ +P EA
Sbjct  133   AVMYAFLLPLVELAYQKAK-QPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEA  191

Query  510   REFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYH  331
             REF+LG   +YV+AV +AI+WQ FF+GA+G+I   SSL+S ++++VLLP+TE+LAVIFYH
Sbjct  192   REFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYH  251

Query  330   EKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESSAETEMTSAP  193
             EKF+ EKG+SL LS+WGFVSYFYG+IK  K  +     E ++ S P
Sbjct  252   EKFQKEKGLSLALSLWGFVSYFYGEIKADK--DKRIQEEAQLNSLP  295



>ref|XP_004158055.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Cucumis 
sativus]
Length=304

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 220/299 (74%), Gaps = 6/299 (2%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HR  1051
             MRR LL  +C +L++G CGGPLL+RLYFL GGNR+W S++L+TAG P+IFIPLL+SY HR
Sbjct  1     MRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETAGCPIIFIPLLISYIHR  60

Query  1050  RRRACS----DESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIV  883
             RRR        ES+ S +   +   L +A+ ++G++ G  ++ Y+YG+A++PVSTS+LI 
Sbjct  61    RRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIR  120

Query  882   ATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVM  703
             A QL FTAGFAF LVKQKFTA+S N+VVL+T G  +L L    DR AGESN+ Y+ GF+ 
Sbjct  121   ACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLT  180

Query  702   TVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVI  523
             TVAA+ +YG ILPL+EL+Y KA+ Q ++++LVLE Q+IM    T+  ++ M+IN DF++I
Sbjct  181   TVAASVVYGFILPLVELTYKKAR-QQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMI  239

Query  522   PREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILA  346
               EA  F LG  KYYV+ V +AI+WQ FF+G +GVI   SS  S +I+AVLLPVTEILA
Sbjct  240   AMEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFXSGIIIAVLLPVTEILA  298



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 216/339 (64%), Gaps = 33/339 (10%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL RLY+ +GG+RIWF S+L TAG P+I IPL VS+ RR     + S  + K  
Sbjct  16    GTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRRSNRNHNNSETAEK--  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
                                         AK+ V  + L +A+ L F A F+FL+VKQKFT
Sbjct  74    ----------------------------AKVFVMETPLFIASILAFNAIFSFLMVKQKFT  105

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS NAVVLLTVG  +L L    DRPAG S K Y++GF++T+ AA LY  ++PL+EL+Y 
Sbjct  106   PFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLIAAVLYAFLMPLVELTYK  165

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLAV  466
             K + Q ++F+LVLE QM+M    T F  VGMV+  DF  IPREAREF +G +  YY L V
Sbjct  166   KVR-QEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREAREFMIGSSLFYYTLIV  224

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
                IVWQ FF+GALGV+   SSL S + V+VLLPVTE+LAV+ + EKF+AEKG++L LS+
Sbjct  225   VIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCFREKFQAEKGVALLLSL  284

Query  285   WGFVSYFYGDIKNTKK-DNNESSAETEMTSAPTVASTQA  172
             WGFVSYFYG+ K+ KK  ++  S ETE+   P   S  A
Sbjct  285   WGFVSYFYGEFKSGKKIIDSPKSPETELPPLPVSGSDVA  323



>tpg|DAA61854.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=394

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 246/381 (65%), Gaps = 37/381 (10%)
 Frame = -1

Query  1269  DLKALKMEGQTR--TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTA  1096
             D++A K +        M R L+ L+C +L++G  GGPLL RLYF +GG+R W S+WL+T 
Sbjct  2     DVEARKSDAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETG  61

Query  1095  GFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMA  916
             G+P++ IP+  S+  RR        +     L  P + +AAA LGV  G D++ Y++G+A
Sbjct  62    GWPLLVIPVAASFVARR-----ARDRGAPVLLAPPRILLAAAGLGVATGADDFIYAFGLA  116

Query  915   KLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGE  736
              LPVSTS+++++TQL FT  FAFL+V+Q+ TA S NAV LLTVGAVVLGL   SDRP G 
Sbjct  117   YLPVSTSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGV  176

Query  735   SNKAYLLGFVMTVAAAALYGLILPLIELSY---LKAKLQAVSFSLVLEFQMIMGFVGTIF  565
             +   Y LGFV+T+ AAALYGL+LPL+EL+Y     A  +AV+++LV+E Q++MGF  T F
Sbjct  177   TRGQYWLGFVLTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAF  236

Query  564   STVGMVINKDFE---------------------------VIPREAREFELGVTKYYVLAV  466
              TVGMV+NKDF+                            IPREAR ++LG  +YY +  
Sbjct  237   CTVGMVVNKDFQGAHRLANWQQQCPRAEMPPDDGIIIGAAIPREARRYKLGEARYYAVLA  296

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
             ++A++WQ FF+GA+GVI    +LL+ +++AV +PVTE+ AVIF  E+F +EKG++L LS+
Sbjct  297   WSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLRERFSSEKGVALVLSL  356

Query  285   WGFVSYFYGDIKNTKKDNNES  223
             WG  SY YG+    +    ++
Sbjct  357   WGLASYSYGEWSEARAKKRKT  377



>ref|XP_002462514.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
 gb|EER99035.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
Length=378

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 244/370 (66%), Gaps = 28/370 (8%)
 Frame = -1

Query  1254  KMEGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFI  1075
             +  G TRT +R  LL ++  ++ +G+ GGPL +R YFL GG R W S++LQTAGFP++ +
Sbjct  15    QSAGTTRTLIRNPLLVVNFALMVVGSAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLV  74

Query  1074  PLLVSY------------HRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFY  931
             PL VS+                 A +++++    FFL+TP L  A+A +G++ GVD+  Y
Sbjct  75    PLCVSFFSRRRQRDRDDADADADAPANKAATRTPFFLMTPRLLAASAAIGLMTGVDDLLY  134

Query  930   SYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSD  751
             +YG+A LP           L FTA FA LLV+Q+FTAFS NAV LLTVGA +LG+ AG D
Sbjct  135   AYGLAYLP-----------LAFTAAFALLLVRQRFTAFSVNAVALLTVGAAMLGMNAGGD  183

Query  750   RPAGESNKAYLLGFVMTVAAAALYGLILPLIELS----YLKAKLQAVSFSLVLEFQMIMG  583
             RPAG S   Y  GF MT+ AAALYGL+LP++ELS      +A   AV+++LV+E Q+++G
Sbjct  184   RPAGVSRAQYGAGFAMTLGAAALYGLVLPVVELSQARHAARAGAGAVTYTLVIEMQLVIG  243

Query  582   FVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVLAVFTAIVWQFFFVGALGVISYG  406
                T+FS VGM+ N D   IP EAREF+LG +  YY+L   +A  +Q FF+G +G + +G
Sbjct  244   LTATVFSAVGMLANNDLHAIPGEAREFDLGGSAGYYLLLAGSAATYQCFFLGTIGAVFFG  303

Query  405   ssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNE  226
             S+LL+ +++ VL+PVTE+LAV+F+HE F   KG++L LS+WGFVSYFYG+++ +K   + 
Sbjct  304   SALLAGVVMTVLIPVTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGEVQTSKAHRHH  363

Query  225   SSAETEMTSA  196
               +  +  +A
Sbjct  364   HQSADKTPNA  373



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 230/332 (69%), Gaps = 22/332 (7%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVI---------FIPLLVSYHRRRRACSD  1030
             G+ GG LL+RLYF+RGG+R+W S++LQ A +P++         F+P              
Sbjct  43    GSGGGSLLLRLYFVRGGHRMWLSTFLQVAAWPILLLPLYLSRLFLP-------------T  89

Query  1029  ESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFA  850
              ++  R   L+   L+ A+A LG+L+ +D Y Y+YG + LP+STSSL++A+QL FTA F+
Sbjct  90    TTTPRRHHLLLPLPLAAASAFLGLLIALDCYLYAYGSSCLPLSTSSLLIASQLAFTAVFS  149

Query  849   FLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLI  670
             FL+V+Q+FTAFS NAVVLLT+G VVL L A  DRP GE+   Y +GF M++AAAAL GL+
Sbjct  150   FLIVRQRFTAFSLNAVVLLTLGPVVLSLGAAGDRPEGEAMSKYYVGFFMSIAAAALIGLV  209

Query  669   LPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGV  490
             LPL+EL+Y +   + ++++ V+  Q++MG  G++F  +GM+INKDF+ IP+EA++FELG 
Sbjct  210   LPLVELAYRRMSTEEMTYATVIVTQIVMGASGSVFCLLGMLINKDFQAIPKEAKDFELGE  269

Query  489   TKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEK  310
              KYY++ ++ AI WQ   VG +GVI   SSL   +++A+L+PV EILAVIF +EKF   K
Sbjct  270   LKYYMVLIWNAICWQIINVGMVGVIFTASSLFCGVMIAILVPVGEILAVIFLNEKFNGSK  329

Query  309   GISLFLSIWGFVSYFYGDIKNTKKDNNESSAE  214
             G++L L +WGF SY YG++K +KK    SS E
Sbjct  330   GVALALCLWGFASYMYGEMKQSKKQKQPSSVE  361



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 226/329 (69%), Gaps = 16/329 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY--HRRRRACSDESSKSRK  1009
             G  GGPLL+RLY+L GGNR W SS LQ+AGFP++ IPL + Y  HRR R  S        
Sbjct  42    GTIGGPLLMRLYYLHGGNRRWLSSLLQSAGFPILLIPLSLLYLRHRRHRGVSPSE-----  96

Query  1008  FFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQK  829
              F I P L +++A+LG+L+G+DN+ Y+ G++ +PVSTS+++ A+QL F AGFA L+VKQ+
Sbjct  97    -FFIEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVSTSAILFASQLAFIAGFARLIVKQR  155

Query  828   FTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FT +S N+VVL+T+G++ LG+ +  DRPAG S+  YL GF++T+ +A L G ILP IE +
Sbjct  156   FTPYSINSVVLMTIGSITLGIHSDGDRPAGVSDGEYLSGFLLTLGSALLIGFILPSIEFA  215

Query  648   YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
             Y KA  +AV  + V++FQ  +G   +I S  GM+INKDF+ IPREARE+ELG   YY + 
Sbjct  216   YSKAS-RAVDLTAVMQFQFNVGLFSSILSATGMLINKDFQEIPREAREYELGHGMYYFVL  274

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
               +AI WQ  FVG LG+I   +SL + +  AVLLP  E+ AVI YHEKF  EKGI+L L 
Sbjct  275   SASAIAWQLSFVGLLGLIFCTTSLFTGIYSAVLLPFAEVGAVIAYHEKFTGEKGIALALC  334

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMT  202
             +WGF SYFYG+ + +K        ET MT
Sbjct  335   LWGFTSYFYGEYRKSK-------VETSMT  356



>ref|XP_006841261.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
 gb|ERN02936.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
Length=366

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 228/318 (72%), Gaps = 7/318 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G C  PL+ R+YFL GG R WF++W+QTA +P++ IPL +     ++  S +      F 
Sbjct  46    GGCA-PLVSRIYFLHGGQRKWFTAWIQTAAWPLLLIPLSLPKFFSKKLQSQQEKSHLTF-  103

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
                P L++ +A +G+L+G+D+Y Y++G++ LPVSTSSL++ TQL FTA FAF+LV+ +FT
Sbjct  104   ---P-LALQSAGIGLLIGLDDYMYAFGLSYLPVSTSSLLLCTQLAFTALFAFVLVRYRFT  159

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NAVVLLT+G V+LGL A  DRP G S   Y LG+VMTV  AA++GL++PL+EL Y 
Sbjct  160   AYSINAVVLLTLGPVLLGLGARGDRPEGVSGAKYALGYVMTVGTAAVFGLVVPLLELVYG  219

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK+  V+++LVLE Q+IM  V T F TVGM+ NKDF+ IP EAREF LG  KYY+  V 
Sbjct  220   KAKV-VVTYTLVLEMQVIMYVVATAFCTVGMIANKDFQAIPIEAREFGLGEFKYYLTVVA  278

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             + ++WQ FF+G+ G I   SS+ + + VA+ +P++E+L VIF+HEKF  EKG++L LS+W
Sbjct  279   SGVMWQLFFIGSAGFIFCTSSMFTGVFVALQIPLSELLVVIFFHEKFTGEKGMALVLSMW  338

Query  282   GFVSYFYGDIKNTKKDNN  229
             GFVSYFYG+  N +K   
Sbjct  339   GFVSYFYGEHLNARKKKG  356



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 223/336 (66%), Gaps = 17/336 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYF  GG  IWFS++L+TAGFP+IFIPLL SY +RRR  S+  +++   F
Sbjct  16    GNCGGPLIMRLYFNNGGKSIWFSTFLETAGFPIIFIPLLFSYLKRRR--SNNGNENTSLF  73

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             LI P L IAA L+G+L G DNY Y+YG+A LPVST++LI+A+QL F A F++ +V  KFT
Sbjct  74    LIKPRLLIAAVLIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVNHKFT  133

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NAVVLLTVGA VLG+   +D+P  E++K Y++GF++TVAAA +Y  +LPL+EL+Y 
Sbjct  134   PFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLVTVAAAVMYAFVLPLVELAYQ  193

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KAK Q +S+SLVLE Q+I+ F+ ++ S +G+  N+   +          G    + LA  
Sbjct  194   KAK-QPMSYSLVLEVQLILCFLASLVSLIGLT-NRSKRIQAWRGNVLCGGCGFSHNLA--  249

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEI--LAVIFYHEKFEAEKGISLFLS  289
               I+    ++  L +IS        L    + P      L+  FYHEKF+AEKG+SL LS
Sbjct  250   -RILLGSHWIDLLRIIS-------RLGYYDISPFAHHRGLSCYFYHEKFQAEKGLSLALS  301

Query  288   IWGFVSYFYGDIKNTKKDNNESSAETEMTSAPTVAS  181
             +WGFVSYFYG+IK   K+N     ETE+ S P   S
Sbjct  302   LWGFVSYFYGEIK-ANKENKRIQQETELISLPRTIS  336



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 186/232 (80%), Gaps = 1/232 (0%)
 Frame = -1

Query  951  GVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvl  772
            G+ NYFY+YG++K+PVSTSSLI+A+QL FTA F F LVKQKFT +S NAVVLLT GA VL
Sbjct  2    GLVNYFYTYGVSKIPVSTSSLIIASQLAFTAVFCFFLVKQKFTPYSINAVVLLTCGAAVL  61

Query  771  glraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQM  592
             + A SDRP GESNK Y +GF+MT A + LYGLILPL+ELSY++A  Q +S+SL+LEFQM
Sbjct  62   AMHASSDRPNGESNKDYWMGFIMTAAVSVLYGLILPLMELSYMRAG-QVLSYSLILEFQM  120

Query  591  IMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVIS  412
            +M F  T F TVGM++NKDF+ I  EA  FELGV KYYV+  F   + Q FFVG +GVI 
Sbjct  121  VMCFFATAFCTVGMIVNKDFQAIGEEAEGFELGVAKYYVVVFFNVTINQCFFVGVVGVIF  180

Query  411  YGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGD  256
            Y SSL S +++A+LLP TEILAV+F+HEKF+ EKG+SLFL++WGFVSYFYG+
Sbjct  181  YSSSLFSGVLLALLLPPTEILAVVFFHEKFQVEKGVSLFLALWGFVSYFYGE  232



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 220/332 (66%), Gaps = 2/332 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R+ L ++ +IL++G CG PL +RLYF RGG  +WF+ WLQ+ G+PVI +PL V+Y  R
Sbjct  1     MKRLFLLVNAVILAVGYCGLPLTLRLYFGRGGEMVWFAGWLQSGGWPVILLPLAVNYLAR  60

Query  1047  RRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLV  868
             RR      S S K   + P L  AA  +G++ G DN+ Y+YG++KLPVST +LI ATQL 
Sbjct  61    RR--ERTPSGSVKVIRLRPKLFAAAMAIGMITGADNFMYAYGISKLPVSTVALIDATQLA  118

Query  867   FTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAA  688
             FT  F+F +VKQK TAFS NAVVLLTVGAVV  + +  DRPAGES+  Y  GF M   +A
Sbjct  119   FTVVFSFFIVKQKLTAFSVNAVVLLTVGAVVFAVHSTGDRPAGESHSEYWKGFAMMAGSA  178

Query  687   ALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             A +GL L L+E SY K    ++ ++ VLEF ++     T+FSTVGM    +F+ I  EA 
Sbjct  179   ATFGLCLSLVEFSYAKTGGPSMDYAAVLEFDLVTNISATLFSTVGMAAEHNFQAIRGEAT  238

Query  507   EFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHE  328
              +  G  KYY      A+V Q   +G  GVI Y SSL S ++++VLLP+ E+LAV+F+ +
Sbjct  239   GYRSGRIKYYAAVFSVALVCQCLRLGIAGVIHYSSSLYSGILLSVLLPLVEVLAVVFFKD  298

Query  327   KFEAEKGISLFLSIWGFVSYFYGDIKNTKKDN  232
             ++  EKGI+LFLS+WGFVSYFYG+ K     N
Sbjct  299   EYPPEKGIALFLSLWGFVSYFYGEYKVANNRN  330



>ref|XP_002301070.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
 gb|EEE80343.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
Length=349

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 232/343 (68%), Gaps = 7/343 (2%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             + Q +  M+  L+FL+C+++++G   GPLL+R+Y+L GG   W  +WL TAGFP++ IP+
Sbjct  13    QHQNKKHMKAFLVFLNCMLMAVGQVAGPLLVRIYYLHGGKSNWLGAWLLTAGFPILIIPI  72

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
              +SY          +       L+TP+L  A+ +LG+L+G+D+Y YS+GM+ LPVS SS+
Sbjct  73    AISY------IRARARAQAGRLLVTPWLFSASVILGLLLGLDSYLYSFGMSYLPVSVSSI  126

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             + ++QL FTA FA+++VK KFT +S NAV L+T G+V+LG     DRP+GES   Y+LGF
Sbjct  127   LGSSQLAFTAIFAYIIVKHKFTHYSINAVALMTFGSVILGFHMNGDRPSGESKGKYILGF  186

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              MT+  AAL+G ++P +E +YLKA  +A++F LVL+ Q ++    T+F ++ M+INKDF+
Sbjct  187   FMTIGGAALHGFLMPALEFTYLKAG-KAITFDLVLQVQFLISMFATLFCSIPMIINKDFK  245

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              I +EA EF LG TKYY + +  AIV Q   +G+LGVI   SSLL  L+ ++L+PV +  
Sbjct  246   AISKEAAEFGLGKTKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAF  305

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESS  220
             AV+   E F AEKG++L + +WGF SY YG+ +  + +  ES+
Sbjct  306   AVMILKEVFNAEKGMALAMCLWGFASYLYGEYQKPEANKEEST  348



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 226/320 (71%), Gaps = 9/320 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVS--YHRRRRACSDESSKSRK  1009
             GN GGPLL+RLY+L GGNR W S  LQ+AGFP++ IPL +   +HRRRR  S        
Sbjct  4     GNIGGPLLMRLYYLHGGNRRWLSCSLQSAGFPILLIPLSLLYLHHRRRRGVSPSE-----  58

Query  1008  FFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQK  829
              F I P L +++A+LG+L+G+DN+ Y+ G++ +PVSTS+L+ ATQL FTAGFA L+VKQ+
Sbjct  59    -FFIEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVSTSALLFATQLAFTAGFARLIVKQR  117

Query  828   FTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FT +S N+VVL+ +G++ LG+ +G D PAG S+  YL GF +T+ +A L G ILP IE +
Sbjct  118   FTPYSINSVVLMILGSITLGIHSGGDWPAGVSDGEYLSGFFLTLGSALLVGFILPCIEFA  177

Query  648   YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLA  469
             Y KA  +AV F+ V++FQ  MG   TIF+ + M+INKDF+ IPREARE+ELG   YY + 
Sbjct  178   YSKAS-RAVDFAAVMQFQFNMGLFATIFAAMEMLINKDFQEIPREAREYELGHGMYYFVL  236

Query  468   VFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLS  289
               +AIVWQ   +G LG+I   +SL + +  AVLLP  EI AVI YHEKF  EKGI+L L 
Sbjct  237   SASAIVWQLSLIGLLGLIFCTTSLFTGIYGAVLLPFAEIGAVIAYHEKFTGEKGIALALC  296

Query  288   IWGFVSYFYGDIKNTKKDNN  229
             +WGF SYFYG+ + +K + +
Sbjct  297   LWGFTSYFYGEYRKSKVERS  316



>gb|ABR16841.1| unknown [Picea sitchensis]
Length=368

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 218/304 (72%), Gaps = 11/304 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+  GPLL R YFL GG++ W SSWL+TAG+P++ +PL +SY   R+  + E+       
Sbjct  39    GSTAGPLLTRFYFLHGGSKRWLSSWLETAGWPLLLLPLYLSY---RKQPNRENH------  89

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              ITP L +A   +G+L G D+Y Y+YG++ LP+ST+S+++A+ L FTAGFA LLV+QKF+
Sbjct  90    -ITPKLFLACCGIGILTGADDYLYAYGLSFLPLSTASVLIASHLGFTAGFALLLVRQKFS  148

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              FS N+VVLL+  +V+L      DRP G +++ Y++GFV+T+ AAALYG ++PLIEL+Y 
Sbjct  149   PFSVNSVVLLSASSVLLAFHTSGDRPEGVTSRQYVVGFVLTLGAAALYGFVIPLIELTYK  208

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             +AK + ++++LV+E Q +M    T+F TVGM+IN DF+ + REA  F LG   Y +  V+
Sbjct  209   RAK-RPITYTLVMEMQFVMSVTATVFCTVGMLINGDFQALHREAEGFRLGKIDYSMALVW  267

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              A+ WQ FF+G  GV S  SSLLS +I+A+++P TE+LAVI +HEKF AEKG++L L++W
Sbjct  268   AAVAWQLFFIGVFGVTSMASSLLSGVIIALMIPGTEVLAVILFHEKFSAEKGMALVLALW  327

Query  282   GFVS  271
             GF S
Sbjct  328   GFAS  331



>ref|XP_009631999.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 221/323 (68%), Gaps = 5/323 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G +L+R+YFL GG R W  ++  TAGFP++ +P+ +S+ +RR+A   E+++     
Sbjct  39    GQIAGVMLVRIYFLHGGKRKWLQAFWLTAGFPILLLPIAISFAKRRKANKTETNR----V  94

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A+A+LG+L+GV +Y Y++GM+ LPVS SSL+ +T L FTA FA+ +VK KFT
Sbjct  95    LLTPKLILASAILGLLLGVCSYLYTFGMSYLPVSISSLLASTSLAFTAIFAYFIVKHKFT  154

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T G+++LGL    DRP GESN+ Y+LGFVMT+  AAL+G +   +E S++
Sbjct  155   HYSVNAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMTIVGAALHGFLNAGVEYSHI  214

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA + AV+F LV++ Q ++    T+F  V M+INKDF+ I REA  F LG  KYY++   
Sbjct  215   KAGV-AVTFDLVMQMQFLISMFSTLFCVVAMIINKDFQTIHREAEAFGLGQNKYYMILAL  273

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI  Q   +G LG+I   S+LLS +  ++L+PV +I AV+F  E F AEK ++L + +W
Sbjct  274   SAIALQIMIIGNLGLIFSSSALLSGIFNSLLVPVQQIFAVMFLPESFNAEKWMALAMCLW  333

Query  282   GFVSYFYGDIKNTKKDNNESSAE  214
             GF SYFYG+ K + K   ++  +
Sbjct  334   GFASYFYGEYKASLKKVTKTKPD  356



>emb|CDP01096.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 216/326 (66%), Gaps = 8/326 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLL+R+YFL GG R W ++WL TAGFP++ +P+ +SY + R      S  S   F
Sbjct  39    GQVGGPLLVRIYFLHGGKRKWLTAWLLTAGFPLLILPISISYFKNR------SKASSPKF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L  A+A LG L+G+D+Y Y++GM+ LPVS SSL+ ++QL FTA FA+ +VK KFT
Sbjct  93    LVPPRLVAASAFLGFLLGIDSYLYTFGMSYLPVSVSSLLGSSQLAFTAIFAYFVVKHKFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T G+ +LGL    DRP+GESN  Y LGF MT+ AAAL+G I+P  E +  
Sbjct  153   HYSINAVVLMTFGSAILGLHMNGDRPSGESNANYTLGFFMTLGAAALHGFIMPAFEYAQK  212

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA++  V+F L L+ Q ++    T+F T+ M+INKDF+ IP+EA EFELG  KYY + V 
Sbjct  213   KAEV-TVTFDLFLQVQFLVSMFATLFCTIPMIINKDFQAIPQEAAEFELGPMKYYTILVM  271

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
               I  Q   +G+ GVI   SSL   ++ ++L+PV +I AV    E F  EKG++L + +W
Sbjct  272   AGIALQCMMIGSTGVIFSSSSLFGGIVTSLLVPVQQIFAVFCLAESFSGEKGMALAMCLW  331

Query  282   GFVSYFYGDIK-NTKKDNNESSAETE  208
             GF SYFYG+ K N K+ + +   E E
Sbjct  332   GFASYFYGEYKVNQKQPDVKHEPEHE  357



>ref|XP_010098677.1| Purine permease 3 [Morus notabilis]
 gb|EXB75580.1| Purine permease 3 [Morus notabilis]
Length=273

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 170/218 (78%), Gaps = 6/218 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             GNCGGPL++RLYFL GG R+W SSWL+T G+ +I +PL  S++RRRR  S     + KFF
Sbjct  27    GNCGGPLIMRLYFLNGGKRVWLSSWLETGGWAIILLPLAFSFYRRRRQNS-----AAKFF  81

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              I PFL +A+A +G+L G+D+Y Y+YG+A+LPVSTS+LI+A+QL FTA FA+LLVKQKFT
Sbjct  82    EIKPFLFLASAGVGLLTGLDDYIYAYGVARLPVSTSALIIASQLAFTAAFAYLLVKQKFT  141

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S NAVVLLT+   VL L    DRP GESNK YL+GF+MTV AA LYG ILPL+EL Y 
Sbjct  142   SYSVNAVVLLTIAGAVLALHTSGDRPKGESNKEYLMGFLMTVGAAVLYGFILPLMELVYK  201

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             KAK Q +++SLVLE QM+M F  T F TVGM++NKDF+
Sbjct  202   KAK-QEITYSLVLEIQMVMCFFATAFCTVGMIVNKDFQ  238



>gb|EPS74474.1| hypothetical protein M569_00285, partial [Genlisea aurea]
Length=311

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 218/309 (71%), Gaps = 10/309 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+ G PL++RLYF+ GG  +WF+SWLQT+ FP+I IPLL ++ RR       ++ + +FF
Sbjct  12    GSSGIPLIMRLYFIHGGKMLWFASWLQTSAFPLILIPLLFNHLRR------TTTTAARFF  65

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              I   LS AAA +G+ +G +NY Y+YG +KLPVSTSSLI +TQL+FTA F+FLLVK KFT
Sbjct  66    SINRKLSAAAAAIGIAIGFNNYLYAYGSSKLPVSTSSLIFSTQLIFTALFSFLLVKHKFT  125

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A+S NA+VLLTVGAV+L   + +     ES++ Y  GF +TV A AL GLI PL+EL YL
Sbjct  126   AYSINAIVLLTVGAVILSFHSSAKD---ESDRDYEFGFAVTVTAVALSGLIQPLMELCYL  182

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             K+  QAV   + LEFQ ++    T F TVGM++ KDFE I  EA+ FE+G   Y +   F
Sbjct  183   KSD-QAVDGVVALEFQFVLSSFATGFCTVGMLMGKDFEGISGEAKGFEIGAVNYILTVFF  241

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TA+V Q FF+G++GVI   S+LL+ +I+   LP+ EILAV+ + EKF  EKG+SL LS+W
Sbjct  242   TAVVSQCFFLGSVGVIHLSSALLAGVIICASLPLCEILAVVLFREKFRPEKGVSLLLSLW  301

Query  282   GFVSYFYGD  256
             G VSYFYG+
Sbjct  302   GSVSYFYGE  310



>emb|CDY35721.1| BnaC03g58420D [Brassica napus]
Length=319

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 216/341 (63%), Gaps = 37/341 (11%)
 Frame = -1

Query  1179  NCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR---RRRACSDESSKSRK  1009
              CGGPLL RLY+ +GG+RIWF S+L TAG P+I IPL VS+ R   R    S+ + K++ 
Sbjct  11    TCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRLSNRSHNNSETTEKAKV  70

Query  1008  FFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQK  829
             F + TP                  F +Y       S S+        F A F+FL+VKQK
Sbjct  71    FVMETPL-----------------FIAYP------SLSA--------FNAIFSFLMVKQK  99

Query  828   FTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FT FS NAVVLLTVG  +L L    DRPAG S K Y++GF++T+ AA LY  ++PL+EL+
Sbjct  100   FTPFSINAVVLLTVGTGILALHTNGDRPAGVSKKEYVVGFMLTLIAAVLYAFLMPLVELT  159

Query  648   YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTK-YYVL  472
             Y K + Q ++F+LVLE QM+M    T F  VGMV+  DF+ IPREAREF +G +  YY L
Sbjct  160   YKKVR-QEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFKAIPREAREFMIGSSLFYYTL  218

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              V   IVWQ FF+GA GV+   SSL S + V+VLLPVTE+LAV+ + EKF+A+KG++L L
Sbjct  219   IVVIGIVWQCFFLGAFGVVYCASSLTSGVFVSVLLPVTEVLAVVCFREKFQAKKGVALLL  278

Query  291   SIWGFVSYFYGDIKNTKK-DNNESSAETEMTSAPTVASTQA  172
             S+WGFVSYF G+ K+ KK  ++  S ETE+   P   S  A
Sbjct  279   SLWGFVSYFSGEFKSGKKIIDSPKSPETELPPLPVSGSDVA  319



>ref|XP_009762898.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=359

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/322 (46%), Positives = 217/322 (67%), Gaps = 6/322 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G +L+R+YFL GG R W  ++L TAGFP++ +P+ +SY +RR+A ++ +       
Sbjct  38    GQIAGVMLVRIYFLHGGKRKWLQAFLLTAGFPILVLPIAISYAKRRKAKTETNR-----V  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             ++TP L +A+A+LG+L  V +Y Y++GM+ LPVS SSL+ +T L FTA FA+  VK KFT
Sbjct  93    ILTPKLILASAILGLLFCVCSYLYTFGMSYLPVSISSLLASTSLAFTAIFAYFFVKHKFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T G+++LGL    DRP GESN+ Y+LGFVMT+  AAL+G +   +E S++
Sbjct  153   HYSINAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMTIVGAALHGFVNAGVEYSHI  212

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA +  V+F LV++ Q ++    T+F  V M+IN+DF+ I REA EF LG  KYY++   
Sbjct  213   KAGV-VVTFDLVMQMQFLICIFSTLFCVVAMIINEDFQAIHREAGEFRLGQNKYYMILAL  271

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI  Q   +G LG+I   S+LLS ++ ++L+PV +I AV+F  E F AEK ++L + +W
Sbjct  272   SAIALQIMIIGNLGLIFSSSALLSGIVNSLLVPVQQIFAVMFLPESFNAEKWMALAMCLW  331

Query  282   GFVSYFYGDIKNTKKDNNESSA  217
             GF SYFYG+ K + K      A
Sbjct  332   GFASYFYGEYKASLKVTKTKHA  353



>ref|XP_006661332.1| PREDICTED: purine permease 3-like, partial [Oryza brachyantha]
Length=265

 Score =   251 bits (642),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 196/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  981  IAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNav  802
            +A A LGVL G D++ Y+ G+A LPVSTS+++ +T L FT  FA L+V+Q+ TA + NAV
Sbjct  1    LAGAGLGVLTGADDFIYASGLAYLPVSTSAILTSTHLAFTVFFACLIVRQRLTAATLNAV  60

Query  801  vlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKL--Q  628
             LLT+GAVVLGL   +DRPAG +N  Y +GF +T+ AAALYGLILPL+EL+Y  A    +
Sbjct  61   ALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGR  120

Query  627  AVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVW  448
            AV+++LV+E Q++MGF  T F TVGM+++KDF+ IPREA+++ELG T+YY + VF AI+W
Sbjct  121  AVTYALVVEMQLVMGFFATAFCTVGMIVDKDFQAIPREAKQYELGETRYYTVLVFNAILW  180

Query  447  QFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSY  268
            QFFFVGA+GVI Y  +LL+ +I+AV +P+TE+L+V+F HEKF +EKG++L LS+WG  SY
Sbjct  181  QFFFVGAIGVIFYVHTLLAGIIIAVFIPITEVLSVVFLHEKFSSEKGVALVLSLWGLASY  240

Query  267  FYGDIKNTKKDNNESS  220
             YG+  + K +   +S
Sbjct  241  SYGEYTDAKANKRAAS  256



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 213/312 (68%), Gaps = 19/312 (6%)
 Frame = -1

Query  1149  YFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAA  970
             YF+RGG+R+W S++LQTA                  A +      R F L+ P L+ A A
Sbjct  53    YFVRGGHRMWLSAFLQTA------------------AAATRRRCRRFFLLLPPALTAACA  94

Query  969   LLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvllt  790
             +LG+L+ VD+Y YSY  + LP+STSSL++A+QL FTA FA L+V+Q+FT FS NAVVLLT
Sbjct  95    VLGLLIAVDSYMYSYASSFLPLSTSSLLMASQLAFTAVFALLIVRQRFTPFSLNAVVLLT  154

Query  789   vgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSL  610
             +G VVLGL   SDRP GE    Y LGF M VAAAAL GL+LPL+EL+Y +   + +++++
Sbjct  155   LGPVVLGLGGASDRPEGEPQSKYYLGFCMMVAAAALIGLVLPLVELAYRRTT-EEMTYAM  213

Query  609   VLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVG  430
             V+E QM+MG  G++F  +GM+++KDF+ IP+EAREFELG  +YY++ ++ AI WQ   VG
Sbjct  214   VIETQMVMGASGSLFCLLGMLLSKDFQAIPKEAREFELGELRYYMVLIWDAICWQILNVG  273

Query  429   ALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIK  250
              +GVI   SSL   +++A+L+P+ EIL VIF +EKF   K ++L LS+WGF SY YG++K
Sbjct  274   LVGVIFSASSLFGGMMIAILVPIGEILPVIFLNEKFNGSKAVALALSLWGFASYLYGELK  333

Query  249   NTKKDNNESSAE  214
               KK    +  E
Sbjct  334   QGKKSKQTTEVE  345



>gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis]
Length=261

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 170/218 (78%), Gaps = 5/218 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPLL+RLY+L GG+ +W SSWL+T G+P IF+ L V+Y RRR A       S +  
Sbjct  46    GTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYLRRRSA----EGPSARLV  101

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ PFL  A+A++GVL G+D+Y Y+YG+A+LP STS+L++ATQL FTAGFAFLLV+Q+FT
Sbjct  102   LMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQLAFTAGFAFLLVRQQFT  161

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++S N+V LLTV A VL L A SDRPAGES++ Y  GF MT+ AAALYG +LPL+EL+Y 
Sbjct  162   SYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGAAALYGFVLPLVELTYK  221

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             KAK QAV++SLVLE Q++M F  T F TVGM++NKDF+
Sbjct  222   KAK-QAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQ  258



>ref|XP_002513954.1| purine transporter, putative [Ricinus communis]
 gb|EEF48537.1| purine transporter, putative [Ricinus communis]
Length=358

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 219/327 (67%), Gaps = 9/327 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLLIRLY+L GG R W +SWL TAGFP++ +P+  SY   R      +S+     
Sbjct  35    GQVGGPLLIRLYYLHGGKRKWLTSWLLTAGFPILILPISSSYMIARARSRAPTSR----L  90

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+T +L  A+A +G+L+G+D Y YS+G++ LPVS SSL+ +TQL FTA FA+++VK +FT
Sbjct  91    LLTRWLFAASAFIGLLLGLDGYLYSFGLSYLPVSVSSLLGSTQLAFTAIFAYIVVKHRFT  150

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T G+++LG     D P GESN  Y+LGF M V AAAL+G I+P +E +++
Sbjct  151   HYSINAVVLMTFGSIILGFHMNGDVPNGESNGKYVLGFFMAVGAAALHGFIMPAVEYTHM  210

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
              A +  ++F LV++ Q ++    T+F T+ M+INKDF+ IP+EA +F LG  KYY + V 
Sbjct  211   NAGM-PITFDLVMQVQFLISMFATLFCTIPMIINKDFQAIPKEAEKFGLGQAKYYTILVV  269

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
              A++ Q   +G+LGVI   +SLL  L+ ++L+PV ++ AVIF HE F AEKG++L + +W
Sbjct  270   AAVIMQLLIIGSLGVIFASTSLLGGLVSSLLVPVQQVFAVIFLHEVFNAEKGMALAMCLW  329

Query  282   GFVSYFYG----DIKNTKKDNNESSAE  214
             GF S+ YG      K   K   ES+ E
Sbjct  330   GFASHLYGAYVESSKKQAKKKEESNCE  356



>ref|XP_011016754.1| PREDICTED: purine permease 1-like [Populus euphratica]
Length=349

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 224/343 (65%), Gaps = 7/343 (2%)
 Frame = -1

Query  1248  EGQTRTTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPL  1069
             + Q +  M+  L+FL+C+++++G   GPLL+R+Y+L GG   W  +WL TAGF       
Sbjct  13    QHQNKKHMKAFLVFLNCMLMAVGQVAGPLLVRMYYLHGGKSNWLGAWLLTAGF------P  66

Query  1068  LVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSL  889
             ++            +       L+TP+L  A+ +LG+++G+D+Y YS+GM+ LPVS SS+
Sbjct  67    ILIIPISISYIRARARAQAGRLLVTPWLFSASVILGLVLGLDSYLYSFGMSYLPVSVSSI  126

Query  888   IVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGF  709
             + ++QL FTA FA+++VK KFT +S NAV L+T G+++LG     DRP+GES   Y+LGF
Sbjct  127   LGSSQLTFTAFFAYIIVKHKFTHYSINAVALMTFGSLILGFHMNGDRPSGESKGKYILGF  186

Query  708   VMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              MT+  AAL+G ++P +E +YLKA  +A++F LVL+ Q ++    T+F ++ M+INKDF+
Sbjct  187   FMTIGGAALHGFLMPALEFTYLKAG-KAITFDLVLQVQFLISMFATLFCSIPMIINKDFK  245

Query  528   VIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEIL  349
              I +EA EF LG TKYY + +  AIV Q   +G+LGVI   SSLL  L+ ++L+PV +  
Sbjct  246   AISKEAAEFGLGETKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAF  305

Query  348   AVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKKDNNESS  220
             AVI   E F A KG++L + +WGF SY YG+ +  + +  ES+
Sbjct  306   AVIILKEVFNAVKGMALAMCLWGFASYLYGEYQKPEANKEEST  348



>ref|XP_009801738.1| PREDICTED: purine permease 1-like isoform X1 [Nicotiana sylvestris]
Length=310

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 212/320 (66%), Gaps = 32/320 (10%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF++GG RIW S+WLQT  +P+ F+PL +SY    +  +D ++ + K  
Sbjct  16    GTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSLKNINDNNNNNTKVI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP + +A   +GVL G  NYFYSYG AKLPVSTS L+ ATQL FT GFAFL+ K KFT
Sbjct  76    LMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAFTTGFAFLIAKLKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++  NAV+LLT+G V+L L +G D+P GE+ K Y+LGF+MT+AAAAL GLI PL+EL Y 
Sbjct  136   SYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAALSGLIFPLVELIYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA  QA++++LVLEFQ +  FV TI +T+GM+INKDF                       
Sbjct  196   KAH-QAITYTLVLEFQTVYCFVATIVATIGMIINKDF-----------------------  231

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
                   F+F+G +GVI   SSL+S ++++VLLPVTEILAV  Y EK   +K   L  S++
Sbjct  232   -----LFYFLGTIGVIYSASSLVSGILISVLLPVTEILAVFIYGEKLVQKKEF-LLPSLY  285

Query  282   GFVSYFYGDI--KNTKKDNN  229
             G + + +  I  K  +K NN
Sbjct  286   GDLFHIFMVILKKARRKKNN  305



>ref|XP_004252530.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=364

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 220/324 (68%), Gaps = 5/324 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G LL+R+Y+L GG R W  ++L TAGFP++ +P+ +SY ++R+  ++ ++  R  F
Sbjct  38    GQISGVLLVRIYYLHGGKRKWLQAFLLTAGFPILILPISISYLKKRKKITNINNNIR--F  95

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L++ +A+LG+L+G+ +Y Y++GM+ LPVS SSL+ +T L FTA FA+ +VK KFT
Sbjct  96    FVTPKLAMFSAILGLLLGICSYLYTFGMSYLPVSISSLLSSTSLAFTAIFAYFMVKHKFT  155

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+ +G+++LGL    DRP GESN++Y LGFVMT+  AAL+G +   +E S++
Sbjct  156   DYSVNAVVLMMLGSIILGLHMNGDRPIGESNRSYALGFVMTLVGAALHGFVNAGVEYSHV  215

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA +  V+F LV++ Q ++     +F  V M+INKDF+ I REA EF LG  KYY++   
Sbjct  216   KAGV-VVTFDLVMQMQFLISMFSALFCIVAMIINKDFQAITREAEEFGLGQRKYYMILGL  274

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TAI  Q   +G LG+I   S+LL  ++ A+L+P+ +I AV+F  E F ++K ++L + +W
Sbjct  275   TAISLQIMIIGNLGMIFCSSALLLGIVNALLVPIQQIFAVMFLPESFNSDKWMALAMCLW  334

Query  282   GFVSYFYGDIKN--TKKDNNESSA  217
             GF SYFYG+ K   T K   +  A
Sbjct  335   GFASYFYGEYKESITNKVTKDKHA  358



>gb|EEE69873.1| hypothetical protein OsJ_29687 [Oryza sativa Japonica Group]
Length=341

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 187/238 (79%), Gaps = 2/238 (1%)
 Frame = -1

Query  966  LGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltv  787
            +GVL G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+ TA + NAV LLT+
Sbjct  85   VGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVALLTI  144

Query  786  gavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKL--QAVSFS  613
            GAVVLGL A  DRPAG +   Y +GF +T+ AAALYGLILPL+EL+Y  A    +AV+++
Sbjct  145  GAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYA  204

Query  612  LVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFV  433
            LV+E Q++MGF  T F TVG+++NKDF+ IPREA+++ELG  +YYV+ VF A++W+FFFV
Sbjct  205  LVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVLVFNAVLWEFFFV  264

Query  432  GALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYG  259
            GA+GVI    +LL+ +I+AV +P+TE+L VIF HEKF +EKG++L LS+WG  SY YG
Sbjct  265  GAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  322



>ref|XP_006360267.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=361

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 218/316 (69%), Gaps = 4/316 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G LL+R+Y+L GG R W  ++L TAGFP++ +P+ +SY ++R+  ++ ++      
Sbjct  36    GQISGVLLVRIYYLHGGKRKWLQAFLLTAGFPILILPISISYVKKRKKITNNNNIR---L  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L+I +A+LG+L+G+ +Y Y++GM+ LPVS SSL+ +T L FTA FA+ +VK KFT
Sbjct  93    FVTPKLAIFSAILGILLGICSYLYTFGMSYLPVSISSLLSSTSLAFTAIFAYFMVKHKFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+ +G+++LGL    DRP GESN+ Y LGFVMT+  AAL+G +   +E S++
Sbjct  153   DYSVNAVVLMMLGSIILGLHMNGDRPIGESNRRYTLGFVMTLVGAALHGFVNAGVEYSHV  212

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA +  V+F LV++ Q ++     +F  V M+INKDF+ I REA EF LG  KYY++   
Sbjct  213   KAGV-VVTFDLVMQMQFLISMFSALFCIVAMIINKDFQAITREAEEFGLGQRKYYMILAL  271

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TAI  Q   +G LG+I   S+LLS ++ A+L+P+ +I AV+F  E+F ++K ++L + +W
Sbjct  272   TAISLQTMIIGNLGMIFCSSALLSGIVNALLVPIQQIFAVMFLPERFNSDKWMALAMCLW  331

Query  282   GFVSYFYGDIKNTKKD  235
             GF SYFYG+ K++  +
Sbjct  332   GFASYFYGEYKDSMTN  347



>gb|EPS58881.1| hypothetical protein M569_15932 [Genlisea aurea]
Length=320

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 204/322 (63%), Gaps = 10/322 (3%)
 Frame = -1

Query  1158  IRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSI  979
             +RLYF  GG  +WF +WL +AG P+I +PL V+Y RRR   S        FF++ P L +
Sbjct  1     MRLYFAEGGGLVWFLTWLSSAGCPIILLPLAVNYVRRRSK-SAADGIMPPFFIVKPKLLV  59

Query  978   AAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavv  799
               A +G++   DNYFY YGM+KLPVST ++I ATQL FTAGFAFL+VKQKFT +S NAVV
Sbjct  60    CGAAIGIIAAADNYFYVYGMSKLPVSTFAIIGATQLAFTAGFAFLIVKQKFTPYSINAVV  119

Query  798   lltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVS  619
             LLT  A VL L A + R +GE +  Y  GF  T   A L+GLI+ L+ELSY K++ Q ++
Sbjct  120   LLTAAAAVLSLDAKNVRLSGEPSVDYWTGFCFTAGEAVLFGLIMSLVELSYSKSQ-QPMT  178

Query  618   FSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFF  439
             + LVLEFQ+ M     + S +GM     F  I  +A  FE G  KY  +A+FTA   Q F
Sbjct  179   YGLVLEFQLAMCSSACVCSAIGMAATGGFAKIRTDAAGFESGRAKYCAVALFTAAACQCF  238

Query  438   FVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYG  259
             F+GA+GV+ + SSL S +++  LL + EI AV+F+H++F A K ++LFLS+WGF SY YG
Sbjct  239   FLGAIGVVCFSSSLFSGVVLNSLLVLVEICAVVFFHDEFGAGKAVALFLSLWGFASYSYG  298

Query  258   D--------IKNTKKDNNESSA  217
             +        I     DN  S A
Sbjct  299   EYRIRVRVPIPGNDDDNVPSQA  320



>ref|XP_006360266.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=364

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 215/316 (68%), Gaps = 3/316 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G LL+R+Y+L GG R W  S L TAGFP++ +P+ +SY ++ +  +  ++  R F 
Sbjct  38    GQISGVLLVRIYYLHGGKRKWLQSLLLTAGFPILILPISISYMKKMKKITINNNNIRLF-  96

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L+I +A+LG+L G+ +Y Y+ GM+ LPVS SSL+ +T L FTA FA+ +VK KFT
Sbjct  97    -VTPKLAIFSAILGILFGICSYLYTIGMSYLPVSISSLLSSTSLAFTAIFAYFMVKHKFT  155

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+ +G+++LGL    DRP GESN+ Y LGFVMT+  AAL+G +   +E S++
Sbjct  156   HYSVNAVVLMMLGSIILGLHMNGDRPIGESNRQYTLGFVMTIIGAALHGFLNAGVEYSHV  215

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             KA +  V+F LV++ Q ++    ++F  V ++IN+DF+ I REA EF LG  KYY++   
Sbjct  216   KAGV-VVTFDLVMQIQFLISMFSSLFCIVAIIINRDFQAITREAEEFGLGQKKYYMILAL  274

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             TAI  Q   +G+LG+I   S+LL  ++ A+L+P+ +I AVIF  E F ++K ++L + +W
Sbjct  275   TAISLQTMMIGSLGMIFCSSALLFGIVNALLIPIQQIFAVIFLPESFNSDKWMALAMCLW  334

Query  282   GFVSYFYGDIKNTKKD  235
             GF SYFYG+ K++  +
Sbjct  335   GFASYFYGEYKDSMTN  350



>ref|XP_009801739.1| PREDICTED: purine permease 1-like isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 174/238 (73%), Gaps = 2/238 (1%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF++GG RIW S+WLQT  +P+ F+PL +SY    +  +D ++ + K  
Sbjct  16    GTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSLKNINDNNNNNTKVI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP + +A   +GVL G  NYFYSYG AKLPVSTS L+ ATQL FT GFAFL+ K KFT
Sbjct  76    LMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAFTTGFAFLIAKLKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++  NAV+LLT+G V+L L +G D+P GE+ K Y+LGF+MT+AAAAL GLI PL+EL Y 
Sbjct  136   SYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAALSGLIFPLVELIYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF-EVIPREAREFELGVTKYYVL  472
             KA  QA++++LVLEFQ +  FV TI +T+GM+INKDF E+   E  EFE   TK  +L
Sbjct  196   KAH-QAITYTLVLEFQTVYCFVATIVATIGMIINKDFLEIRATEDPEFETFYTKNILL  252



>ref|XP_010418647.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=248

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 168/228 (74%), Gaps = 4/228 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+CGGPL++RLYF  GG RIWFSS+LQT G P+I  PLL S+  RRR    E  +    F
Sbjct  20    GSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLSRRRL---EEQEKTSLF  76

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+ P L IA+ ++G+L+G DNY YSYG+A +PVST+SLI++ QL FTA FAF +VKQKFT
Sbjct  77    LMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFFMVKQKFT  136

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F+ NA+VLLTVGAVVL   + SD+ A E++K Y++GF+MT  AA LY  ILPL+EL+Y 
Sbjct  137   PFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAALLYAFILPLVELAYK  196

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFE  499
             K++ Q V+++LVLEFQM++ FV T F  VGM+ + DF+VI RE    E
Sbjct  197   KSR-QRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREXSTLE  243



>ref|XP_010939716.1| PREDICTED: purine permease 1-like isoform X1 [Elaeis guineensis]
Length=408

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 169/225 (75%), Gaps = 4/225 (2%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   GPLL+RLYFL+GG R W SSWLQT G+P++FIPL +SY  R   C     +  K +
Sbjct  37    GTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHR---CRCGGGRPIKLY  93

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A  +LG+LVG+D++ Y+YG++ LPVSTSS+++++QL FTA FAF +VKQKFT
Sbjct  94    LMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTALFAFFMVKQKFT  153

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FS NAVVLL++GAV+LGL A  DRP GESN  Y LGF MT+AAA LYG ILPL+EL+Y 
Sbjct  154   SFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYGFILPLVELTYA  213

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR  508
             KAK Q VS++LV+E Q+ MGF  T+F TVGM++N DF  I    R
Sbjct  214   KAK-QVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHNILVHCR  257



>ref|XP_009789614.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=271

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 184/237 (78%), Gaps = 5/237 (2%)
 Frame = -1

Query  1233  TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYH  1054
             T +RRILL ++C+IL++G CGGPL++RLY++ GG+R+WFSSWLQTAG+P+  IPL + Y 
Sbjct  8     TNLRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPLTLIPLAILYF  67

Query  1053  RRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQ  874
              RR+        + K + ITP + IA+ ++GV+ G+D++ YS+G +KLPVSTSSL++A Q
Sbjct  68    YRRK----TQGSNTKLYFITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQ  123

Query  873   LVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVA  694
             L FTA  AF +VK KFT +S NAV+LLTVGAV+LG+R+  DRP G ++KAY+LGF+MT+ 
Sbjct  124   LAFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDRPEGVTSKAYILGFMMTLL  183

Query  693   AAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVI  523
             AAALYG+ILP IEL YLKAK Q ++ +LVLE QMIM    T F T+GM++N DF+V+
Sbjct  184   AAALYGVILPCIELIYLKAK-QVITATLVLEIQMIMCLAATTFCTMGMIVNNDFQVL  239



>ref|XP_008779125.1| PREDICTED: purine permease 1-like [Phoenix dactylifera]
Length=261

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 165/218 (76%), Gaps = 6/218 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G    PLL+RLYFL+GG+R W S WL+T G+P++ IPL +SY  RRR          K +
Sbjct  36    GTTASPLLLRLYFLKGGSRKWLSGWLETVGWPLLLIPLAISYAHRRRG-----GGPTKLY  90

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L +A  +LG+L+G+D +  +YG++ LPVSTSS++++TQL FTA FAF +VKQKFT
Sbjct  91    LMTPPLFLACTVLGLLLGLDCFLNAYGLSYLPVSTSSILISTQLGFTALFAFFIVKQKFT  150

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             +FSTNAVVLL++GAV+LGL A  DRP GESN  Y LGF MT+AAA LY  ILPL+EL+Y 
Sbjct  151   SFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYAFILPLVELTYA  210

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             KAK Q VS++LV+E Q++MGF   +F TVGM++NKDF+
Sbjct  211   KAK-QVVSYTLVMEMQLVMGFFAAVFCTVGMLVNKDFQ  247



>ref|XP_009801740.1| PREDICTED: purine permease 1-like isoform X3 [Nicotiana sylvestris]
Length=237

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G CGGPL++RLYF++GG RIW S+WLQT  +P+ F+PL +SY    +  +D ++ + K  
Sbjct  16    GTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSLKNINDNNNNNTKVI  75

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP + +A   +GVL G  NYFYSYG AKLPVSTS L+ ATQL FT GFAFL+ K KFT
Sbjct  76    LMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAFTTGFAFLIAKLKFT  135

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             ++  NAV+LLT+G V+L L +G D+P GE+ K Y+LGF+MT+AAAAL GLI PL+EL Y 
Sbjct  136   SYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAALSGLIFPLVELIYK  195

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             KA  QA++++LVLEFQ +  FV TI +T+GM+INKDF
Sbjct  196   KAH-QAITYTLVLEFQTVYCFVATIVATIGMIINKDF  231



>ref|XP_004985414.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=376

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 208/346 (60%), Gaps = 17/346 (5%)
 Frame = -1

Query  1173  GGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLIT  994
             GG LLIR YF+ GG R+W S+ +Q +G+P++  P+  S   R R+  D +       L  
Sbjct  31    GGSLLIRAYFVHGGRRLWLSTMIQLSGWPLLLPPICASLLLRSRS-RDGAGGGVADHLPP  89

Query  993   PFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFS  814
             P L  A A+LG +  V  + YS G   LP+STSSL+ ATQL F A  AFL    +FT FS
Sbjct  90    PRLVRAVAVLGAVFAVACFAYSLGSQALPLSTSSLLQATQLTFNAVSAFLFAGLRFTPFS  149

Query  813   TNavvlltvgavvlglraGSDRPA-GESNKAYLLGFVMTVAAAALYGLILPLIELSYLK-  640
              NAVVLLT+G  VLG    S+  A  E + AY  GF+  +++AAL GL+LPL+E++  + 
Sbjct  150   VNAVVLLTIGPAVLGFAPSSETEAQAEGSTAYWTGFLECMSSAALIGLVLPLVEVAMSRY  209

Query  639   ---------AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVT  487
                      A+    S++ V++ Q +MG  GT    VGM I KDF+ IP EA  F LG T
Sbjct  210   GRRDGGPAAARAPPPSYATVMQIQAVMGAAGTAVCLVGMAIAKDFQAIPTEAAAFGLGET  269

Query  486   KYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKG  307
              YY+L +F A+ WQ   +G +G+I   SSLL+ +++A++LP++E+LAVIF HEKF+  KG
Sbjct  270   NYYLLLIFGAVSWQLSNLGIMGLIVCSSSLLAGIMIALVLPLSEVLAVIFLHEKFDGVKG  329

Query  306   ISLFLSIWGFVSYFYGD-----IKNTKKDNNESSAETEMTSAPTVA  184
             I+L L +WGFVSY YG+     +K T K   E S + E    P VA
Sbjct  330   IALVLCLWGFVSYLYGESARKKMKATGKQVAEGSKDLESIRCPLVA  375



>emb|CBI19192.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 171/239 (72%), Gaps = 7/239 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPLL+R+Y+L GG R W ++WL T+GFP++ +P+  SY R       ++       
Sbjct  36    GQVGGPLLLRIYYLHGGKRKWLNAWLLTSGFPILILPMAFSYLR------AQAKGQATVL  89

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L+TP L  A+A LG+L+G+D Y YS+G++ LP+S SSL+ +TQL FTA FAF++VK KFT
Sbjct  90    LVTPRLVAASAFLGILLGLDGYLYSFGLSYLPISVSSLLGSTQLAFTAIFAFIVVKHKFT  149

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +S NAVVL+T G++VLGL    DRP+G S+  YLLGF+MT+ AAAL+G I+P +E ++L
Sbjct  150   HYSVNAVVLMTFGSIVLGLHMNGDRPSGVSDGKYLLGFLMTLGAAALHGFIMPALEYTHL  209

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAV  466
             KA +  ++F LV++ Q ++    T+F T+ MVINKDF+ + +EA E+ LG TKYY++++
Sbjct  210   KAGM-PITFDLVMQIQFLISMFATLFCTIPMVINKDFQAVSKEAAEYGLGETKYYMVSI  267



>dbj|BAG88745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 166/227 (73%), Gaps = 8/227 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKS----  1015
             G+  GPLL+R YFLRGGNR W SS LQTAG+P++  PL  SY  RRR    E   +    
Sbjct  50    GSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRRRRREVEDDGAGAGA  109

Query  1014  --RKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLL  841
                  FL+TP L +A+A++G++ GVD+  Y+YG+A LPVSTSS++++TQL FTA FA LL
Sbjct  110   AATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLL  169

Query  840   VKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPL  661
             V+Q+FTAFS NAVVLL+VGA +LG+ AG DRPAG S   Y  GF MT+AAAALYGL+LP+
Sbjct  170   VRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAMTLAAAALYGLVLPV  229

Query  660   IELS--YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEV  526
             +ELS  +  A   AV+++LV+E Q+++GFV T FS VGM++N DF V
Sbjct  230   MELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHV  276



>gb|EMS63809.1| Purine permease 3 [Triticum urartu]
Length=284

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  957  LVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgav  778
            + G+D+  Y+YG+A LPVSTSS++++TQL FTA FA LLV+Q+FTAFS NAVVLL+VGA 
Sbjct  1    MTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAA  60

Query  777  vlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQ---AVSFSLV  607
            +LG+ AG DRPAG +   Y  GF MT+ AAALYGL+LP++ELS  K   +   AV+++LV
Sbjct  61   MLGMNAGGDRPAGVTRAQYSAGFGMTLGAAALYGLMLPVMELSQAKHAARTGAAVTYTLV  120

Query  606  LEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGA  427
            +E Q+++GF  T FS VGM++N DF  IPREAREF LG   YY+L   +AIV+QFFF+G 
Sbjct  121  MEMQIVIGFTATAFSAVGMLVNNDFHAIPREAREFGLGQIGYYLLLAASAIVYQFFFLGT  180

Query  426  LGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEK  310
            +G I YGS+LL+ +I+ VL+PVTE+LAV+F+HE F   K
Sbjct  181  IGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTK  219



>ref|XP_003602861.1| Purine permease [Medicago truncatula]
Length=274

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 172/241 (71%), Gaps = 9/241 (4%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRR  1048
             M+R LL ++C+ILS+G C  PL++RLYF+ GG R+W S++LQTAGFP++ IPL +SY +R
Sbjct  13    MKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLMLIPLAISYIKR  72

Query  1047  RR------ACSDESSKSRKFFLIT--PFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSS  892
              R        +  S    K  +I+  P +  AAA +G+L G+D+Y ++YG+A+LPVSTS+
Sbjct  73    HRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAYGVARLPVSTSA  132

Query  891   LIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLG  712
             LI+A+QL FTA FAFL+VK+KFTAF+ NAVVLLTVGA VL +   SDRPAG S K Y + 
Sbjct  133   LIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRPAGVSAKQYWIS  192

Query  711   FVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDF  532
             F  TVAA+ALYG ILP +EL Y K K Q V++S V+EFQ +     T+F  +GM+ N DF
Sbjct  193   FSTTVAASALYGFILPSVELVYKKIK-QPVTYSFVMEFQFVTCMFATLFCAIGMIANNDF  251

Query  531   E  529
             +
Sbjct  252   K  252



>gb|KHN08969.1| Purine permease 1, partial [Glycine soja]
Length=206

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = -1

Query  753  DRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVG  574
            DRP GES K Y++GFVMTV AAALYG +LPLIEL Y K K Q +++SLV+E Q +M F  
Sbjct  20   DRPPGESVKEYVMGFVMTVIAAALYGFVLPLIELVYQKIK-QPLTYSLVMEIQFVMCFSA  78

Query  573  TIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssll  394
            T+F  +GM+IN DF+VIPREA++FE G   YY + V +AI+WQ FF+GA+GVI   SSL 
Sbjct  79   TLFCLLGMIINNDFKVIPREAKQFEHGEGSYYAVLVGSAIIWQAFFLGAIGVIFCASSLF  138

Query  393  salivavlLPVTEILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNT---KKDNNES  223
            S +++AVLLPVTE+LAVIFY EKF+AEKG+SL LS+WG VSYFYG+IK++   KK N++ 
Sbjct  139  SGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSRKRKKKNSDP  198

Query  222  SAETEMTS  199
             AE    S
Sbjct  199  EAEPSQYS  206



>ref|XP_009380885.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=266

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = -1

Query  1227  MRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSY-HR  1051
             +RR+L+ L+C+++++GN GGPLL+RLYF  GG R W SSWL T G+P+IF+PLLV+Y HR
Sbjct  27    LRRVLIGLNCVLMALGNTGGPLLLRLYFRSGGKRQWLSSWLVTGGWPLIFLPLLVTYLHR  86

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RR           K F ITP L +A A LG+L G+D++ Y+YG++ LPVSTSSL+++TQL
Sbjct  87    RRHQIRPSHIHPTKLFFITPRLFLACAFLGLLTGLDDFLYAYGLSFLPVSTSSLLISTQL  146

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FTA FAFL+VKQKFT +S N+V LLTVGA +LGL   SDRP   +   Y +GF++T+ +
Sbjct  147   AFTAFFAFLIVKQKFTPYSINSVALLTVGAAILGLHVSSDRPDNVTKSEYYMGFILTLGS  206

Query  690   AALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMG  583
             AALY LILPL++L Y K+K QA++++LV+E Q++ G
Sbjct  207   AALYALILPLVQLMYAKSK-QAITYTLVMEVQLVRG  241



>ref|XP_006661331.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=269

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 164/214 (77%), Gaps = 5/214 (2%)
 Frame = -1

Query  843  LVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILP  664
            +V+Q+ TA + NAV LLT+GAVVLGL   +DRPAG +N  Y +GF +T+ AAALYGLILP
Sbjct  55   VVRQRLTAATLNAVALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILP  114

Query  663  LIELSYLKAKL--QAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGV  490
            L+EL+Y  A    +AV+++LV+E Q++MGF  T F TVGM++NKDF+ IPREA+++ELG 
Sbjct  115  LVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMIVNKDFQAIPREAKQYELGE  174

Query  489  TKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEK  310
            T+YY + VF+AI+W+FFFVGA+GVI    +LL+ +I+AV +P+TE+L VIF HEKF +EK
Sbjct  175  TRYYTVLVFSAILWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEK  234

Query  309  GISLFLSIWGFVSYFYG---DIKNTKKDNNESSA  217
            G++L LS+WG  SY YG   D K  K+  +E+ A
Sbjct  235  GVALVLSLWGLASYSYGEYTDAKAKKRAASEAGA  268



>gb|ABR16480.1| unknown [Picea sitchensis]
Length=367

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 201/325 (62%), Gaps = 11/325 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G     LL R YF  GG+  W S+ LQT G+P++ IPL++           +  ++ K  
Sbjct  53    GQAAATLLSRYYFAYGGDSRWISTLLQTVGWPILLIPLVLY----------QGKEASKLT  102

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L +    LG+L+  DN  YS+G++ +P ST SL+ ++QL F A FAF+L++QK T
Sbjct  103   PLTPKLVLIYVALGLLLAGDNLLYSWGVSFMPASTYSLLCSSQLAFNAVFAFMLIRQKIT  162

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              +  N++VLLT+ A++LG+ + SDRP G +   +++GF+ T+AA+A+YGL+LPL++L + 
Sbjct  163   PYIVNSLVLLTLSAILLGVHSDSDRPEGVNTAKHIVGFICTIAASAIYGLLLPLMQLVFD  222

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVLAVF  463
             +  ++  +F++VLE Q+    V T+   VG+ ++ +F  I  EA  F  G   YY+  ++
Sbjct  223   RV-IKKETFAVVLEMQIYTSLVATVVCIVGLFVSGEFRDIKEEAHSFTRGKVAYYMTLIW  281

Query  462   TAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSIW  283
             +AI WQ   VG +G+I   SSL S +I  + LPV  IL+V F+H+K +A K IS+ LSIW
Sbjct  282   SAIGWQVCSVGVVGLIFLVSSLFSNVISTLALPVVPILSVGFFHDKMDALKIISMLLSIW  341

Query  282   GFVSYFYGDIKNTKKDNNESSAETE  208
             GFVSY +G   ++K      +A  E
Sbjct  342   GFVSYIFGGYVDSKPAMGSKNAARE  366



>ref|XP_002977418.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
 gb|EFJ21422.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
Length=388

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/321 (40%), Positives = 194/321 (60%), Gaps = 13/321 (4%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G LL R YF  GG+R W S+WLQT+G+P++ +     Y +R            K  
Sbjct  75    GMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYWKR----------GIKLT  124

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L+     LG L  +DN+ Y+YG+A LP ST+ L+ ++QL F A FA ++ +Q+  
Sbjct  125   PLTPALAATYIALGFLGALDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRIN  184

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELS--  649
              F  NA+VL++  A++L L +  ++  G + K  +LG+VMT+ AAAL+GL+ PLIEL+  
Sbjct  185   PFGWNAIVLVSSAAMILALHSDDEKLPGVTRKEVVLGYVMTIGAAALFGLLYPLIELAIR  244

Query  648   -YLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVL  472
              +L       + ++VLE Q ++  + T  ++V M IN DF  IP E+R F+ G   YY+ 
Sbjct  245   KFLTRSSDGGAAAVVLEMQTLLSLISTAVASVAMAINHDFLAIPGESRRFKAGAASYYLT  304

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              V TA+ WQF F+G LG+I   SSLL+ +I+A+ +P+  I AVIF+ + F   K +S+ L
Sbjct  305   LVSTAVSWQFAFLGTLGIIFLSSSLLAGVILALAIPIGSIFAVIFFGDSFGGVKIMSMLL  364

Query  291   SIWGFVSYFYGDIKNTKKDNN  229
             S+WGFVSY +G   + KK + 
Sbjct  365   SLWGFVSYTFGGYVDMKKASK  385



>tpg|DAA40289.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=281

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 174/253 (69%), Gaps = 7/253 (3%)
 Frame = -1

Query  1230  TMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHR  1051
             TMRR+L+  +C++L++G  GG LL RLYF +GG+R W S WLQT G+P++  P+  SY R
Sbjct  16    TMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLLPPVAASYVR  75

Query  1050  RRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQL  871
             RR   +   S         P + +AAA LG++ GVDN  Y++G+  LPVSTS+++++TQL
Sbjct  76    RR---ARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAILISTQL  132

Query  870   VFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAA  691
              FT  FAFL+V+Q+ T  + NAV LLTVGAVVLGL   SDRPAG +   Y LGF +T+ A
Sbjct  133   AFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGFTLTLGA  192

Query  690   AALYGLILPLIELSYLKAK--LQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPR  517
             A LYGL LPL+EL+Y  A    +AV+++LV+E Q++MGFV T F TVGM++NKDF+V  R
Sbjct  193   AVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKDFQV--R  250

Query  516   EAREFELGVTKYY  478
             +A    +   + +
Sbjct  251   DAPHIRVAYIRTF  263



>gb|EAZ09428.1| hypothetical protein OsI_31702 [Oryza sativa Indica Group]
Length=262

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 156/222 (70%), Gaps = 7/222 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL+ RLYF +GG+R W S+WL+TAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPLISRLYFSKGGHRQWLSAWLETAGWPLLLVPVSASYLGRR-----ARDRGAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A   LGVL G D++ Y+YG+  LPVSTS+++ +T L FT  FA L+V+Q+ T
Sbjct  93    LTPRRVLLACVGLGVLTGADDFIYAYGLDYLPVSTSAILTSTHLAFTVFFACLIVRQRLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY-  646
             A + NAV LLT+GAVVLGL    DRPAG +N  Y +GF + + AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHVSKDRPAGVTNGKYWMGFFLIIGAAALYGLILPLVELAYK  212

Query  645   -LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVI  523
              + A+ +AV+++LV+E Q++MGF  T F TVGMV+NKDF+VI
Sbjct  213   HVAARGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQVI  254



>gb|EEE69876.1| hypothetical protein OsJ_29691 [Oryza sativa Japonica Group]
Length=265

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 7/220 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL+ RLYF +GG+R W S+WLQTAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR-----ARDRRAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A   LG L G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+FT
Sbjct  93    LTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRFT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAV LLT+GAVVLGL A  DRPAG ++  Y +GF +T+ AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYGLILPLVELAYK  212

Query  642   KAK--LQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              A    +AV+++LV+E Q++MGF  T F TVGMV+NKDF+
Sbjct  213   HAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ  252



>gb|EEC84725.1| hypothetical protein OsI_31703 [Oryza sativa Indica Group]
Length=265

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 156/220 (71%), Gaps = 7/220 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL+ RLYF +GG+R W S+WLQTAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR-----ARGRRAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A   LG L G D++ Y+YG+A LPVSTS+++++TQL FT  FA L+V+Q+ T
Sbjct  93    LTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAV LLT+GAVVLGL A  DRPAG ++  Y +GF +T+ AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYGLILPLVELAYK  212

Query  642   KAK--LQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              A    +AV+++LV+E Q++MGF  T F TVGMV+NKDF+
Sbjct  213   HAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ  252



>dbj|BAJ96346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 209/327 (64%), Gaps = 14/327 (4%)
 Frame = -1

Query  1179  NCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFL  1000
               GGPLL+R+YF+ GG R+W S+ LQ +G+P++  P+ VS  R RR             L
Sbjct  53    GAGGPLLLRVYFVHGGQRLWLSALLQISGWPLLLPPMCVSLFRGRR-------HGIANLL  105

Query  999   ITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTA  820
             + P L +AAA+LG    V  Y Y+ G   LP+STSSL++ATQL FTA FAFL V  +FT 
Sbjct  106   LPPRLVVAAAVLGGFYAVSCYVYAMGSQALPLSTSSLLLATQLAFTAVFAFLFVGLRFTP  165

Query  819   FSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLK  640
             FS NAV+LL +G  VLG+  G+ +PAG ++KAY  GF   +AAAAL GL+LPL+E+S  +
Sbjct  166   FSANAVLLLIIGPAVLGVGPGAGKPAGVTSKAYWTGFCEGIAAAALAGLVLPLVEVSMER  225

Query  639   -------AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKY  481
                    A      +S V++ Q +MG  GT+   +GM I  DF  +  EA  F LG TKY
Sbjct  226   YGRRTGPAARAPPPYSTVMQMQAVMGAAGTLVCLLGMAIKSDFGALRSEAAAFGLGETKY  285

Query  480   YVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGIS  301
             Y++ V+ A+ WQ   +G +G+I++ SSLL+ +++AVLLP+++ILAV+F HEKF+  KGI+
Sbjct  286   YLVLVWDAVSWQLLNLGIMGLITFASSLLAGIMIAVLLPLSQILAVLFLHEKFDGPKGIA  345

Query  300   LFLSIWGFVSYFYGDIKNTKKDNNESS  220
             L LS+WGF SY YG+    KK     S
Sbjct  346   LVLSLWGFASYMYGEKVQQKKAEAHKS  372



>ref|NP_001063426.2| Os09g0467500 [Oryza sativa Japonica Group]
 dbj|BAF25340.2| Os09g0467500 [Oryza sativa Japonica Group]
Length=253

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 154/220 (70%), Gaps = 7/220 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  GGPL+ RLYF +GG+R W S+WL+TAG+P++ +P+  SY  RR        +    F
Sbjct  38    GTTGGPLISRLYFSKGGHRQWLSAWLETAGWPLLLVPVSASYLGRR-----ARDRGAPLF  92

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L    + +A   LGVL G D++ Y+YG+  LPVSTS+++ +T L FT  FA L+V+Q+ T
Sbjct  93    LTPRRVLLACVGLGVLTGADDFIYAYGLDYLPVSTSAILTSTHLAFTVFFACLIVRQRLT  152

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSY-  646
             A + NAV LLT+GAVVLGL    DRPAG +N  Y +GF + + AAALYGLILPL+EL+Y 
Sbjct  153   AATLNAVALLTIGAVVLGLHVSKDRPAGVTNGKYWMGFFLIIGAAALYGLILPLVELAYK  212

Query  645   -LKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
              + A+ +AV+++LV+E Q++MGF  T F TVGMV+NKDF+
Sbjct  213   HVAARGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ  252



>ref|XP_004959528.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=279

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 175/254 (69%), Gaps = 10/254 (4%)
 Frame = -1

Query  1269  DLKALKMEGQTR---TTMRRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQT  1099
             DL+A       R   TTMRR+L+ L+C++L +G  GG LL RLY+  GG+R W S+WLQT
Sbjct  2     DLEARNHSPPARSKSTTMRRLLMALNCVLLGVGITGGQLLSRLYYNNGGHRQWLSAWLQT  61

Query  1098  AGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGM  919
             AG+P++ IP+  SY  RR        +     L  P + +AAA LG++ G D++ Y++G+
Sbjct  62    AGWPLLLIPVAGSYASRR-----ARDRGAPVLLCPPRVLLAAAGLGLITGADDFLYAWGL  116

Query  918   AKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAG  739
               LPVSTS+++++TQLVFT  FAFLLV Q+ TA + NAV LLTVGAVVLGL   SDRPAG
Sbjct  117   KFLPVSTSAILISTQLVFTVLFAFLLVGQRLTAPTMNAVALLTVGAVVLGLHVSSDRPAG  176

Query  738   ESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAK--LQAVSFSLVLEFQMIMGFVGTIF  565
              +   Y LGF +T+ AA LYG+ +PL+EL+Y  A    +A+++++ +E Q+++GFV T F
Sbjct  177   VTRGQYWLGFALTLGAAVLYGVFMPLVELAYRCAAGGGRALTYAVAVELQLVIGFVATAF  236

Query  564   STVGMVINKDFEVI  523
              T GMV+NKDF+V+
Sbjct  237   CTAGMVVNKDFQVV  250



>emb|CDP05635.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 4/175 (2%)
 Frame = -1

Query  1158  IRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSI  979
             +RLYF++GG RIW S WLQT GFP+I  PLL+SY   R+     +    K  L+   L I
Sbjct  1     MRLYFVKGGKRIWLSGWLQTVGFPIIASPLLISYFHDRKTEGPNT----KLVLMKYPLFI  56

Query  978   AAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavv  799
             AAA++G+L  + NY Y+YGMA+LPVSTSS+I+A+QL FTA FAFLLVKQKF A+S NA+V
Sbjct  57    AAAVIGLLTSIGNYLYAYGMARLPVSTSSIIIASQLAFTAVFAFLLVKQKFVAYSVNAIV  116

Query  798   lltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLKAK  634
             LL VGA VL +   SDRP GES K Y+LGF+MT+AAAALYGLILP++EL YLK K
Sbjct  117   LLAVGARVLAMHISSDRPKGESTKMYVLGFLMTLAAAALYGLILPVVELMYLKTK  171



>ref|XP_006826553.1| hypothetical protein AMTR_s02825p00003100, partial [Amborella 
trichopoda]
 gb|ERM93790.1| hypothetical protein AMTR_s02825p00003100, partial [Amborella 
trichopoda]
Length=245

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 159/218 (73%), Gaps = 7/218 (3%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G  G PL+ RLYF+ GG R W ++W+QTA FP++ IPL +S     +  S   S+ R+  
Sbjct  35    GATGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLS-----KISSTSQSQRRQSH  89

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             +  P L++ +A +G+L+G+D+Y Y++G++ LP+STS+L+V+TQL FTA FAFL+V Q+FT
Sbjct  90    VTFP-LALQSAGIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFT  148

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
             A + NAVVLL++G+V+LGLRA  DRP G +   Y LGFV+T+ AAAL GL+ PLIEL Y+
Sbjct  149   AHTINAVVLLSLGSVLLGLRASGDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYV  208

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFE  529
             K+K Q V+F LV+E   +M  V T F T+GMVINKDF+
Sbjct  209   KSK-QIVTFGLVMEMLFVMSVVATGFCTIGMVINKDFQ  245



>gb|EMS56378.1| hypothetical protein TRIUR3_06439 [Triticum urartu]
Length=394

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 208/327 (64%), Gaps = 14/327 (4%)
 Frame = -1

Query  1179  NCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFL  1000
               GGPLL+R+YF+ GG R+W S+ LQ +G+P++  PL VS  R RR             L
Sbjct  53    GAGGPLLLRVYFVHGGQRLWLSALLQISGWPLLLPPLCVSLFRGRR-------HGIANLL  105

Query  999   ITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTA  820
             + P L +AAA+LG    V  Y Y+ G   LP+STSSL++ATQL FTA FAFL V  +FT 
Sbjct  106   LPPRLVVAAAVLGGFYAVSCYVYAMGSQALPLSTSSLLLATQLAFTAVFAFLFVGLRFTP  165

Query  819   FSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLK  640
             FS NAV+LL +G  VLG+  G+ +PAG ++KAY  GF   +AAAAL GL+LPL+E++  +
Sbjct  166   FSANAVLLLIIGPAVLGVGPGAGKPAGVTSKAYWTGFCEGIAAAALAGLVLPLVEVAMER  225

Query  639   -------AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKY  481
                    A      +S V++ Q +MG  GTI   +GM I  DF  +  EA  F LG T Y
Sbjct  226   YGRRTGPAARTPPPYSTVMQMQAVMGAAGTIVCLLGMAIKSDFGALRSEAAAFGLGETNY  285

Query  480   YVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGIS  301
             Y++ V+ A+ WQ   +G +G+I+  SSLL+ +++AVLLP+++ILAV+F HEKF+  KGI+
Sbjct  286   YLVLVWDAVSWQLLNLGIMGLITCASSLLAGIMIAVLLPLSQILAVMFLHEKFDGPKGIA  345

Query  300   LFLSIWGFVSYFYGDIKNTKKDNNESS  220
             L LS+WGF SY YG+    KK   + S
Sbjct  346   LVLSLWGFASYMYGEKVQQKKLEAQKS  372



>ref|XP_002977419.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
 gb|EFJ21423.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
Length=380

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 191/322 (59%), Gaps = 17/322 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G   G LL R YF  GG+R W S+WLQT+G+P++ +     Y +R            K  
Sbjct  68    GTVVGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYWKR----------GIKLT  117

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
              +TP L+     LG LV + ++ Y+YG++ LP STS L+ ++QL F A FA ++ +QK  
Sbjct  118   PLTPALAATYTALGFLVALYSFMYAYGLSYLPASTSGLLSSSQLAFNAIFALIITRQKIN  177

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
              F  NA+VL+T  AV+L L +  ++  G + K  +LG+VMT+ AAAL G   P+ EL   
Sbjct  178   PFGWNAIVLVTSAAVILALHSDDEKLPGVTRKEVVLGYVMTIVAAALSGFFFPITELVIR  237

Query  642   K----AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYV  475
             K    +     + +++LE Q ++  + T  S+V M IN DF  IP E+R F+ G  +YY+
Sbjct  238   KFLTGSSRSGDAATVLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYI  297

Query  474   LAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLF  295
               V TA+ WQF F+G LG+I   SSLL+ +I+A+ +P+  I AVIF+ + F   K +S+ 
Sbjct  298   TLVSTAVSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSML  357

Query  294   LSIWGFVSYFYG---DIKNTKK  238
             LS+WGFVSY YG   D+KN  +
Sbjct  358   LSLWGFVSYTYGGYMDMKNKSE  379



>ref|XP_002465736.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
 gb|EER92734.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
Length=370

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 201/332 (61%), Gaps = 16/332 (5%)
 Frame = -1

Query  1173  GGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF--L  1000
             GG LLIR+YF++GG  +W S+ +Q +G+P++  P+ +S   R R    +          L
Sbjct  23    GGSLLIRVYFVQGGQSLWLSTMIQVSGWPLLLPPICISLLLRSRRRDRDRDGGYSIADDL  82

Query  999   ITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTA  820
             + P L  A A+LGVL  +  Y YS G   LP++TSSL+ ATQL F A  AF+    +FT 
Sbjct  83    LQPRLVGAVAVLGVLFALACYAYSLGSQALPLTTSSLLQATQLAFNALCAFVFAGIRFTP  142

Query  819   FSTNavvlltvgavvlglraGS--DRPAGE-SNKAYLLGFVMTVAAAALYGLILPLIELS  649
             FS NAVVLLTVG  VLG+   S  +  +GE S  AY  GF   +A+AAL GL++PL E++
Sbjct  143   FSVNAVVLLTVGPAVLGVGPSSSDETVSGEGSRTAYWAGFTECMASAALMGLVVPLFEVA  202

Query  648   YLKAKLQAV-----------SFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREF  502
               +   +             S+  V++ Q +MG  GT+   VGM + ++F+ +PREA  F
Sbjct  203   MSRYGRRTAPAGGAFTGAPPSYVTVMQVQAVMGAAGTVLCLVGMAVMEEFQAVPREAATF  262

Query  501   ELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKF  322
              LG T Y ++ +F  + WQ   +G +G+++  SSLL+ +++A+LLP++E+LAV+F HEKF
Sbjct  263   GLGETSYCLVLIFGTVSWQLCNLGIMGLVACSSSLLAGIMLALLLPLSEVLAVVFLHEKF  322

Query  321   EAEKGISLFLSIWGFVSYFYGDIKNTKKDNNE  226
             +  KG++L L +WGFVSY YG+    KK   +
Sbjct  323   DGVKGVALVLCLWGFVSYLYGESAQNKKLTKD  354



>ref|XP_004959524.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=257

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 175/251 (70%), Gaps = 8/251 (3%)
 Frame = -1

Query  1269  DLKALKMEGQTRTTM-RRillflsciilsIGNCGGPLLIRLYFLRGGNRIWFSSWLQTAG  1093
             D++A K    TR  + RR+L+ L+C +L++G   GPLL RLY+ +GG R W S+WLQ+AG
Sbjct  2     DVEARKDSSPTRGKLVRRLLVALNCGMLALGTTAGPLLTRLYYDKGGQREWLSAWLQSAG  61

Query  1092  FPVIFIPLLVSYHRRRRACSDESSKSRKFFLITPFLSIAAALLGVLVGVDNYFYSYGMAK  913
             +P++ +P+  SY  RR AC   +       L  P + +AAA LGV  G DN+ Y+  +  
Sbjct  62    WPLLLVPVAASYAARR-ACDWRA----PLLLTPPRVLLAAAGLGVATGADNFIYALSLRY  116

Query  912   LPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFSTNavvlltvgavvlglraGSDRPAGES  733
             LPVSTS+++++TQL FT  FAFL+V+Q+ TA + NAV LLT GA VLGL   SDRPAG +
Sbjct  117   LPVSTSAILISTQLAFTVFFAFLIVRQRLTATTVNAVALLTAGAAVLGLHVSSDRPAGAT  176

Query  732   NKAYLLGFVMTVAAAALYGLILPLIELSYLKAK--LQAVSFSLVLEFQMIMGFVGTIFST  559
                YL+GF + + AAALYGLILP++EL+Y +A    +AV+++LV+E Q++MGF  T F T
Sbjct  177   KGQYLMGFALALGAAALYGLILPMVELAYKRAAGGGRAVTYALVMEMQLVMGFFATAFCT  236

Query  558   VGMVINKDFEV  526
             VGM++NKDF+V
Sbjct  237   VGMIVNKDFQV  247



>ref|XP_006859063.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
 gb|ERN20530.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
Length=376

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/333 (37%), Positives = 194/333 (58%), Gaps = 15/333 (5%)
 Frame = -1

Query  1182  GNCGGPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFF  1003
             G+    +L R YF+ GG+  W S+W+Q+ GFP++ +P+ +S+              R F 
Sbjct  44    GSISASMLSRFYFMHGGSSRWLSTWVQSIGFPLLLMPIYLSHL--------TGHSPRPFS  95

Query  1002  LITPFLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFT  823
             L TP L  A   LG+L+G++N+ YS+G++ + V+T+SL+++TQL F A F+F+LVKQK +
Sbjct  96    LFTPKLLYACFGLGLLIGINNFLYSWGISYISVTTASLLLSTQLAFNAIFSFVLVKQKIS  155

Query  822   AFSTNavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYL  643
               S N +VLLT  +++L L +  D P G +   Y+LGF+ T+ AA L+ + LPL+E+ Y 
Sbjct  156   FPSMNCIVLLTSSSILLALSSSQDMPKGVTKFQYILGFLSTLGAAGLFAIYLPLMEMVYK  215

Query  642   KAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAR-EFELGVTKYYVLAV  466
             K      +++LV+E Q++M    T+F+T+GMV +  F  +  EA  +FELG   Y +  V
Sbjct  216   KLTSIKFTYALVMEMQLVMSISATLFATIGMVGDGAFREMREEANGKFELGRLSYILTVV  275

Query  465   FTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFLSI  286
                I WQF F+   G+I   +SL+  + ++ LLP+  +   + + + F  EK IS  L +
Sbjct  276   GGVISWQFCFMATTGLIFLTTSLMCGICMSALLPLIVVAGAVIFKDDFSGEKWISTVLCM  335

Query  285   WGFVSYFYGDIKNT------KKDNNESSAETEM  205
             WGF SY YG+ K        K++N E      M
Sbjct  336   WGFFSYLYGERKKNQEVVGLKRENGERDRGRSM  368



>dbj|BAJ95836.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95854.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 207/324 (64%), Gaps = 14/324 (4%)
 Frame = -1

Query  1170  GPLLIRLYFLRGGNRIWFSSWLQTAGFPVIFIPLLVSYHRRRRACSDESSKSRKFFLITP  991
             GPLL+R+YF+ GG R+W S+ +Q +G+P++  PL VS  R RR             L+  
Sbjct  55    GPLLLRVYFVHGGQRLWLSALVQISGWPLLLPPLCVSLFRGRR-------HGIANLLLPA  107

Query  990   FLSIAAALLGVLVGVDNYFYSYGMAKLPVSTSSLIVATQLVFTAGFAFLLVKQKFTAFST  811
              L   A +LG L  V  Y Y+ G   LP+STSSL++ATQL FTA FAFL V  +FT FS 
Sbjct  108   RLVGTAVVLGSLYAVSCYVYAMGSQALPLSTSSLLLATQLAFTAVFAFLFVGLRFTPFSA  167

Query  810   NavvlltvgavvlglraGSDRPAGESNKAYLLGFVMTVAAAALYGLILPLIELSYLK---  640
             NAV+LLT+G  VLG+  GS +PAGE +K Y  GF   +AAAAL GL+LPL+E++  +   
Sbjct  168   NAVMLLTIGPAVLGVGPGSGKPAGEPSKTYWTGFCEAIAAAALAGLVLPLVEVAMERFGR  227

Query  639   ----AKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINKDFEVIPREAREFELGVTKYYVL  472
                 A      +S V++ Q +MG  GT+   +GM I  DF+ +P EA  + LG TKYY++
Sbjct  228   RTGPAARAPPPYSTVMQMQAMMGAAGTMVCLLGMAIKTDFKAMPSEAAAYGLGETKYYLV  287

Query  471   AVFTAIVWQFFFVGALGVISYGssllsalivavlLPVTEILAVIFYHEKFEAEKGISLFL  292
              V+ A+ WQ   +G +G+I+  SSLL+ ++VAVLLP++E+LAVIF HEKF+  KGI+L L
Sbjct  288   LVWGAVSWQMLNLGVVGLITCASSLLAGIMVAVLLPLSEVLAVIFLHEKFDGPKGIALVL  347

Query  291   SIWGFVSYFYGDIKNTKKDNNESS  220
             S+WGF SY YG+    KK   + S
Sbjct  348   SLWGFASYMYGEKVQQKKLEAQKS  371



>gb|KHN08292.1| Purine permease 1 [Glycine soja]
Length=176

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 135/171 (79%), Gaps = 4/171 (2%)
 Frame = -1

Query  717  LGFVMTVAAAALYGLILPLIELSYLKAKLQAVSFSLVLEFQMIMGFVGTIFSTVGMVINK  538
            +GFVMTV AAALYG ILPL+EL Y K K Q +++SLV+E Q +M F  T+F  +GM+IN 
Sbjct  1    MGFVMTVIAAALYGFILPLVELVYKKIK-QPLTYSLVMEIQFVMCFSATLFCLLGMIINN  59

Query  537  DFEVIPREAREFELGVTKYYVLAVFTAIVWQFFFVGALGVISYGssllsalivavlLPVT  358
            DF+VIPREA++FE G   YY + V +AI+WQ FF+GA+GVI   SSL S +++AVLLPVT
Sbjct  60   DFKVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVT  119

Query  357  EILAVIFYHEKFEAEKGISLFLSIWGFVSYFYGDIKNTKK---DNNESSAE  214
            E+LAVIFY EKF+AEKG+SL LS+WG VSYFYG+IK++KK    N+++ AE
Sbjct  120  EVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMKMKNSDTEAE  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3374802091560