BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25280_g1_i5 len=1324 path=[975:0-41 1017:42-70 6655:71-93
6678:94-117 4323:118-141 14994:142-407 4613:408-445 14847:446-484
14886:485-520 4726:521-544 14945:545-548 4754:549-574 584:575-612
622:613-656 1699:657-688 1731:689-733 13555:734-763 4965:764-836
16074:837-840 5042:841-868 15938:869-910 5112:911-949 884:950-967
902:968-1005 17093:1006-1009 16221:1010-1045 17119:1046-1046
5245:1047-1323]

Length=1324
                                                                      Score     E

gb|AEQ28336.1|  threonine deaminase                                     509   1e-171   
gb|EYU41567.1|  hypothetical protein MIMGU_mgv1a003249mg                502   1e-169   
ref|XP_008796630.1|  PREDICTED: threonine dehydratase biosyntheti...    490   1e-164   
ref|XP_009593672.1|  PREDICTED: threonine dehydratase biosyntheti...    487   7e-164   
ref|XP_008794048.1|  PREDICTED: threonine dehydratase biosyntheti...    488   9e-164   
ref|XP_011094452.1|  PREDICTED: LOW QUALITY PROTEIN: threonine de...    486   2e-163   
ref|XP_009774928.1|  PREDICTED: threonine dehydratase biosyntheti...    484   8e-163   
ref|NP_001234234.1|  chloroplast threonine deaminase 1 precursor        479   7e-161   
ref|XP_006339100.1|  PREDICTED: threonine dehydratase biosyntheti...    479   2e-160   
ref|XP_009400978.1|  PREDICTED: threonine dehydratase biosyntheti...    477   8e-160   
ref|XP_011101468.1|  PREDICTED: threonine dehydratase biosyntheti...    476   1e-159   
ref|XP_006826329.1|  hypothetical protein AMTR_s00004p00101110          476   4e-159   
ref|XP_010683961.1|  PREDICTED: threonine dehydratase biosyntheti...    475   4e-159   
ref|XP_009793990.1|  PREDICTED: threonine dehydratase biosyntheti...    474   1e-158   
gb|AIL30479.1|  chloroplast threonine deaminase 1 precursor             474   1e-158   
gb|EYU38591.1|  hypothetical protein MIMGU_mgv1a003122mg                472   9e-158   
ref|XP_009590879.1|  PREDICTED: threonine dehydratase biosyntheti...    471   1e-157   
ref|XP_010933388.1|  PREDICTED: threonine dehydratase biosyntheti...    471   2e-157   
ref|XP_002466574.1|  hypothetical protein SORBIDRAFT_01g010250          470   3e-157   Sorghum bicolor [broomcorn]
ref|XP_002264311.2|  PREDICTED: threonine dehydratase biosyntheti...    469   6e-157   Vitis vinifera
ref|XP_010242986.1|  PREDICTED: threonine dehydratase biosyntheti...    469   7e-157   
emb|CDY00902.1|  BnaC05g42980D                                          469   9e-157   
ref|XP_007027549.1|  L-O-methylthreonine resistant 1 isoform 1          463   2e-154   
ref|XP_008387481.1|  PREDICTED: threonine dehydratase biosyntheti...    462   8e-154   
emb|CDY60161.1|  BnaAnng16560D                                          461   9e-154   
gb|KDP29223.1|  hypothetical protein JCGZ_16612                         461   2e-153   
ref|XP_010486587.1|  PREDICTED: threonine dehydratase biosyntheti...    459   5e-153   
ref|XP_009340966.1|  PREDICTED: threonine dehydratase biosyntheti...    459   5e-153   
gb|EEE59807.1|  hypothetical protein OsJ_12332                          456   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010480268.1|  PREDICTED: threonine dehydratase biosyntheti...    458   1e-152   
ref|XP_008241338.1|  PREDICTED: threonine dehydratase biosyntheti...    458   2e-152   
gb|AAL58211.1|AC090882_14  putative dehydratase/deaminase               457   3e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650494.1|  PREDICTED: threonine dehydratase biosyntheti...    454   3e-152   
ref|XP_010098862.1|  Threonine dehydratase biosynthetic                 457   7e-152   
ref|XP_009123138.1|  PREDICTED: threonine dehydratase biosyntheti...    457   7e-152   
ref|XP_009412484.1|  PREDICTED: threonine dehydratase biosyntheti...    455   4e-151   
ref|XP_009418835.1|  PREDICTED: threonine dehydratase biosyntheti...    453   2e-150   
gb|AFW67823.1|  hypothetical protein ZEAMMB73_691557                    446   5e-150   
dbj|BAK03015.1|  predicted protein                                      444   6e-150   
ref|XP_004156263.1|  PREDICTED: threonine dehydratase biosyntheti...    451   2e-149   
ref|XP_004143291.1|  PREDICTED: threonine dehydratase biosyntheti...    451   2e-149   
gb|KCW89298.1|  hypothetical protein EUGRSUZ_A015882                    446   4e-149   
ref|XP_006430342.1|  hypothetical protein CICLE_v10011319mg             449   5e-149   
ref|XP_008462516.1|  PREDICTED: threonine dehydratase biosyntheti...    450   6e-149   
ref|XP_010069098.1|  PREDICTED: threonine dehydratase biosyntheti...    446   2e-148   
ref|XP_004981992.1|  PREDICTED: threonine dehydratase biosyntheti...    447   3e-148   
gb|ABF98530.1|  Threonine dehydratase biosynthetic, chloroplast p...    447   3e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011018852.1|  PREDICTED: threonine dehydratase biosyntheti...    447   4e-148   
ref|XP_006481926.1|  PREDICTED: threonine dehydratase biosyntheti...    447   4e-148   
ref|XP_002528625.1|  threonine dehydratase/deaminase, putative          447   5e-148   Ricinus communis
ref|XP_008644574.1|  PREDICTED: LOW QUALITY PROTEIN: threonine de...    446   9e-148   
ref|XP_008665294.1|  PREDICTED: threonine dehydratase biosyntheti...    446   1e-147   
ref|XP_003559531.1|  PREDICTED: threonine dehydratase biosyntheti...    446   1e-147   
ref|XP_006381341.1|  hypothetical protein POPTR_0006s11980g             446   1e-147   
gb|KHN24377.1|  Threonine dehydratase biosynthetic, chloroplastic       441   5e-147   
gb|AES60662.2|  threonine dehydratase biosynthetic protein              443   2e-146   
ref|XP_007145276.1|  hypothetical protein PHAVU_007G225400g             443   2e-146   
gb|KHG26517.1|  Threonine dehydratase biosynthetic, chloroplastic...    443   2e-146   
ref|XP_010543484.1|  PREDICTED: threonine dehydratase biosyntheti...    442   3e-146   
gb|KHN48213.1|  Threonine dehydratase biosynthetic, chloroplastic       439   3e-146   
ref|XP_010464666.1|  PREDICTED: threonine dehydratase biosyntheti...    441   6e-146   
ref|XP_003535251.1|  PREDICTED: threonine dehydratase biosyntheti...    441   7e-146   
ref|XP_004303056.1|  PREDICTED: threonine dehydratase biosyntheti...    441   1e-145   
ref|XP_006297203.1|  hypothetical protein CARUB_v10013211mg             441   2e-145   
ref|XP_007203765.1|  hypothetical protein PRUPE_ppa003062mg             440   2e-145   
ref|NP_187616.1|  threonine dehydratase                                 440   2e-145   Arabidopsis thaliana [mouse-ear cress]
gb|AAO00883.1|  threonine dehydratase/deaminase (OMR1)                  439   3e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339313.1|  PREDICTED: threonine dehydratase biosyntheti...    439   3e-145   
ref|XP_003542539.1|  PREDICTED: threonine dehydratase biosyntheti...    439   4e-145   
ref|XP_002884774.1|  L-O-methylthreonine resistant 1                    437   1e-144   
gb|AAT74612.1|  threonine dehydratase/deaminase mutant                  437   1e-144   
gb|AAT74611.1|  threonine dehydratase/deaminase mutant                  437   1e-144   
ref|XP_009375637.1|  PREDICTED: LOW QUALITY PROTEIN: threonine de...    438   1e-144   
emb|CDY41319.1|  BnaA01g32000D                                          437   3e-144   
gb|AAT74610.1|  threonine dehydratase/deaminase mutant                  436   7e-144   
ref|XP_004249785.1|  PREDICTED: threonine dehydratase biosyntheti...    435   1e-143   
ref|XP_002966929.1|  hypothetical protein SELMODRAFT_144447             432   1e-143   
gb|AAG59585.1|AF229927_1  threonine deaminase                           434   3e-143   Nicotiana attenuata
ref|XP_010552986.1|  PREDICTED: threonine dehydratase biosyntheti...    434   4e-143   
ref|XP_009593366.1|  PREDICTED: threonine dehydratase biosyntheti...    434   5e-143   
gb|AFK40110.1|  unknown                                                 434   6e-143   
ref|XP_009135030.1|  PREDICTED: threonine dehydratase biosyntheti...    432   6e-143   
gb|AAD54324.1|AF177212_1  threonine dehydratase/deaminase               433   7e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07946.1|  BnaC03g35770D                                          432   9e-143   
ref|XP_002961078.1|  hypothetical protein SELMODRAFT_139810             429   1e-142   
ref|XP_009135029.1|  PREDICTED: threonine dehydratase biosyntheti...    432   2e-142   
ref|XP_001783582.1|  predicted protein                                  434   4e-142   
ref|XP_004497587.1|  PREDICTED: threonine dehydratase biosyntheti...    431   8e-142   
gb|ABR18075.1|  unknown                                                 432   1e-141   Picea sitchensis
ref|XP_006407611.1|  hypothetical protein EUTSA_v10020316mg             431   1e-141   
emb|CDX74007.1|  BnaA03g30400D                                          430   2e-141   
ref|XP_003590411.1|  Threonine dehydratase biosynthetic                 430   2e-141   
gb|ABR18160.1|  unknown                                                 429   2e-140   Picea sitchensis
ref|XP_009337412.1|  PREDICTED: threonine dehydratase biosyntheti...    426   5e-140   
gb|KFK38389.1|  hypothetical protein AALP_AA3G107100                    426   7e-140   
ref|XP_004496176.1|  PREDICTED: threonine dehydratase biosyntheti...    424   3e-139   
ref|XP_004497558.1|  PREDICTED: threonine dehydratase biosyntheti...    423   6e-139   
ref|XP_008349803.1|  PREDICTED: LOW QUALITY PROTEIN: threonine de...    420   7e-138   
emb|CDY22213.1|  BnaC01g38880D                                          419   1e-136   
gb|KHG11164.1|  Threonine dehydratase biosynthetic, chloroplastic...    402   5e-135   
ref|XP_006363692.1|  PREDICTED: threonine dehydratase biosyntheti...    407   5e-133   
gb|AFW67822.1|  hypothetical protein ZEAMMB73_691557                    396   3e-131   
gb|AAK18849.1|AC082645_19  putative threonine dehydratase/deaminase     402   2e-130   Oryza sativa [red rice]
ref|XP_003572603.1|  PREDICTED: threonine dehydratase biosyntheti...    397   9e-130   
gb|ACU26536.1|  threonine deaminase                                     387   2e-129   Glycine max [soybeans]
ref|XP_010923370.1|  PREDICTED: threonine dehydratase biosyntheti...    370   1e-122   
sp|P31212.1|THD1_SOLTU  RecName: Full=Threonine dehydratase biosy...    353   4e-115   Solanum tuberosum [potatoes]
ref|XP_006366786.1|  PREDICTED: threonine dehydratase biosyntheti...    358   1e-113   
ref|XP_004156327.1|  PREDICTED: threonine dehydratase biosyntheti...    354   6e-112   
ref|XP_004143369.1|  PREDICTED: threonine dehydratase biosyntheti...    353   1e-111   
ref|WP_015437906.1|  threonine dehydratase                              348   6e-111   
ref|WP_011237732.1|  threonine dehydratase                              346   4e-110   
ref|WP_018988428.1|  L-threonine dehydratase biosynthetic IlvA          345   5e-110   
ref|WP_028461734.1|  threonine dehydratase                              343   5e-109   
ref|WP_018748402.1|  L-threonine dehydratase biosynthetic IlvA          342   9e-109   
ref|WP_004259793.1|  threonine dehydratase                              342   1e-108   
ref|WP_011764235.1|  threonine dehydratase                              342   2e-108   
gb|AAA34171.1|  threonine deaminase                                     344   3e-108   Solanum lycopersicum
ref|XP_004246590.1|  PREDICTED: threonine dehydratase biosyntheti...    344   3e-108   
ref|WP_011478496.1|  threonine dehydratase                              341   4e-108   
ref|WP_002931530.1|  MULTISPECIES: threonine dehydratase                340   1e-107   
gb|EXI83896.1|  L-threonine dehydratase biosynthetic IlvA               339   1e-107   
ref|WP_013294583.1|  threonine dehydratase, biosynthetic                339   1e-107   
ref|WP_004306745.1|  MULTISPECIES: threonine dehydratase                339   2e-107   
ref|WP_004343520.1|  threonine dehydratase                              339   2e-107   
ref|WP_035054671.1|  threonine dehydratase                              338   3e-107   
ref|WP_018152808.1|  hypothetical protein                               338   3e-107   
ref|WP_011379799.1|  threonine dehydratase                              337   9e-107   
gb|EXI79062.1|  L-threonine dehydratase biosynthetic IlvA               337   1e-106   
ref|WP_034921213.1|  threonine dehydratase                              337   1e-106   
ref|WP_034944030.1|  threonine dehydratase                              337   2e-106   
gb|KFB78564.1|  L-threonine dehydratase biosynthetic IlvA               337   4e-106   
ref|WP_021247591.1|  L-threonine dehydratase biosynthetic IlvA          335   4e-106   
ref|WP_004364503.1|  threonine dehydratase                              335   1e-105   
gb|EEC76062.1|  hypothetical protein OsI_13266                          328   7e-105   Oryza sativa Indica Group [Indian rice]
ref|WP_014235838.1|  threonine ammonia-lyase, biosynthetic, long ...    332   8e-105   
ref|WP_041101209.1|  threonine dehydratase                              332   9e-105   
ref|WP_011111322.1|  threonine dehydratase                              332   1e-104   
ref|WP_027468367.1|  threonine dehydratase                              332   1e-104   
dbj|BAO31368.1|  threonine dehydratase                                  332   2e-104   
ref|WP_028101573.1|  threonine dehydratase                              332   2e-104   
ref|WP_036238909.1|  threonine dehydratase                              331   3e-104   
ref|WP_009206812.1|  threonine dehydratase                              331   3e-104   
ref|WP_006510237.1|  threonine ammonia-lyase, biosynthetic, long ...    330   6e-104   
ref|WP_004174842.1|  Threonine dehydratase biosynthetic                 330   7e-104   
ref|WP_029757055.1|  threonine dehydratase                              329   1e-103   
ref|WP_036301798.1|  threonine dehydratase                              328   2e-103   
ref|WP_031595868.1|  threonine dehydratase                              328   3e-103   
ref|WP_018507057.1|  L-threonine dehydratase biosynthetic IlvA          328   4e-103   
gb|EXI92889.1|  L-threonine dehydratase biosynthetic IlvA               328   4e-103   
ref|WP_019899841.1|  L-threonine dehydratase biosynthetic IlvA          327   8e-103   
ref|WP_025040540.1|  threonine dehydratase                              327   1e-102   
ref|WP_018078119.1|  L-threonine dehydratase biosynthetic IlvA          326   2e-102   
gb|KDV24669.1|  threonine dehydratase                                   322   2e-102   
ref|WP_013967187.1|  threonine dehydratase                              326   2e-102   
ref|WP_013646424.1|  threonine dehydratase, biosynthetic                325   3e-102   
ref|WP_034942689.1|  threonine dehydratase                              325   5e-102   
ref|WP_017305017.1|  L-threonine dehydratase biosynthetic IlvA          324   1e-101   
ref|WP_009522955.1|  threonine dehydratase                              324   1e-101   
ref|WP_028451783.1|  threonine dehydratase                              323   2e-101   
ref|WP_028499919.1|  threonine dehydratase                              324   2e-101   
gb|ETW99107.1|  L-threonine dehydratase biosynthetic IlvA               324   2e-101   
ref|WP_027785407.1|  threonine dehydratase                              323   2e-101   
ref|WP_027810296.1|  threonine dehydratase                              323   3e-101   
ref|WP_011634235.1|  threonine dehydratase                              323   3e-101   
ref|XP_005706433.1|  threonine dehydratase                              326   3e-101   
ref|WP_013440989.1|  threonine dehydratase, biosynthetic                323   3e-101   
ref|WP_034208369.1|  threonine dehydratase                              323   3e-101   
ref|WP_011546192.1|  threonine dehydratase                              323   3e-101   
ref|WP_015829182.1|  threonine dehydratase                              323   3e-101   
ref|WP_006477833.1|  Threonine dehydratase                              323   4e-101   
ref|WP_012329211.1|  threonine dehydratase                              323   4e-101   
ref|WP_027806087.1|  threonine dehydratase                              323   4e-101   
ref|WP_011694396.1|  threonine dehydratase                              323   4e-101   
ref|WP_031293175.1|  threonine dehydratase                              323   5e-101   
ref|WP_039360117.1|  threonine dehydratase                              322   5e-101   
ref|WP_012696459.1|  threonine dehydratase                              322   5e-101   
ref|WP_034418162.1|  threonine dehydratase                              322   6e-101   
gb|ESA35477.1|  l-threonine ammonia-lyase                               322   6e-101   
ref|WP_029049573.1|  threonine dehydratase                              322   6e-101   
ref|WP_011886005.1|  threonine dehydratase                              321   1e-100   
ref|WP_018008744.1|  L-threonine dehydratase biosynthetic IlvA          322   1e-100   
ref|WP_034179012.1|  threonine dehydratase                              321   1e-100   
ref|WP_009343705.1|  Threonine dehydratase I                            321   2e-100   
ref|WP_014723627.1|  MULTISPECIES: threonine dehydratase biosynth...    321   2e-100   
gb|KER66669.1|  threonine dehydratase                                   321   2e-100   
ref|WP_034295593.1|  threonine dehydratase                              321   2e-100   
ref|WP_006487895.1|  MULTISPECIES: threonine ammonia-lyase, biosy...    321   2e-100   
ref|WP_012777653.1|  threonine dehydratase                              321   2e-100   
ref|WP_011353168.1|  threonine dehydratase                              320   3e-100   
ref|WP_019495845.1|  L-threonine dehydratase biosynthetic IlvA          320   3e-100   
ref|WP_011136640.1|  threonine dehydratase                              320   4e-100   
ref|WP_011312875.1|  L-threonine ammonia-lyase                          320   4e-100   
ref|WP_009691933.1|  threonine dehydratase                              320   6e-100   
ref|WP_026097029.1|  threonine dehydratase                              320   6e-100   
ref|WP_026688207.1|  threonine dehydratase                              320   6e-100   
ref|WP_026072273.1|  threonine dehydratase                              320   6e-100   
ref|WP_011429063.1|  threonine dehydratase                              319   8e-100   
ref|WP_027789147.1|  threonine dehydratase                              319   8e-100   
ref|WP_021161327.1|  Threonine dehydratase biosynthetic                 319   9e-100   
ref|WP_017326871.1|  L-threonine dehydratase biosynthetic IlvA          319   1e-99    
ref|WP_035382601.1|  threonine dehydratase                              319   1e-99    
ref|WP_012080959.1|  threonine dehydratase                              319   1e-99    
ref|WP_007192294.1|  threonine dehydratase, biosynthetic                319   1e-99    
ref|WP_017877779.1|  L-threonine dehydratase biosynthetic IlvA          319   1e-99    
ref|WP_018972123.1|  hypothetical protein                               319   2e-99    
ref|WP_022654027.1|  L-threonine dehydratase biosynthetic IlvA          318   2e-99    
ref|WP_013030866.1|  threonine dehydratase, biosynthetic                318   2e-99    
ref|WP_031401113.1|  threonine dehydratase                              318   2e-99    
ref|WP_034199374.1|  threonine dehydratase                              318   2e-99    
ref|WP_026101469.1|  threonine dehydratase                              318   2e-99    
ref|XP_006430341.1|  hypothetical protein CICLE_v10011319mg             318   3e-99    
ref|WP_012807069.1|  threonine dehydratase                              318   3e-99    
gb|KDO60994.1|  hypothetical protein CISIN_1g048400mg                   318   3e-99    
ref|WP_039754705.1|  threonine dehydratase                              318   3e-99    
ref|WP_015196219.1|  L-threonine ammonia-lyase                          318   3e-99    
ref|WP_019923396.1|  L-threonine dehydratase biosynthetic IlvA          318   3e-99    
ref|WP_023067781.1|  threonine ammonia-lyase, biosynthetic              318   4e-99    
ref|WP_028990311.1|  threonine dehydratase                              317   4e-99    
ref|WP_024302367.1|  threonine dehydratase                              318   4e-99    
ref|WP_016490271.1|  threonine dehydratase                              318   4e-99    
gb|ETW99105.1|  L-threonine dehydratase biosynthetic IlvA               314   5e-99    
ref|WP_027457085.1|  threonine dehydratase                              317   5e-99    
ref|WP_028993818.1|  threonine dehydratase                              317   5e-99    
ref|WP_006216278.1|  threonine ammonia-lyase                            317   6e-99    
ref|WP_011289843.1|  threonine dehydratase                              317   6e-99    
gb|KFH64600.1|  threonine ammonia-lyase, biosynthetic                   318   6e-99    
ref|WP_015203624.1|  L-threonine ammonia-lyase                          317   8e-99    
ref|WP_018412054.1|  L-threonine dehydratase biosynthetic IlvA          317   8e-99    
ref|WP_014086873.1|  threonine dehydratase, biosynthetic                317   9e-99    
ref|WP_024976674.1|  threonine dehydratase                              317   1e-98    
ref|WP_013436321.1|  Threonine dehydratase                              317   1e-98    
ref|WP_015078860.1|  threonine dehydratase                              317   1e-98    
ref|WP_013213542.1|  threonine deaminase                                317   1e-98    
ref|WP_021477527.1|  L-threonine dehydratase biosynthetic IlvA          316   2e-98    
ref|WP_008939564.1|  threonine dehydratase                              316   2e-98    
ref|WP_026795625.1|  MULTISPECIES: threonine dehydratase                315   2e-98    
ref|WP_025513893.1|  threonine dehydratase                              316   2e-98    
ref|WP_026785842.1|  MULTISPECIES: threonine dehydratase                315   2e-98    
ref|WP_016952509.1|  L-threonine dehydratase biosynthetic IlvA          315   3e-98    
ref|WP_022988357.1|  L-threonine dehydratase biosynthetic IlvA          315   3e-98    
ref|WP_026098107.1|  threonine dehydratase                              315   3e-98    
dbj|BAP90004.1|  threonine dehydratase                                  316   3e-98    
ref|WP_027248872.1|  threonine dehydratase                              315   3e-98    
ref|WP_004364990.1|  threonine dehydratase                              315   3e-98    
gb|KEI68621.1|  IlvA                                                    315   3e-98    
ref|WP_008953892.1|  threonine dehydratase, biosynthetic                315   3e-98    
ref|WP_012761143.1|  threonine dehydratase                              315   4e-98    
ref|WP_006515732.1|  L-threonine ammonia-lyase                          315   4e-98    
ref|WP_038706016.1|  threonine dehydratase                              315   4e-98    
ref|WP_002655162.1|  Threonine dehydratase I                            315   4e-98    
ref|WP_015397307.1|  threonine dehydratase                              315   4e-98    
ref|WP_027401311.1|  threonine dehydratase                              315   4e-98    
ref|WP_041034856.1|  threonine dehydratase                              315   4e-98    
ref|WP_039199335.1|  threonine dehydratase                              315   5e-98    
ref|WP_019681977.1|  L-threonine dehydratase biosynthetic IlvA          312   5e-98    
gb|KIJ83293.1|  threonine dehydratase                                   315   5e-98    
ref|WP_017742574.1|  L-threonine dehydratase biosynthetic IlvA          315   5e-98    
ref|WP_038826499.1|  threonine dehydratase                              313   5e-98    
ref|XP_004156265.1|  PREDICTED: LOW QUALITY PROTEIN: threonine de...    318   5e-98    
ref|XP_004143289.1|  PREDICTED: threonine dehydratase biosyntheti...    317   6e-98    
ref|WP_037027615.1|  threonine dehydratase                              315   6e-98    
ref|WP_015143877.1|  threonine ammonia-lyase, biosynthetic, long ...    314   6e-98    
ref|WP_025223557.1|  threonine dehydratase                              314   6e-98    
ref|WP_028449983.1|  threonine dehydratase                              314   7e-98    
ref|WP_035984704.1|  threonine dehydratase                              314   7e-98    
ref|WP_017772684.1|  L-threonine dehydratase biosynthetic IlvA          314   7e-98    
ref|WP_004633283.1|  L-threonine ammonia-lyase                          314   8e-98    
ref|WP_020749705.1|  threonine deaminase                                314   8e-98    
ref|WP_039725490.1|  threonine dehydratase                              314   8e-98    
ref|WP_009239143.1|  MULTISPECIES: threonine dehydratase biosynth...    314   8e-98    
ref|WP_027678246.1|  threonine dehydratase                              314   9e-98    
ref|WP_040494163.1|  threonine dehydratase                              314   9e-98    
ref|WP_016876667.1|  L-threonine dehydratase biosynthetic IlvA          314   9e-98    
ref|WP_020167000.1|  MULTISPECIES: L-threonine dehydratase biosyn...    314   1e-97    
ref|WP_040042676.1|  threonine dehydratase                              314   1e-97    
ref|WP_013146886.1|  threonine dehydratase, biosynthetic                314   1e-97    
ref|WP_009277158.1|  threonine ammonia-lyase, biosynthetic              314   1e-97    
ref|WP_010805054.1|  threonine dehydratase                              314   1e-97    
ref|WP_028536448.1|  threonine dehydratase                              314   1e-97    
ref|WP_033992805.1|  threonine dehydratase                              313   2e-97    
ref|WP_039396068.1|  threonine dehydratase                              313   2e-97    
ref|WP_031633689.1|  threonine dehydratase                              313   2e-97    
ref|WP_033963243.1|  threonine dehydratase                              313   2e-97    
ref|WP_031754589.1|  threonine dehydratase                              313   2e-97    
ref|WP_031632106.1|  threonine dehydratase                              313   2e-97    
ref|WP_012073945.1|  threonine dehydratase                              313   2e-97    
ref|WP_003110582.1|  MULTISPECIES: threonine dehydratase                313   2e-97    
ref|WP_009787971.1|  threonine dehydratase                              313   2e-97    
gb|AHH47697.1|  L-threonine dehydratase biosynthetic IlvA               313   2e-97    
ref|WP_041025782.1|  threonine dehydratase                              313   2e-97    
ref|WP_003160933.1|  threonine dehydratase, biosynthetic                313   2e-97    
ref|WP_034079388.1|  threonine dehydratase                              313   2e-97    
ref|WP_009852570.1|  threonine ammonia-lyase, biosynthetic              313   2e-97    
ref|WP_023082627.1|  threonine ammonia-lyase, biosynthetic              313   2e-97    
ref|WP_031693595.1|  threonine dehydratase                              313   2e-97    
emb|CEH98923.1|  L-threonine dehydratase biosynthetic IlvA              313   3e-97    
gb|AGO38288.1|  L-threonine dehydratase biosynthetic IlvA               313   3e-97    
ref|WP_031635645.1|  threonine dehydratase                              313   3e-97    
ref|WP_024916934.1|  threonine dehydratase                              313   3e-97    
ref|WP_038402443.1|  threonine dehydratase                              313   3e-97    
ref|WP_003084387.1|  threonine dehydratase, biosynthetic                313   3e-97    
ref|WP_018059021.1|  L-threonine dehydratase biosynthetic IlvA          313   3e-97    
ref|XP_007027550.1|  L-O-methylthreonine resistant 1 isoform 2          313   3e-97    
gb|EQL42905.1|  L-threonine dehydratase biosynthetic IlvA               313   3e-97    
gb|AJE98858.1|  threonine dehydratase                                   313   4e-97    
ref|WP_016492358.1|  threonine dehydratase                              313   4e-97    
ref|WP_033998032.1|  threonine dehydratase                              312   4e-97    
ref|WP_028629538.1|  threonine dehydratase                              312   4e-97    
ref|WP_038404920.1|  threonine dehydratase                              312   4e-97    
ref|WP_026735844.1|  threonine dehydratase                              312   4e-97    
ref|WP_012628657.1|  threonine dehydratase                              312   4e-97    
ref|WP_015244588.1|  threonine ammonia-lyase, biosynthetic, long ...    313   4e-97    
ref|WP_022966158.1|  L-threonine dehydratase biosynthetic IlvA          312   4e-97    
ref|WP_034014985.1|  threonine dehydratase                              312   5e-97    
ref|WP_034044071.1|  threonine dehydratase                              312   5e-97    
ref|WP_026719352.1|  threonine dehydratase                              312   5e-97    
ref|WP_023086904.1|  threonine ammonia-lyase, biosynthetic              312   5e-97    
ref|WP_015138641.1|  threonine ammonia-lyase, biosynthetic, long ...    312   5e-97    
ref|WP_015600482.1|  threonine ammonia-lyase, biosynthetic              312   6e-97    
ref|WP_020183488.1|  L-threonine dehydratase biosynthetic IlvA          312   6e-97    
ref|WP_013689771.1|  Threonine dehydratase                              313   6e-97    
gb|KIE33442.1|  threonine dehydratase                                   311   6e-97    
ref|WP_039369767.1|  threonine dehydratase                              312   6e-97    
ref|WP_003449482.1|  Threonine dehydratase biosynthetic                 312   7e-97    
ref|WP_033695902.1|  threonine dehydratase                              311   7e-97    
ref|WP_034435248.1|  threonine dehydratase                              311   7e-97    
ref|WP_021207242.1|  L-threonine dehydratase biosynthetic IlvA          311   8e-97    
ref|WP_029654759.1|  threonine dehydratase                              311   9e-97    
ref|WP_019500456.1|  L-threonine dehydratase biosynthetic IlvA          311   9e-97    
ref|WP_019504642.1|  L-threonine dehydratase biosynthetic IlvA          311   1e-96    
ref|WP_021196469.1|  L-threonine dehydratase biosynthetic IlvA          311   1e-96    
ref|WP_009626218.1|  L-threonine ammonia-lyase                          311   1e-96    
ref|WP_033978765.1|  threonine dehydratase                              311   1e-96    
ref|WP_036057384.1|  threonine dehydratase                              311   1e-96    
ref|WP_033971835.1|  threonine dehydratase                              311   1e-96    
ref|WP_010998370.1|  threonine dehydratase                              311   1e-96    
ref|WP_034072550.1|  threonine dehydratase                              311   1e-96    
ref|WP_039408234.1|  threonine dehydratase                              311   1e-96    
gb|KIA80367.1|  threonine dehydratase                                   311   1e-96    
ref|WP_004580127.1|  threonine dehydratase                              311   1e-96    
ref|WP_011317547.1|  threonine dehydratase                              311   1e-96    
ref|WP_015389827.1|  threonine dehydratase                              311   1e-96    
ref|WP_017524880.1|  L-threonine dehydratase biosynthetic IlvA          311   1e-96    
ref|WP_018987607.1|  L-threonine dehydratase biosynthetic IlvA          311   1e-96    
gb|KGC13090.1|  threonine ammonia-lyase, biosynthetic                   311   1e-96    
gb|KES22270.1|  threonine dehydratase                                   311   1e-96    
ref|WP_033697627.1|  threonine dehydratase                              311   2e-96    
ref|WP_018310452.1|  L-threonine dehydratase biosynthetic IlvA          311   2e-96    
ref|WP_039599085.1|  threonine dehydratase                              311   2e-96    
ref|WP_034416670.1|  threonine dehydratase                              310   2e-96    
emb|CDF83998.1|  threonine dehydratase                                  311   2e-96    
dbj|BAM75632.1|  hypothetical threonine dehydratase                     310   2e-96    
ref|WP_034036200.1|  threonine dehydratase                              310   2e-96    
ref|WP_040259507.1|  threonine dehydratase                              310   2e-96    
ref|WP_036208746.1|  threonine dehydratase                              310   2e-96    
gb|KER73550.1|  threonine dehydratase                                   310   3e-96    
ref|WP_008444518.1|  threonine dehydratase biosynthetic                 310   3e-96    
ref|WP_016724049.1|  L-threonine dehydratase biosynthetic IlvA          310   3e-96    
ref|WP_011000410.1|  threonine dehydratase                              310   3e-96    
ref|WP_017235557.1|  L-threonine dehydratase biosynthetic IlvA          310   4e-96    
ref|WP_023264521.1|  L-threonine dehydratase biosynthetic IlvA          310   4e-96    
dbj|BAP81600.1|  threonine dehydratase                                  310   4e-96    
gb|AHL73868.1|  threonine dehydratase                                   310   4e-96    
ref|WP_027596754.1|  threonine dehydratase                              310   4e-96    
ref|WP_013955515.1|  threonine dehydratase biosynthetic                 310   4e-96    
ref|WP_017311479.1|  L-threonine dehydratase biosynthetic IlvA          309   5e-96    
emb|CDN09835.1|  Threonine dehydratase biosynthetic                     308   5e-96    
ref|WP_009632172.1|  threonine ammonia-lyase, biosynthetic, long ...    309   6e-96    
ref|WP_028818139.1|  threonine dehydratase                              309   6e-96    
ref|WP_036035759.1|  threonine dehydratase                              309   6e-96    
ref|WP_035822720.1|  threonine dehydratase                              309   6e-96    
ref|WP_028455624.1|  threonine dehydratase                              309   6e-96    
ref|WP_024128737.1|  L-threonine dehydratase biosynthetic IlvA          309   7e-96    
ref|WP_025494776.1|  threonine dehydratase                              310   7e-96    
ref|WP_009520007.1|  MULTISPECIES: threonine dehydratase                310   7e-96    
ref|WP_034357371.1|  threonine dehydratase                              310   7e-96    
ref|WP_026086435.1|  MULTISPECIES: threonine dehydratase                309   8e-96    
ref|WP_006276454.1|  Threonine dehydratase I                            309   8e-96    
ref|WP_036246224.1|  threonine dehydratase                              309   8e-96    
ref|WP_011657906.1|  threonine dehydratase                              309   9e-96    
ref|WP_023873128.1|  MULTISPECIES: L-threonine dehydratase biosyn...    309   9e-96    
ref|WP_023597537.1|  L-threonine dehydratase biosynthetic IlvA          309   9e-96    
ref|WP_019341724.1|  L-threonine dehydratase biosynthetic IlvA          309   1e-95    
ref|WP_016859237.1|  L-threonine dehydratase biosynthetic IlvA          308   1e-95    
ref|WP_034038180.1|  threonine dehydratase                              308   1e-95    
ref|WP_015149909.1|  L-threonine ammonia-lyase                          308   1e-95    
ref|WP_010814427.1|  MULTISPECIES: threonine dehydratase                309   1e-95    
ref|WP_008248045.1|  threonine dehydratase                              308   1e-95    
ref|WP_006751944.1|  threonine dehydratase, biosynthetic                308   1e-95    
ref|WP_012364693.1|  threonine dehydratase                              308   1e-95    
ref|WP_040851380.1|  threonine dehydratase                              308   1e-95    
gb|EHC09453.1|  threonine dehydratase, biosynthetic                     309   1e-95    
ref|WP_013219525.1|  threonine dehydratase, biosynthetic                308   1e-95    
ref|WP_006759681.1|  threonine dehydratase, biosynthetic                308   1e-95    
ref|WP_016867915.1|  L-threonine dehydratase biosynthetic IlvA          308   2e-95    
ref|WP_026187800.1|  threonine dehydratase                              308   2e-95    
ref|WP_008052790.1|  Threonine dehydratase biosynthetic                 308   2e-95    
ref|WP_015173223.1|  L-threonine ammonia-lyase                          308   2e-95    
gb|AHI29839.1|  L-threonine dehydratase biosynthetic IlvA               308   2e-95    
ref|WP_027102188.1|  threonine dehydratase                              308   2e-95    
ref|WP_037215997.1|  threonine dehydratase                              308   2e-95    
ref|WP_022533509.1|  L-threonine dehydratase biosynthetic IlvA          308   2e-95    
ref|WP_016344209.1|  L-threonine ammonia-lyase                          308   2e-95    
ref|WP_006620198.1|  threonine dehydratase                              308   2e-95    
ref|WP_011872231.1|  threonine deaminase                                308   2e-95    
ref|WP_006668368.1|  threonine dehydratase, biosynthetic                308   3e-95    
gb|EGZ50721.1|  threonine dehydratase, biosynthetic                     308   3e-95    
ref|WP_019587271.1|  L-threonine dehydratase biosynthetic IlvA          308   3e-95    
ref|WP_010582921.1|  L-threonine ammonia-lyase                          308   3e-95    
ref|WP_020704460.1|  L-threonine dehydratase biosynthetic IlvA          308   3e-95    
ref|WP_013614146.1|  threonine dehydratase, biosynthetic                308   3e-95    
ref|WP_003297326.1|  threonine dehydratase                              307   3e-95    
ref|WP_029462956.1|  threonine dehydratase                              308   3e-95    
ref|WP_031357564.1|  threonine dehydratase                              307   4e-95    
ref|WP_034351258.1|  threonine dehydratase                              307   4e-95    
ref|WP_036524776.1|  threonine dehydratase                              307   4e-95    
ref|WP_038494940.1|  threonine dehydratase                              307   4e-95    
ref|WP_008064221.1|  Threonine dehydratase biosynthetic                 306   4e-95    
ref|WP_027865728.1|  threonine dehydratase                              307   4e-95    
ref|WP_006624174.1|  threonine dehydratase biosynthetic                 307   5e-95    
gb|EIJ46259.1|  threonine dehydratase                                   307   5e-95    
ref|WP_015278520.1|  L-threonine ammonia-lyase                          307   5e-95    
ref|WP_006633560.1|  threonine dehydratase, biosynthetic                306   6e-95    
ref|WP_036172349.1|  threonine dehydratase                              306   7e-95    
ref|WP_013206998.1|  threonine deaminase                                306   8e-95    
ref|WP_040141934.1|  threonine dehydratase                              306   8e-95    
ref|WP_035497941.1|  threonine dehydratase                              306   8e-95    
ref|WP_006763411.1|  Threonine dehydratase                              306   8e-95    
ref|WP_014617983.1|  threonine deaminase                                306   8e-95    
ref|WP_028082555.1|  threonine dehydratase                              306   9e-95    
ref|WP_015121270.1|  L-threonine ammonia-lyase                          306   9e-95    
ref|WP_028089166.1|  threonine dehydratase                              306   1e-94    
ref|WP_017334189.1|  L-threonine dehydratase biosynthetic IlvA          306   1e-94    
ref|WP_011395019.1|  threonine dehydratase                              306   1e-94    
ref|WP_006224710.1|  threonine dehydratase                              306   1e-94    
ref|WP_019883782.1|  MULTISPECIES: L-threonine dehydratase biosyn...    306   1e-94    
ref|WP_040053009.1|  threonine dehydratase                              306   1e-94    
ref|WP_010475608.1|  threonine dehydratase                              306   1e-94    
ref|WP_014896070.1|  threonine dehydratase                              306   1e-94    
ref|WP_028447653.1|  threonine dehydratase                              306   1e-94    
gb|AIY39845.1|  Threonine dehydratase biosynthetic                      306   1e-94    
ref|WP_023009593.1|  L-threonine dehydratase biosynthetic IlvA          306   2e-94    
ref|WP_039010500.1|  threonine dehydratase                              306   2e-94    
ref|WP_008568432.1|  threonine dehydratase                              305   2e-94    
ref|WP_024930963.1|  threonine dehydratase                              305   2e-94    
gb|KIG02247.1|  threonine dehydratase, biosynthetic                     306   2e-94    
ref|WP_035979428.1|  threonine dehydratase                              305   2e-94    
ref|WP_006169768.1|  threonine dehydratase                              306   2e-94    
ref|WP_039784168.1|  threonine dehydratase                              303   2e-94    
ref|WP_020653668.1|  L-threonine dehydratase biosynthetic IlvA          306   2e-94    
ref|WP_014578420.1|  threonine dehydratase biosynthetic                 305   2e-94    
ref|WP_014004615.1|  threonine dehydratase                              305   2e-94    
ref|WP_037481017.1|  threonine dehydratase                              305   2e-94    
ref|WP_008170952.1|  threonine dehydratase                              305   2e-94    
ref|WP_020410689.1|  L-threonine dehydratase biosynthetic IlvA          305   2e-94    
ref|WP_027845822.1|  threonine dehydratase                              305   2e-94    
ref|WP_012351703.1|  threonine dehydratase                              305   2e-94    
ref|WP_003278777.1|  threonine amonia-lyase (threonine dehydratas...    305   2e-94    
ref|WP_015177429.1|  L-threonine ammonia-lyase                          305   2e-94    
ref|WP_029147503.1|  threonine dehydratase                              305   2e-94    
ref|WP_027829792.1|  threonine dehydratase                              305   2e-94    
ref|WP_039556215.1|  threonine dehydratase                              305   2e-94    
ref|XP_006677174.1|  hypothetical protein BATDEDRAFT_15990              305   2e-94    
ref|WP_035157526.1|  threonine dehydratase                              305   2e-94    
gb|KDB52514.1|  threonine dehydratase, biosynthetic                     305   3e-94    
ref|WP_015877004.1|  threonine dehydratase                              305   3e-94    
ref|WP_006398295.1|  threonine ammonia-lyase, biosynthetic              305   3e-94    
ref|WP_036132585.1|  threonine dehydratase                              305   3e-94    
ref|WP_015136174.1|  L-threonine ammonia-lyase                          305   3e-94    
ref|WP_018402688.1|  L-threonine dehydratase biosynthetic IlvA          305   3e-94    
ref|WP_006465116.1|  threonine dehydratase                              305   3e-94    
ref|WP_025101711.1|  threonine dehydratase                              302   3e-94    
ref|WP_014190369.1|  threonine dehydratase, biosynthetic                305   3e-94    
ref|WP_014872757.1|  Threonine dehydratase biosynthetic                 305   3e-94    
ref|WP_036049213.1|  threonine dehydratase                              305   3e-94    
ref|WP_013235841.1|  threonine dehydratase                              305   4e-94    
ref|WP_008351636.1|  MULTISPECIES: threonine dehydratase                305   4e-94    
ref|WP_013699367.1|  Threonine dehydratase                              305   4e-94    
ref|WP_006453526.1|  threonine ammonia-lyase, biosynthetic              305   4e-94    
ref|WP_006415512.1|  threonine ammonia-lyase, biosynthetic              305   4e-94    
ref|WP_014422705.1|  MULTISPECIES: threonine deaminase                  305   4e-94    
ref|WP_027490912.1|  threonine dehydratase                              304   4e-94    
ref|WP_003269663.1|  threonine deaminase                                304   5e-94    
ref|WP_035961749.1|  threonine dehydratase                              304   5e-94    
ref|WP_011786848.1|  threonine dehydratase                              304   6e-94    
ref|WP_035986620.1|  threonine dehydratase                              304   6e-94    
ref|WP_026052091.1|  threonine dehydratase                              304   6e-94    
ref|WP_019450122.1|  L-threonine dehydratase biosynthetic IlvA          304   7e-94    
ref|WP_002737080.1|  threonine ammonia-lyase, biosynthetic              304   7e-94    
dbj|GAL91256.1|  threonine dehydratase biosynthetic                     304   7e-94    
ref|WP_037989208.1|  threonine dehydratase                              304   7e-94    
ref|WP_034311087.1|  threonine dehydratase                              304   7e-94    
ref|WP_002797906.1|  Threonine dehydratase biosynthetic                 304   7e-94    
ref|WP_015877555.1|  threonine dehydratase                              305   8e-94    
ref|WP_020163192.1|  L-threonine dehydratase biosynthetic IlvA          304   8e-94    
ref|WP_034330864.1|  threonine dehydratase                              304   8e-94    
ref|WP_002754274.1|  Threonine dehydratase biosynthetic                 303   8e-94    
ref|WP_004267963.1|  Threonine dehydratase biosynthetic                 303   9e-94    
ref|WP_008202098.1|  Threonine dehydratase biosynthetic                 303   9e-94    



>gb|AEQ28336.1| threonine deaminase [Lemna minor]
Length=652

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 288/325 (89%), Gaps = 1/325 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAGIAA+VK V PEVKIIGVEP+DANAMALSLHHG+RVML+QVGGFADGVAVKVVG
Sbjct  328   GGGLIAGIAAYVKQVRPEVKIIGVEPYDANAMALSLHHGQRVMLEQVGGFADGVAVKVVG  387

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EET+ +CREL+DG+V V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKGE
Sbjct  388   EETYRLCRELVDGIVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGE  447

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ +TSGANMNFDRLR + ELADVG ++EA+L+T++PEEPGSFK+F +LVGP+NITEF+
Sbjct  448   SVVAITSGANMNFDRLRLVTELADVGRKQEAVLATSMPEEPGSFKRFCQLVGPVNITEFK  507

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY + + ++LVLY V VHT  EL ++V RM   +  T+DLT+NDL KDHLRHL+GGR +
Sbjct  508   YRYDASKEKALVLYSVGVHTAAELKSVVGRMGFENFETVDLTNNDLAKDHLRHLVGGRTN  567

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             VE+ELLCRFIFPERPG L++FLD+FSP+WNI+LF+YR+ GEAGANVLVG+QVP  E+DEF
Sbjct  568   VENELLCRFIFPERPGTLMKFLDSFSPRWNISLFHYRSQGEAGANVLVGIQVPGGEMDEF  627

Query  423   KQRANDLGYEYAIETS-EAFQLLMN  352
             +  A +L Y+YA+E S +A+QLLM+
Sbjct  628   RAIATNLDYDYALEMSNKAYQLLMH  652



>gb|EYU41567.1| hypothetical protein MIMGU_mgv1a003249mg [Erythranthe guttata]
Length=597

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 276/314 (88%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+P++KIIGVEP DANAMALSLHHG+RVMLDQVGGFADGVAVKVVGEETF ICREL
Sbjct  283   YVKRVSPQIKIIGVEPFDANAMALSLHHGQRVMLDQVGGFADGVAVKVVGEETFRICREL  342

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKG N++ VTSGAN
Sbjct  343   IDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGANVVAVTSGAN  402

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELA+VG +REA+L+T +PE PGSFK F ELVGPMNITEF+YRYSS + +S
Sbjct  403   MNFDRLRLVTELANVGRRREAVLATYMPEAPGSFKLFCELVGPMNITEFKYRYSSDQEKS  462

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT+ ELD MVE++  S LHTI+LT NDLVKDHLRHL+GGR +V+ EL CRFI
Sbjct  463   LVLYSVGLHTEAELDEMVEKLESSQLHTINLTKNDLVKDHLRHLMGGRSNVKYELFCRFI  522

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDA SP+WNITLF+YR  GE GANVLVG+QV  +E+DEF+ RA+ LGYE
Sbjct  523   FPERPGALMKFLDALSPRWNITLFHYRGQGETGANVLVGIQVSDSEMDEFRDRADSLGYE  582

Query  393   YAIET-SEAFQLLM  355
             Y +ET +EAFQLLM
Sbjct  583   YEVETGNEAFQLLM  596



>ref|XP_008796630.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Phoenix dactylifera]
Length=615

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 281/325 (86%), Gaps = 1/325 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK V PEVKIIGVEP DANAMALSL+HG+RVML+QVGGFADGVAVKVVG
Sbjct  291   GGGLVAGIAAYVKRVRPEVKIIGVEPFDANAMALSLYHGQRVMLEQVGGFADGVAVKVVG  350

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CREL+DGVV VGRDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY L+G 
Sbjct  351   EETFRLCRELVDGVVLVGRDAVCASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLEGT  410

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N++ +TSGANMNFDRLR + ELADVG +REAIL+T L EE GSFK++ ELVG +NITEF+
Sbjct  411   NVVAITSGANMNFDRLRLVTELADVGRKREAILATILQEERGSFKQYCELVGSINITEFK  470

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY S +  +LVLY V +HT  EL AM+ERM  + L T +LT++D+VK HLR+ +GGR +
Sbjct  471   YRYDSRKEDALVLYSVGLHTDTELGAMMERMKAAQLRTFNLTNDDVVKHHLRYFMGGRSN  530

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             V+DELLCRFIFPERPGAL++FLD FSP+WNI+LF+YRA GE GANVLVG+QVP  +++EF
Sbjct  531   VQDELLCRFIFPERPGALMKFLDTFSPRWNISLFHYRAQGETGANVLVGIQVPKEDMEEF  590

Query  423   KQRANDLGYEYAIE-TSEAFQLLMN  352
             + +AN LGYEYA   T+EA+QLLM 
Sbjct  591   RNKANTLGYEYAYGVTNEAYQLLMQ  615



>ref|XP_009593672.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Nicotiana tomentosiformis]
Length=605

 Score =   487 bits (1254),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 286/315 (91%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P++KIIGVEP DANAMALSL HG+RVMLDQVGGFADGVAVKVVGEET+ +C+EL
Sbjct  291   YLKRVAPDIKIIGVEPLDANAMALSLQHGQRVMLDQVGGFADGVAVKVVGEETYRLCKEL  350

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  351   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  410

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T +PEEPGSFKKF E+VGPMNITEF+YRY+SG+ ++
Sbjct  411   MNFDRLRLVTELADVGRQREAVLATFMPEEPGSFKKFSEMVGPMNITEFKYRYNSGKEKA  470

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HTK+EL+ MV+RM  ++L T++LTDNDLVKDHLRHL+GGR +V++ELLCRF 
Sbjct  471   LVLYSVGLHTKLELEEMVKRMKSAELQTVNLTDNDLVKDHLRHLMGGRTNVQNELLCRFT  530

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPE+PGAL++FL+AFSP+WNI+LF+YRA G+ GANVLVG+QVP  E+DEF+ RA+ LGYE
Sbjct  531   FPEKPGALMKFLNAFSPRWNISLFHYRAQGDTGANVLVGIQVPQAEVDEFQGRADSLGYE  590

Query  393   YAIET-SEAFQLLMN  352
             YA+E+ +EAFQL+M+
Sbjct  591   YAMESLNEAFQLIMH  605



>ref|XP_008794048.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Phoenix dactylifera]
Length=618

 Score =   488 bits (1255),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 231/325 (71%), Positives = 280/325 (86%), Gaps = 1/325 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK V PEVKIIGVEP DANAMALSL+HG+RV L+QVGGFADGVAVKVVG
Sbjct  294   GGGLVAGIAAYVKRVRPEVKIIGVEPSDANAMALSLYHGQRVTLEQVGGFADGVAVKVVG  353

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CREL+DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKG 
Sbjct  354   EETFRLCRELVDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGT  413

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ +TSGANMNFDRLR + ELADVG +REA+L+T L EE GSFK+F ELVG +NITEF+
Sbjct  414   SVVAITSGANMNFDRLRLVTELADVGRKREAVLATILREERGSFKQFCELVGSINITEFK  473

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY S +  +LVLY V +HT  EL AMVERM  + L TI+LT++++VKDH+R+ +GGR +
Sbjct  474   YRYDSRKEDALVLYSVGLHTDAELVAMVERMKSAQLRTINLTNDNVVKDHMRYFMGGRSN  533

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             V+DELLCRFIFPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QV   +++EF
Sbjct  534   VQDELLCRFIFPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVAKEDMEEF  593

Query  423   KQRANDLGYEYAIE-TSEAFQLLMN  352
               +AN LGYEY  E T+EA+QLLM 
Sbjct  594   ANQANKLGYEYTYEVTNEAYQLLMQ  618



>ref|XP_011094452.1| PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, 
chloroplastic [Sesamum indicum]
Length=604

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 272/314 (87%), Gaps = 4/314 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHG+RV+LDQVGGFADGVAVKVVGEETF +CREL
Sbjct  293   YVKRVLPEVKIIGVEPFDANAMALSLHHGQRVVLDQVGGFADGVAVKVVGEETFHLCREL  352

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+CASIKDMFEE+R+ILEP+GAL+   AEAYCKYY LK  N++ VTSGAN
Sbjct  353   IDGVVLVSRDAICASIKDMFEEKRSILEPAGALA---AEAYCKYYGLKAANVVAVTSGAN  409

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG ++EA+++T LPE PGSFK+F ELVGPMNITEF+YRY S + +S
Sbjct  410   MNFDRLRLVTELADVGRRKEAVMATYLPESPGSFKRFCELVGPMNITEFKYRYYSDKEKS  469

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT+ E+ AMV+RM  S LHTI+LT+NDLVKDHLRHL+GGR  V+DELLCRF+
Sbjct  470   LVLYSVGLHTEAEIHAMVKRMESSQLHTINLTENDLVKDHLRHLMGGRSYVKDELLCRFV  529

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDA SP+WNI+LF+YRA GE GANVLVG+QV   E+DEF+ RAN +GY 
Sbjct  530   FPERPGALMKFLDALSPRWNISLFHYRAQGEMGANVLVGIQVADTEMDEFRDRANSIGYG  589

Query  393   YAIET-SEAFQLLM  355
             Y +ET +EAFQLLM
Sbjct  590   YEVETRNEAFQLLM  603



>ref|XP_009774928.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Nicotiana sylvestris]
Length=602

 Score =   484 bits (1247),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 232/315 (74%), Positives = 283/315 (90%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P++KIIGVEP DANAMALSL HG+RVMLDQVGGFADGVAVKVVGEET+ +C+EL
Sbjct  288   YLKRVAPDIKIIGVEPLDANAMALSLQHGQRVMLDQVGGFADGVAVKVVGEETYRLCKEL  347

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGENI+ +TSGAN
Sbjct  348   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENIVAITSGAN  407

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T + E+PGSFKKF E+VGPMNITEF+YRY+SG+ ++
Sbjct  408   MNFDRLRLVTELADVGRQREAVLATFMAEKPGSFKKFSEMVGPMNITEFKYRYNSGKEKA  467

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HTK+EL+ MVERM  ++L TI+LTDNDLVKDHLRHL+GGR +V +ELLCRF 
Sbjct  468   LVLYSVGLHTKLELEEMVERMKYANLQTINLTDNDLVKDHLRHLMGGRTNVLNELLCRFT  527

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPE+PGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP  E+DEF+ RA+ LGYE
Sbjct  528   FPEKPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPQAEVDEFQGRADSLGYE  587

Query  393   YAIET-SEAFQLLMN  352
             YA+E+ +EAFQL+M 
Sbjct  588   YAVESLNEAFQLIMQ  602



>ref|NP_001234234.1| chloroplast threonine deaminase 1 precursor [Solanum lycopersicum]
 gb|ABK20067.1| chloroplast threonine deaminase 1 precursor [Solanum lycopersicum]
Length=606

 Score =   479 bits (1234),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 229/315 (73%), Positives = 283/315 (90%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P++KIIGVEP DANA+ALSLHHG+RVMLDQVGGFADGVAVKVVGEET+ +C EL
Sbjct  292   YLKRVAPDIKIIGVEPLDANALALSLHHGQRVMLDQVGGFADGVAVKVVGEETYRLCEEL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  352   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T +PE+PGSFKKF E+VGPMNITEF+YRY+S + ++
Sbjct  412   MNFDRLRLVTELADVGRQREAVLATFMPEDPGSFKKFAEMVGPMNITEFKYRYNSDKERA  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT +EL+ MVERM  +DL TI+LTDNDLVKDHLRHL+GGR +V +ELLCRF 
Sbjct  472   LVLYSVGLHTILELEGMVERMESADLQTINLTDNDLVKDHLRHLMGGRTNVHNELLCRFT  531

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPE+PGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP +E+ EF+ RA+ LGYE
Sbjct  532   FPEKPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPPDEVVEFEGRADSLGYE  591

Query  393   YAIET-SEAFQLLMN  352
             YA+E+ +EA+QL+M+
Sbjct  592   YAMESLNEAYQLIMH  606



>ref|XP_006339100.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Solanum tuberosum]
Length=609

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 283/315 (90%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P++KIIGVEP DANA+ALSL HG+RVMLDQVGGFADGVAVKVVGEET+ +C EL
Sbjct  295   YLKRVAPDIKIIGVEPLDANALALSLQHGQRVMLDQVGGFADGVAVKVVGEETYRLCEEL  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  355   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T +PE+PGSFKKF E+VGPMNITEF+YRY+S + ++
Sbjct  415   MNFDRLRLVTELADVGRQREAVLATFMPEDPGSFKKFAEMVGPMNITEFKYRYNSDKERA  474

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT +EL+ MVERM  +DL TI+L+DNDLVKDHLRHL+GGR +V +ELLCRF 
Sbjct  475   LVLYSVGLHTILELEGMVERMESADLQTINLSDNDLVKDHLRHLMGGRTNVHNELLCRFT  534

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPE+PGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP +E+ EF+ RAN+LGYE
Sbjct  535   FPEKPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPQDEVVEFEGRANNLGYE  594

Query  393   YAIET-SEAFQLLMN  352
             YA+E+ +EA+QL+M+
Sbjct  595   YAVESLNEAYQLIMH  609



>ref|XP_009400978.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=609

 Score =   477 bits (1228),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 266/315 (84%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHG+R+M++ VGGFADGVAVKVVGEETF +CREL
Sbjct  295   YVKRVCPEVKIIGVEPSDANAMALSLHHGQRIMVEHVGGFADGVAVKVVGEETFRLCREL  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKG N++ +TSGAN
Sbjct  355   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGTNVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFK F +LVG MNITEF+YRY S R  +
Sbjct  415   MNFDRLRLVTELADVGRKREAVLATILPEEHGSFKTFCKLVGSMNITEFKYRYDSRREDA  474

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT  EL AMV RM  + L TI+LT++DL KDHLR+ +GG  +V+DELLCRFI
Sbjct  475   LVLYSVGLHTDTELGAMVNRMKSAQLRTINLTNDDLAKDHLRYFMGGWSNVQDELLCRFI  534

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP WNITLF+YRA GE GANVLVG+QVP  ++ EFK +A DLGYE
Sbjct  535   FPERPGALMKFLDAFSPCWNITLFHYRAQGETGANVLVGIQVPKEDMQEFKHQAQDLGYE  594

Query  393   YAIE-TSEAFQLLMN  352
             Y+ E T E++ LLM 
Sbjct  595   YSYEMTDESYWLLMQ  609



>ref|XP_011101468.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Sesamum indicum]
Length=610

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 278/314 (89%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSL+H +RVMLDQVGGFADGVAVKVVGEE F +CREL
Sbjct  296   YVKRVSPEVKIIGVEPFDANAMALSLYHDQRVMLDQVGGFADGVAVKVVGEEPFRLCREL  355

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKG N++ VTSGAN
Sbjct  356   IDGIVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGANVVAVTSGAN  415

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T + EEPGSFK+F ELVGPMNITEF+YRY+S + ++
Sbjct  416   MNFDRLRLVTELADVGRRREAVLATYMTEEPGSFKQFCELVGPMNITEFKYRYNSDKEKA  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT++EL+ MV+RM  + L TI+LT+NDLVKDHLRHL+GGR  V+DELLCRF+
Sbjct  476   LVLYSVGLHTELELEGMVKRMKSAQLQTINLTENDLVKDHLRHLMGGRSYVKDELLCRFV  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDA SP+WNI+LF+YR  GE GANVLVG+QV  +E+DEF+ RAN LGYE
Sbjct  536   FPERPGALMKFLDALSPRWNISLFHYRGQGETGANVLVGIQVAQHEMDEFRDRANSLGYE  595

Query  393   YAIETS-EAFQLLM  355
             Y +E+S EAFQLLM
Sbjct  596   YELESSNEAFQLLM  609



>ref|XP_006826329.1| hypothetical protein AMTR_s00004p00101110 [Amborella trichopoda]
 gb|ERM93566.1| hypothetical protein AMTR_s00004p00101110 [Amborella trichopoda]
Length=616

 Score =   476 bits (1224),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 271/315 (86%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DAN +A+SL+HG+RV+LD VGGFADGVAVK++GEETF +CR+L
Sbjct  302   YVKRVRPEVKIIGVEPVDANTLAMSLYHGQRVLLDHVGGFADGVAVKLIGEETFRVCRDL  361

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV VGRDA+CASIKDMFEE+R+ILEPSGALS+AGAEAYCKYY LKGE ++ +TSGAN
Sbjct  362   VDGVVLVGRDAICASIKDMFEEKRSILEPSGALSLAGAEAYCKYYGLKGETVVAITSGAN  421

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T +PE+PGSFK F E+VGP+NITEF+YRY   + ++
Sbjct  422   MNFDRLRLVTELADVGRKREAVLATFMPEKPGSFKTFAEMVGPINITEFKYRYDGTKEEA  481

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVL  V VHT  +L AMVER+  S+L TIDLT+NDL KDHLRHL+GGR +V+DELLCRF 
Sbjct  482   LVLCSVGVHTSSQLKAMVERLGSSNLRTIDLTNNDLAKDHLRHLMGGRSNVKDELLCRFT  541

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FL+AFSP+WNI+LF+YRA G+ GANVLVG+QVP  ++DE + +A+ LGYE
Sbjct  542   FPERPGALMKFLNAFSPRWNISLFHYRAQGDIGANVLVGIQVPKGDMDELRDKADVLGYE  601

Query  393   YAIE-TSEAFQLLMN  352
             Y +E  +EA +LLM 
Sbjct  602   YMLEMNNEALRLLMQ  616



>ref|XP_010683961.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=611

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 229/315 (73%), Positives = 281/315 (89%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHG+R+MLD+VGGFADGVAVKVVGEETF IC+EL
Sbjct  297   YVKRVKPEVKIIGVEPSDANAMALSLHHGQRIMLDKVGGFADGVAVKVVGEETFRICKEL  356

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+CASIK+MFEE+R+ILEP+GAL++AGAEAYCKYY +K +N++V+TSGAN
Sbjct  357   IDGVVLVNRDAICASIKNMFEEKRSILEPAGALALAGAEAYCKYYGIKNQNVVVITSGAN  416

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T +PEEPGSF+ F E+VGPMNITEF+YRY+S + ++
Sbjct  417   MNFDRLRLVTELADVGRQREAVLATFMPEEPGSFRIFSEMVGPMNITEFKYRYNSAKQEA  476

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V  HT  EL+AM ERM  S L TI+LT+NDLVKDHLRHL+GGR  VE+ELLCRF+
Sbjct  477   LVLYSVGHHTVSELEAMKERMESSKLRTINLTNNDLVKDHLRHLMGGRSDVENELLCRFV  536

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGALL+FLD FSP+WNI+LF+YRA GEAGANVLVG+QVPS+E+DEF++RA+++G+ 
Sbjct  537   FPERPGALLKFLDVFSPRWNISLFHYRAQGEAGANVLVGIQVPSSEMDEFRERADNIGFI  596

Query  393   YAIET-SEAFQLLMN  352
             YAIE+ +E + +LM+
Sbjct  597   YAIESGNEVYDVLMH  611



>ref|XP_009793990.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Nicotiana sylvestris]
Length=601

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 278/315 (88%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V+P++KIIGVEP D+NAMALSLHHG R+ML+ VGGFAD VA+KV+GEETF +CREL
Sbjct  287   YLKKVSPDIKIIGVEPFDSNAMALSLHHGRRIMLEHVGGFADAVAIKVMGEETFRLCREL  346

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGENI+ +TSGAN
Sbjct  347   LDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENIVAITSGAN  406

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L T +PEEPGSF+KF ++VG MN+TE +YRY+S + ++
Sbjct  407   MNFDRLRLVTELADVGRQREAVLVTYMPEEPGSFRKFYKMVGRMNLTELKYRYNSEKEKA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              VLYRV +HTK+EL+ MV+RM  S LHTI+ TDN+LVKDHLRHL+GGR +V DELLCRFI
Sbjct  467   RVLYRVGLHTKLELEEMVDRMESSQLHTINFTDNELVKDHLRHLMGGRSNVHDELLCRFI  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  E+ EFK RA+ LGYE
Sbjct  527   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPQGEVGEFKARADTLGYE  586

Query  393   YAIET-SEAFQLLMN  352
             Y +ET +EAFQ+LM+
Sbjct  587   YVVETLNEAFQILMH  601



>gb|AIL30479.1| chloroplast threonine deaminase 1 precursor [Nicotiana tabacum]
Length=602

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/305 (73%), Positives = 275/305 (90%), Gaps = 0/305 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P++KIIGVEP DANAMALSL HG+RVMLDQVGGFADGVAVKVVGEE + +C+EL
Sbjct  291   YLKRVAPDIKIIGVEPLDANAMALSLQHGQRVMLDQVGGFADGVAVKVVGEEAYRLCKEL  350

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKG N++ +TSGAN
Sbjct  351   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGGNVVAITSGAN  410

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T +PEEPGSFKKF E+VGPMNITEF+YRY+SG+ ++
Sbjct  411   MNFDRLRLVTELADVGRQREAVLATFMPEEPGSFKKFSEMVGPMNITEFKYRYNSGKEKA  470

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HTK+EL+ MV+RM  ++L T++LTDNDLVKDHLRHL+GGR +V++ELLCRF 
Sbjct  471   LVLYSVGLHTKLELEEMVKRMKSAELQTVNLTDNDLVKDHLRHLMGGRTNVQNELLCRFT  530

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPE+PGAL++FL+AFSP+WNI+LF+YRA G+ GANVLVG+QVP  E+DEF+ RA+ LGYE
Sbjct  531   FPEKPGALMKFLNAFSPRWNISLFHYRAQGDTGANVLVGIQVPQAEVDEFQGRADSLGYE  590

Query  393   YAIET  379
             YA+E+
Sbjct  591   YAMES  595



>gb|EYU38591.1| hypothetical protein MIMGU_mgv1a003122mg [Erythranthe guttata]
Length=606

 Score =   472 bits (1214),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 233/314 (74%), Positives = 274/314 (87%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V+PEVKIIGVEP DANAMALSLHH +RVMLDQVGGFADGVAVKVVGEETF +C EL
Sbjct  292   YMKRVSPEVKIIGVEPFDANAMALSLHHDQRVMLDQVGGFADGVAVKVVGEETFRLCSEL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKG N++ VTSGAN
Sbjct  352   IDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGANVVAVTSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T + EEPGSFK+F ELVGP+NITEF+YR    + ++
Sbjct  412   MNFDRLRLVTELADVGRRREAVLATYIQEEPGSFKQFCELVGPLNITEFKYRCILDKQEA  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT +ELDAMV+RM  + L TI+LT+NDLVKDHLRHL+GGR +V DELLCRFI
Sbjct  472   LVLYSVGLHTDLELDAMVQRMRSAQLKTINLTENDLVKDHLRHLMGGRSNVRDELLCRFI  531

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDA SP+WNI+LF+YR  GE GANVLVG+QV  NE+ EF+ RAN LGYE
Sbjct  532   FPERPGALMKFLDALSPRWNISLFHYRGQGETGANVLVGIQVAQNEMGEFRGRANSLGYE  591

Query  393   YAIETS-EAFQLLM  355
             Y +ETS EAFQLLM
Sbjct  592   YELETSNEAFQLLM  605



>ref|XP_009590879.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=601

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 280/315 (89%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V+P++KIIGVEP D+NAMALSLHHG R+ML+QVGGFAD VA+KV+GEETF +CREL
Sbjct  287   YLKKVSPDIKIIGVEPFDSNAMALSLHHGRRIMLEQVGGFADAVAIKVMGEETFRLCREL  346

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV VGRDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGENI+ +TSGAN
Sbjct  347   LDGVVLVGRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENIVAITSGAN  406

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG Q EA+L+T +PE+PGSF+KF ++VG MN+TE +YRY+S + ++
Sbjct  407   MNFDRLRLVTELADVGRQLEAVLATYMPEQPGSFRKFYKMVGRMNLTELKYRYNSEKEKA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              VLYRV +HTK+EL+ MV+RM  S LHTI+ TDN+LVKDHLRHL+G R +V +ELLCRFI
Sbjct  467   RVLYRVGLHTKLELEEMVDRMESSQLHTINFTDNELVKDHLRHLMGCRSTVHNELLCRFI  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVL+G+QVP +E+DEF+ RA+ LGYE
Sbjct  527   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLIGIQVPQSEVDEFRARADTLGYE  586

Query  393   YAIET-SEAFQLLMN  352
             Y +ET +EAFQLLM+
Sbjct  587   YVLETLNEAFQLLMH  601



>ref|XP_010933388.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Elaeis guineensis]
Length=617

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 271/315 (86%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL+HG+RV L+QVGGFADGVAVKVVGEETF +CREL
Sbjct  303   YVKRVRPEVKIIGVEPSDANAMALSLYHGQRVSLEQVGGFADGVAVKVVGEETFRLCREL  362

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKG +++ +TSGAN
Sbjct  363   VDGVVLVNRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGVSVVAITSGAN  422

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T L EE GSFK+F ELVG +NITEF+YRY S +  +
Sbjct  423   MNFDRLRLVTELADVGRKREAVLATILQEERGSFKQFCELVGSINITEFKYRYDSHKEDA  482

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT  EL AMVERM  + L TI+LT+N+LVKDH+R+ +GGR +V+DELLCRFI
Sbjct  483   LVLYSVGLHTDAELVAMVERMKSAQLRTINLTNNNLVKDHMRYFVGGRSNVQDELLCRFI  542

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP  +++EF ++AN+LGYE
Sbjct  543   FPERPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPEEDMEEFTKQANNLGYE  602

Query  393   YAIE-TSEAFQLLMN  352
             Y  E T E ++LLM 
Sbjct  603   YTYEVTDEVYRLLMQ  617



>ref|XP_002466574.1| hypothetical protein SORBIDRAFT_01g010250 [Sorghum bicolor]
 gb|EER93572.1| hypothetical protein SORBIDRAFT_01g010250 [Sorghum bicolor]
Length=605

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 266/314 (85%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  287   YVKRVRPEVKIIGVEPSDANAMALSLCHGKRVMLEHVGGFADGVAVKTVGEETFRLCREL  346

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYYNLKGEN++ +TSGAN
Sbjct  347   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYNLKGENVVAITSGAN  406

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY S    +
Sbjct  407   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFTELVGRMNITEFKYRYDSNAKDA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV+RM  + L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  467   LVLYSVGIYTDDELGAMVDRMESAKLRTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GEAGANVLVG+QVP  E DEFK  A +LGYE
Sbjct  527   FPERPGALMKFLDAFSPRWNISLFHYRAQGEAGANVLVGIQVPPAEFDEFKSHAENLGYE  586

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  587   YMSEHNNEIYRLLL  600



>ref|XP_002264311.2| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Vitis vinifera]
 emb|CBI30207.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 277/315 (88%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHH +RVMLDQVGGFADGVAVKVVGEETF +CREL
Sbjct  292   YVKRVSPEVKIIGVEPCDANAMALSLHHDQRVMLDQVGGFADGVAVKVVGEETFRLCREL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V V RDA+CASIK+MFEE+R+ILEP+GAL++AGAEAYCKYY +KG NI+ +TSGAN
Sbjct  352   IDGIVLVSRDAICASIKNMFEEKRSILEPAGALALAGAEAYCKYYGIKGGNIVAITSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T LPEEPGSFK+F E+VG MNITEF+YRY+  + ++
Sbjct  412   MNFDRLRLVTELADVGRQREAVLATLLPEEPGSFKQFCEMVGHMNITEFKYRYNPHKEKA  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT +EL AMVERM  S L T++LT++DLVKDHLRHL+GGR  VE+ELLCRF+
Sbjct  472   LVLYSVGLHTVLELSAMVERMESSQLTTLNLTNDDLVKDHLRHLMGGRSHVENELLCRFV  531

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG L++FLD FSP+WNI+LF+YR  GEAGANVLVG+QVP  E+ EFK+RA+ LGYE
Sbjct  532   FPERPGTLMKFLDTFSPRWNISLFHYRGQGEAGANVLVGIQVPETEMTEFKRRADALGYE  591

Query  393   YAIETS-EAFQLLMN  352
             YA+ETS +A+ LLM+
Sbjct  592   YAVETSNKAYLLLMH  606



>ref|XP_010242986.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Nelumbo nucifera]
Length=610

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 229/313 (73%), Positives = 273/313 (87%), Gaps = 1/313 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVK+IGVEP DANAMALSLHHG+R+ML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  296   YVKRVRPEVKVIGVEPSDANAMALSLHHGQRIMLEQVGGFADGVAVKVVGEETFRLCREL  355

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKY+ LKGE+++ +TSGAN
Sbjct  356   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYHGLKGESVVAITSGAN  415

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T L EEPGSFK+F ELVG MNITEF+YRY + R  +
Sbjct  416   MNFDRLRLVTELADVGRQREAVLATFLHEEPGSFKQFCELVGQMNITEFKYRYDASREDA  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +HT  EL+AMV+RM  S L TI+LT+NDLVKDHLRHL+GGR +V++ELLCRF+
Sbjct  476   LVLYSVVLHTVSELEAMVDRMESSQLRTINLTNNDLVKDHLRHLMGGRSNVQNELLCRFV  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG L+ FL  FSP+WNITLF+YR  GE GANVLVG+QV SNE++EFK RAN LGY+
Sbjct  536   FPERPGTLMNFLHTFSPRWNITLFHYRGQGETGANVLVGIQVASNEMEEFKDRANTLGYD  595

Query  393   YAIETS-EAFQLL  358
             Y IETS EAF+LL
Sbjct  596   YMIETSNEAFRLL  608



>emb|CDY00902.1| BnaC05g42980D [Brassica napus]
Length=608

 Score =   469 bits (1207),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 270/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DAN+MALSLHHGERV+L+Q+GGFADGVAVK VGEETF ICR+L
Sbjct  295   YVKRVSPEVKIIGVEPADANSMALSLHHGERVILNQIGGFADGVAVKEVGEETFRICRKL  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDAMCASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGAN
Sbjct  355   IDGVVLVTRDAMCASIKDMFEEKRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F ELVGPMNITEF+YR  S R  +
Sbjct  415   MNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKQFCELVGPMNITEFKYRCGS-RKDA  473

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LCRFI
Sbjct  474   VVLYSVGVHTPGELKALEKRMESSQLKTTNLTTSDLVKDHLRYLMGGRSSVENEVLCRFI  533

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YRA G AGANVLVG+QVP NE++EF+ RA  LGYE
Sbjct  534   FPERPGALMKFLDSFSPRWNISLFHYRAEGAAGANVLVGIQVPENEMEEFRNRAQVLGYE  593

Query  393   YAIETSEA-FQLLMN  352
             Y + + +  F+LLM 
Sbjct  594   YVLVSEDINFKLLMQ  608



>ref|XP_007027549.1| L-O-methylthreonine resistant 1 isoform 1 [Theobroma cacao]
 gb|EOY08051.1| L-O-methylthreonine resistant 1 isoform 1 [Theobroma cacao]
Length=612

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/325 (71%), Positives = 278/325 (86%), Gaps = 2/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK V PEVKIIGVEP DANAMALSLHHGERVMLDQVGGFADGVAVK VG
Sbjct  289   GGGLVAGIAAYVKRVAPEVKIIGVEPFDANAMALSLHHGERVMLDQVGGFADGVAVKEVG  348

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CREL+DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKG+
Sbjct  349   EETFRLCRELVDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGK  408

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             NI+ +TSGANMNFD+LR + ELA+VG Q+EA+L+T LPEEPGSFK+F ELVGPMNITEF+
Sbjct  409   NIVAITSGANMNFDKLRVVTELANVGRQQEAVLATILPEEPGSFKQFCELVGPMNITEFK  468

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR SS + +++VLY V VHT  EL  M +RM  S L T +LT +DLVKDHLR+L+GGR +
Sbjct  469   YRCSSEK-EAVVLYSVGVHTVSELGTMKQRMESSQLRTYNLTASDLVKDHLRYLMGGRLN  527

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             VE+E+LCRFIFPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QV   E++EF
Sbjct  528   VENEVLCRFIFPERPGALMKFLDTFSPRWNISLFHYRGQGETGANVLVGIQVAKGEMEEF  587

Query  423   KQRANDLGYEYAIETSEA-FQLLMN  352
                A+ LGY+Y + T +  FQLLM+
Sbjct  588   HHLADRLGYDYVLVTDDKDFQLLMH  612



>ref|XP_008387481.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Malus domestica]
Length=608

 Score =   462 bits (1188),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 269/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V P+VKIIGVEP DANA+ALSLHHG+R+MLDQVGGFADGVAVK VGEETF +C+++
Sbjct  295   YVKRVAPKVKIIGVEPSDANALALSLHHGQRIMLDQVGGFADGVAVKEVGEETFRLCKDM  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+C SIKDMFEE R+ILEP+GALS+AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  355   VDGVVLVSRDAICGSIKDMFEETRSILEPAGALSLAGAEAYCKYYGLKGENVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PEEPGSFK + ELVGPMNI+EF+YR++S + ++
Sbjct  415   MNFDKLRVVTELANVGRQQEAVLATVMPEEPGSFKHYCELVGPMNISEFKYRHNSDK-EA  473

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ER+  S L T +LT +DLVKDHLR+L+GGR ++++E+LCRF+
Sbjct  474   IVLYSVGVHTASELQEMQERLESSQLKTYNLTKSDLVKDHLRYLMGGRSNLQNEILCRFV  533

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YR  GE GANVLVG+QVP +EIDEF  RA  LGY+
Sbjct  534   FPERPGALMKFLDAFSPRWNISLFHYRGEGETGANVLVGIQVPQSEIDEFHARATTLGYD  593

Query  393   YAIETSEA-FQLLMN  352
             Y + T +  F+LLM+
Sbjct  594   YVVVTDDIDFKLLMH  608



>emb|CDY60161.1| BnaAnng16560D [Brassica napus]
Length=605

 Score =   461 bits (1187),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 269/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DAN+MALSLHHGERV+L+Q+GGFADGVAVK VGEETF ICR+L
Sbjct  292   YVKRVSPEVKIIGVEPADANSMALSLHHGERVILNQIGGFADGVAVKEVGEETFRICRKL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDAMCASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGAN
Sbjct  352   MDGVVLVTRDAMCASIKDMFEEKRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F ELVGPMNITEF+YR  S R ++
Sbjct  412   MNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKQFCELVGPMNITEFKYRCGS-RKEA  470

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LCRFI
Sbjct  471   VVLYSVGVHTPGELKALEKRMESSQLKTTNLTTSDLVKDHLRYLMGGRSSVENEVLCRFI  530

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YRA G AGANVLVG+ V  +E++EF+ RA  LGYE
Sbjct  531   FPERPGALMKFLDSFSPRWNISLFHYRAEGAAGANVLVGIHVSEHEMEEFRNRAQVLGYE  590

Query  393   YAIETSEA-FQLLMN  352
             Y + + +  F+LLM 
Sbjct  591   YVLVSEDINFKLLMQ  605



>gb|KDP29223.1| hypothetical protein JCGZ_16612 [Jatropha curcas]
Length=609

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 224/325 (69%), Positives = 280/325 (86%), Gaps = 2/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK VNPEVKIIGVEP DANAMALSLHHGERVMLD VGGFADGVAVK VG
Sbjct  286   GGGLVAGIAAYVKRVNPEVKIIGVEPSDANAMALSLHHGERVMLDHVGGFADGVAVKEVG  345

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+E IDGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY L+G+
Sbjct  346   EETFRLCKESIDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLQGK  405

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N++ +TSGANMNFD+LR + ELA+VG Q+EA+L+T +PEEPG FK+F ELVGPMNITEF+
Sbjct  406   NVVAITSGANMNFDKLRVVTELANVGRQQEAVLATVMPEEPGMFKRFCELVGPMNITEFK  465

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +S + +++VLY V +HT  E++A+ +RM  S L T +LT +DLVKDHLR+L+GGR +
Sbjct  466   YRCNSEK-EAVVLYSVGLHTVSEIEALQQRMESSQLRTYNLTSSDLVKDHLRYLMGGRLN  524

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             V++E+LC F+FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QVP +E+DEF
Sbjct  525   VQNEVLCHFVFPERPGALMKFLDTFSPRWNISLFHYRGQGETGANVLVGIQVPEHEMDEF  584

Query  423   KQRANDLGYEYAIET-SEAFQLLMN  352
               RAN +GY+Y + T  + FQLLM+
Sbjct  585   HSRANSVGYDYDLVTDDDNFQLLMH  609



>ref|XP_010486587.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Camelina sativa]
Length=591

 Score =   459 bits (1181),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHGERV+LD+VGGFADGVAVK VGEETF I R L
Sbjct  278   YVKRVAPEVKIIGVEPADANAMALSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNL  337

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGAN
Sbjct  338   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGAN  397

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGP+NITEF+YR S+ + ++
Sbjct  398   MNFDKLRMVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPVNITEFKYRCSTEK-EA  456

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+  RM  S L T++LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  457   VVLYSVGVHTADELKALQNRMECSQLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFT  516

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+ SP+WNI+LF+YR  GE GANVLVG+QVP  E++EFK RAN LGY+
Sbjct  517   FPERPGALMNFLDSLSPRWNISLFHYRGQGETGANVLVGIQVPEQEMEEFKDRANALGYD  576

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  577   YFLVSDDDYFQLLMH  591



>ref|XP_009340966.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Pyrus x bretschneideri]
Length=608

 Score =   459 bits (1182),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 269/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V P+VKIIGVEP DANA+ALSLHHG+R+MLDQVGGFADGVAVK VGEETF +C+++
Sbjct  295   YVKRVAPKVKIIGVEPSDANALALSLHHGQRIMLDQVGGFADGVAVKEVGEETFRLCKDM  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+C SIKDMFEE R+ILEP+GALS+AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  355   VDGVVLVSRDAICGSIKDMFEETRSILEPAGALSLAGAEAYCKYYGLKGENVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PEEPGSFK F ELVGPMNI+EF+YR++S + ++
Sbjct  415   MNFDKLRVVTELANVGRQQEAVLATVMPEEPGSFKHFCELVGPMNISEFKYRHNSDK-EA  473

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ER+  S L T +LT +DLVKDHLR+L+GGR ++++E+LCRF+
Sbjct  474   IVLYSVGVHTASELQEMQERLESSQLKTYNLTKSDLVKDHLRYLMGGRSNLQNEILCRFV  533

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+W+I+LF+YR  GE GANVLVG+QV  +EIDEF  RAN LGY+
Sbjct  534   FPERPGALMKFLDAFSPRWDISLFHYRGEGETGANVLVGIQVTQSEIDEFHARANTLGYD  593

Query  393   YAIETSE-AFQLLMN  352
             Y + T +  F+LLM+
Sbjct  594   YVVVTDDIEFKLLMH  608



>gb|EEE59807.1| hypothetical protein OsJ_12332 [Oryza sativa Japonica Group]
Length=536

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/314 (73%), Positives = 266/314 (85%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  218   YVKRVRPEVKIIGVEPSDANAMALSLCHGQRVMLEQVGGFADGVAVKVVGEETFRLCREL  277

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  278   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  337

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  338   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDCNAKDA  397

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMVERM  S L T+DLTDNDL KDHLR+ IGGR  V DEL+ RFI
Sbjct  398   LVLYSVGIYTDDELKAMVERMESSKLRTVDLTDNDLAKDHLRYFIGGRSEVTDELVYRFI  457

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  E DEFK RA++LGYE
Sbjct  458   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPPEEFDEFKSRADNLGYE  517

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  518   YMSEQNNEIYRLLL  531



>ref|XP_010480268.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Camelina sativa]
Length=591

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 264/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHGERV+LD+VGGFADGVAVK VGEETF I R L
Sbjct  278   YVKRVAPEVKIIGVEPADANAMALSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNL  337

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGAN
Sbjct  338   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGAN  397

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGP+NITEF+YR S+ + ++
Sbjct  398   MNFDKLRMVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPVNITEFKYRCSTEK-EA  456

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+  RM  S L T++LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  457   VVLYSVGVHTADELKALQNRMECSQLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFT  516

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+ SP+WNI+LF+YR  GE GANVLVG+QVP  E+ EFK RAN LGY+
Sbjct  517   FPERPGALMNFLDSLSPRWNISLFHYRGQGETGANVLVGIQVPEQEMGEFKDRANALGYD  576

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  577   YFLVSDDDYFQLLMH  591



>ref|XP_008241338.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Prunus mume]
Length=607

 Score =   458 bits (1179),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+P+VKIIGVEP DANAMALSLHHG+R+MLDQVGGFADGVAVK VGEETF +C+++
Sbjct  294   YVKRVSPKVKIIGVEPSDANAMALSLHHGQRIMLDQVGGFADGVAVKEVGEETFRLCKDM  353

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+C SIKDMFEE R+ILEP+GALS+AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  354   VDGVVLVSRDAICGSIKDMFEETRSILEPAGALSLAGAEAYCKYYGLKGENVVAITSGAN  413

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PEEPGSFK + ELVGPMNI+EF+YR +S + Q+
Sbjct  414   MNFDKLRVVTELANVGRQQEAVLATIMPEEPGSFKHYCELVGPMNISEFKYRCNSDK-QA  472

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ER+    L T +LT +DLVKDHLR+L+GGR +V++E+LC F+
Sbjct  473   VVLYSVGVHTASELKEMQERLESCQLKTYNLTKSDLVKDHLRYLMGGRSNVQNEVLCHFV  532

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QV   +IDEF+ RA+ LGY+
Sbjct  533   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVARGDIDEFQARASSLGYD  592

Query  393   YAIET-SEAFQLLMN  352
             YA+ T  + F LLM+
Sbjct  593   YAVVTDDDEFNLLMH  607



>gb|AAL58211.1|AC090882_14 putative dehydratase/deaminase [Oryza sativa Japonica Group]
Length=602

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 266/315 (84%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  284   YVKRVRPEVKIIGVEPSDANAMALSLCHGQRVMLEQVGGFADGVAVKVVGEETFRLCREL  343

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  344   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  403

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  404   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDCNAKDA  463

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMVERM  S L T+DLTDNDL KDHLR+ IGGR  V DEL+ RFI
Sbjct  464   LVLYSVGIYTDDELKAMVERMESSKLRTVDLTDNDLAKDHLRYFIGGRSEVTDELVYRFI  523

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  E DEFK RA++LGYE
Sbjct  524   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPPEEFDEFKSRADNLGYE  583

Query  393   YAIE-TSEAFQLLMN  352
             Y  E  +E ++LL+ 
Sbjct  584   YMSEQNNEIYRLLLR  598



>ref|XP_006650494.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Oryza brachyantha]
Length=515

 Score =   454 bits (1169),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 266/314 (85%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL H +RVML+ VGGFADGVAVKVVGEETF +CREL
Sbjct  197   YVKRVRPEVKIIGVEPSDANAMALSLCHDQRVMLENVGGFADGVAVKVVGEETFRLCREL  256

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  257   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  316

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVGPMNITEF+YRY      +
Sbjct  317   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFAELVGPMNITEFKYRYDCNTKDA  376

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV RM  S+L T+DLTDNDL KDHLR+ IGGR  V +EL+ RFI
Sbjct  377   LVLYSVGIYTDDELTAMVGRMESSNLKTVDLTDNDLAKDHLRYFIGGRTEVREELVYRFI  436

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GEAGANVLVG+QVPS + DEFK RA++LGYE
Sbjct  437   FPERPGALMKFLDAFSPRWNISLFHYRAQGEAGANVLVGIQVPSEDFDEFKSRADNLGYE  496

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E + LL+
Sbjct  497   YMSELNNEIYHLLL  510



>ref|XP_010098862.1| Threonine dehydratase biosynthetic [Morus notabilis]
 gb|EXB75950.1| Threonine dehydratase biosynthetic [Morus notabilis]
Length=610

 Score =   457 bits (1175),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 274/315 (87%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHG+RV+LDQVGGFADGVAVK VGEETF +CREL
Sbjct  297   YVKRVTPEVKIIGVEPSDANAMALSLHHGQRVILDQVGGFADGVAVKEVGEETFRLCREL  356

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYC+YY +KGEN++ ++SGAN
Sbjct  357   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCRYYGIKGENVVAISSGAN  416

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPE  GSFK F +LVGPM+ITEF+YRYSS + ++
Sbjct  417   MNFDKLRVVTELANVGRQQEAVLATVLPEVAGSFKHFCQLVGPMDITEFKYRYSSDK-EA  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  MVERM  S L T +LT+NDLVKDHLR+L+GGR +V++E+LCRF+
Sbjct  476   VVLYSVGVHTVSELKEMVERMASSQLQTYNLTENDLVKDHLRYLMGGRLNVQNEVLCRFV  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGALL+FLDAFSP+WNITLF+YR  G  GANVLVG+QVPS+E+DEF+ RA+ LGYE
Sbjct  536   FPERPGALLKFLDAFSPRWNITLFHYRGQGATGANVLVGIQVPSSEMDEFRDRADSLGYE  595

Query  393   YAIETSEA-FQLLMN  352
             Y + T++  F+LLM+
Sbjct  596   YTVVTNDGDFKLLMH  610



>ref|XP_009123138.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Brassica rapa]
Length=607

 Score =   457 bits (1175),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 266/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVKVVGEETF I R 
Sbjct  293   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRN  352

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGA
Sbjct  353   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGA  412

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFKKF ELVG MNITEF+YR  S + +
Sbjct  413   NMNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKKFCELVGSMNITEFKYRCGSEK-E  471

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             S+VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC+F
Sbjct  472   SVVLYSVGVHTPGELKALEKRMESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLCQF  531

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QVP  E++EF+ RA  LGY
Sbjct  532   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVPEQEMEEFRNRAQVLGY  591

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +  F+LLM+
Sbjct  592   EYVLVSEDTVFKLLMH  607



>ref|XP_009412484.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=621

 Score =   455 bits (1171),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 269/315 (85%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVK+IGVEP DANAMALSL+HG+R+ML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  307   YVKRVRPEVKVIGVEPSDANAMALSLYHGQRIMLEQVGGFADGVAVKVVGEETFCLCREL  366

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYC+YY LK E I+ +TSGAN
Sbjct  367   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCRYYGLKDETIVAITSGAN  426

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF +LVGPMNITEF+YR+ S +  +
Sbjct  427   MNFDRLRLVTELADVGRKREAVLATILPEERGSFKKFCKLVGPMNITEFKYRFDSRKDNA  486

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V VHT  EL AMV +M  + L T +LT++DL KDHLR+ +GGR +VEDELLCRF+
Sbjct  487   LVLYSVGVHTDSELAAMVHQMEHAQLKTFNLTNDDLAKDHLRYFMGGRSNVEDELLCRFV  546

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YRA GE GANVLVG+QVP  E +EFK RA +LGYE
Sbjct  547   FPERPGALMKFLDSFSPRWNISLFHYRAQGETGANVLVGIQVPKGETEEFKNRAQNLGYE  606

Query  393   YAIE-TSEAFQLLMN  352
             YA E  + A++LLM 
Sbjct  607   YAYEMNNAAYRLLMQ  621



>ref|XP_009418835.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=613

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 268/315 (85%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL+HGER+ML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  299   YVKRVRPEVKIIGVEPSDANAMALSLYHGERIMLEQVGGFADGVAVKVVGEETFRLCREL  358

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYC+YY LK ENI+ +TSGAN
Sbjct  359   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCRYYGLKDENIVAITSGAN  418

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T+LPEE GSFKKF +LVGPMNITEF+YRY S +  +
Sbjct  419   MNFDRLRLVTELADVGRKREAVLATHLPEEQGSFKKFCKLVGPMNITEFKYRYDSRKEHA  478

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V VHT  EL AM+ RM  + L T +LT +DL KDHLR+ +GGR +V+DELLCRFI
Sbjct  479   LVLYSVGVHTDSELAAMIHRMEHAQLKTFNLTSDDLAKDHLRYFMGGRSNVQDELLCRFI  538

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YRA GE GANVLVG+QV   ++ EFK  A +LGYE
Sbjct  539   FPERPGALMKFLDSFSPRWNISLFHYRAQGETGANVLVGIQVSKADMKEFKIGAQNLGYE  598

Query  393   YAIE-TSEAFQLLMN  352
             +  E  +EA++LLM 
Sbjct  599   FTYEMNNEAYRLLMQ  613



>gb|AFW67823.1| hypothetical protein ZEAMMB73_691557 [Zea mays]
Length=429

 Score =   446 bits (1146),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 266/314 (85%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL+HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  111   YVKRVRPEVKIIGVEPSDANAMALSLYHGKRVMLEHVGGFADGVAVKAVGEETFRLCREL  170

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYYNLKG+ ++ +TSGAN
Sbjct  171   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYNLKGDTVVAITSGAN  230

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  231   MNFDRLRLVTELADVGRKREAVLATFLPEEHGSFKKFTELVGRMNITEFKYRYDFNAKDA  290

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV+RM L+ L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  291   LVLYSVGIYTDNELGAMVDRMELAKLKTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  350

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  + DEFK  A++LGYE
Sbjct  351   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPPVDFDEFKSHADNLGYE  410

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  411   YMSENNNEIYRLLL  424



>dbj|BAK03015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   444 bits (1143),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 266/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RV+L+ VGGFADGVAVKVVGEETF +C+EL
Sbjct  83    YVKRVRPEVKIIGVEPSDANAMALSLCHGQRVVLEHVGGFADGVAVKVVGEETFRLCQEL  142

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE RNILEP+GAL++AGAEAYCKYY LKGE ++ ++SGAN
Sbjct  143   VDGIVLVSRDAICASIKDMFEENRNILEPAGALALAGAEAYCKYYGLKGETVVAISSGAN  202

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY S   ++
Sbjct  203   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDSHGKEA  262

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMVERM  S+L T++LTDNDL KDHLR+ IGGR  V+DEL+ RFI
Sbjct  263   LVLYSVGIYTDHELKAMVERMESSELKTVNLTDNDLAKDHLRYFIGGRSEVKDELVYRFI  322

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD  SP+WNI+LF+YRA GE GANVLVG+QVP  E+DEF+ RA++LGYE
Sbjct  323   FPERPGALMNFLDTLSPRWNISLFHYRAQGETGANVLVGIQVPPEEVDEFRSRADNLGYE  382

Query  393   YAIE-TSEAFQLLMN*LNR  340
             Y  E  +E + LL+   N+
Sbjct  383   YMSEMNNEIYHLLLRSPNK  401



>ref|XP_004156263.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cucumis sativus]
Length=630

 Score =   451 bits (1160),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 267/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSL HG+RV+LD+ GGFADGVAVK VGEETF +C++L
Sbjct  305   YVKRVSPEVKIIGVEPSDANAMALSLCHGQRVILDKAGGFADGVAVKEVGEETFRLCKDL  364

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKGEN++V+TSGAN
Sbjct  365   MDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGENVVVITSGAN  424

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+L  + ELA+VG ++EA+L+T LPE PGSFKKF ELVGPMNITEF+YRYSS + ++
Sbjct  425   MNFDKLSIVTELANVGREKEAVLATILPETPGSFKKFCELVGPMNITEFKYRYSSEK-EA  483

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +H   EL+ M +RM  S L T +LT NDLVKDHLR+L+GG+ +VE+E+LCRFI
Sbjct  484   VVLYSVGIHMPSELEEMKDRMESSQLPTYNLTKNDLVKDHLRYLMGGKSNVENEVLCRFI  543

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLDA SP+WNITLF+Y++ GE GAN+LVGLQ+   ++ EF +RA  +GY+
Sbjct  544   FPERPGALEKFLDALSPRWNITLFHYQSKGETGANILVGLQIEKPDMGEFHERARRVGYD  603

Query  393   YAIETSEA-FQLLMN  352
             Y + T +  FQLLM+
Sbjct  604   YVVVTDDGIFQLLMH  618



>ref|XP_004143291.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48217.1| hypothetical protein Csa_6G449240 [Cucumis sativus]
Length=630

 Score =   451 bits (1160),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 267/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSL HG+RV+LD+ GGFADGVAVK VGEETF +C++L
Sbjct  305   YVKRVSPEVKIIGVEPSDANAMALSLCHGQRVILDKAGGFADGVAVKEVGEETFRLCKDL  364

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKGEN++V+TSGAN
Sbjct  365   MDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGENVVVITSGAN  424

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+L  + ELA+VG ++EA+L+T LPE PGSFKKF ELVGPMNITEF+YRYSS + ++
Sbjct  425   MNFDKLSIVTELANVGREKEAVLATILPETPGSFKKFCELVGPMNITEFKYRYSSEK-EA  483

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +H   EL+ M +RM  S L T +LT NDLVKDHLR+L+GG+ +VE+E+LCRFI
Sbjct  484   VVLYSVGIHMPSELEEMKDRMESSQLPTYNLTKNDLVKDHLRYLMGGKSNVENEVLCRFI  543

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLDA SP+WNITLF+Y++ GE GAN+LVGLQ+   ++ EF +RA  +GY+
Sbjct  544   FPERPGALEKFLDALSPRWNITLFHYQSKGETGANILVGLQIEKPDMGEFHERARRVGYD  603

Query  393   YAIETSEA-FQLLMN  352
             Y + T +  FQLLM+
Sbjct  604   YVVVTDDGIFQLLMH  618



>gb|KCW89298.1| hypothetical protein EUGRSUZ_A015882 [Eucalyptus grandis]
Length=502

 Score =   446 bits (1147),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 274/315 (87%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHG+R+MLDQVGGFADGVAVKVVGEETF +C+EL
Sbjct  187   YVKRVSPEVKIIGVEPADANAMALSLHHGQRIMLDQVGGFADGVAVKVVGEETFRLCKEL  246

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  247   VDGVVLVSRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  306

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVG MNITEF+YR +S + ++
Sbjct  307   MNFDKLRVVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGLMNITEFKYRCNSDK-EA  365

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL  M +RM  S L T +LT NDLVKDHLR+L+G R +++DE+LCRF+
Sbjct  366   VVLYSVGLHTASELQQMQKRMKDSHLTTYNLTGNDLVKDHLRYLMGSRLNLQDEVLCRFV  425

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QV  +E+DEFK+ A+ LGY+
Sbjct  426   FPERPGALMKFLDTFSPRWNISLFHYRGQGETGANVLVGIQVTQSEMDEFKECADGLGYD  485

Query  393   YAIETS-EAFQLLMN  352
             YA+ T+ EAF+LLM+
Sbjct  486   YAMVTNDEAFRLLMH  500



>ref|XP_006430342.1| hypothetical protein CICLE_v10011319mg [Citrus clementina]
 gb|ESR43582.1| hypothetical protein CICLE_v10011319mg [Citrus clementina]
Length=606

 Score =   449 bits (1156),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 272/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+ +VKIIGVEP+DANAMALSLHHGERVMLD VGGFADGVAVK VGEETF IC+EL
Sbjct  293   YVKRVSTQVKIIGVEPYDANAMALSLHHGERVMLDHVGGFADGVAVKEVGEETFRICKEL  352

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGA+AYCKYY L G+N++ +TSGAN
Sbjct  353   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAKAYCKYYGLSGKNVVAITSGAN  412

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+ +T +PE+ GSFK+F EL+GPMNITEF+YR+SS +A +
Sbjct  413   MNFDKLRVVTELANVGRQQEAVFATVMPEQSGSFKQFCELLGPMNITEFKYRFSSDKA-A  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL+AM ERM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LCRFI
Sbjct  472   VVLYSVGVHTVAELEAMQERMESSQLKTYNLTQSDLVKDHLRYLMGGRLSVENEVLCRFI  531

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG+L++FLDAFSP+WNI+LF+YR  GE GAN+LVG+QVP NE+ EF  RAN LGY+
Sbjct  532   FPERPGSLMKFLDAFSPRWNISLFHYRGQGETGANILVGIQVPENELAEFHGRANRLGYD  591

Query  393   YAIETSE-AFQLLMN  352
             YA+ T +  F+LLM+
Sbjct  592   YAVVTDDNNFELLMH  606



>ref|XP_008462516.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Cucumis melo]
Length=630

 Score =   450 bits (1157),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 266/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSL HG+RV+LD+ GGFADGVAVK VGEETF +C++L
Sbjct  305   YVKRVSPEVKIIGVEPSDANAMALSLCHGQRVILDKAGGFADGVAVKEVGEETFRLCKDL  364

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCKYY LKGEN++V+TSGAN
Sbjct  365   MDGVVLVSRDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKYYGLKGENVVVITSGAN  424

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+L  + ELA+VG ++EA+L+T LPE PGSFKKF ELVGPMNITEF+YRYSS + ++
Sbjct  425   MNFDKLSIVTELANVGREKEAVLATILPETPGSFKKFCELVGPMNITEFKYRYSSEK-EA  483

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +H   EL+ M  RM  S L T +LT NDLVKDHLR+L+GG+ +VE+E+LCRFI
Sbjct  484   VVLYSVGIHMPSELEEMKNRMESSQLPTYNLTKNDLVKDHLRYLMGGKSNVENEVLCRFI  543

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLDA SP+WNITLF+Y++ GE GAN+LVGLQ+   ++ EF +RA  +GY+
Sbjct  544   FPERPGALEKFLDALSPRWNITLFHYQSKGETGANILVGLQIEKPDMGEFHERARRVGYD  603

Query  393   YAIETSEA-FQLLMN  352
             Y + T +  FQLLM+
Sbjct  604   YVVVTDDGIFQLLMH  618



>ref|XP_010069098.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic, 
partial [Eucalyptus grandis]
Length=545

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 274/315 (87%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHG+R+MLDQVGGFADGVAVKVVGEETF +C+EL
Sbjct  230   YVKRVSPEVKIIGVEPADANAMALSLHHGQRIMLDQVGGFADGVAVKVVGEETFRLCKEL  289

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  290   VDGVVLVSRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  349

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVG MNITEF+YR +S + ++
Sbjct  350   MNFDKLRVVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGLMNITEFKYRCNSDK-EA  408

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL  M +RM  S L T +LT NDLVKDHLR+L+G R +++DE+LCRF+
Sbjct  409   VVLYSVGLHTASELQQMQKRMKDSHLTTYNLTGNDLVKDHLRYLMGSRLNLQDEVLCRFV  468

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QV  +E+DEFK+ A+ LGY+
Sbjct  469   FPERPGALMKFLDTFSPRWNISLFHYRGQGETGANVLVGIQVTQSEMDEFKECADGLGYD  528

Query  393   YAIETS-EAFQLLMN  352
             YA+ T+ EAF+LLM+
Sbjct  529   YAMVTNDEAFRLLMH  543



>ref|XP_004981992.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Setaria italica]
Length=600

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/314 (71%), Positives = 264/314 (84%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  282   YVKRVRPEVKIIGVEPSDANAMALSLCHGKRVMLEHVGGFADGVAVKTVGEETFRLCREL  341

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYYNLKGE ++ +TSGAN
Sbjct  342   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYNLKGETVVAITSGAN  401

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFK+F ELVG MNITEF+YRY S    +
Sbjct  402   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKRFTELVGRMNITEFKYRYDSNAKDA  461

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV+RM  + L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  462   LVLYSVGIYTDNELGAMVDRMESAKLRTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  521

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP WNI+LF+YRA GEAGANVLVG+QVP  + DEFK RA  LGYE
Sbjct  522   FPERPGALMKFLDAFSPCWNISLFHYRAQGEAGANVLVGIQVPPKDFDEFKSRAESLGYE  581

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  582   YMSEHNNEIYRLLL  595



>gb|ABF98530.1| Threonine dehydratase biosynthetic, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=617

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = -2

Query  1272  EVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRELIDGVVFV  1093
             +VKIIGVEP DANAMALSL HG+RVML+QVGGFADGVAVKVVGEETF +CREL+DG+V V
Sbjct  306   QVKIIGVEPSDANAMALSLCHGQRVMLEQVGGFADGVAVKVVGEETFRLCRELVDGIVLV  365

Query  1092  GRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFDRLR  913
              RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGANMNFDRLR
Sbjct  366   SRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGANMNFDRLR  425

Query  912   CIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLYRVS  733
              + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +LVLY V 
Sbjct  426   LVTELADVGRKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDCNAKDALVLYSVG  485

Query  732   VHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFIFPERPGA  553
             ++T  EL AMVERM  S L T+DLTDNDL KDHLR+ IGGR  V DEL+ RFIFPERPGA
Sbjct  486   IYTDDELKAMVERMESSKLRTVDLTDNDLAKDHLRYFIGGRSEVTDELVYRFIFPERPGA  545

Query  552   LLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYEYAIE-TS  376
             L++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  E DEFK RA++LGYEY  E  +
Sbjct  546   LMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPPEEFDEFKSRADNLGYEYMSEQNN  605

Query  375   EAFQLLMN  352
             E ++LL+ 
Sbjct  606   EIYRLLLR  613



>ref|XP_011018852.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Populus euphratica]
Length=614

 Score =   447 bits (1150),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKIIGVEP DANAMALSLHHG+RVMLDQVGGFADGVAVK VGEETF +C+EL
Sbjct  301   YVKRVNPEVKIIGVEPSDANAMALSLHHGQRVMLDQVGGFADGVAVKEVGEETFRLCKEL  360

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KG N++ +TSGAN
Sbjct  361   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGVKGANVVAITSGAN  420

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE PGSFK F ELVGPMNI+EF+YR S+    +
Sbjct  421   MNFDKLRVVTELANVGRQQEALLATVMPEVPGSFKHFCELVGPMNISEFKYR-SNSEKDA  479

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL+AM +RM  S L T +LT +DLVKDHLR+LIGG+ +V DE+LCRF+
Sbjct  480   VVLYSVGLHTAFELEAMKKRMESSQLRTYNLTASDLVKDHLRYLIGGKLNVPDEVLCRFV  539

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YR  GE GANVLVG+QVP +E+DEF  RAN LGY+
Sbjct  540   FPERPGALMKFLDSFSPRWNISLFHYRGQGETGANVLVGIQVPQSEMDEFCSRANSLGYD  599

Query  393   YAIETSE-AFQLLMN  352
             Y I T +  F LLM+
Sbjct  600   YVIVTDDNEFHLLMH  614



>ref|XP_006481926.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Citrus sinensis]
Length=606

 Score =   447 bits (1149),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 271/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+ +VKIIGVEP+DANAMALSLHHGERVMLD VGGFADGVAVK VGEETF IC+EL
Sbjct  293   YVKRVSTQVKIIGVEPYDANAMALSLHHGERVMLDHVGGFADGVAVKEVGEETFRICKEL  352

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGA+AYCKYY L G+N++ +TSGAN
Sbjct  353   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAKAYCKYYGLSGKNVVAITSGAN  412

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+ +T +PE+ GSFK+F EL+GPMNITEF+YR+SS +A +
Sbjct  413   MNFDKLRVVTELANVGRQQEAVFATVMPEQSGSFKQFCELLGPMNITEFKYRFSSDKA-A  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL+AM ERM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LCRFI
Sbjct  472   VVLYSVGVHTVAELEAMQERMESSQLKTYNLTQSDLVKDHLRYLMGGRLSVENEVLCRFI  531

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG+L++FLDAFSP+WNI+LF+YR  GE GAN+LVG+QVP NE+ EF   AN LGY+
Sbjct  532   FPERPGSLMKFLDAFSPRWNISLFHYRGQGETGANILVGIQVPENELAEFHGHANRLGYD  591

Query  393   YAIETSE-AFQLLMN  352
             YA+ T +  F+LLM+
Sbjct  592   YAVVTDDNNFELLMH  606



>ref|XP_002528625.1| threonine dehydratase/deaminase, putative [Ricinus communis]
 gb|EEF33728.1| threonine dehydratase/deaminase, putative [Ricinus communis]
Length=618

 Score =   447 bits (1150),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 272/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKIIGVEP DANAMALSLHHGERVMLDQVGGFADGVAVK VGEETF +C+EL
Sbjct  305   YVKRVNPEVKIIGVEPSDANAMALSLHHGERVMLDQVGGFADGVAVKEVGEETFRLCKEL  364

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY L+G+N++ +TSGAN
Sbjct  365   IDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLEGKNVVAITSGAN  424

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PEEPG FK+F ELVGPMNITEF+YR SS + ++
Sbjct  425   MNFDKLRIVTELANVGRQQEAVLATVMPEEPGMFKRFCELVGPMNITEFKYRCSSEK-EA  483

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  E+ A+ +RM  S L T +LT +DLVKDHLR+L+GGR +V++E+LC+F+
Sbjct  484   VVLYSVGLHTVFEIQALQQRMEASQLRTYNLTSSDLVKDHLRYLMGGRLNVQNEVLCQFV  543

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YR  GE GAN+LVG+QVP +E++EF  RAN +GY 
Sbjct  544   FPERPGALMKFLDAFSPRWNISLFHYRGQGETGANILVGIQVPESEMEEFHSRANSVGYG  603

Query  393   YAIETSE-AFQLLMN  352
             Y + T +  FQLLM+
Sbjct  604   YVVVTDDNNFQLLMH  618



>ref|XP_008644574.1| PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, 
chloroplastic-like [Zea mays]
Length=603

 Score =   446 bits (1147),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 266/314 (85%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL+HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  285   YVKRVRPEVKIIGVEPSDANAMALSLYHGKRVMLEHVGGFADGVAVKAVGEETFRLCREL  344

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYYNLKG+ ++ +TSGAN
Sbjct  345   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYNLKGDTVVAITSGAN  404

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  405   MNFDRLRLVTELADVGRKREAVLATFLPEEHGSFKKFTELVGRMNITEFKYRYDFNAKDA  464

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV+RM L+ L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  465   LVLYSVGIYTDNELGAMVDRMELAKLKTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  524

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA GE GANVLVG+QVP  + DEFK  A++LGYE
Sbjct  525   FPERPGALMKFLDAFSPRWNISLFHYRAQGETGANVLVGIQVPPVDFDEFKSHADNLGYE  584

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  585   YMSENNNEIYRLLL  598



>ref|XP_008665294.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Zea mays]
 tpg|DAA51003.1| TPA: hypothetical protein ZEAMMB73_127861 [Zea mays]
Length=606

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 264/314 (84%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  288   YVKRVRPEVKIIGVEPSDANAMALSLCHGKRVMLEHVGGFADGVAVKAVGEETFRLCREL  347

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYYNLKGE ++ +TSGAN
Sbjct  348   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYNLKGETVVAITSGAN  407

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPE  GSFKKF ELVG MNITEF+YRY S    +
Sbjct  408   MNFDRLRLVTELADVGRKREAVLATFLPERQGSFKKFTELVGRMNITEFKYRYDSNAKDA  467

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AM++RM  + L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  468   LVLYSVGIYTDNELGAMMDRMESAKLRTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  527

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YRA GEAGANVLVG+QVP  E DEFK  AN+LGYE
Sbjct  528   FPERPGALMKFLDTFSPRWNISLFHYRAQGEAGANVLVGIQVPPAEFDEFKSHANNLGYE  587

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E ++LL+
Sbjct  588   YMSEHNNEIYRLLL  601



>ref|XP_003559531.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Brachypodium distachyon]
Length=605

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 264/314 (84%), Gaps = 1/314 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+ VGGFADGVAVKVVGEETF +C+EL
Sbjct  287   YVKRVRPEVKIIGVEPSDANAMALSLSHGQRVMLEHVGGFADGVAVKVVGEETFRLCQEL  346

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE RNILEP+GAL++AGAEAYCKYY LKGE ++ ++SGAN
Sbjct  347   VDGIVLVSRDAICASIKDMFEENRNILEPAGALALAGAEAYCKYYGLKGETLVAISSGAN  406

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPE  GSFKKF ELVGPMNITEF+YRY S   ++
Sbjct  407   MNFDRLRLVTELADVGRKREAVLATFLPEVQGSFKKFAELVGPMNITEFKYRYDSNGKEA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T +EL AM+ERM  S L T++LT NDL KDHLR+ IGGR  V+DEL+ RFI
Sbjct  467   LVLYSVGIYTDLELRAMMERMESSKLKTVNLTSNDLAKDHLRYFIGGRSEVKDELVYRFI  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG L++FLDA SP+WNI+LF+YRA GE GANVLVG+QVP  ++DEF+ RA++LGYE
Sbjct  527   FPERPGTLMQFLDALSPRWNISLFHYRAQGETGANVLVGIQVPPEDLDEFRSRADNLGYE  586

Query  393   YAIE-TSEAFQLLM  355
             Y  E  +E + LL+
Sbjct  587   YMSEMNNEIYNLLL  600



>ref|XP_006381341.1| hypothetical protein POPTR_0006s11980g [Populus trichocarpa]
 gb|ERP59138.1| hypothetical protein POPTR_0006s11980g [Populus trichocarpa]
Length=614

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKIIGVEP DANAMALSLHHG+RVMLDQVGGFADGVAVK VGEETF +C+EL
Sbjct  301   YVKRVNPEVKIIGVEPSDANAMALSLHHGQRVMLDQVGGFADGVAVKEVGEETFRLCKEL  360

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KG N++ +TSGAN
Sbjct  361   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGVKGANVVAITSGAN  420

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE PGSFK F ELVGPMNI+EF+YR S+    +
Sbjct  421   MNFDKLRVVTELANVGRQQEALLATVMPEVPGSFKHFCELVGPMNISEFKYR-SNSEKDA  479

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL+AM +RM  S L T +LT +DLVKDHLR+LIGG+ +V DE+LCRF+
Sbjct  480   VVLYSVGLHTAFELEAMKKRMESSQLRTYNLTASDLVKDHLRYLIGGKLNVPDEVLCRFV  539

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YR  GE GANVLVG+QVP +E+DEF  RAN LGY+
Sbjct  540   FPERPGALMKFLDSFSPRWNISLFHYRGQGETGANVLVGIQVPQSEMDEFCSRANSLGYD  599

Query  393   YAIETSEA-FQLLMN  352
             Y + T +  F LLM+
Sbjct  600   YVVVTDDNDFHLLMH  614



>gb|KHN24377.1| Threonine dehydratase biosynthetic, chloroplastic [Glycine soja]
Length=504

 Score =   441 bits (1133),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 270/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKI GVEP DANAMALSLHH +RV+LDQVGGFADGVAVK VGEETF IC+EL
Sbjct  191   YVKRVNPEVKIFGVEPTDANAMALSLHHDQRVILDQVGGFADGVAVKEVGEETFRICKEL  250

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RD++CASIKDMFEE+RNILEP+GAL++AGAEAYCK++ ++G++I+V+TSGAN
Sbjct  251   IDGVVLVSRDSICASIKDMFEEKRNILEPAGALALAGAEAYCKHHGVQGKDIVVITSGAN  310

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L+T LPEEPGSFK+F ELVG MNITEF+YRY+S   ++
Sbjct  311   MNFDKLRVVTELANVGRKQEAVLATVLPEEPGSFKQFCELVGQMNITEFKYRYNSNE-KA  369

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL AM ERM  S L T +LT++DLVKDHLR+L+GGR ++++E+LCRF 
Sbjct  370   VVLYSVGIHTVSELRAMQERMESSQLKTYNLTESDLVKDHLRYLMGGRSNIQNEVLCRFT  429

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QVP +E+DEF  RAN LGY+
Sbjct  430   FPERPGALMKFLDPFSPRWNISLFHYRGEGETGANVLVGIQVPKSEMDEFHDRANKLGYD  489

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  490   YKVVNNDDDFQLLMH  504



>gb|AES60662.2| threonine dehydratase biosynthetic protein [Medicago truncatula]
Length=605

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 270/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK +NPEVKIIGVEP DANA+ALSLHHG+RV+LDQVGGFADGVAVK VGEETF +C+EL
Sbjct  292   YVKRINPEVKIIGVEPTDANALALSLHHGQRVVLDQVGGFADGVAVKEVGEETFRLCKEL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN+I +TSGAN
Sbjct  352   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVIAITSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L T +PEEPGSFK+F ELVG MNITEF+YRYSS + ++
Sbjct  412   MNFDKLRIVTELANVGRKQEALLLTVMPEEPGSFKQFCELVGQMNITEFKYRYSS-KEKA  470

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT +EL  M ERM  S L T +L+D DLVKDHLRH++G R  +++E+LCRF 
Sbjct  471   VVLYSVGVHTPLELKEMQERMETSKLVTHNLSDVDLVKDHLRHMMGARPDIQNEVLCRFT  530

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLD+FSP+WNI+LF+YRA GE GANVLVG+QVPS+E++EF  RA  LGY+
Sbjct  531   FPERPGALTKFLDSFSPRWNISLFHYRAQGETGANVLVGIQVPSSEMEEFNDRATGLGYD  590

Query  393   YAIETSEA-FQLLMN  352
             Y + + +  F+LLM+
Sbjct  591   YNVLSDDLFFKLLMH  605



>ref|XP_007145276.1| hypothetical protein PHAVU_007G225400g [Phaseolus vulgaris]
 gb|ESW17270.1| hypothetical protein PHAVU_007G225400g [Phaseolus vulgaris]
Length=601

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 270/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEV+IIGVEP DANAMALS HH +RV+LDQVGGFADGVAVK VGEETF IC+EL
Sbjct  288   YVKRVNPEVRIIGVEPSDANAMALSFHHDQRVILDQVGGFADGVAVKEVGEETFRICKEL  347

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RD++CASIKDMFEE+RNILEP+GAL++AGAEAYCKY  ++GENI+V+TSGAN
Sbjct  348   VDGVVLVSRDSICASIKDMFEEKRNILEPAGALALAGAEAYCKYNGIRGENIVVITSGAN  407

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L+T +PEEPGSFK+F +LVG +NITEF+YRY+S R ++
Sbjct  408   MNFDKLRVVTELANVGRKQEAVLATIMPEEPGSFKQFCQLVGQVNITEFKYRYNSDR-KA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL AM ERM  S L T +LT++DLVKDHLR+L+GGR ++++E+LCRF 
Sbjct  467   VVLYSVGVHTVSELRAMQERMESSQLKTYNLTESDLVKDHLRYLMGGRSNIQNEVLCRFT  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GAN+LVG+QVP +E+DEF  RAN LGY+
Sbjct  527   FPERPGALMKFLDPFSPRWNISLFHYRGEGETGANILVGIQVPKSEMDEFHDRANRLGYD  586

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  587   YQVVNNDDDFQLLMH  601



>gb|KHG26517.1| Threonine dehydratase biosynthetic, chloroplastic -like protein 
[Gossypium arboreum]
Length=607

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERVML++VGGFADGVAVK VGEETF ICREL
Sbjct  295   YVKRVSPEVKIIGVEPFDANAMALSLHHGERVMLEKVGGFADGVAVKEVGEETFSICREL  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +K +N+  +TSGAN
Sbjct  355   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGIKEKNVAAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPEEPGSFK+F E+VGPMNITEF+YR ++ +A  
Sbjct  415   MNFDKLRVVTELANVGRQQEAVLATVLPEEPGSFKQFCEMVGPMNITEFKYRCTADKA--  472

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL+AM +R+  S L T +LT +DLVKDHLR+L+GGR  VE+E+LCRFI
Sbjct  473   VVLYSVGVHTVSELEAMKQRLESSQLRTYNLTASDLVKDHLRYLMGGRSDVENEVLCRFI  532

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QV  +E DEF  RA+ LGYE
Sbjct  533   FPERPGALMKFLDTFSPRWNISLFHYRGQGETGANVLVGVQVSKSEEDEFIHRADSLGYE  592

Query  393   YA-IETSEAFQLLMN  352
             Y  +   E FQLLM+
Sbjct  593   YVLVNDDENFQLLMH  607



>ref|XP_010543484.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Tarenaya hassleriana]
Length=610

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANA+ALSLHHGERV+L+ VGGFADGVAVK VGEETF +CR+L
Sbjct  297   YVKRVAPEVKIIGVEPADANALALSLHHGERVILNNVGGFADGVAVKEVGEETFRLCRKL  356

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  357   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  416

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F +LVGPMNITEF+YR SS + +S
Sbjct  417   MNFDKLRIVTELANVGRQQEAVLATVMPEKPGSFKQFCKLVGPMNITEFKYRCSSEK-ES  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL AM  RM  S L T +LT +DLVKDHLR+L+GGR +V+DELLCRF 
Sbjct  476   VVLYSVGVHTAAELKAMQSRMESSQLRTHNLTSSDLVKDHLRYLMGGRSTVQDELLCRFT  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNI+LF+YRA GE GANVLVG+QVP +E++EF +RA+ LGYE
Sbjct  536   FPERPGALMMFLDSFSPRWNISLFHYRAQGETGANVLVGIQVPEHEMEEFGKRADTLGYE  595

Query  393   YA-IETSEAFQLLMN  352
             Y  +  +E F+LLM 
Sbjct  596   YELVSNNEDFKLLMQ  610



>gb|KHN48213.1| Threonine dehydratase biosynthetic, chloroplastic [Glycine soja]
Length=504

 Score =   439 bits (1128),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKI GVEP DANAMALSLHH +RV+LDQVGGFADGVAVK VGEETF IC+EL
Sbjct  191   YVKRVNPEVKIFGVEPTDANAMALSLHHDQRVILDQVGGFADGVAVKEVGEETFRICKEL  250

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V V RD++CASIKDMFEE+RNILEP+GAL++AGAEAYCK++ ++G+NI+ +TSGAN
Sbjct  251   IDGIVLVSRDSICASIKDMFEEKRNILEPAGALALAGAEAYCKHHGIQGKNIVAITSGAN  310

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L+T + EEPGSFK+F ELVG MNITEF+YRY+S   ++
Sbjct  311   MNFDKLRVVTELANVGRKQEAVLATVMAEEPGSFKQFCELVGQMNITEFKYRYNSNE-KA  369

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL AM ERM  S L T +LT++DLVKDHLR+L+GGR +V++E+LCR  
Sbjct  370   VVLYSVGVHTISELRAMQERMESSQLKTYNLTESDLVKDHLRYLMGGRSNVQNEVLCRLT  429

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YR  GE GANVLVGLQVP +EIDEF  RAN LGY+
Sbjct  430   FPERPGALMKFLDSFSPRWNISLFHYRGEGETGANVLVGLQVPKSEIDEFHDRANKLGYD  489

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  490   YKVVNNDDDFQLLMH  504



>ref|XP_010464666.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Camelina sativa]
Length=591

 Score =   441 bits (1134),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHGERV+LD+VGGFADGVAVK VGEETF I R L
Sbjct  278   YVKRVAPEVKIIGVEPADANAMALSLHHGERVILDKVGGFADGVAVKEVGEETFRISRNL  337

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  338   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  397

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F ELVGP+NITEF+YR S+ + ++
Sbjct  398   MNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELVGPVNITEFKYRCSTEK-EA  456

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+  RM  S L T++LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  457   VVLYSVGVHTADELKALQNRMECSQLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFT  516

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+ SP+WNI+LF+YR  GE GANVLVG+QVP  E++EFK RAN LGYE
Sbjct  517   FPERPGALMNFLDSLSPRWNISLFHYRGQGETGANVLVGIQVPEQEMEEFKDRANTLGYE  576

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  577   YLLVSDDDYFQLLMH  591



>ref|XP_003535251.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Glycine max]
Length=602

 Score =   441 bits (1134),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 270/315 (86%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKI GVEP DANAMALSLHH +RV+LDQVGGFADGVAVK VGEETF IC+EL
Sbjct  289   YVKRVNPEVKIFGVEPTDANAMALSLHHDQRVILDQVGGFADGVAVKEVGEETFRICKEL  348

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RD++CASIKDMFEE+RNILEP+GAL++AGAEAYCK++ ++G++I+V+TSGAN
Sbjct  349   IDGVVLVSRDSICASIKDMFEEKRNILEPAGALALAGAEAYCKHHGVQGKDIVVITSGAN  408

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L+T LPEEPGSFK+F ELVG MNITEF+YRY+S   ++
Sbjct  409   MNFDKLRVVTELANVGRKQEAVLATVLPEEPGSFKQFCELVGQMNITEFKYRYNSNE-KA  467

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL AM ERM  S L T +LT++DLVKDHLR+L+GGR ++++E+LCRF 
Sbjct  468   VVLYSVGIHTVSELRAMQERMESSQLKTYNLTESDLVKDHLRYLMGGRSNIQNEVLCRFT  527

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QVP +E+DEF  RAN LGY+
Sbjct  528   FPERPGALMKFLDPFSPRWNISLFHYRGEGETGANVLVGIQVPKSEMDEFHDRANKLGYD  587

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  588   YKVVNNDDDFQLLMH  602



>ref|XP_004303056.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=607

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 266/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK ++PEVKIIGVEP DAN MALSLHHGER+MLDQVGGFADGVAVK VGEETF IC+EL
Sbjct  294   YVKRLSPEVKIIGVEPSDANGMALSLHHGERIMLDQVGGFADGVAVKEVGEETFRICKEL  353

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+  SIKDMFEE R+ILEP+GAL++AGAEAYCKYY LKGEN++ + SGAN
Sbjct  354   IDGVVLVSRDAISGSIKDMFEETRSILEPAGALALAGAEAYCKYYGLKGENVVAIASGAN  413

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE PGSFK++ ELVGPMNITEF+YRYSS + ++
Sbjct  414   MNFDKLRVVTELANVGRQQEALLATVMPEVPGSFKRYCELVGPMNITEFKYRYSSDK-EA  472

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL AM ER+  S+L T +LT +DL KDHLR+L+GGR  VE+E+LCRF+
Sbjct  473   VVLYSVGVHTVSELGAMQERLESSELRTFNLTKSDLAKDHLRYLMGGRTDVENEVLCRFV  532

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD  SP+WNI+LF+YR  GE GANVLVG+QV  +EIDEF  RA+ LGY+
Sbjct  533   FPERPGALMKFLDTISPRWNISLFHYRGQGETGANVLVGIQVSKSEIDEFHSRASSLGYD  592

Query  393   YAIETSEA-FQLLMN  352
             Y + T++  F+LLM+
Sbjct  593   YVVVTNDTIFKLLMH  607



>ref|XP_006297203.1| hypothetical protein CARUB_v10013211mg, partial [Capsella rubella]
 gb|EOA30101.1| hypothetical protein CARUB_v10013211mg, partial [Capsella rubella]
Length=628

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 263/315 (83%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHGERV+LDQVG FADGVAVK VGEETF I R L
Sbjct  315   YVKRVAPEVKIIGVEPADANAMALSLHHGERVILDQVGRFADGVAVKEVGEETFRISRNL  374

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  375   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  434

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFKKF ELVGPMNITEF+YR SS + ++
Sbjct  435   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKKFCELVGPMNITEFKYRCSSEK-EA  493

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  + +RM  S L T++LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  494   VVLYSVGVHTADELKELQKRMESSQLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFT  553

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+ SP+WNI+LF+YR  GE GANVLVG+QVP  E++EFK RA  LGYE
Sbjct  554   FPERPGALMNFLDSLSPRWNISLFHYRGQGETGANVLVGIQVPEQEMEEFKDRAKALGYE  613

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   E FQLLM+
Sbjct  614   YFLVSDDENFQLLMH  628



>ref|XP_007203765.1| hypothetical protein PRUPE_ppa003062mg [Prunus persica]
 gb|EMJ04964.1| hypothetical protein PRUPE_ppa003062mg [Prunus persica]
Length=607

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+P+VKIIGVEP DANAMALSLHHG+R+MLDQVGGFADGVAVK VGEETF +C+++
Sbjct  294   YVKRVSPKVKIIGVEPSDANAMALSLHHGQRIMLDQVGGFADGVAVKEVGEETFRLCKDM  353

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+C SIKDMFEE R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  354   VDGVVLVSRDAICGSIKDMFEETRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  413

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PEEPGSFK + ELVGPMNI+EF+YRY+S + Q+
Sbjct  414   MNFDKLRVVTELANVGRQQEAVLATIMPEEPGSFKHYCELVGPMNISEFKYRYNSDK-QA  472

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ER+    L T +LT +DLVKDHLR+L+GGR +V++E+LC F+
Sbjct  473   VVLYSVGVHTASELKEMQERLESCQLKTYNLTKSDLVKDHLRYLMGGRSNVQNEVLCHFV  532

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YR  GE GANVLVG+QV   +IDEF+ RA  LGY+
Sbjct  533   FPERPGALMKFLDAFSPRWNISLFHYRGQGETGANVLVGIQVARGDIDEFQARAGSLGYD  592

Query  393   YAIET-SEAFQLLMN  352
             YA+ T ++ F LLM+
Sbjct  593   YAVVTDNDEFNLLMH  607



>ref|NP_187616.1| threonine dehydratase [Arabidopsis thaliana]
 sp|Q9ZSS6.1|THD1_ARATH RecName: Full=Threonine dehydratase biosynthetic, chloroplastic; 
AltName: Full=Threonine deaminase; Short=TD; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF04418.1|AC010927_11 threonine dehydratase/deaminase (OMR1) [Arabidopsis thaliana]
 gb|AAF32370.1|AF221984_1 threonine dehydratase/deaminase [Arabidopsis thaliana]
 gb|AAC97936.1| threonine dehydratase/deaminase [Arabidopsis thaliana]
 gb|AAL57674.1| AT3g10050/T22K18_12 [Arabidopsis thaliana]
 gb|AEE74854.1| threonine dehydratase biosynthetic [Arabidopsis thaliana]
Length=592

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 266/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHLR+L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF+YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>gb|AAO00883.1| threonine dehydratase/deaminase (OMR1) [Arabidopsis thaliana]
Length=592

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 266/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHLR+L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF+YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>ref|XP_006339313.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Solanum tuberosum]
Length=591

 Score =   439 bits (1129),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 264/315 (84%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V+P+ KIIGVEP D+N+MAL+LHHG+RVML++VG FAD VA+++VGEE+F +C+EL
Sbjct  277   YMKKVSPDTKIIGVEPVDSNSMALALHHGQRVMLEKVGSFADAVAIRMVGEESFRLCKEL  336

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V V  D++ ASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KGEN++ +TSGAN
Sbjct  337   IDGIVLVNHDSISASIKDMFEEKRSILEPAGALALAGAEAYCKYYGVKGENVVAITSGAN  396

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+LST +PEE GSFKKF E++G  NITE +YRY S +  +
Sbjct  397   MNFDRLRLVTELADVGRQREAVLSTYMPEERGSFKKFYEMMGHTNITELKYRYDSEKENA  456

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              V YRV +HTK+EL+ MV+RM  S LHTI+ TDN+LVKDHLRHLIGGR  V +E LCRFI
Sbjct  457   RVFYRVGLHTKVELEEMVDRMESSQLHTINYTDNELVKDHLRHLIGGRSDVHNEHLCRFI  516

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FP++PG L++FLDAFSP WNI+L +YRA GE G NVL+GLQVP NE+DEF+ RA  LGY 
Sbjct  517   FPDKPGVLMKFLDAFSPSWNISLLHYRAQGETGGNVLIGLQVPQNEVDEFRGRAESLGYV  576

Query  393   YAIET-SEAFQLLMN  352
             Y +ET +EAFQ LM+
Sbjct  577   YVVETLNEAFQQLMH  591



>ref|XP_003542539.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Glycine max]
Length=602

 Score =   439 bits (1129),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK VNPEVKI GVEP DANAMALSLHH +RV+LDQVGGFADGVAVK VGEETF IC+EL
Sbjct  289   YVKRVNPEVKIFGVEPTDANAMALSLHHDQRVILDQVGGFADGVAVKEVGEETFRICKEL  348

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V V RD++CASIKDMFEE+RNILEP+GAL++AGAEAYCK++ ++G+NI+ +TSGAN
Sbjct  349   IDGIVLVSRDSICASIKDMFEEKRNILEPAGALALAGAEAYCKHHGIQGKNIVAITSGAN  408

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA+L+T + EEPGSFK+F ELVG MNITEF+YRY+S   ++
Sbjct  409   MNFDKLRVVTELANVGRKQEAVLATVMAEEPGSFKQFCELVGQMNITEFKYRYNSNE-KA  467

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL AM ERM  S L T +LT++DLVKDHLR+L+GGR +V++E+LCR  
Sbjct  468   VVLYSVGVHTISELRAMQERMESSQLKTYNLTESDLVKDHLRYLMGGRSNVQNEVLCRLT  527

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNI+LF+YR  GE GANVLVGLQVP +EIDEF  RAN LGY+
Sbjct  528   FPERPGALMKFLDSFSPRWNISLFHYRGEGETGANVLVGLQVPKSEIDEFHDRANKLGYD  587

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + FQLLM+
Sbjct  588   YKVVNNDDDFQLLMH  602



>ref|XP_002884774.1| L-O-methylthreonine resistant 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61033.1| L-O-methylthreonine resistant 1 [Arabidopsis lyrata subsp. lyrata]
Length=591

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  278   YVKRVAPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  337

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  338   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  397

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNITEF+YR +S + ++
Sbjct  398   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNITEFKYRCNSEK-EA  456

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHLR+L+GGR +V DE+LCRF 
Sbjct  457   VVLYSVGVHTAGELKALQKRMESSQLRTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFT  516

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF+YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  517   FPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  576

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  577   YFLVSDDDNFKLLMH  591



>gb|AAT74612.1| threonine dehydratase/deaminase mutant [synthetic construct]
Length=592

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHLR+L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPERPGALMNFLDSFSPRWNITLFLYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>gb|AAT74611.1| threonine dehydratase/deaminase mutant [synthetic construct]
Length=592

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHLR+L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FP RPGAL+ FLD+FSP+WNITLF+YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPARPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>ref|XP_009375637.1| PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, 
chloroplastic-like [Pyrus x bretschneideri]
Length=610

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 259/315 (82%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V P+VKIIGVEP DAN MALSLH G+R+MLDQVGGFADGVAVK V EETF +C++ 
Sbjct  297   YVKRVAPKVKIIGVEPSDANVMALSLHRGQRIMLDQVGGFADGVAVKEVSEETFRLCKDT  356

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D VV V RDA+C SIKDMFEE R+ILEP+GALS+AGA AYCKYY LKGEN++ +TSGAN
Sbjct  357   VDSVVLVSRDAICDSIKDMFEETRSILEPAGALSLAGAGAYCKYYGLKGENVVAITSGAN  416

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNF +LR + ELA+VG Q+EA+L+T +PEEPGSFK + ELVGPMNI+EF+YRY+S + ++
Sbjct  417   MNFYKLRVVTELANVGQQQEAVLATVVPEEPGSFKHYCELVGPMNISEFKYRYNSDK-EA  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ER+  S L T +LT +D VKDHLR+L+GGR +V++E+LCRF+
Sbjct  476   IVLYSVGVHTASELQEMQERLESSQLKTYNLTKSDSVKDHLRYLMGGRSNVQNEILCRFV  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD FSP+WNI+LF+YR  GE GANVLVG+QV  +E DEF   AN LGY+
Sbjct  536   FPERPGALMKFLDVFSPRWNISLFHYRGQGETGANVLVGIQVTESEFDEFHALANTLGYD  595

Query  393   YAIETSEA-FQLLMN  352
             Y + T++  F+LLM+
Sbjct  596   YEVVTNDIDFKLLMH  610



>emb|CDY41319.1| BnaA01g32000D [Brassica napus]
Length=599

 Score =   437 bits (1123),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 258/316 (82%), Gaps = 10/316 (3%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVKVVGEETF I R+
Sbjct  293   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRK  352

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGA
Sbjct  353   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGA  412

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFKKF ELVG MNITE    Y+     
Sbjct  413   NMNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKKFCELVGAMNITENLLYYTGN---  469

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
                   V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC+F
Sbjct  470   ------VGVHTPGELKALEKRMESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLCQF  523

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QVP  E++EF+ RA+ LGY
Sbjct  524   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVPEQEMEEFRNRAHVLGY  583

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +  F+LLM+
Sbjct  584   EYVLVSEDTVFKLLMH  599



>gb|AAT74610.1| threonine dehydratase/deaminase mutant [synthetic construct]
Length=592

 Score =   436 bits (1120),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHL +L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLCYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF+YR  GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>ref|XP_004249785.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Solanum lycopersicum]
Length=592

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 262/315 (83%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V+P+ KIIGVEP D+N+MAL+LHHG+RVML++VG FAD VA+++VGEE+F +CREL
Sbjct  278   YMKKVSPDTKIIGVEPVDSNSMALALHHGQRVMLEKVGSFADAVAIRMVGEESFRLCREL  337

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDG+V V  D++ ASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KGENI+ +TSGAN
Sbjct  338   IDGIVLVNHDSISASIKDMFEEKRSILEPAGALALAGAEAYCKYYGVKGENIVAITSGAN  397

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG QREA+L+T LPEE GSFKKF E+VG  NITE +YRY S +  +
Sbjct  398   MNFDRLRLVTELADVGRQREAVLATYLPEERGSFKKFYEMVGQTNITELKYRYDSEKENA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              V YR+ +HTK+EL+ MV+RM L  LHTI+ TDN+LVKDHLRHLIGGR  V +E LCRFI
Sbjct  458   RVFYRIGLHTKVELEEMVDRMELEQLHTINYTDNELVKDHLRHLIGGRSDVHNEHLCRFI  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FP +PG L++FLDAFSP+WNI+L +Y A GE G NVL+GLQVP NE+DEF+ RA  LGY 
Sbjct  518   FPYKPGVLMKFLDAFSPRWNISLLHYHAQGETGGNVLIGLQVPQNEVDEFRGRAESLGYV  577

Query  393   YAIET-SEAFQLLMN  352
               +ET +EAFQ LM+
Sbjct  578   CVVETLNEAFQQLMH  592



>ref|XP_002966929.1| hypothetical protein SELMODRAFT_144447 [Selaginella moellendorffii]
 gb|EFJ31528.1| hypothetical protein SELMODRAFT_144447 [Selaginella moellendorffii]
Length=501

 Score =   432 bits (1110),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PEV+IIGVEP DANAMALSLHHG RV LD  G FADGVAVK+VGEETF +CRE 
Sbjct  187   YMKRIRPEVQIIGVEPTDANAMALSLHHGTRVQLDHCGIFADGVAVKLVGEETFRLCREY  246

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CA+IKDMFEE+R+ILEP+GAL+IAGA+AYC YY LK E ++ VTSGAN
Sbjct  247   VDGIVLVSRDAICAAIKDMFEEKRSILEPAGALAIAGAKAYCNYYGLKKEAVVAVTSGAN  306

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG  +EA+L+  + E PGSFK+ VE VGP+NITEFRYRYS  R  +
Sbjct  307   MNFDRLRIVTELADVGASKEAVLAIIMAEIPGSFKRLVEEVGPVNITEFRYRYSDSRT-A  365

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVL  VSVH + EL A+  R+  + L  ID+T NDLVKDHLRHLIGGR  ++DELL RFI
Sbjct  366   LVLCSVSVHKEQELQALKRRLKEAGLMVIDMTSNDLVKDHLRHLIGGRAILKDELLYRFI  425

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLD F+P+WNI+LF+YRA G+ GANVL+G+QVP  +  EFK+ A +LGYE
Sbjct  426   FPERPGALRKFLDTFTPRWNISLFHYRAQGQVGANVLIGIQVPPEDEQEFKRCAVELGYE  485

Query  393   YAIE-TSEAFQLLMN  352
             +  E  +EAFQL+M+
Sbjct  486   FQDECKNEAFQLMMS  500



>gb|AAG59585.1|AF229927_1 threonine deaminase [Nicotiana attenuata]
 gb|AAX22214.1| threonine deaminase [Nicotiana attenuata]
Length=601

 Score =   434 bits (1117),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 272/324 (84%), Gaps = 1/324 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+ K V P  KIIGVEP  A++M  SL+HGERV L+QV  FADGVAV +VG
Sbjct  277   GGGLIAGVAAYFKRVAPHTKIIGVEPFGASSMTQSLYHGERVKLEQVDNFADGVAVALVG  336

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++LIDG+V V  DA+ A++KD+++E RNILE SGAL+IAGAEAYCKYYN+KGE
Sbjct  337   EETFRLCKDLIDGMVLVSNDAISAAVKDVYDEGRNILETSGALAIAGAEAYCKYYNIKGE  396

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N++ + SGANM+F +L+ + +LAD+GGQREA+L+T +PEEPGSFKKF ELVGPMNITEF+
Sbjct  397   NVVAIASGANMDFSKLKLVVDLADIGGQREALLATFMPEEPGSFKKFCELVGPMNITEFK  456

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+SGR Q+LVLY V V+TK +L++M+ERM  S L+T++LT+N+LVK+HLRHL+GGR  
Sbjct  457   YRYNSGRKQALVLYSVGVNTKSDLESMLERMKSSQLNTVNLTNNNLVKEHLRHLMGGRSE  516

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
               +E+ C+FIFPE+PGAL +FLDAFSP+WNI+LF+YR  GE  A+VLVG QVP  EI+EF
Sbjct  517   PSNEIFCQFIFPEKPGALRKFLDAFSPRWNISLFHYREQGELDASVLVGFQVPKGEIEEF  576

Query  423   KQRANDLGYEYAIET-SEAFQLLM  355
             + +AN+LGY Y IE+ +EA QL+M
Sbjct  577   RVQANNLGYSYEIESLNEASQLIM  600



>ref|XP_010552986.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Tarenaya hassleriana]
Length=614

 Score =   434 bits (1117),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLH  ERV+LDQVGGFADGVAVK VGEETF +CR+L
Sbjct  301   YVKRVSPEVKIIGVEPADANAMALSLHRDERVILDQVGGFADGVAVKEVGEETFRLCRKL  360

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LK  NI+ +TSGAN
Sbjct  361   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKDINIVAITSGAN  420

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELV PMNITEF+YR SS + ++
Sbjct  421   MNFDKLRVVTELANVGRQQEAVLATVMPEKPGSFKQFCELVEPMNITEFKYRCSSEK-EA  479

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL+AM  RM  S L T +LT +DLVKDHLR+L+GGR +V+DE+LCRFI
Sbjct  480   VVLYSVGVHTAEELEAMRNRMESSQLRTYNLTSSDLVKDHLRYLMGGRSTVQDEVLCRFI  539

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLDAFSP+WNI++F+YRA GE GANVLVG+QV  +E++EF+ +AN LGYE
Sbjct  540   FPERPGALMMFLDAFSPRWNISIFHYRAQGETGANVLVGIQVLEHEMEEFRIKANTLGYE  599

Query  393   YAIETSEA-FQLLMN  352
             Y + + +  F+LLM 
Sbjct  600   YDLVSEDGNFKLLMQ  614



>ref|XP_009593366.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=603

 Score =   434 bits (1115),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 267/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P +KIIGVEP DANAMALSLH+G+RVMLDQVG FADGVAVKVVGEETF +C+EL
Sbjct  288   YMKRVAPHIKIIGVEPSDANAMALSLHYGQRVMLDQVGRFADGVAVKVVGEETFRLCKEL  347

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LK EN+I +TSGAN
Sbjct  348   IDGVVLVNRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKDENVIAITSGAN  407

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVG-PMNITEFRYRYSSGRAQ  757
             MNFDRLR I+ELADVG +REA+L T +PEEPGSFK+F E VG  M  TE +YRY+SG  +
Sbjct  408   MNFDRLRLISELADVGRKREAVLVTFMPEEPGSFKRFCEQVGTTMKFTEVKYRYNSGNEK  467

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             + VLY V + T+ E ++++ER+    LHT++LT+NDLVKDHLRHL+GGR ++ +ELLCRF
Sbjct  468   AQVLYSVGIQTESEPESLMERLKSVQLHTVNLTENDLVKDHLRHLMGGRSNLHNELLCRF  527

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGALL+FLD FSP+WNI+L +YR  G+ GANVLVG+QVP  E DEF+ RA +LGY
Sbjct  528   TFPEKPGALLKFLDTFSPRWNISLIHYRGQGQIGANVLVGIQVPEAEFDEFQGRAANLGY  587

Query  396   EYAIET-SEAFQLLMN  352
             EY +E+ ++AF+L+M+
Sbjct  588   EYVVESLNDAFKLIMH  603



>gb|AFK40110.1| unknown [Medicago truncatula]
Length=605

 Score =   434 bits (1115),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK +NPEVK IGVEP DANA+ALSLHHG+RV+LDQVGGFADGVAVK VGEETF +C+EL
Sbjct  292   YVKRINPEVKTIGVEPTDANALALSLHHGQRVVLDQVGGFADGVAVKEVGEETFRLCKEL  351

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN+I +TSGAN
Sbjct  352   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVIAITSGAN  411

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG  +EA+L T +PEEPGSFK+F ELVG MNITEF+YRYSS + ++
Sbjct  412   MNFDKLRIVTELANVGRNQEALLLTVMPEEPGSFKQFCELVGQMNITEFKYRYSS-KEKA  470

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT +EL  M ERM    L T +L+D DLVKDHLRH++G R  +++E+ CRF 
Sbjct  471   VVLYSVGVHTPLELKEMQERMETFKLVTHNLSDVDLVKDHLRHMMGARPDIQNEVFCRFT  530

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLD+FSP+WNI+LF+YRA GE GANVLVG+QVPS+E++EF  RA  LGY+
Sbjct  531   FPERPGALTKFLDSFSPRWNISLFHYRAQGETGANVLVGIQVPSSEMEEFNDRAPGLGYD  590

Query  393   YAIETSEA-FQLLMN  352
             Y +   +  F+LLM+
Sbjct  591   YNVLFDDLFFKLLMH  605



>ref|XP_009135030.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=543

 Score =   432 bits (1110),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 217/316 (69%), Positives = 265/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVK VG+ETF IC+ 
Sbjct  229   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKEVGKETFRICQN  288

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGA
Sbjct  289   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGA  348

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F EL+GPMNITEF+YR  S + +
Sbjct  349   NMNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEFKYRCGSEK-E  407

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             S+VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC+F
Sbjct  408   SVVLYSVGVHTAGELKALEKRMESSQLRTRNLTTSDLVKDHLRYLMGGRSSVEEEVLCQF  467

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QV   E++EF+ RA  LGY
Sbjct  468   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVSEQEMEEFRNRAQVLGY  527

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +A F LLM 
Sbjct  528   EYVLVSEDAIFNLLMQ  543



>gb|AAD54324.1|AF177212_1 threonine dehydratase/deaminase [Arabidopsis thaliana]
Length=592

 Score =   433 bits (1114),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 264/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R L
Sbjct  279   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRNL  338

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  339   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  398

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T +PE+PGSFK+F ELVGPMNI+EF+YR SS + ++
Sbjct  399   MNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEK-EA  457

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM  S L T++LT +DLVKDHL +L+GGR +V DE+LCRF 
Sbjct  458   VVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKDHLCYLMGGRSTVGDEVLCRFT  517

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNITLF+Y   GE GANVLVG+QVP  E++EFK RA  LGY+
Sbjct  518   FPERPGALMNFLDSFSPRWNITLFHYHGQGETGANVLVGIQVPEQEMEEFKNRAKALGYD  577

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  578   YFLVSDDDYFKLLMH  592



>emb|CDY07946.1| BnaC03g35770D [Brassica napus]
Length=589

 Score =   432 bits (1112),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 266/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHH ERV+LDQVGGFADGVAVK VG+ETF IC+ 
Sbjct  275   SYVKRVCPEVKIIGVEPADANTMALSLHHRERVILDQVGGFADGVAVKEVGKETFRICQN  334

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++V+TSGA
Sbjct  335   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALALAGAEAYCKYYGLKDVNVVVITSGA  394

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F EL+GPMNITEF+YR  S + +
Sbjct  395   NMNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEFKYRCGSEK-E  453

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             S+VLY V +HT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LCRF
Sbjct  454   SVVLYSVGMHTAGELKALEKRMKSSQLRTRNLTTSDLVKDHLRYLMGGRSSVEEEVLCRF  513

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QV   EI+EF+ RA  LGY
Sbjct  514   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVSDQEIEEFRNRAQVLGY  573

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +A F LLM+
Sbjct  574   EYVLVSEDAIFNLLMH  589



>ref|XP_002961078.1| hypothetical protein SELMODRAFT_139810 [Selaginella moellendorffii]
 gb|EFJ38617.1| hypothetical protein SELMODRAFT_139810 [Selaginella moellendorffii]
Length=501

 Score =   429 bits (1103),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 253/315 (80%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PEV+IIGVEP DANAMALSLHHG RV LD  G FADGVAVK+VGEETF +CRE 
Sbjct  187   YMKRIRPEVQIIGVEPTDANAMALSLHHGTRVQLDHCGIFADGVAVKLVGEETFRLCREY  246

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CA+IKDMFEE+R+ILEP+GAL+IAGA+AYC YY LK E ++ VTSGAN
Sbjct  247   VDGIVLVSRDAICAAIKDMFEEKRSILEPAGALAIAGAKAYCNYYGLKKEAVVAVTSGAN  306

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG  +EA+L+  + E PGSFK+ VE VGP+NITEFRYRYS  R  +
Sbjct  307   MNFDRLRIVTELADVGASKEAVLAIIMAEIPGSFKRLVEEVGPVNITEFRYRYSDSRT-A  365

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVL  V VH + EL A+  R+  + L  ID+T NDLVKDHLRHLIGGR  ++DELL RFI
Sbjct  366   LVLCSVGVHKEQELQALKRRLKEAGLMVIDMTSNDLVKDHLRHLIGGRAILKDELLYRFI  425

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL +FLD F+P+WNI+LF+YRA G+ GANVL+G+QVP  +  EFK+ A +LGYE
Sbjct  426   FPERPGALRKFLDTFTPRWNISLFHYRAQGQVGANVLIGIQVPPEDEQEFKRCAVELGYE  485

Query  393   YAIE-TSEAFQLLMN  352
             +  E  +EAFQL+M+
Sbjct  486   FQDECKNEAFQLMMS  500



>ref|XP_009135029.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=603

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/316 (69%), Positives = 265/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVK VG+ETF IC+ 
Sbjct  289   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKEVGKETFRICQN  348

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGA
Sbjct  349   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGA  408

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F EL+GPMNITEF+YR  S + +
Sbjct  409   NMNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEFKYRCGSEK-E  467

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             S+VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC+F
Sbjct  468   SVVLYSVGVHTAGELKALEKRMESSQLRTRNLTTSDLVKDHLRYLMGGRSSVEEEVLCQF  527

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QV   E++EF+ RA  LGY
Sbjct  528   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVSEQEMEEFRNRAQVLGY  587

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +A F LLM 
Sbjct  588   EYVLVSEDAIFNLLMQ  603



>ref|XP_001783582.1| predicted protein [Physcomitrella patens]
 gb|EDQ51614.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 262/314 (83%), Gaps = 2/314 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V PEVKIIGVEP DANAMALSL+HG+RV+LDQVGGFADGVAVK+VGEETF + R L
Sbjct  357   YMKQVRPEVKIIGVEPADANAMALSLYHGKRVVLDQVGGFADGVAVKMVGEETFRLSRNL  416

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RD++CA+IKDMFEE R+ILEP+GALS+AGA+AYC+YY +K E+++ +TSGAN
Sbjct  417   LDGVVLVSRDSICAAIKDMFEETRSILEPAGALSLAGAKAYCQYYGIKDESVVAITSGAN  476

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG ++EA+L+T +PEEPGSFKKF ++VG ++ITEF+YRY++ + ++
Sbjct  477   MNFDRLRVVTELADVGARKEAVLATFMPEEPGSFKKFQQMVGSVDITEFKYRYTTDQ-EA  535

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V +H + EL A+ ERM  +++ T+DLT+NDL KDHLRHL+GGR  V+ ELL RF+
Sbjct  536   LVLYSVGLHKEEELSALKERMEGANMRTMDLTNNDLAKDHLRHLMGGRAHVQHELLYRFV  595

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPER GAL++FLDAFSP WNITLF+YR+ GE GANVLV LQ+   +   F  RAN LGYE
Sbjct  596   FPERQGALMKFLDAFSPSWNITLFHYRSQGEMGANVLVALQITKEDEQAFIDRANALGYE  655

Query  393   YAIE-TSEAFQLLM  355
             +  E  +EAFQL++
Sbjct  656   FQDERNNEAFQLIL  669



>ref|XP_004497587.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cicer arietinum]
Length=608

 Score =   431 bits (1108),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             F+K V+P+VKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVK +GEETF +C+ L
Sbjct  295   FMKRVSPQVKIIGVEPTDANGMALSLHHGERVILDQVGGFADGVAVKEIGEETFRLCKGL  354

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KGEN++ +TSGAN
Sbjct  355   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGIKGENVVAITSGAN  414

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA++ T LPEEPGSFK+F  LVG MNITEF+YRY+S   ++
Sbjct  415   MNFDKLRIVTELANVGRKQEALMLTFLPEEPGSFKQFCRLVGQMNITEFKYRYTSSD-KA  473

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M +R+  S L T +L+++DL KDHLR++IGGR  +++E++CRF 
Sbjct  474   VVLYSVGVHTPKELRQMQQRIESSMLETHNLSESDLTKDHLRYMIGGRLDIQNEVICRFT  533

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
              PERPGAL++FLD FSP+WNI+LF+YRA GE+GANVLVG+QVP+NE+DEF  RAN LGY+
Sbjct  534   IPERPGALMKFLDTFSPRWNISLFHYRAQGESGANVLVGIQVPANEMDEFHNRANKLGYD  593

Query  393   YAIETSEA-FQLLMN  352
             Y +   +  FQL M+
Sbjct  594   YKVVNKDPVFQLFMH  608



>gb|ABR18075.1| unknown [Picea sitchensis]
Length=652

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 265/315 (84%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V PEV+IIGVEP DANAMALSL+ G+RVMLDQVGGFADGVAVKVVGEETF +CREL
Sbjct  338   YMKQVRPEVRIIGVEPADANAMALSLYRGQRVMLDQVGGFADGVAVKVVGEETFRLCREL  397

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGA AYCKYY LK E ++ +TSGAN
Sbjct  398   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGANAYCKYYGLKDETVVAITSGAN  457

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNF+RLR + +LADVG +REA+L+T L EE GSFK F +LVGP+NITEF+YRY  G+ ++
Sbjct  458   MNFERLRLVTQLADVGAKREAVLATFLQEEHGSFKNFCQLVGPINITEFKYRYDIGKDKA  517

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V VH   EL AM +R+  S L T+DLTDNDL KDHLRHL+GGR ++E+ELL RF+
Sbjct  518   LVLYSVGVHKAEELIAMKDRLESSGLRTLDLTDNDLAKDHLRHLMGGRSNLENELLYRFV  577

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP  + +EF  +A  LGYE
Sbjct  578   FPERPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPKEDEEEFIGQAKTLGYE  637

Query  393   YAIE-TSEAFQLLMN  352
             +  E  ++A++LLM+
Sbjct  638   FKDERKNKAYRLLMH  652



>ref|XP_006407611.1| hypothetical protein EUTSA_v10020316mg [Eutrema salsugineum]
 gb|ESQ49064.1| hypothetical protein EUTSA_v10020316mg [Eutrema salsugineum]
Length=614

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VGEETF I R+L
Sbjct  301   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGEETFRISRKL  360

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGAN
Sbjct  361   MDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGAN  420

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F ELVGPMNITEF+YR  S   ++
Sbjct  421   MNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELVGPMNITEFKYRCGS-EEEA  479

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V +HT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  480   VVLYGVGLHTPGELKALEKRMESSQLITYNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFT  539

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD+FSP+WNI+LF+YRA GE GANVLVG+QV   E++EF+ RA  LGYE
Sbjct  540   FPERPGALMNFLDSFSPRWNISLFHYRAQGETGANVLVGIQVLEQEMEEFRNRAQALGYE  599

Query  393   YAIETSEA-FQLLMN  352
             Y + + +  F+ LM+
Sbjct  600   YFLVSDDINFKRLMH  614



>emb|CDX74007.1| BnaA03g30400D [Brassica napus]
Length=603

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/316 (68%), Positives = 265/316 (84%), Gaps = 2/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVK VG+ETF IC+ 
Sbjct  289   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKEVGKETFRICQN  348

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  N++ +TSGA
Sbjct  349   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGA  408

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFK+F EL+GPMNITEF+YR    + +
Sbjct  409   NMNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEFKYRCGLEK-E  467

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             S+VLY V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC+F
Sbjct  468   SVVLYSVGVHTAGELKALEKRMESSQLRTRNLTTSDLVKDHLRYLMGGRSSVEEEVLCQF  527

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QV   E++EF+ RA  LGY
Sbjct  528   TFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVSEQEMEEFRNRAQVLGY  587

Query  396   EYAIETSEA-FQLLMN  352
             EY + + +A F LLM+
Sbjct  588   EYVLVSEDAIFNLLMH  603



>ref|XP_003590411.1| Threonine dehydratase biosynthetic [Medicago truncatula]
Length=611

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/325 (67%), Positives = 270/325 (83%), Gaps = 12/325 (4%)
 Frame = -2

Query  1293  FVKMVNPEV------KIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETF  1132
             +VK +NPEV      KIIGVEP DANA+ALSLHHG+RV+LDQVGGFADGVAVK VGEETF
Sbjct  288   YVKRINPEVCLHGVVKIIGVEPTDANALALSLHHGQRVVLDQVGGFADGVAVKEVGEETF  347

Query  1131  GICRELIDGVVFVGRDAMCASIK----DMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              +C+EL+DGVV V RDA+CASIK    DMFEE+R+ILEP+GAL++AGAEAYCKYY LKGE
Sbjct  348   RLCKELVDGVVLVSRDAICASIKAAELDMFEEKRSILEPAGALALAGAEAYCKYYGLKGE  407

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N+I +TSGANMNFD+LR + ELA+VG ++EA+L T +PEEPGSFK+F ELVG MNITEF+
Sbjct  408   NVIAITSGANMNFDKLRIVTELANVGRKQEALLLTVMPEEPGSFKQFCELVGQMNITEFK  467

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRYSS + +++VLY V VHT +EL  M ERM  S L T +L+D DLVKDHLRH++G R  
Sbjct  468   YRYSS-KEKAVVLYSVGVHTPLELKEMQERMETSKLVTHNLSDVDLVKDHLRHMMGARPD  526

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             +++E+LCRF FPERPGAL +FLD+FSP+WNI+LF+YRA GE GANVLVG+QVPS+E++EF
Sbjct  527   IQNEVLCRFTFPERPGALTKFLDSFSPRWNISLFHYRAQGETGANVLVGIQVPSSEMEEF  586

Query  423   KQRANDLGYEYAIETSEA-FQLLMN  352
               RA  LGY+Y + + +  F+LLM+
Sbjct  587   NDRATGLGYDYNVLSDDLFFKLLMH  611



>gb|ABR18160.1| unknown [Picea sitchensis]
Length=652

 Score =   429 bits (1102),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 263/315 (83%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V PEV+IIGVEP DANAMALSL+ G+RVMLDQVGGFADGVAVKVVGEETF +CREL
Sbjct  338   YMKQVRPEVRIIGVEPADANAMALSLYRGQRVMLDQVGGFADGVAVKVVGEETFRLCREL  397

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGA AYCKYY LK E ++ +TSGAN
Sbjct  398   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGANAYCKYYGLKDETVVAITSGAN  457

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNF+RLR + +LADVG +REA+L+T L EE GSFK F +LVGP+NITEF+YRY  G+ ++
Sbjct  458   MNFERLRLVTQLADVGAKREAVLATFLQEEHGSFKNFCQLVGPINITEFKYRYDIGKDKA  517

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V VH   EL AM  R+  S L T+DLTDNDL KDHLRHL+GGR ++E+ELL RF+
Sbjct  518   LVLYSVGVHKAEELIAMKGRLESSGLRTLDLTDNDLAKDHLRHLMGGRSNLENELLYRFV  577

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLDAFSP+WNI+LF+YRA G+ GANVLVG+QVP  + +EF  +A  L YE
Sbjct  578   FPERPGALMKFLDAFSPRWNISLFHYRAQGDTGANVLVGIQVPKEDEEEFIGQAKTLRYE  637

Query  393   YAIE-TSEAFQLLMN  352
             Y  E  ++A++LLM+
Sbjct  638   YKDERKNKAYRLLMH  652



>ref|XP_009337412.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Pyrus x bretschneideri]
Length=610

 Score =   426 bits (1096),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 259/317 (82%), Gaps = 2/317 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVE  DANAMALS+HHG+R+ML++VGGFADG+AVK VGEETF +CRE
Sbjct  294   SYVKRVRPEVKIIGVEVSDANAMALSIHHGQRIMLEKVGGFADGIAVKKVGEETFRLCRE  353

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             LIDGVV V RDA+CASIKDMFEE+R+ILEP+GA++IAGAEAYCKYY LKGEN++ ++SGA
Sbjct  354   LIDGVVLVSRDAVCASIKDMFEEKRSILEPAGAVAIAGAEAYCKYYGLKGENVVAISSGA  413

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR +++LADVG + E  L+T +PE+ GSFK+F ELVGPMNI E  YRY   +  
Sbjct  414   NMNFDRLRLVSQLADVGRRCEVFLATFVPEKRGSFKQFCELVGPMNILEISYRYDDKKES  473

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGR-CSVEDELLCR  580
              LVLY V  HT +EL+ M++RM+ + L T++LT+ +LVKDH++ L+GGR  S+E+E+LC+
Sbjct  474   GLVLYSVGFHTVLELEEMLDRMMSAQLLTVNLTNKELVKDHMQFLVGGRSSSIENEILCQ  533

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F  P RPGALL+FLDAFSP WNI+LF+Y   GE+GA+ LVGL V S+EI++FK  A+ LG
Sbjct  534   FAIPARPGALLKFLDAFSPLWNISLFHYSGQGESGADALVGLHVASSEINKFKALADALG  593

Query  399   YEYAIET-SEAFQLLMN  352
             + Y  ET +E  QLL++
Sbjct  594   FNYKFETNNETLQLLLH  610



>gb|KFK38389.1| hypothetical protein AALP_AA3G107100 [Arabis alpina]
Length=610

 Score =   426 bits (1095),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 261/315 (83%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+PEVKIIGVEP DANAMALSLHHGERV+LDQVGGFADGVAVK VG ETF I R+L
Sbjct  297   YVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADGVAVKEVGVETFRISRKL  356

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+RNILEP+GAL++AGAEAYCKYY LK  +++ + SGAN
Sbjct  357   LDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVSVVAIASGAN  416

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA++G Q+EA+L+T +PE PGSFK+F E+VGPMNITEF+YR  S + ++
Sbjct  417   MNFDKLRIVTELANIGRQQEAVLATLMPETPGSFKQFCEMVGPMNITEFKYRCGSEK-EA  475

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL A+ +RM    L T +LT +DLVKDHLR+L+GGR SVEDE+LCRF 
Sbjct  476   VVLYSVGVHTPGELKALQKRMESCQLRTSNLTTSDLVKDHLRYLMGGRSSVEDEILCRFT  535

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FLD FSP+WNI+LF+YRA GE GANVLVG+QV   E++EF+ RA  LGYE
Sbjct  536   FPERPGALMNFLDTFSPRWNISLFHYRAQGETGANVLVGIQVLEQEMEEFRNRAQALGYE  595

Query  393   Y-AIETSEAFQLLMN  352
             Y  +   + F+LLM+
Sbjct  596   YFLVSDDDNFKLLMH  610



>ref|XP_004496176.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cicer arietinum]
Length=598

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 263/313 (84%), Gaps = 2/313 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+P+VKIIGVEP DANAMALSLHHG RV+LDQVGGFADGVAVK VGEETF +C+ L
Sbjct  286   YVKRVSPQVKIIGVEPSDANAMALSLHHGHRVILDQVGGFADGVAVKEVGEETFRLCKGL  345

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KGEN++ +TSGAN
Sbjct  346   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGIKGENVVAITSGAN  405

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA++ T LPEEPGSFK+F +LVG M+ITEF+YRYSS   ++
Sbjct  406   MNFDKLRIVTELANVGRKQEALMLTVLPEEPGSFKRFCQLVGQMSITEFKYRYSSSE-KA  464

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M E+M  S L T +L+++D+ KDHLR+++GGR  +++E+LC F 
Sbjct  465   VVLYSVGVHTPKELKKMQEKMESSQLETHNLSESDVAKDHLRYMMGGRSDIQNEVLCCFT  524

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+FSP+WNITLF+YRA G+ GANVLVG+QV S+E+DEF  RAN L Y+
Sbjct  525   FPERPGALMKFLDSFSPRWNITLFHYRAQGQVGANVLVGIQVLSSEMDEFHDRANKLAYD  584

Query  393   YAIETSEA-FQLL  358
             Y +   +  FQLL
Sbjct  585   YKVVNDDPIFQLL  597



>ref|XP_004497558.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004497559.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=601

 Score =   423 bits (1088),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 264/315 (84%), Gaps = 2/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+P+VKIIGVEP DANAMALSLHHG RV+LDQVG FADGVAVK VGEETF +C+ L
Sbjct  288   YVKRVSPQVKIIGVEPTDANAMALSLHHGHRVILDQVGRFADGVAVKEVGEETFRLCKGL  347

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY +KGEN++ +TSGAN
Sbjct  348   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGIKGENVVAITSGAN  407

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG ++EA++ T LPEEP SFK+F +LVG M+ITEF+YRY+S R ++
Sbjct  408   MNFDKLRIVTELANVGRKQEALMLTVLPEEPDSFKRFCQLVGQMSITEFKYRYTS-RDKA  466

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             +VLY V VHT  EL  M ERM  S L T +L+++D+ KDHLR+++GGR  + +E+ C F 
Sbjct  467   VVLYSVGVHTPKELRKMQERMESSQLETHNLSESDVAKDHLRYMMGGRSDILNEVFCCFT  526

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FLD+F+P+WNI+LF+YRA GE+GANVLVG+QVP+NE+DEF  RAN LGY+
Sbjct  527   FPERPGALMKFLDSFNPRWNISLFHYRAQGESGANVLVGIQVPANEMDEFHDRANKLGYD  586

Query  393   YA-IETSEAFQLLMN  352
             Y  +     FQLLM+
Sbjct  587   YKLVNNDPVFQLLMH  601



>ref|XP_008349803.1| PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, 
chloroplastic-like [Malus domestica]
Length=591

 Score =   420 bits (1080),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 254/312 (81%), Gaps = 2/312 (1%)
 Frame = -2

Query  1281  VNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRELIDGV  1102
             V PEVKIIGVE  DANAMALS+HHG+R+ML +VGGFADG+AVK VGEETF +CRELIDGV
Sbjct  280   VRPEVKIIGVEVSDANAMALSIHHGQRIMLVKVGGFADGIAVKKVGEETFRLCRELIDGV  339

Query  1101  VFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFD  922
             V V RDA+CASIKDMFEE+R+ILEP+GA++IAGAEAYCKYY LKGEN++ ++SGANMNFD
Sbjct  340   VLVSRDAVCASIKDMFEEKRSILEPAGAVAIAGAEAYCKYYGLKGENVVAISSGANMNFD  399

Query  921   RLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLY  742
             RLR +++LADVG +RE  L+T +PE+ GSFK+F ELVGPMNI E  YRY   +   L+LY
Sbjct  400   RLRLVSQLADVGRRREVFLATFVPEKRGSFKQFCELVGPMNILEINYRYDDKKESGLILY  459

Query  741   RVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGR-CSVEDELLCRFIFPE  565
              V   T +EL+ M++RM  + L TI+LT+ +LVKDH++ L+GGR  S+E+E+LC+F  P 
Sbjct  460   SVGFQTVLELEEMLDRMKSAQLLTINLTNKELVKDHMQFLVGGRSSSIENEILCQFSIPA  519

Query  564   RPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYEYAI  385
             RPGALL+FLDAFSP WNI+LF+Y   GE+GA+ LVGL V S+EI++FK  A+ LG++Y  
Sbjct  520   RPGALLKFLDAFSPLWNISLFHYSGQGESGADALVGLHVASSEINKFKALADALGFDYKF  579

Query  384   ET-SEAFQLLMN  352
             ET +E  QLL++
Sbjct  580   ETNNETLQLLLH  591



>emb|CDY22213.1| BnaC01g38880D [Brassica napus]
Length=636

 Score =   419 bits (1076),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 250/308 (81%), Gaps = 9/308 (3%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             ++VK V PEVKIIGVEP DAN MALSLHHGERV+LDQVGGFADGVAVKVVGEETF I R+
Sbjct  290   SYVKRVCPEVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRK  349

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+DGVV V RDA+CASIKDMFEE+RNILEP+GAL+IAGAEAYCKYY LK  N++ +TSGA
Sbjct  350   LVDGVVLVTRDAICASIKDMFEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGA  409

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+LR + ELA+VG Q+EA+L+T LPE+PGSFKKF EL+ P +I         G  +
Sbjct  410   NMNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKKFCELLIPSSI-------DMGLKR  462

Query  756   SLVLY--RVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLC  583
             +L+ Y   V VHT  EL A+ +RM  S L T +LT +DLVKDHLR+L+GGR SVE+E+LC
Sbjct  463   NLLYYTGNVGVHTPGELKALEKRMESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLC  522

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             +F FPERPGAL+ FLD+FSP+WNI+LF+YRA G AGANVLVG+QVP  E+ EF+ RA  L
Sbjct  523   QFTFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVPEQEMVEFRNRAQVL  582

Query  402   GYEYAIET  379
             GYE+ + +
Sbjct  583   GYEHRMNS  590



>gb|KHG11164.1| Threonine dehydratase biosynthetic, chloroplastic -like protein 
[Gossypium arboreum]
Length=293

 Score =   402 bits (1033),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 200/294 (68%), Positives = 252/294 (86%), Gaps = 2/294 (1%)
 Frame = -2

Query  1230  MALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRELIDGVVFVGRDAMCASIKDMFE  1051
             MALSLHHGERVMLD+VGGFADGVAVK VG ETF +CREL+DGVV V RDA+CASIKDMFE
Sbjct  1     MALSLHHGERVMLDKVGGFADGVAVKEVGVETFCLCRELVDGVVLVSRDAICASIKDMFE  60

Query  1050  ERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFDRLRCIAELADVGGQREA  871
             E+R+ILEP+GAL++AGAEAYCKYY LKG+NI+ +TSGANMNFD+LR + ELA+VG ++EA
Sbjct  61    EKRSILEPAGALALAGAEAYCKYYGLKGKNIVAITSGANMNFDKLRVVTELANVGRKQEA  120

Query  870   ILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERM  691
             +L+T L E+PGSFK+F ELVGPMNITEF+YR SS +A ++VLY V VH   +L+AM +R+
Sbjct  121   VLATILAEKPGSFKQFCELVGPMNITEFKYRCSSDKA-AVVLYSVGVHMVSDLEAMKQRL  179

Query  690   ILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFIFPERPGALLEFLDAFSPQWNI  511
               S L T +LT +DLVKDHLR+L+GGR +VE+E+LCRF+FPERPGAL++FL  FSP+WNI
Sbjct  180   ESSQLRTYNLTASDLVKDHLRYLMGGRLNVENEVLCRFVFPERPGALMKFLGTFSPRWNI  239

Query  510   TLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYEYAIETSEA-FQLLMN  352
             +LF+YR  GE GANVLVG+QV  +E++EF QR+  LGYEY + T+++ FQLLM+
Sbjct  240   SLFHYRGQGETGANVLVGIQVGKSEMEEFIQRSESLGYEYVLVTNDSNFQLLMH  293



>ref|XP_006363692.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Solanum tuberosum]
Length=572

 Score =   407 bits (1046),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 252/306 (82%), Gaps = 1/306 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V P+VKIIGVEP DANAMA+SLH+G RV+LDQVG FADGVAVKVVGEETF +C+EL
Sbjct  265   YMKRVAPDVKIIGVEPCDANAMAMSLHYGHRVILDQVGNFADGVAVKVVGEETFRLCKEL  324

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             IDGVV V RDA+C SIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LK EN++ +TSGAN
Sbjct  325   IDGVVLVNRDAICVSIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKDENVVAITSGAN  384

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGP-MNITEFRYRYSSGRAQ  757
             MNFDRLR I++LAD G   EA+L+T +PEEPGSFK+F + +GP M   EF+YRY S   +
Sbjct  385   MNFDRLRLISQLADAGRNCEAVLATCMPEEPGSFKRFCKQIGPTMKFIEFKYRYDSRDEK  444

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             +LVLYRV+  TK EL+A++E+M  + LHT++LTDNDLVKDH RHL GGR ++ +ELLCRF
Sbjct  445   ALVLYRVAHQTKSELEALIEKMRSAKLHTVNLTDNDLVKDHSRHLTGGRSNLHNELLCRF  504

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FP++ GAL + +DAFS +WNI+L +YRA G  GANVLVG+QVP +E DEF+  A  LGY
Sbjct  505   TFPKKAGALSKTIDAFSLRWNISLIHYRAQGHIGANVLVGIQVPQDEFDEFQDCARRLGY  564

Query  396   EYAIET  379
             +Y ++T
Sbjct  565   KYVLKT  570



>gb|AFW67822.1| hypothetical protein ZEAMMB73_691557 [Zea mays]
Length=386

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/269 (72%), Positives = 232/269 (86%), Gaps = 0/269 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL+HG+RVML+ VGGFADGVAVK VGEETF +CREL
Sbjct  111   YVKRVRPEVKIIGVEPSDANAMALSLYHGKRVMLEHVGGFADGVAVKAVGEETFRLCREL  170

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYYNLKG+ ++ +TSGAN
Sbjct  171   VDGIVMVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYNLKGDTVVAITSGAN  230

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  231   MNFDRLRLVTELADVGRKREAVLATFLPEEHGSFKKFTELVGRMNITEFKYRYDFNAKDA  290

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMV+RM L+ L T++LTDNDL KDHLR+ IGGR  ++DEL+ RFI
Sbjct  291   LVLYSVGIYTDNELGAMVDRMELAKLKTVNLTDNDLAKDHLRYFIGGRSEIKDELVYRFI  350

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAH  487
             FPERPGAL++FLDAFSP+WNI+LF+YRA 
Sbjct  351   FPERPGALMKFLDAFSPRWNISLFHYRAQ  379



>gb|AAK18849.1|AC082645_19 putative threonine dehydratase/deaminase [Oryza sativa Japonica 
Group]
Length=602

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 231/269 (86%), Gaps = 0/269 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+QVGGFADGVAVKVVGEETF +CREL
Sbjct  284   YVKRVRPEVKIIGVEPSDANAMALSLCHGQRVMLEQVGGFADGVAVKVVGEETFRLCREL  343

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V RDA+CASIKDMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGAN
Sbjct  344   VDGIVLVSRDAICASIKDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGAN  403

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR + ELADVG +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +
Sbjct  404   MNFDRLRLVTELADVGRKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDCNAKDA  463

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T  EL AMVERM  S L T+DLTDNDL KDHLR+ IGGR  V DEL+ RFI
Sbjct  464   LVLYSVGIYTDDELKAMVERMESSKLRTVDLTDNDLAKDHLRYFIGGRSEVTDELVYRFI  523

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAH  487
             FPERPGAL++FLDAFSP+WNI+LF+YRA 
Sbjct  524   FPERPGALMKFLDAFSPRWNISLFHYRAQ  552



>ref|XP_003572603.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Brachypodium distachyon]
Length=539

 Score =   397 bits (1021),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 201/315 (64%), Positives = 256/315 (81%), Gaps = 1/315 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PEVKIIGVEP DANAMALSL HG+RVML+ V GFADGVAVKVVGEETF +C+EL
Sbjct  218   YVKRVRPEVKIIGVEPSDANAMALSLCHGQRVMLEHVSGFADGVAVKVVGEETFRLCQEL  277

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DG+V V R+A+CASIK+MFEE+R ILEP+GAL++AGAEAYCK+Y LKGE ++ + SGAN
Sbjct  278   VDGIVLVSREAICASIKEMFEEKRIILEPAGALALAGAEAYCKHYGLKGETVVAIASGAN  337

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNF+RLR + ELADVG +REA+L+T LPEE G FKKF EL+G +NITE RYR  SG   +
Sbjct  338   MNFERLRLVTELADVGRKREAVLATFLPEELGGFKKFAELIGRVNITEVRYRDDSGVKYA  397

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
             LVLY V ++T   L A+V RM  S L T++LTDNDL KDHLR+ I GR  +++E++ RFI
Sbjct  398   LVLYSVGIYTDDALRAIVARMESSKLKTVNLTDNDLAKDHLRYFIRGRSEIKEEIIFRFI  457

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPG L +FLDAFSP+ NI+LF+YRA GE GA+VLVG+QVP+ ++ EF+  A++L YE
Sbjct  458   FPERPGPLKKFLDAFSPRGNISLFHYRAPGETGADVLVGVQVPAEDLGEFRSYADNLSYE  517

Query  393   YAIET-SEAFQLLMN  352
             Y  E+ +E ++LL++
Sbjct  518   YTSESNNEIYRLLLH  532



>gb|ACU26536.1| threonine deaminase, partial [Glycine max]
Length=288

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 244/286 (85%), Gaps = 2/286 (1%)
 Frame = -2

Query  1206  ERVMLDQVGGFADGVAVKVVGEETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEP  1027
             +RV+LDQVGGFADGVAVK VGEETF IC+ELIDGVV V RD++CASIKDMFEE+RNILEP
Sbjct  4     QRVILDQVGGFADGVAVKEVGEETFRICKELIDGVVLVSRDSICASIKDMFEEKRNILEP  63

Query  1026  SGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPE  847
             +GAL++AGAEAYCK++ ++G++I+V+TSGANMNFD+LR + ELA+VG ++EA+L+T LPE
Sbjct  64    AGALALAGAEAYCKHHGVQGKDIVVITSGANMNFDKLRVVTELANVGRKQEAVLATVLPE  123

Query  846   EPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTI  667
             EPGSFK+F ELVG MNITEF+YRY+S   +++VLY V +HT  EL AM ERM  S L T 
Sbjct  124   EPGSFKQFCELVGQMNITEFKYRYNSNE-KAVVLYSVGIHTVSELRAMQERMESSQLKTY  182

Query  666   DLTDNDLVKDHLRHLIGGRCSVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAH  487
             +LT++DLVKDHLR+L+GGR ++++E+LCRF FPERPGAL++FLD  SP+WNI+LF+YR  
Sbjct  183   NLTESDLVKDHLRYLMGGRSNIQNEVLCRFTFPERPGALMKFLDPSSPRWNISLFHYRGE  242

Query  486   GEAGANVLVGLQVPSNEIDEFKQRANDLGYEY-AIETSEAFQLLMN  352
             GE GANVLVG+QVP +E+DEF  RAN LGY+Y  +   + FQLLM+
Sbjct  243   GETGANVLVGIQVPKSEMDEFHDRANKLGYDYKVVNNDDDFQLLMH  288



>ref|XP_010923370.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Elaeis guineensis]
Length=300

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 228/306 (75%), Gaps = 26/306 (8%)
 Frame = -2

Query  1269  VKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRELIDGVVFVG  1090
             VKIIGVEP DANAMALSL+HG+RVML+QVGGF DGVAVKVVGEETF  CRELIDGVV VG
Sbjct  19    VKIIGVEPSDANAMALSLYHGQRVMLEQVGGFVDGVAVKVVGEETFRSCRELIDGVVLVG  78

Query  1089  RDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFDRLRC  910
             RDA+CASIKDMFEE+R+ILEP+GALS+AGAEAYCK Y L+G N++ + SGANMNFDRLR 
Sbjct  79    RDAICASIKDMFEEKRSILEPAGALSLAGAEAYCKNYGLEGTNVVAIASGANMNFDRLRL  138

Query  909   IAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLYRVSV  730
             + ELAD     E +   N    PG                       G     V   V +
Sbjct  139   VIELADRAN--EVLRRKNKASSPG-----------------------GDLTLAVTEAVGL  173

Query  729   HTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFIFPERPGAL  550
             H   EL   VER+  + L T +LT++D+VK HLR+ +GG+ +V+DE+LCRFIFPERPGAL
Sbjct  174   HIDTELGPTVERLRSAQLRTFNLTNDDMVKHHLRYFMGGQSNVQDEVLCRFIFPERPGAL  233

Query  549   LEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYEYAIE-TSE  373
             ++FLDA+SP+WNI+LF+YRA GE GANVLVG+QVP  +++EF+ +AN+LGYEYA E T+E
Sbjct  234   MKFLDAYSPRWNISLFHYRAQGETGANVLVGIQVPKEDMEEFRNKANNLGYEYAYEVTNE  293

Query  372   AFQLLM  355
             A++LLM
Sbjct  294   AYKLLM  299



>sp|P31212.1|THD1_SOLTU RecName: Full=Threonine dehydratase biosynthetic; AltName: Full=Threonine 
deaminase; Short=TD, partial [Solanum tuberosum]
 emb|CAA48039.1| threonine dehydratase [Solanum tuberosum]
Length=359

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 240/324 (74%), Gaps = 1/324 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+   V P  KIIGVEP+ A +M LSL+ G RV L+ V  FADGVAV +VG
Sbjct  34    GGGLISGVAAYFTQVAPHTKIIGVEPYGAASMTLSLYEGHRVKLENVDTFADGVAVALVG  93

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF  C+ELIDG+V V  D + A+IKD+++E RNILE SGA++IAGA AYC++YN+K E
Sbjct  94    EYTFAKCQELIDGMVLVRNDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYNIKNE  153

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             NI+ + SGANM+F +L  + ELA++G   EA+L+T + E+PGSFK F +LVG MNITE  
Sbjct  154   NIVAIASGANMDFSKLHKVTELAELGSDNEALLATFMIEQPGSFKTFAKLVGSMNITEVT  213

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR++S R ++LVLYRV V  K +L+ M++++  S++ T + + N+LV +H++HL+GG  S
Sbjct  214   YRFTSERKEALVLYRVDVDEKSDLEEMIKKLNSSNMKTFNFSHNELVAEHIKHLVGGSAS  273

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             + DE+   FIFPE+ G L  FL+AFSP+WNITL  YR  G+   NVLVG QVP +E+DEF
Sbjct  274   ISDEIFGEFIFPEKAGTLSTFLEAFSPRWNITLCRYRDQGDINGNVLVGFQVPQSEMDEF  333

Query  423   KQRANDLGYEYAIETS-EAFQLLM  355
             K +A+ LGY Y ++ S EAF +++
Sbjct  334   KSQADGLGYPYELDNSNEAFNIVV  357



>ref|XP_006366786.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Solanum tuberosum]
Length=596

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 243/324 (75%), Gaps = 1/324 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AAF K + P  KIIGVEP+ A +M LSL+ G RV L+ V  FADGVAV +VG
Sbjct  271   GGGLISGVAAFFKQIAPNTKIIGVEPYGAASMTLSLYEGHRVKLENVDTFADGVAVALVG  330

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF  C+ELIDG+V V  D + A+IKD+++E RNILE SGA++IAGA AYC++YN+K E
Sbjct  331   EYTFAKCQELIDGMVLVRNDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYNIKNE  390

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             NI+ + SGANM+F +L  + ELA++G  +EA+L+T + E+PGSFK F +LVG MNITE  
Sbjct  391   NIVAIASGANMDFSKLHKVTELAELGSDKEALLATFMIEQPGSFKTFAKLVGSMNITEVT  450

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR++S R ++LVLYRV V  K +L+ M++++  S++ T + + N+LV +H++HL+GG  S
Sbjct  451   YRFTSERKEALVLYRVDVDEKSDLEEMIKKLNSSNMKTFNFSHNELVAEHIKHLVGGSAS  510

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             + DE+   FIFPE+ GAL  FL+AFSP+WNITL  YR  G+   NVLVG QVP +E+DEF
Sbjct  511   ISDEIFGEFIFPEKAGALSTFLEAFSPRWNITLCRYRDQGDINGNVLVGFQVPQSEMDEF  570

Query  423   KQRANDLGYEYAIET-SEAFQLLM  355
             K +A+ LGY Y ++  +EAF +++
Sbjct  571   KSQADGLGYPYELDNLNEAFNIVV  594



>ref|XP_004156327.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cucumis sativus]
Length=619

 Score =   354 bits (909),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 233/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +F K+V PEVKIIGVEP+DAN+MA +LH+ + V L+ VG FADGVAVK VG+E F I RE
Sbjct  303   SFYKLVFPEVKIIGVEPNDANSMASALHNDQVVKLETVGTFADGVAVKQVGDENFRISRE  362

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             LIDG+V V +DA+ A IKDMFE+ R+ILEP+GALSIAGA+AYC+Y N++G NI+ VTSGA
Sbjct  363   LIDGIVLVDKDAIAACIKDMFEDTRSILEPAGALSIAGAKAYCEYNNIRGVNIVAVTSGA  422

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+L  IA+ AD G Q EA  +T LPE+PGS + F +L+G  ++TEF+YR++S +  
Sbjct  423   NMNFDQLGSIADNADSGNQTEATFATILPEKPGSLRTFSDLMGSRSVTEFKYRFNSEK-N  481

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             ++VLY V V    EL  + +++  S   T DLT N+LVKDHLR+++GGR SV +E+  RF
Sbjct  482   AIVLYSVGVKVASELGEVKKKIESSPFETYDLTKNELVKDHLRYMMGGRSSVPNEVFYRF  541

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
               PER GALL+FLDAFSP+WNI+L +YR  G   A+VLVGLQ+  +E  EF + A  LG+
Sbjct  542   TLPERSGALLQFLDAFSPRWNISLIHYRRQGIISADVLVGLQIEGSEEAEFHESARKLGF  601

Query  396   EYAIETSEAFQLLMN  352
              Y + +++    L+ 
Sbjct  602   GYVVVSNDPASKLLT  616



>ref|XP_004143369.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48214.1| hypothetical protein Csa_6G448720 [Cucumis sativus]
Length=619

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 232/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +F K+V PEVKIIGVEP+DAN+MA +LH+ + V L+ VG FADGVAVK VG+E F I RE
Sbjct  303   SFYKLVFPEVKIIGVEPNDANSMASALHNDQVVKLETVGTFADGVAVKQVGDENFRISRE  362

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             LIDG+V V +DA+ A IKDMFE+ R+ILEP+GALSIAGA+AYC+Y N+KG NI+ VTSGA
Sbjct  363   LIDGIVLVDKDAIAACIKDMFEDTRSILEPAGALSIAGAKAYCEYNNIKGVNIVAVTSGA  422

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFD+L  IA+ AD G Q EA  +T LPE+PGS   F +L+G  ++TEF+YR++S +  
Sbjct  423   NMNFDQLGSIADNADSGNQTEATFATILPEKPGSLITFSDLMGSRSVTEFKYRFNSEK-N  481

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRF  577
             ++VLY V V    EL  + +++  S   T DLT N+LVKDHLR+++GGR SV +E+  RF
Sbjct  482   AIVLYSVGVKVASELGEVKKKIESSPFETYDLTKNELVKDHLRYMMGGRSSVPNEVFYRF  541

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
               PER GALL+FLDAFSP+WNI+L +YR  G   A+VLVGLQ+  +E  EF + A  LG+
Sbjct  542   TLPERSGALLQFLDAFSPRWNISLIHYRRQGIISADVLVGLQIEGSEEAEFHESARKLGF  601

Query  396   EYAIETSEAFQLLMN  352
              Y + +++    L+ 
Sbjct  602   GYVVVSNDPASKLLT  616



>ref|WP_015437906.1| threonine dehydratase [Azoarcus sp. KH32C]
 ref|YP_007553582.1| threonine dehydratase [Azoarcus sp. KH32C]
 dbj|BAL26606.1| threonine dehydratase [Azoarcus sp. KH32C]
Length=506

 Score =   348 bits (893),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 233/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE KIIGVE  DA+AM  SL  G RV LDQVG FADG AVK+VG
Sbjct  182   GGGLISGVAAYIKRLRPETKIIGVETVDADAMTRSLAEGRRVALDQVGLFADGTAVKLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++ +D ++ V  DA+CA++KD+FE+ R+ILEPSGAL++AGA+ Y K +NL G+
Sbjct  242   EETFRLCQQYVDEMILVDNDAICAALKDVFEDTRSILEPSGALAVAGAKEYAKLHNLHGK  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N++ V SGANMNFDRLR +AE A+VG QREA+ +  +PE PGSF+KF  L+G  +ITEF 
Sbjct  302   NLVAVASGANMNFDRLRFVAERAEVGEQREAVFAVTIPERPGSFRKFCSLIGNRHITEFN  361

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+  R Q+ +   VSVH + E   ++E +   +L  +DLTD+++ K H+R+++GGR  
Sbjct  362   YRYADPR-QAHIFVGVSVHNRAEATRIIEMLDRHELPAVDLTDDEMAKSHIRYMVGGRAP  420

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V  EL+ RF FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  421   HVNHELVYRFEFPERPGALMNFLSNLHSDWNISLFHYRNHGADFGRVLVGMQVPPEDKTA  480

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             F+   + LGYEY  E++  A+++ +
Sbjct  481   FQDFLDRLGYEYVDESANPAYRMFL  505



>ref|WP_011237732.1| threonine dehydratase [Aromatoleum aromaticum]
 ref|YP_158940.1| threonine dehydratase [Aromatoleum aromaticum EbN1]
 emb|CAI08039.1| Threonine dehydratase [Aromatoleum aromaticum EbN1]
Length=506

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 233/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK + PE++I+GVE  DA+AM  SL  GERV+LDQVG FADG AVK +G
Sbjct  182   GGGLIAGVAAYVKRLRPEIRIVGVETVDADAMTRSLAAGERVVLDQVGLFADGTAVKQIG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +D +V V  DA+CA++KD+FE+ R+ILEPSGAL+IAGA+ Y K +NL G+
Sbjct  242   EETFRLCREYVDEMVLVDNDAICAALKDVFEDTRSILEPSGALAIAGAKEYAKRHNLHGK  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A+VG QREA+ +  +PE PGSF+KF  LVG  +ITEF 
Sbjct  302   CLVAVASGANMNFDRLRFVAERAEVGEQREAVFAVTIPERPGSFRKFCSLVGDRHITEFN  361

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+    Q+ +   VSVH + E   ++E +   +L  +DLTD+++ K H+R+++GG   
Sbjct  362   YRYADAE-QAHIFVGVSVHNRAEASRLIEMLGRHELPAVDLTDDEMAKSHVRYMVGGHAP  420

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              +++EL+ RF FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  421   HIDNELVYRFEFPERPGALMNFLTNLHSDWNISLFHYRNHGSDSGRVLVGMQVPPGDKTA  480

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F    + LGYE A E+ + A+++ +
Sbjct  481   FSAFLDRLGYESADESGNPAYRMFL  505



>ref|WP_018988428.1| L-threonine dehydratase biosynthetic IlvA [Azoarcus toluclasticus]
Length=506

 Score =   345 bits (886),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE++IIGVE  DA+AM  SL  G RV LDQVG FADG AVK VG
Sbjct  182   GGGLIAGVAAYIKRLRPEIRIIGVETVDADAMTRSLAEGRRVALDQVGLFADGTAVKQVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++ +D ++ V  DA+CA++KD+FE+ R+ILEPSGAL++AGA+ Y K +NL G+
Sbjct  242   EETFRLCQQYVDEMILVDNDAICAALKDVFEDTRSILEPSGALAVAGAKEYAKRHNLHGK  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N++ V SGANMNFDRLR +AE A+VG QREA+ +  +PE PGSF+KF  ++G  +ITEF 
Sbjct  302   NLVAVASGANMNFDRLRFVAERAEVGEQREAVFAVTIPERPGSFRKFCSVIGNRHITEFN  361

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+  + Q+ +    +VH + E   +VE +   +L  +DLTD+++ K H+R+++GGR  
Sbjct  362   YRYADPQ-QAHIFVGAAVHNRAEAARVVEMLERHELPAVDLTDDEMAKSHIRYMVGGRAP  420

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V  EL+ RF FPERPGAL+ FL +    WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  421   HVNHELVYRFEFPERPGALMNFLTSLHSDWNISLFHYRNHGSDFGRVLVGMQVPPEDKTA  480

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             F+   + LGYEYA E++  A+++ +
Sbjct  481   FQDFLDRLGYEYADESANPAYRMFL  505



>ref|WP_028461734.1| threonine dehydratase [Nitrosomonas cryotolerans]
Length=503

 Score =   343 bits (880),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 231/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+GIAA+VK + P +KIIGVEP DA+AM  SL  G RV L Q G FADGVAV+ VG
Sbjct  179   GGGLISGIAAYVKRLYPNIKIIGVEPVDADAMYRSLQKGRRVKLAQAGLFADGVAVREVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +CREL+D V+ V  D +CA+IKD+FE+ R ILEPSGALSIAG +AY +   ++ +
Sbjct  239   KETFRLCRELVDEVILVDTDTICAAIKDVFEDTRAILEPSGALSIAGLKAYAQREKIRHQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I + SGANMNFDRLR ++E A++G QREAI+S  +PE+PGSF+KF  L+G   ITEF 
Sbjct  299   TLIAIASGANMNFDRLRHVSERAELGEQREAIMSVTIPEQPGSFRKFCNLLGAKGITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRYS    ++ V   VSV  + E   ++  +  S L+T DL DN++ K H+RHL+GGR  
Sbjct  359   YRYSDPN-EAHVFVGVSVRNRDEALKLIRNLRESGLNTEDLNDNEMAKLHVRHLVGGRAR  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V++E+L RF FP+RPGAL+ FL++ S  WNI+LF+YR HG     VL+G+QVPS+E   
Sbjct  418   DVKNEMLYRFEFPDRPGALMSFLNSMSHNWNISLFHYRNHGADYGRVLIGMQVPSDEKVA  477

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             FK   N LGY Y  E+   A++L +
Sbjct  478   FKAFLNQLGYRYWDESKNPAYKLFL  502



>ref|WP_018748402.1| L-threonine dehydratase biosynthetic IlvA [Chitiniphilus shinanonensis]
Length=506

 Score =   342 bits (878),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 231/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK + PEVKIIGVEP DANAM LSL  GERV L QVG FADGVAVK VG
Sbjct  182   GGGLIAGVAAYVKRLRPEVKIIGVEPTDANAMYLSLKLGERVNLPQVGIFADGVAVKQVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CREL+D V+ V  DAMCA+IKD+FE+ R+ILEP+GAL+IAGA+ +    N +  
Sbjct  242   EETFRLCRELVDDVILVDTDAMCAAIKDVFEDTRSILEPAGALAIAGAKLWAARENAQDR  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGANMNFDRLR +AE A++G +REAI++  +PE PG+++ F  L+G  N+TEF 
Sbjct  302   TLVAIASGANMNFDRLRYVAEQAEMGEEREAIIAVTIPERPGAYRDFCSLLGARNVTEFN  361

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY++    + +   +S+  + E+  ++ R+    L  IDLTDN+  K H+RHL+GGR  
Sbjct  362   YRYANDEV-AHIFVGLSIQHRAEVADLIGRLADHGLAAIDLTDNETAKLHIRHLVGGRAP  420

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               +DE L RF FPERPGAL+ FL+    +WNI+LF+YR HG     VLVG+QVP  + + 
Sbjct  421   QAQDERLLRFEFPERPGALMNFLNQMGGKWNISLFHYRNHGADYGRVLVGIQVPEGDNEA  480

Query  426   FKQRANDLGYEYAIE-TSEAFQLLMN  352
             F      LGY Y +E T+ A++L ++
Sbjct  481   FVAFLEKLGYPYWMESTNPAYKLFLS  506



>ref|WP_004259793.1| threonine dehydratase [Thauera sp. 63]
 gb|ENO77453.1| threonine dehydratase [Thauera sp. 63]
Length=506

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/328 (52%), Positives = 237/328 (72%), Gaps = 9/328 (3%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE KIIGVE  DA+AM  SL  G+RV LDQVG FADG AVK VG
Sbjct  181   GGGLIAGVAAYIKRLRPETKIIGVEAVDADAMTQSLAAGKRVALDQVGIFADGAAVKEVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+ Y + + L+ +
Sbjct  241   AETFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPAGALAVAGAKEYARRHKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  NITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEKPGSFRKFISVLGNRNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  R Q+ +   V+VH + E   +VE +   +L  +DLTD++L K H+R+++GG   
Sbjct  361   YRYADAR-QAHIFVGVTVHNRNEAGRLVEMLERHELPALDLTDDELAKTHVRYMVGGHSP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNE---  436
               E+E++ RF+FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  420   QAENEVVYRFVFPERPGALMNFLSNLRSDWNISLFHYRNHGSDFGRVLVGMQVPPADKAA  479

Query  435   IDEFKQRANDLGYEYAIET-SEAFQLLM  355
              D+F QR   LGYEY  ET + A++L +
Sbjct  480   FDDFLQR---LGYEYVAETDNPAYRLFL  504



>ref|WP_011764235.1| threonine dehydratase [Azoarcus sp. BH72]
 ref|YP_932004.1| threonine dehydratase [Azoarcus sp. BH72]
 emb|CAL93117.1| probable threonine dehydratase [Azoarcus sp. BH72]
Length=506

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 233/326 (71%), Gaps = 5/326 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK + PE +IIGVE   A AM  SL  GERV L+QV  FADG AVK VG
Sbjct  182   GGGLIAGVAAYVKRLRPETRIIGVESEGAAAMTESLARGERVSLEQVALFADGTAVKQVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEPSGAL++AGA+ Y + + L   
Sbjct  242   GETFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPSGALAVAGAKEYARRHQLSDR  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  +ITEF 
Sbjct  302   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEQPGSFRKFINILGNRDITEFN  361

Query  783   YRYS-SGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
             YRY+ S RA   +   V+V ++ E   +VE +   DL  +DLTD++L K H+R+++GGR 
Sbjct  362   YRYADSERAH--IFVGVTVRSRDEATRLVEMLGQHDLPALDLTDDELAKSHVRYMVGGRA  419

Query  606   -SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
               V +EL+ RF+FPERPGALL FL      WNI+LF+YR HG     VLVG+QVP  +ID
Sbjct  420   PQVANELVYRFVFPERPGALLNFLSNLRSDWNISLFHYRNHGADFGRVLVGMQVPPQDID  479

Query  429   EFKQRANDLGYEYAIET-SEAFQLLM  355
              F+     LGYEYA ET + A++L +
Sbjct  480   AFEAFLQRLGYEYAAETENPAYRLFL  505



>gb|AAA34171.1| threonine deaminase, partial [Solanum lycopersicum]
Length=594

 Score =   344 bits (882),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 236/325 (73%), Gaps = 1/325 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+A F K + P  KIIGVEP+ A +M LSLH G RV L  V  FADGVAV +VG
Sbjct  269   GGGLIAGVATFFKQIAPNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVG  328

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF  C+ELIDG+V V  D + A+IKD+++E RNILE SGA++IAGA AYC++Y +K E
Sbjct  329   EYTFAKCQELIDGMVLVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNE  388

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             NI+ + SGANM+F +L  + ELA +G  +EA+L+T + E+ GSFK FV LVG +N TE  
Sbjct  389   NIVAIASGANMDFSKLHKVTELAGLGSGKEALLATFMVEQQGSFKTFVGLVGSLNFTELT  448

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR++S R  +L+LYRV+V  + +L+ M+E M  S++ T++L+ N+LV DHL+HL+GG  +
Sbjct  449   YRFTSERKNALILYRVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVDHLKHLVGGSAN  508

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             + DE+   FI PE+   L  FLDAFSP+WNITL  YR  G+  A++L+G QVP  E+DEF
Sbjct  509   ISDEIFGEFIVPEKAETLKTFLDAFSPRWNITLCRYRNQGDINASLLMGFQVPQAEMDEF  568

Query  423   KQRANDLGYEYAIET-SEAFQLLMN  352
             K +A+ LGY Y ++  +EAF L+++
Sbjct  569   KNQADKLGYPYELDNYNEAFNLVVS  593



>ref|XP_004246590.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic 
[Solanum lycopersicum]
 sp|P25306.1|THD1_SOLLC RecName: Full=Threonine dehydratase biosynthetic, chloroplastic; 
AltName: Full=Threonine deaminase; Short=TD; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA68097.1| threonine deaminase [Solanum lycopersicum]
Length=595

 Score =   344 bits (882),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 236/325 (73%), Gaps = 1/325 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+A F K + P  KIIGVEP+ A +M LSLH G RV L  V  FADGVAV +VG
Sbjct  270   GGGLIAGVATFFKQIAPNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVG  329

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF  C+ELIDG+V V  D + A+IKD+++E RNILE SGA++IAGA AYC++Y +K E
Sbjct  330   EYTFAKCQELIDGMVLVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNE  389

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             NI+ + SGANM+F +L  + ELA +G  +EA+L+T + E+ GSFK FV LVG +N TE  
Sbjct  390   NIVAIASGANMDFSKLHKVTELAGLGSGKEALLATFMVEQQGSFKTFVGLVGSLNFTELT  449

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR++S R  +L+LYRV+V  + +L+ M+E M  S++ T++L+ N+LV DHL+HL+GG  +
Sbjct  450   YRFTSERKNALILYRVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVDHLKHLVGGSAN  509

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
             + DE+   FI PE+   L  FLDAFSP+WNITL  YR  G+  A++L+G QVP  E+DEF
Sbjct  510   ISDEIFGEFIVPEKAETLKTFLDAFSPRWNITLCRYRNQGDINASLLMGFQVPQAEMDEF  569

Query  423   KQRANDLGYEYAIET-SEAFQLLMN  352
             K +A+ LGY Y ++  +EAF L+++
Sbjct  570   KNQADKLGYPYELDNYNEAFNLVVS  594



>ref|WP_011478496.1| threonine dehydratase [Methylobacillus flagellatus]
 ref|YP_544240.1| threonine dehydratase [Methylobacillus flagellatus KT]
 gb|ABE48399.1| L-threonine ammonia-lyase [Methylobacillus flagellatus KT]
Length=503

 Score =   341 bits (874),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/325 (52%), Positives = 230/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K V PE+K+IGVE +DANAM +SL  G RV LDQVG FADG AVK+VG
Sbjct  179   GGGLIAGVAAYIKAVRPEIKVIGVEVNDANAMTVSLQQGARVTLDQVGLFADGKAVKLVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++ +D ++ V  DA+CA+IKD+FE+ R ILEP+GALS+AG +AY + +NL+G+
Sbjct  239   EETFRLCQQYVDEMILVDNDAICAAIKDVFEDTRAILEPTGALSLAGLKAYAQQHNLQGK  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I V SGANM+FDRLR +AE A++G +REA+L+  +PE PGSFKKF  L+G  NITEF 
Sbjct  299   TLIAVASGANMSFDRLRFVAERAEIGEKREAVLAVTIPETPGSFKKFCRLIGHRNITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+   A  + +  +++    E   +V R+    L  +DL++N++ K HLRHL+GG   
Sbjct  359   YRYADATAAHIYV-GIAIQDPSESGKLVTRLQEHGLPALDLSENEVAKLHLRHLVGGHAP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               + E + RF FPE+PGAL+ FLD     WNI+LF+YR HG     VLVG+QVP  E  E
Sbjct  418   QAKHEQVYRFEFPEKPGALMNFLDNMRHDWNISLFHYRNHGADFGRVLVGMQVPPGEEQE  477

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             F     +LGY Y  E++  A++L +
Sbjct  478   FTDFLQNLGYPYWDESNNPAYKLFL  502



>ref|WP_002931530.1| MULTISPECIES: threonine dehydratase [Thauera]
 gb|ENO80785.1| threonine dehydratase [Thauera sp. 27]
 gb|ENO91553.1| threonine dehydratase [Thauera sp. 28]
Length=509

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/329 (51%), Positives = 239/329 (73%), Gaps = 9/329 (3%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE KIIGVE   A+AM  SL  G+RV L+QVG FADG AVK VG
Sbjct  181   GGGLIAGVAAYIKRLRPETKIIGVEAVGADAMTQSLAAGKRVTLEQVGIFADGAAVKEVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              E F +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+ Y + + L+ +
Sbjct  241   AENFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPAGALAVAGAKEYARRHKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSFKKF+ ++G  NITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEKPGSFKKFISVLGNRNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  + Q+ +   V+VH + E+  +VE +   +L  IDLTD++L K H+R+++GGR  
Sbjct  361   YRYAHPQ-QAHIFVGVTVHNRNEVARLVEMLERHELPAIDLTDDELAKTHVRYMVGGRSP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNE---  436
               E+E++ RFIFPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  420   QAENEVVYRFIFPERPGALMNFLSNLRSDWNISLFHYRNHGSDFGRVLVGMQVPPQDKAA  479

Query  435   IDEFKQRANDLGYEYAIET-SEAFQLLMN  352
              D+F QR   LGYEYA E+ + A+++ ++
Sbjct  480   FDDFLQR---LGYEYAAESDNPAYRMFLS  505



>gb|EXI83896.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. BA-93]
Length=501

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 236/325 (73%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE +IIGVE  DA+AMA SL  G+RV LD VG FADG AVK VG
Sbjct  177   GGGLISGVAAYIKRVRPETRIIGVEASDADAMARSLAAGKRVRLDHVGLFADGAAVKYVG  236

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+ Y + + LK +
Sbjct  237   EETFRLCQMYVDEMVLVNTDAICAAIKDVFEDTRAVLEPAGALAVAGAKEYARAHKLKDK  296

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGAN+NFDRLR +AE A++G QREA+ +  LPE+PG++K+FV L+G  NITEF 
Sbjct  297   TLVAIASGANLNFDRLRFVAERAELGEQREAVFAVTLPEKPGAYKRFVSLIGSHNITEFN  356

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+  R  + V   + V ++ E   ++E++   D   +DLTD+++ K H+RHL+GG   
Sbjct  357   YRYNDQR-DAHVFVGIQVGSRAESIKLLEQLHRHDYPALDLTDDEMAKGHIRHLVGGHSP  415

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              + +ELL RF FPERPGAL++FL++ S  WNI+LF+YR HG     VLVG+QVP +E++E
Sbjct  416   RISNELLYRFEFPERPGALMKFLNSMSAGWNISLFHYRNHGADYGRVLVGMQVPPSEMNE  475

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     +GY +  ET ++A++L +
Sbjct  476   FEDFLKKVGYAHWNETNNQAYKLFL  500



>ref|WP_013294583.1| threonine dehydratase, biosynthetic [Gallionella capsiferriformans]
 ref|YP_003848428.1| threonine dehydratase, biosynthetic [Gallionella capsiferriformans 
ES-2]
 gb|ADL56664.1| threonine dehydratase, biosynthetic [Gallionella capsiferriformans 
ES-2]
Length=502

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P++KIIGV+P D++AMA SL  G RV LD VG FADGVAVK VG
Sbjct  178   GGGLISGVAAYVKALRPDIKIIGVQPVDSDAMAQSLKTGARVTLDHVGLFADGVAVKQVG  237

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C+EL+D ++ V  D  CA++KD+FE+ R+ILEP+GAL+IAGA+ Y     +KGE
Sbjct  238   IETFRLCQELVDEIILVNTDETCAALKDVFEDTRSILEPAGALAIAGAKLYAAREGIKGE  297

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ +  GANMNFDRLR +AE AD+G +RE+IL+  +PE PGSF+KF   +G  NITEF 
Sbjct  298   ALVAIACGANMNFDRLRFVAERADIGEKRESILAVTIPETPGSFRKFCTQLGKRNITEFN  357

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YR+++ +A + V   + V  + E D +VE++    L T+DL+DN++ K HLRHL+GG   
Sbjct  358   YRFANPKA-AQVFVGIQVRNQQETDELVEKLQAHKLPTLDLSDNEMAKLHLRHLVGGHAP  416

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               ++E+L RF FPERPGAL++FL++ +  WNI+LF+YR HG     VLVG+QVP ++   
Sbjct  417   DAKNEILFRFEFPERPGALMQFLNSMNHNWNISLFHYRNHGADYGRVLVGMQVPDHDKLA  476

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F +  + LGY Y  ET + A++L +
Sbjct  477   FTEFLDTLGYPYYDETDNPAYRLFL  501



>ref|WP_004306745.1| MULTISPECIES: threonine dehydratase [Thauera]
 ref|YP_002354372.1| threonine dehydratase [Thauera sp. MZ1T]
 gb|ACK53476.1| threonine dehydratase, biosynthetic [Thauera sp. MZ1T]
 gb|ENO85719.1| threonine dehydratase [Thauera aminoaromatica S2]
 gb|KIN90044.1| threonine ammonia-lyase, biosynthetic [Thauera sp. SWB20]
Length=507

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 236/326 (72%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE KIIGVE  DA+AM  SL  G+R+ L+QVG FADG AVK VG
Sbjct  181   GGGLIAGVAAYIKRLRPETKIIGVEAVDADAMTRSLAAGKRIALEQVGIFADGAAVKEVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+ Y +   L+ +
Sbjct  241   AETFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPAGALAVAGAKEYARRNKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  NITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEKPGSFRKFISVLGNRNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+    ++ +   V+VH + E+  +VE +   +L  +DLTD+++ K H+R+++GGR  
Sbjct  361   YRYADAE-RAHIFVGVTVHNRSEVGRLVEMLERHELPALDLTDDEMAKSHVRYMVGGRAP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              VE+E++ RF+FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  + D 
Sbjct  420   QVENEVVYRFVFPERPGALMNFLSNLRSDWNISLFHYRNHGSDFGRVLVGMQVPPADKDA  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLMN  352
             F      LGY+Y  ET + A+++ ++
Sbjct  480   FDAFLQRLGYDYVAETDNPAYRMFLS  505



>ref|WP_004343520.1| threonine dehydratase [Thauera linaloolentis]
 gb|ENO85012.1| threonine dehydratase [Thauera linaloolentis 47Lol = DSM 12138]
Length=506

 Score =   339 bits (869),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 231/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+GIAA++K + PE KIIGVE   A+AM  SL  G R+ LDQVG FADG AVK VG
Sbjct  181   GGGLISGIAAYIKRLRPETKIIGVEAVGADAMTQSLAAGRRIALDQVGLFADGAAVKEVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+IAGA+ Y K + L+ +
Sbjct  241   AETFRLCQQYVDEMILVDNDAICAAIKDVFEDTRSILEPAGALAIAGAKEYAKRHKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  NITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEKPGSFRKFISVLGNRNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+    Q+ +   V+VH + E   +VE +   +L  IDLTD++L K H R+++GGR  
Sbjct  361   YRYADAE-QAHIFVGVTVHNRNEAGRLVEMLERHELPAIDLTDDELAKTHARYMVGGRSP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               ++E++ RF+FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  420   QAKNEVVYRFVFPERPGALMNFLTNLRSDWNISLFHYRNHGSDYGRVLVGMQVPPEDTAA  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     LGYEY  ET + A++L +
Sbjct  480   FEDFLQRLGYEYVAETGNPAYRLFL  504



>ref|WP_035054671.1| threonine dehydratase [Andreprevotia chitinilytica]
Length=505

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PEVKIIGVEP DANAM LSL  GERV L QVG FADGVAVK VG
Sbjct  180   GGGLIAGVAAYIKRLRPEVKIIGVEPTDANAMYLSLKLGERVNLPQVGIFADGVAVKQVG  239

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + ++ +D V+ V  DAMCA+IKD+FE+ R+ILEP+GAL++AGA+ +     ++G+
Sbjct  240   EETFRLAQQFVDDVILVDTDAMCAAIKDVFEDTRSILEPAGALAVAGAKLWAARQKVEGQ  299

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ +TSGANMNFDRLR +AE A++G +REAI++  +PE+PG+F+ F  L+G  N+TEF 
Sbjct  300   TLVAITSGANMNFDRLRYVAEQAEMGEEREAIIAVTIPEKPGAFRTFCGLIGARNVTEFN  359

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+S    + V   +S+  + E+  ++E++    +  +DLT+N+L K H+RHL+GGR  
Sbjct  360   YRYASDDI-AHVFVGLSIQNRSEVADLIEKLANEGIIALDLTNNELAKLHIRHLVGGRAP  418

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V++E L RF FPERPGALL FL   +  WNI+LF+YR HG     VLVG+QVP+ E   
Sbjct  419   HVDNERLIRFEFPERPGALLNFLTGMNVGWNISLFHYRNHGADYGRVLVGIQVPAEEDAA  478

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F      LGY + +E+ + A+QL +
Sbjct  479   FGDFLKKLGYPFWLESGNPAYQLFL  503



>ref|WP_018152808.1| hypothetical protein [Leeia oryzae]
Length=501

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 230/324 (71%), Gaps = 2/324 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +GIA +VK + P +K+ GVEP +A++M  S+  GERV L  VG FADGVAVK+VG
Sbjct  178   GGGLASGIAVYVKRLKPWIKVYGVEPFEADSMYQSIQAGERVKLPHVGLFADGVAVKLVG  237

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF +C+EL+DGV+ V  D MCA+IKD+FE+ R+ILEP+GAL+IAGA+ + +     G+
Sbjct  238   EHTFNLCKELLDGVIRVTNDEMCAAIKDVFEDTRSILEPAGALAIAGAKRWAQDSGATGQ  297

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGANMNFDRLR +AE +++G  REA+ +  +PE+PG+FK F+  +G  +ITEF 
Sbjct  298   TLVAIASGANMNFDRLRHVAERSEIGESREAVFAVTIPEQPGAFKDFLTQIGNRSITEFN  357

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRYS  + ++ +   V V  + E  A+V+++  S   T+DLTDN+L K H+RHL+GG  S
Sbjct  358   YRYSD-KVKAHIFVGVQVQNRAEASAIVQQLSDSGHATLDLTDNELAKLHVRHLVGGHAS  416

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
                E L RF FPERPGAL+ FL++ S  WNITLF+YR HG     VL+G+QVP N+  +F
Sbjct  417   ASHERLLRFEFPERPGALMGFLNSMSRGWNITLFHYRNHGADYGRVLIGIQVPENDASDF  476

Query  423   KQRANDLGYEYAIET-SEAFQLLM  355
             ++  +DLGYE+  ET + A+ L +
Sbjct  477   QRFLDDLGYEFVEETQNPAYTLFL  500



>ref|WP_011379799.1| threonine dehydratase [Nitrosospira multiformis]
 ref|YP_411137.1| threonine dehydratase [Nitrosospira multiformis ATCC 25196]
 gb|ABB73745.1| L-threonine ammonia-lyase [Nitrosospira multiformis ATCC 25196]
Length=503

 Score =   337 bits (864),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 236/325 (73%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + PE++IIGVEP DA++M  SL    RV L +VG FADGVAVK VG
Sbjct  179   GGGLISGVAAYVKRLYPEIRIIGVEPVDADSMYQSLKKNRRVRLARVGLFADGVAVKQVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +CREL+D ++ V  DA+CA+IKD+FE+ R ILEPSGALSIAGA+AY K   ++G+
Sbjct  239   VETFHLCRELVDEILLVDTDAICAAIKDVFEDTRAILEPSGALSIAGAKAYAKREGIRGK  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N+I + SGANMNFDRLR ++E A++G QREA+++  +PEEPGSFKKF  ++GP +ITEF 
Sbjct  299   NLIAIASGANMNFDRLRHVSERAELGEQREAVMAVTIPEEPGSFKKFCAMLGPRSITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YR+ +G  ++ V   VSV  + E   +++ +  + L T DL+DN++ K H+RHL+GG   
Sbjct  359   YRF-AGPKEAHVFVGVSVRNREEAAKLIKDLENNGLRTEDLSDNEMAKLHIRHLVGGHAR  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V++E++ RF FP+RPGAL++FL++ S  WNI+LF+YR HG     VLVG++VP  E  +
Sbjct  418   DVKNEIVYRFEFPDRPGALMQFLNSMSHHWNISLFHYRNHGADYGRVLVGMEVPPEEKAD  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             FK     L   Y  ET + A++L +
Sbjct  478   FKAFLAQLDNRYWDETHNPAYKLFL  502



>gb|EXI79062.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. BA-92]
Length=501

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 235/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE +IIGVE  DA+AMA SL  G+R+ LD VG FADG AVK VG
Sbjct  177   GGGLISGVAAYIKRVRPETRIIGVEASDADAMARSLAAGKRIRLDHVGLFADGAAVKYVG  236

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+AY + + LK +
Sbjct  237   EETFRLCQMYVDEMVLVNTDAICAAIKDVFEDTRAVLEPAGALAVAGAKAYARTHRLKDK  296

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGAN+NFDRLR +AE A++G QREA+ +  LPE+PG++K FV L+G  NITEF 
Sbjct  297   ALVAIASGANLNFDRLRFVAERAELGEQREAVFAVTLPEKPGAYKNFVSLIGSHNITEFN  356

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+  R  + V   + V ++ E   ++E++       +DLTD+++ K H+RHL+GG   
Sbjct  357   YRYNDQR-DAHVFVGIQVSSRAESIKLLEQLHKHHYPALDLTDDEMAKGHIRHLVGGHSP  415

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              + +ELL RF FPERPGAL++FL++ S  WNI+LF+YR HG     VLVG+QVP +E++E
Sbjct  416   RISNELLYRFEFPERPGALMKFLNSMSAGWNISLFHYRNHGADYGRVLVGMQVPPSEMNE  475

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     +GY +  ET ++A++L +
Sbjct  476   FEDFLEKVGYAHWNETNNQAYKLFL  500



>ref|WP_034921213.1| threonine dehydratase [Candidatus Accumulibacter sp. SK-01]
 gb|KFB69867.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. SK-01]
Length=503

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 230/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE +IIGVE  DA+AM  SL  G+RV LD VG FADG AVK VG
Sbjct  179   GGGLISGVAAYIKRVRPETRIIGVEAVDADAMTRSLKAGKRVRLDHVGLFADGAAVKYVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AG +AY K + LK  
Sbjct  239   EETFRLCQMYVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGVKAYAKAHKLKDR  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I   SGANMNFDRLR +AE A++G QREA+ +  LPE+PG++K+FV L+G  NITEF 
Sbjct  299   TLIATASGANMNFDRLRFVAERAEIGEQREAVFAVTLPEKPGAYKRFVALIGARNITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY++ R  + V   + V ++ E   ++E +   D  T+DLTD+++ K H+RHL+GG   
Sbjct  359   YRYNNQR-DAHVFVGIQVASRAESVRLLEHLRKHDYPTLDLTDDEMAKGHIRHLVGGHSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              ++ E+L RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP +E+ +
Sbjct  418   QIQHEILYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRVLVGMQVPPSEMGD  477

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             F+     LGY Y  E++  A++L +
Sbjct  478   FEDFLAKLGYAYWNESNNPAYKLFL  502



>ref|WP_034944030.1| threonine dehydratase [Candidatus Accumulibacter sp. SK-02]
Length=503

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 229/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE +IIGVE  DA+AM  SL  G+RV LD VG FADG AVK VG
Sbjct  179   GGGLISGVAAYIKRVRPETRIIGVEAVDADAMTRSLKAGKRVRLDHVGLFADGAAVKYVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+AY K + LK  
Sbjct  239   EETFRLCQMYVDDMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGAKAYAKAHKLKDR  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I   SGANMNFDRLR +AE A++G QREA+ +  LPE+PG++K+FV L+G  NITEF 
Sbjct  299   TLIATASGANMNFDRLRFVAERAEIGEQREAVFAVTLPEKPGAYKRFVALIGSRNITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  R  + V   + V ++ E   ++E +   D  T+DLTD+++ K H+RHL+GG   
Sbjct  359   YRYNDQR-DAHVFVGIQVASRAESVRLLEHLRKHDYPTLDLTDDEMAKGHIRHLVGGHSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              ++ E+L RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP  E+ +
Sbjct  418   QIQHEILYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRVLVGMQVPPCEMGD  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     LGY Y  E+ + A++L +
Sbjct  478   FEDFLAKLGYAYWNESHNPAYKLFL  502



>gb|KFB78564.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. SK-02]
Length=543

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 229/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE +IIGVE  DA+AM  SL  G+RV LD VG FADG AVK VG
Sbjct  219   GGGLISGVAAYIKRVRPETRIIGVEAVDADAMTRSLKAGKRVRLDHVGLFADGAAVKYVG  278

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+AY K + LK  
Sbjct  279   EETFRLCQMYVDDMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGAKAYAKAHKLKDR  338

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I   SGANMNFDRLR +AE A++G QREA+ +  LPE+PG++K+FV L+G  NITEF 
Sbjct  339   TLIATASGANMNFDRLRFVAERAEIGEQREAVFAVTLPEKPGAYKRFVALIGSRNITEFN  398

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  R  + V   + V ++ E   ++E +   D  T+DLTD+++ K H+RHL+GG   
Sbjct  399   YRYNDQR-DAHVFVGIQVASRAESVRLLEHLRKHDYPTLDLTDDEMAKGHIRHLVGGHSP  457

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              ++ E+L RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP  E+ +
Sbjct  458   QIQHEILYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRVLVGMQVPPCEMGD  517

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     LGY Y  E+ + A++L +
Sbjct  518   FEDFLAKLGYAYWNESHNPAYKLFL  542



>ref|WP_021247591.1| L-threonine dehydratase biosynthetic IlvA [Thauera terpenica]
 gb|EPZ17306.1| L-threonine dehydratase biosynthetic IlvA [Thauera terpenica 
58Eu]
Length=506

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE KIIGVE   A+AM  SL  GER+ L+QVG FADG AVK VG
Sbjct  181   GGGLIAGVAAYIKRLRPETKIIGVEAVGADAMTQSLAAGERITLEQVGLFADGAAVKQVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EE F +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+IAGA+ Y + + L+ +
Sbjct  241   EENFRLCQQYVDEMILVDNDAICAAIKDVFEDTRSILEPAGALAIAGAKEYVRRHKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  +ITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREALLAVTIPEKPGSFRKFINVLGKRSITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+    ++ +   VSVH + E   +VE +   DL  +DLTDN+L K H+R+++GGR  
Sbjct  361   YRYADAE-RAHIFVGVSVHNRSEAGRLVEMLERHDLPALDLTDNELAKMHIRYMVGGRSP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               E+E++ RF+FPERPGAL  FL      WNI+LF+YR HG     VLVG+QVP+++   
Sbjct  420   QAENEVIYRFVFPERPGALANFLSKLHSDWNISLFHYRNHGSDYGRVLVGMQVPADDAAA  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F      +GY+YA ET + A++L +
Sbjct  480   FADFLERVGYQYAAETDNPAYRLFL  504



>ref|WP_004364503.1| threonine dehydratase [Thauera phenylacetica]
 gb|ENO96714.1| threonine dehydratase [Thauera phenylacetica B4P]
Length=507

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 235/326 (72%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE KIIGVE  DA+AM  SL  G+R+ L+QVG FADG AVK VG
Sbjct  181   GGGLIAGVAAYIKRLRPETKIIGVEAVDADAMTRSLAAGKRIALEQVGIFADGAAVKEVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+ Y +   L+ +
Sbjct  241   LETFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPAGALAVAGAKEYARRNKLRDK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ V SGANMNFDRLR +AE A++G QREA+L+  +PE+PGSF+KF+ ++G  NITEF 
Sbjct  301   SLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPEKPGSFRKFISVLGNRNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+    ++ +   V+VH + E   +VE +   +L  +DLTD+++ K H+R+++GGR  
Sbjct  361   YRYADAE-RAHIFVGVTVHNRNEAGRLVEMLERHELPALDLTDDEMAKSHVRYMVGGRAP  419

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               E+E++ RF+FPERPGAL+ FL      WNI+LF+YR HG     VLVG+QVP ++ + 
Sbjct  420   QAENEVVYRFVFPERPGALMNFLSNLRSDWNISLFHYRNHGSDFGRVLVGMQVPPSDKEA  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLMN  352
             F      LGY+Y  ET + A+++ ++
Sbjct  480   FDAFLQRLGYDYVAETDNPAYRMFLS  505



>gb|EEC76062.1| hypothetical protein OsI_13266 [Oryza sativa Indica Group]
Length=381

 Score =   328 bits (841),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 197/238 (83%), Gaps = 1/238 (0%)
 Frame = -2

Query  1065  KDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGANMNFDRLRCIAELADVG  886
             +DMFEE+R+ILEP+GAL++AGAEAYCKYY LKGEN++ +TSGANMNFDRLR + ELADVG
Sbjct  139   EDMFEEKRSILEPAGALALAGAEAYCKYYGLKGENVVAITSGANMNFDRLRLVTELADVG  198

Query  885   GQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQSLVLYRVSVHTKMELDA  706
              +REA+L+T LPEE GSFKKF ELVG MNITEF+YRY      +LVLY V ++T  EL A
Sbjct  199   RKREAVLATFLPEEQGSFKKFAELVGRMNITEFKYRYDCNAKDALVLYSVGIYTDDELKA  258

Query  705   MVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFIFPERPGALLEFLDAFS  526
             MVERM  S L T+DLTDNDL KDHLR+ IGGR  V DEL+ RFIFPERPGAL++FLDAFS
Sbjct  259   MVERMESSKLRTVDLTDNDLAKDHLRYFIGGRSEVTDELVYRFIFPERPGALMKFLDAFS  318

Query  525   PQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYEYAIE-TSEAFQLLM  355
             P+WNI+LF+YRA GE GANVLVG+QVP  E DEFK RA++LGYEY  E  +E ++LL+
Sbjct  319   PRWNISLFHYRAQGETGANVLVGIQVPPEEFDEFKSRADNLGYEYMSEQNNEIYRLLL  376



>ref|WP_014235838.1| threonine ammonia-lyase, biosynthetic, long form [Azospira oryzae]
 ref|YP_005026978.1| threonine ammonia-lyase, biosynthetic, long form [Dechlorosoma 
suillum PS]
 gb|AEV25137.1| threonine ammonia-lyase, biosynthetic, long form [Dechlorosoma 
suillum PS]
Length=503

 Score =   332 bits (851),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 224/315 (71%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V PE+K+IGVE  DA+AM  S+  G+RV LD VG FADG AVK VGEETF +CRE 
Sbjct  189   YIKAVRPEIKVIGVETFDADAMKQSIAAGKRVRLDNVGLFADGTAVKFVGEETFRVCREY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEPSGAL+IAGA+ Y K + LK ++++ V SGAN
Sbjct  249   LDDIILVDTDAICAAIKDVFEDTRSILEPSGALAIAGAKEYAKQHKLKDKSLVAVASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
              NFDRLR +AE A+VG QREA+L+  LPE+PG++K+FV L+G  NITEF YR+   R ++
Sbjct  309   TNFDRLRFVAERAEVGEQREAVLAVTLPEKPGAYKRFVSLIGSRNITEFNYRFHEAR-EA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              V   V V  + E   +VE +      T+DLTD+++ K H+RH++GG    VE+ELL RF
Sbjct  368   HVFVGVQVANRAESTKLVESLKKHGYATLDLTDDEMGKLHVRHMVGGHAPQVENELLYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP  E+ EF+    +LGY
Sbjct  428   EFPERPGALMNFLNRMSSGWNISLFHYRNHGADYGRVLVGMQVPPAEMGEFQTFLQELGY  487

Query  396   EYAIETSE-AFQLLM  355
              +  ET+  A++L +
Sbjct  488   HHWDETANPAYKLFL  502



>ref|WP_041101209.1| threonine dehydratase [Sulfuritalea hydrogenivorans]
Length=501

 Score =   332 bits (851),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE ++IGVE  DA+AM  SL  G+RV L+ VG FADG AVK VG
Sbjct  177   GGGLISGVAAYIKRLRPETRVIGVEAADADAMDRSLKAGKRVRLESVGLFADGAAVKYVG  236

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +C++ +D +V V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+A+ K + ++G+
Sbjct  237   QETFRLCQQYVDEMVLVDTDAICAAIKDVFEDTRSILEPAGALAVAGAKAWAKKHGVQGK  296

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A+VG QREA+L+  LPE+PGS+KKFV L+G  +ITEF 
Sbjct  297   TLVAVASGANMNFDRLRFVAERAEVGEQREAVLAVTLPEKPGSYKKFVSLIGSRSITEFN  356

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YR+     ++ V   + V  + E   +V ++  +    +DLTD+++ K H+RHL+GG   
Sbjct  357   YRFHDA-GEAHVFVGMQVANRGEATKLVAQLQKNGYPALDLTDDEMAKLHIRHLVGGHAP  415

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V++EL+ RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG++VP  E+ +
Sbjct  416   QVKNELIYRFEFPERPGALMHFLNKMSAGWNISLFHYRNHGADTGRVLVGMEVPPKEMKD  475

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+    +LGY +  ET + A++L +
Sbjct  476   FRAFLKNLGYRFWDETKNPAYRLFL  500



>ref|WP_011111322.1| threonine dehydratase [Nitrosomonas europaea]
 ref|NP_840780.1| threonine dehydratase [Nitrosomonas europaea ATCC 19718]
 emb|CAD84612.1| ilvA, threonine dehydratase [Nitrosomonas europaea ATCC 19718]
Length=503

 Score =   332 bits (850),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + P++K+IGVEP D+NAM  SL  G RV L QVG FADGVAV++VGEETF +CR
Sbjct  187   AAYVKRLRPDIKVIGVEPVDSNAMYRSLQAGYRVELSQVGLFADGVAVRLVGEETFRLCR  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D ++ V  DA+CA+IKD+FE+ R+I+EPSGALSIAG +AY K  NL  E ++ + SG
Sbjct  247   ELVDDIILVDSDAICAAIKDIFEDTRSIVEPSGALSIAGLKAYVKQKNLLHEVLVAIASG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR ++E A++G QREAIL+  +PE+PGSFKKF  L+G  NITEF YRY+    
Sbjct  307   ANMNFDRLRHVSERAELGEQREAILAVTIPEKPGSFKKFCNLLGARNITEFNYRYADPE-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLC  583
              + V   VSV  + E   ++E +  + L T D+TDN++ K H+RH++GGR   V  E+L 
Sbjct  366   MAHVFVGVSVRNREESLHLIEILQENGLKTEDMTDNEMAKLHIRHMVGGRSREVMHEILY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FP+RPGAL+ FL+  S  WNI+LF+YR HG     VL+G+QVP  E  EF++  + L
Sbjct  426   RFEFPDRPGALMNFLNHMSDHWNISLFHYRNHGADFGRVLIGIQVPPEEKQEFREFLDKL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY +  E  + A+QL +
Sbjct  486   GYSFWDENDNPAYQLFL  502



>ref|WP_027468367.1| threonine dehydratase [Deefgea rivuli]
Length=505

 Score =   332 bits (850),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 222/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PEVK+IGVEP DANAM LSL  GER+ L QVG FADGVAVK VGEETF + +E 
Sbjct  189   YIKRLRPEVKVIGVEPTDANAMYLSLKLGERITLPQVGIFADGVAVKQVGEETFRLSQEF  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DAMCA+IKD+FE+ R+ILEP+GAL+IAG +A+    N++ + ++ + SGAN
Sbjct  249   VDDVILVDTDAMCAAIKDVFEDNRSILEPAGALAIAGMKAWAARENVQEKTLVAIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A++G QREAI+   +PE+PGSF+ F  L+G  N+TEF YRY+   +++
Sbjct  309   MNFDRLRYVAEQAEMGEQREAIMVVTVPEKPGSFRTFCSLIGARNVTEFNYRYAKD-SEA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              V   +S+  + E+  ++E++    L  +DLTDN+L K H+RHL+GG      +E L RF
Sbjct  368   HVFVGLSIQQRSEVVDLIEKLAEHQLAAVDLTDNELAKLHIRHLVGGHAPQAVNERLIRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGALL FL+  S  WNI+LF+YR HG   A VLVG+QVPS + ++F      L Y
Sbjct  428   EFPERPGALLSFLNGMSDNWNISLFHYRNHGADYARVLVGIQVPSTDDEQFSAFLARLAY  487

Query  396   EYAIETSE-AFQLLM  355
              Y IET   A+QL +
Sbjct  488   PYWIETQNLAYQLFL  502



>dbj|BAO31368.1| threonine dehydratase [Sulfuritalea hydrogenivorans sk43H]
Length=517

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE ++IGVE  DA+AM  SL  G+RV L+ VG FADG AVK VG
Sbjct  193   GGGLISGVAAYIKRLRPETRVIGVEAADADAMDRSLKAGKRVRLESVGLFADGAAVKYVG  252

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +C++ +D +V V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+A+ K + ++G+
Sbjct  253   QETFRLCQQYVDEMVLVDTDAICAAIKDVFEDTRSILEPAGALAVAGAKAWAKKHGVQGK  312

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A+VG QREA+L+  LPE+PGS+KKFV L+G  +ITEF 
Sbjct  313   TLVAVASGANMNFDRLRFVAERAEVGEQREAVLAVTLPEKPGSYKKFVSLIGSRSITEFN  372

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YR+     ++ V   + V  + E   +V ++  +    +DLTD+++ K H+RHL+GG   
Sbjct  373   YRFHDA-GEAHVFVGMQVANRGEATKLVAQLQKNGYPALDLTDDEMAKLHIRHLVGGHAP  431

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V++EL+ RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG++VP  E+ +
Sbjct  432   QVKNELIYRFEFPERPGALMHFLNKMSAGWNISLFHYRNHGADTGRVLVGMEVPPKEMKD  491

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+    +LGY +  ET + A++L +
Sbjct  492   FRAFLKNLGYRFWDETKNPAYRLFL  516



>ref|WP_028101573.1| threonine dehydratase [Pseudoduganella violaceinigra]
Length=510

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 224/322 (70%), Gaps = 7/322 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+A +VK + P++K+IGV+  D++AM  SL  GERV L  VG FADG AV++VG
Sbjct  182   GGGLIAGVATYVKQLRPDIKVIGVQTMDSDAMGRSLKAGERVTLSDVGLFADGTAVRLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCK-----YY  979
             EETF + ++ +D V+ V  DA+CA+IKD+F + R+ILEPSGAL++AGA+AY +      Y
Sbjct  242   EETFRLAKQFVDEVIVVDTDAICAAIKDVFTDTRSILEPSGALAVAGAKAYVERAEMGKY  301

Query  978   NLKGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
              + GE ++ V SGANMNFDRLR +AE A++G  REA+ +  +PE+ GSFK+F  LVGP N
Sbjct  302   PITGETLVTVCSGANMNFDRLRFVAERAELGESREAVFAVTIPEQRGSFKRFCSLVGPRN  361

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S  + Q+ V   V +  + E  A+  R   +D  T+DLT ++L K HLRHL+
Sbjct  362   VTEFNYRISD-KEQAHVFVGVQIADRSESSAIARRFEENDFRTLDLTHDELAKSHLRHLV  420

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+  + +DELL RF FPERPGAL+ FLD+  P+WNI+L +YR+ G     +L+GLQVP 
Sbjct  421   GGKSELAKDELLYRFEFPERPGALMRFLDSMEPEWNISLCHYRSQGGDVGRILIGLQVPP  480

Query  441   NEIDEFKQRANDLGYEYAIETS  376
              + ++F Q    LGY Y  E+ 
Sbjct  481   QDAEKFMQFLTTLGYRYWDESQ  502



>ref|WP_036238909.1| threonine dehydratase [Massilia sp. JS1662]
 gb|KGF79092.1| threonine dehydratase [Massilia sp. JS1662]
Length=510

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 226/322 (70%), Gaps = 7/322 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P++KIIGV+ +D++AMA SL  GERV L  VG FADG AV++VG
Sbjct  182   GGGLISGVAAYVKQIRPDIKIIGVQTNDSDAMARSLKAGERVTLTDVGLFADGTAVRLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNL---  973
              ETF +C+EL+D ++ V  DA+CA+IKD+F + R+I+EPSGAL+IAGA+AY +   +   
Sbjct  242   AETFRLCQELVDEIIIVDNDALCAAIKDVFTDTRSIVEPSGALAIAGAKAYVERSQMSKN  301

Query  972   --KGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
               +GE ++ V  GANMNFDRLR +AE A++G  REA+ +  +PE+ GSFK+F  L+GP N
Sbjct  302   PVRGETLVAVACGANMNFDRLRFVAERAELGEAREAVFAVTIPEQRGSFKRFCALIGPRN  361

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S  R ++ V   V + ++ E   +          T+DLT ++L K H+RHL+
Sbjct  362   VTEFNYRISDER-EAHVFVGVQIGSRSESGTVARTFEEHGFKTLDLTHDELAKQHVRHLV  420

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+  +  DELL RF FPERPGAL+ FLD  +P WNI+LF+YR  G     +LVGLQVPS
Sbjct  421   GGKSGLAHDELLYRFEFPERPGALMRFLDTLAPNWNISLFHYRNQGGDVGRILVGLQVPS  480

Query  441   NEIDEFKQRANDLGYEYAIETS  376
              E+DEF++    LGY +  E++
Sbjct  481   GEMDEFREFLATLGYRHWDESA  502



>ref|WP_009206812.1| threonine dehydratase [Sulfuricella denitrificans]
 ref|YP_008545274.1| threonine dehydratase [Sulfuricella denitrificans skB26]
 dbj|BAN34242.1| threonine dehydratase [Sulfuricella denitrificans skB26]
Length=503

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 218/315 (69%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK + PE+KIIGVEP DA+AM  SL   ERV L QVG FADGVAVK VGEETF +CREL
Sbjct  189   YVKRLKPEIKIIGVEPVDADAMYRSLKKKERVTLAQVGIFADGVAVKQVGEETFRLCREL  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R+ILEP+GALSIAGA+ Y     LK E ++ + SGAN
Sbjct  249   VDEVILVDTDAICAAIKDVFEDTRSILEPAGALSIAGAKLYATREKLKNETLVAIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A++G QREAILS  +PE+PGSFK F  L+G  NITEF YRYS   A +
Sbjct  309   MNFDRLRHVAERAELGEQREAILSVTIPEKPGSFKAFCALLGTRNITEFNYRYSDSSA-A  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              V   V    + E + ++  +    L  +D++DN++ K H+RH++GG     ++E+L RF
Sbjct  368   HVFVGVQAQNRGETEKLLTLLERKGLQPVDMSDNEMAKLHVRHMVGGHAPQAKNEILYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL++FLD+    WNI+LF+YR HG     VLVG+QVP  E   FK     LGY
Sbjct  428   EFPERPGALMKFLDSVGQSWNISLFHYRNHGADYGRVLVGVQVPPQEKPAFKAFLKRLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  E+ + A++L +
Sbjct  488   PYVDESKNPAYKLFL  502



>ref|WP_006510237.1| threonine ammonia-lyase, biosynthetic, long form [Xenococcus 
sp. PCC 7305]
 gb|ELS02674.1| threonine ammonia-lyase, biosynthetic, long form [Xenococcus 
sp. PCC 7305]
Length=502

 Score =   330 bits (846),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 231/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE+KIIGVEP D++AM+ SL  GERV L QVG FADGVAVK VG
Sbjct  179   GGGLISGVAAYIKRLRPEIKIIGVEPVDSDAMSQSLQKGERVKLPQVGLFADGVAVKHVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   + G+
Sbjct  239   AETFRLCQKYVDEIILVSTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREQVTGQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
               I V  GANMNFDRLR +AE A+ G +REAI +  +PEE GSF+KF   +G  N++EF 
Sbjct  299   TFISVACGANMNFDRLRFVAERAEFGERREAIFAVTIPEERGSFRKFCSCIGKHNLSEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  + Q+ +   V +  +++ + +V     +   TIDLTD++L K HLRH++GGR S
Sbjct  359   YRIAE-KKQAHIFVGVQIQNRVDAENIVATFEENGFKTIDLTDDELAKMHLRHMVGGRSS  417

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  +ELL RF FPERPGAL++FL++ SP WNI+LF+YR +G     + +G+QV  NE++E
Sbjct  418   LANNELLYRFEFPERPGALVDFLNSMSPNWNISLFHYRNNGSDYGRIAIGVQVAPNEMNE  477

Query  426   FKQRANDLGYEYAIE-TSEAFQLLM  355
             ++     LGY Y  E T+ A++L +
Sbjct  478   WQAFLETLGYPYWDESTNPAYKLFL  502



>ref|WP_004174842.1| Threonine dehydratase biosynthetic [Nitrosospira sp. APG3]
 emb|CCU61375.1| Threonine dehydratase biosynthetic [Nitrosospira sp. APG3]
Length=503

 Score =   330 bits (845),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 228/317 (72%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK ++PE+KIIGVEP DA++M  SL  G R+ L QVG FADGVAVK VG ETF +CR
Sbjct  187   AAYVKRLHPEIKIIGVEPVDADSMYRSLRAGRRIKLAQVGLFADGVAVKQVGVETFRLCR  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D ++ V  DA+CA+IKD+FE+ R +LEPSGALSIAGA+ Y K  N++ +N+I + SG
Sbjct  247   ELVDEIILVDTDAICAAIKDVFEDTRTVLEPSGALSIAGAKLYAKRENIRDKNLIAIASG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR I+E A++G QREA+++  +PE+PGSF+KF  ++G  +ITEF YRY+  + 
Sbjct  307   ANMNFDRLRHISERAELGEQREAVMAVTIPEQPGSFRKFCAMLGTKSITEFNYRYADPK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLC  583
             ++ V   VSV  + E   ++  +  S L T DLTDN++ K H+RHL+GGR   V++E L 
Sbjct  366   EAHVFVAVSVRNRDEAAKLIRSLERSGLRTEDLTDNEMAKLHIRHLVGGRARDVKNERLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FP+RPGAL++FL++   +WNI+LF+YR HG     VLVG++VP  E  EFK+    +
Sbjct  426   RFEFPDRPGALMKFLNSMGHRWNISLFHYRNHGADYGRVLVGMEVPPEEKAEFKEFLKRM  485

Query  402   GYEYAIETSE-AFQLLM  355
                Y  E+S  A++L +
Sbjct  486   ENHYWDESSNPAYKLFL  502



>ref|WP_029757055.1| threonine dehydratase [Oxalobacteraceae bacterium JGI 001010-B17]
Length=510

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 226/322 (70%), Gaps = 7/322 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P++KIIGV+ +D++AMA SL  GERV L  VG FADG AV++VG
Sbjct  182   GGGLISGVAAYVKQIRPDIKIIGVQTNDSDAMARSLKAGERVTLTDVGLFADGTAVRLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYY-----  979
              ETF +C++L+D ++ V  DA+CA+IKD+F + R+I+EPSGAL+IAGA+AY +       
Sbjct  242   AETFRLCQQLVDEIIIVDNDALCAAIKDVFTDTRSIVEPSGALAIAGAKAYVERSLMSKN  301

Query  978   NLKGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
              ++GE ++ V  GANMNFDRLR +AE A+VG  REA+ +  +PE+ GSFK+F  L+GP N
Sbjct  302   PVRGETLVAVACGANMNFDRLRFVAERAEVGEAREAVFAVTIPEQRGSFKRFCSLIGPRN  361

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S  R ++ V   V +  + E   +          T+DLT ++L K H+RHL+
Sbjct  362   VTEFNYRISDER-EAHVFVGVQIGNRSESSTVARTFEEHGFRTLDLTHDELAKQHVRHLV  420

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+  +  DELL RF FPERPGAL+ FLD+ +P WNI+LF+YR  G     ++VGLQVP+
Sbjct  421   GGKSGLAHDELLYRFEFPERPGALMRFLDSMAPNWNISLFHYRNQGGDVGRIVVGLQVPA  480

Query  441   NEIDEFKQRANDLGYEYAIETS  376
              E+DEF+Q    LGY +  E++
Sbjct  481   GEMDEFRQFLATLGYRHWDESA  502



>ref|WP_036301798.1| threonine dehydratase [Methylotenera sp. L2L1]
Length=503

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 223/315 (71%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+KIIGVE  DA AM  SLH G+RVMLDQVG FADG AVK VGE TF +C++ 
Sbjct  189   YVKAVRPEIKIIGVEARDAEAMTESLHKGQRVMLDQVGLFADGAAVKQVGEHTFALCQQY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+ AG +AY     L+G+ +I + SGAN
Sbjct  249   VDEMIVVDNDAICAAIKDVFEDTRSILEPAGALATAGLKAYAAREKLEGKTLIGIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR IAE A++G +REA+L+  +PE+PG+FK F  L+G  NITEF YRYS  + ++
Sbjct  309   MNFDRLRFIAERAELGEKREAVLAVTIPEKPGAFKAFCHLLGNRNITEFNYRYSDQK-EA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              +   V+V+   E   +V+ ++   L  +DL++N++ K HLRHL+GG     E E++ RF
Sbjct  368   HIFVGVAVNDPAESATLVKDLVAHGLPALDLSENEVAKLHLRHLVGGHAPQAEHEVVFRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGAL++FLD     WNI+LF+YR HG     VLVG+QVP NE+ EF    N+LGY
Sbjct  428   EFPEKPGALMKFLDTMGHDWNISLFHYRNHGADFGRVLVGMQVPPNELSEFSDFLNNLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  ET + A++L +
Sbjct  488   PYWEETQNPAYKLFL  502



>ref|WP_031595868.1| threonine dehydratase [Ferrovum myxofaciens]
Length=507

 Score =   328 bits (841),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 227/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+A  VK + PE++IIGV+P D++AM  SL  G RVMLDQVG FADGVAV+ VG
Sbjct  180   GGGLIAGVATLVKQLRPEIRIIGVQPQDSDAMRQSLAAGRRVMLDQVGLFADGVAVRQVG  239

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +C++ +D VV V  DA+CA++KD+F++ R +LEP+GAL++AG +   +    +G+
Sbjct  240   QETFRLCQKYVDEVVTVNTDALCAAVKDVFDDTRAVLEPAGALAVAGLKQVVQRAGWQGK  299

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ + SGAN+NFDRLR +AE A++G QREA+ +  +PE PGSF++F  L+G   +TEF 
Sbjct  300   SVVAIASGANLNFDRLRFVAERAELGEQREALFAATIPERPGSFRQFCTLLGSRAVTEFN  359

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  + Q+ V   VS+    EL  ++ R+    + T+DLT N++ K H+RHL+GG   
Sbjct  360   YRYADHQ-QAHVFVGVSLAQPDELPELLNRLQAQGIRTLDLTHNEMAKLHIRHLVGGHAP  418

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               E E+L RF FPERPGAL  FLD  S  WNI+LF+YR HG     VLVGLQVP ++ + 
Sbjct  419   QAEHEILYRFEFPERPGALACFLDRLSAHWNISLFHYRNHGADYGRVLVGLQVPPSDQEA  478

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+   N LGY +  ET + A+QL +
Sbjct  479   FQNFLNILGYPWVDETRNPAYQLFL  503



>ref|WP_018507057.1| L-threonine dehydratase biosynthetic IlvA [Thiobacillus thioparus]
Length=505

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 229/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE+KI+GVEP DA+AMA SL  GER+ L +VG FADGVAVK VG
Sbjct  181   GGGLIAGMAAYIKRLRPEIKIVGVEPEDADAMARSLCKGERITLPRVGIFADGVAVKKVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF + +  +D ++ V  DA+CA+IKD+FE+ R+ILEP+GALSIAG +A      LKG+
Sbjct  241   KETFRLAQLYVDEIIRVNNDAICAAIKDVFEDTRSILEPAGALSIAGMKAAIAADRLKGK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR IAE A++G +REA+L+  +PE PGSFK F  L+G  NITEF 
Sbjct  301   TLVAVASGANMNFDRLRYIAERAELGEKREAVLAVTIPETPGSFKTFCGLLGARNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRYS  +  + V   +SV    E   +V+ +    L  +DLTDN++ K H+RHL+GGR  
Sbjct  361   YRYSDPKI-ARVFVGLSVPGAGESARVVDLLQRHGLEALDLTDNEMAKLHIRHLVGGRAP  419

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
                +E+L RF FPERPGAL++FL + S  WNI+LF+YR HG     VLVG+QVP  E   
Sbjct  420   EAVNEVLYRFEFPERPGALMQFLQSMSRGWNISLFHYRNHGADYGRVLVGIQVPEKEKPR  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F++  ++LGY Y  E+ + A+ L +
Sbjct  480   FQKFLDELGYRYWDESRNPAYTLFL  504



>gb|EXI92889.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. BA-94]
Length=503

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 231/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+GIAA+VK + P  +I+GVE  DA+AMA SL  G+RV L+ VG FADG AVK VG
Sbjct  179   GGGLISGIAAYVKRLRPSTRIVGVEAVDADAMARSLRAGKRVRLEHVGLFADGAAVKYVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+ Y   + L+G+
Sbjct  239   EETFRLCQTYVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGAKEYAGRHRLQGK  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I   SGAN+NFDRLR +AE A++G QREA+ +  LPE PG++K+FV L+G  +ITEF 
Sbjct  299   TLIATASGANINFDRLRFVAERAEIGEQREAVFAVTLPERPGAYKQFVALIGARSITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  RA + V   + V ++ E   +++ +      T+DLTD+++ K H+RHL+GG   
Sbjct  359   YRYNDQRA-AQVFVGIQVASRAESVRLLQHLRKHGYPTLDLTDDEMAKGHIRHLVGGHSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             ++ +E++ RF FPERPGAL+ FL+  S  WNI+LF+YR HG      LVG+QVP +E+ +
Sbjct  418   AISNEIVYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRALVGMQVPPDEMGD  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+Q    LGY +  ET ++A++L +
Sbjct  478   FRQFLRTLGYAHWDETGNQAYRLFL  502



>ref|WP_019899841.1| L-threonine dehydratase biosynthetic IlvA [Methylotenera mobilis]
Length=503

 Score =   327 bits (838),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 222/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+KIIGVE  DA AM  SLH G RVMLDQVG FADG AVK VGE TF +C++ 
Sbjct  189   YVKAVRPEIKIIGVEARDAEAMTESLHKGHRVMLDQVGLFADGAAVKQVGEHTFALCQQY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+ AG +AY     L+G+ +I + SGAN
Sbjct  249   VDEMIVVDNDAICAAIKDVFEDTRSILEPAGALATAGLKAYAAREKLEGKTLIGIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR IAE A++G +REA+L+  +PE+PG+FK F  L+G  NITEF YRYS  + ++
Sbjct  309   MNFDRLRFIAERAELGEKREAVLAVTIPEKPGAFKAFCHLLGNRNITEFNYRYSDQK-EA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              +   V+V+   E   +V+ +    L  +DL++N++ K HLRHL+GG     E+E++ RF
Sbjct  368   HIFVGVAVNDPTESAQLVKDLEAKGLPALDLSENEVAKLHLRHLVGGHAPQAENEVVFRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGAL++FLD     WNI+LF+YR HG     VLVG+QVP NE+ EF    N+LGY
Sbjct  428   EFPEKPGALMKFLDTMGHDWNISLFHYRNHGADFGRVLVGMQVPPNELSEFSDFLNNLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  ET + A++L +
Sbjct  488   PYWDETQNPAYKLFL  502



>ref|WP_025040540.1| threonine dehydratase [Nitrosospira briensis]
Length=503

 Score =   327 bits (837),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             A++VK + PE+KIIGVEP DA++M  SL    RV L QVG FADGVAVK VG ETF +CR
Sbjct  187   ASYVKRLYPEIKIIGVEPTDADSMYQSLKKKRRVRLAQVGLFADGVAVKQVGGETFRLCR  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D ++ V  DA+CA+IKD+FE+ R ILEPSGALS+AGA+AY K   ++G+++I + SG
Sbjct  247   ELVDEIILVDTDAICAAIKDVFEDTRAILEPSGALSVAGAKAYAKREKIRGKDLIAIASG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR ++E A++G QREA+++  +PEEPGSF+KF  ++G  +ITEF YRY+  + 
Sbjct  307   ANMNFDRLRHVSERAELGEQREAVMAVTIPEEPGSFRKFCAMLGTKSITEFNYRYADPK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLC  583
             ++ V   VSV  + E   ++  +  S L T DL+DN++ K H+RHL+GGR   +++ELL 
Sbjct  366   EAHVFVAVSVRNRDEAAKLIRSLERSGLRTEDLSDNEMAKLHVRHLVGGRAREIKNELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FP+RPGAL+ FL++    WNI+LF+YR HG     VLVG++VP  E DEF+     L
Sbjct  426   RFEFPDRPGALMRFLNSMGRHWNISLFHYRNHGADYGRVLVGMEVPPEERDEFEAFLKQL  485

Query  402   GYEYAIET-SEAFQLLM  355
                Y  E+ + A++L +
Sbjct  486   DNHYWDESENPAYKLFL  502



>ref|WP_018078119.1| L-threonine dehydratase biosynthetic IlvA [Thiobacillus denitrificans]
Length=505

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 229/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + PE++I+GVEP DA+AMA SL  G+R+ L +VG FADGVAVK VG
Sbjct  181   GGGLIAGMAAYIKRLRPEIRIVGVEPEDADAMARSLCKGKRITLPRVGIFADGVAVKRVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF + +  +D ++ V  DA+CA+IKD+FE+ R+ILEP+GALS+AG +A      LKG+
Sbjct  241   KETFRLSQLYVDEIIRVNNDAICAAIKDVFEDTRSILEPAGALSVAGLKAAIAGDKLKGK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR IAE A++G +REA+L+  +PE PGSFK F  L+G  NITEF 
Sbjct  301   TLVAVASGANMNFDRLRHIAERAELGEKREAVLAVTIPETPGSFKTFCGLLGARNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRYS  R  + V   +SV    E   +VE +    L  IDLTDN++ K H+RHL+GGR  
Sbjct  361   YRYSDPRT-ARVFVGLSVPGAGEGARVVELLQRHGLEAIDLTDNEMAKLHIRHLVGGRAP  419

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
                +E+L RF FPERPGAL++FL + S  WNI+LF+YR HG     VLVG+QVP  E   
Sbjct  420   EAVNEVLYRFEFPERPGALMQFLQSMSRGWNISLFHYRNHGADYGRVLVGIQVPEKEKPG  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F++  + LGY Y  E+ + A++L +
Sbjct  480   FQKFLDRLGYRYWDESRNPAYKLFL  504



>gb|KDV24669.1| threonine dehydratase, partial [Burkholderia cepacia JBK9]
Length=393

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  69    GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  128

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  129   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  188

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  189   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  248

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  249   YRIADAQS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  307

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  308   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  367

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  368   FERFLAALGYPYVEESANPAYRLFLS  393



>ref|WP_013967187.1| threonine dehydratase [Nitrosomonas sp. Is79A3]
 ref|YP_004696376.1| threonine dehydratase, biosynthetic [Nitrosomonas sp. Is79A3]
 gb|AEJ02977.1| threonine dehydratase, biosynthetic [Nitrosomonas sp. Is79A3]
Length=503

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 223/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + P++KIIGVEP D++AM  SL  G RV L QVG FADGVAV+ VG+ETF +CR
Sbjct  187   AAYVKRLYPKIKIIGVEPVDSDAMYRSLQSGRRVKLAQVGLFADGVAVRHVGKETFRLCR  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D V+ V  DA+CA++KD+FE+ R ILEPSGALS+AG +AY     +  + ++ + SG
Sbjct  247   ELVDEVILVDTDAICAAVKDVFEDTRTILEPSGALSVAGIKAYVAREKILHKTLVAIASG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR I+E A++G +REA+L+  +PE+PGSFKKF  L+G  +ITEF YRY++ + 
Sbjct  307   ANMNFDRLRHISERAEIGERREAVLTVTIPEKPGSFKKFCNLLGAKSITEFNYRYANPKV  366

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLC  583
              + V   VSV  + E   ++  +  S L T D++DN++ K H+RHL+GG    V++E+L 
Sbjct  367   -AHVFVGVSVRNQEETQKLISELKQSGLATEDMSDNEMAKLHIRHLVGGHAHDVKNEILY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FP+RPGAL+ FL+  S  WNI+LF+YR HG     VL+G+QVP  E  +FK   N L
Sbjct  426   RFEFPDRPGALMNFLNNLSHNWNISLFHYRNHGADYGRVLIGIQVPPEERSDFKAFLNQL  485

Query  402   GYEYAIETSE-AFQLLM  355
             GY Y  ET   A++L +
Sbjct  486   GYHYWDETKNPAYKLFL  502



>ref|WP_013646424.1| threonine dehydratase, biosynthetic [Nitrosomonas sp. AL212]
 ref|YP_004293519.1| threonine dehydratase, biosynthetic [Nitrosomonas sp. AL212]
 gb|ADZ25357.1| threonine dehydratase, biosynthetic [Nitrosomonas sp. AL212]
Length=503

 Score =   325 bits (834),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 222/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK + P++KIIGVEP DA+AM  SL  G RV L QVG FADGVAV+ VG+ETF +CREL
Sbjct  189   YVKRLYPKIKIIGVEPVDADAMYRSLQSGRRVKLAQVGLFADGVAVRYVGKETFRLCREL  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R I+EPSGALSIAG + Y     +  + ++ + SGAN
Sbjct  249   VDEVILVDTDAICAAIKDVFEDTRTIMEPSGALSIAGIKVYAAREKITHKTMVAIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR I+E A++G QREA++S  +PE+PGSFKKF  L+G  +ITEF YRY+  +  +
Sbjct  309   MNFDRLRHISERAEIGEQREAVMSVTIPEQPGSFKKFCNLLGAKSITEFNYRYADPKV-A  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              +   VSV  + E   +++ +  S L T DL+ N++ K H+RHL+GGR   V++E+L RF
Sbjct  368   HIFVGVSVRNQEETRKLIDELKQSGLATEDLSANEMAKLHIRHLVGGRAREVKNEILYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FP+RPGAL+ FL++ S  WNI+LF+YR HG     VL+G+QVP  E  +FK   + LGY
Sbjct  428   EFPDRPGALMNFLNSMSHNWNISLFHYRNHGADYGRVLIGIQVPPEEKTDFKTFLDQLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  ET + A++L +
Sbjct  488   RYWDETRNPAYKLFL  502



>ref|WP_034942689.1| threonine dehydratase [Candidatus Accumulibacter sp. SK-12]
 gb|EXI64382.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Accumulibacter 
sp. SK-12]
Length=503

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/325 (49%), Positives = 230/325 (71%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P  +I+GVE  DA+AMA SL  G+RV L+ VG FADG AVK VG
Sbjct  179   GGGLISGVAAYVKRLRPATRIVGVEAVDADAMARSLRAGKRVRLEHVGLFADGAAVKYVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+ Y   + L+G 
Sbjct  239   EETFRLCQTHVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGAKEYAARHRLQGR  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++   SGAN+NFDRLR +AE A++G QREA+ +  LPE PG++K+FV L+G  +ITEF 
Sbjct  299   TLVATASGANINFDRLRFVAERAEIGEQREAVFAVTLPERPGAYKQFVALIGARSITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  R ++ V   + V ++ E   +++ +      T+DLTD+++ K H+RHL+GG   
Sbjct  359   YRYNDQR-EAHVFVGIQVASRAESVRLLQHLRKHGYPTLDLTDDEVAKGHIRHLVGGHSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             ++ +E++ RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP +E+ +
Sbjct  418   AISNEIVYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRVLVGMQVPPDEMGD  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+Q    LGY +  ET + A++L +
Sbjct  478   FRQFLRTLGYAHWDETGNHAYRLFL  502



>ref|WP_017305017.1| L-threonine dehydratase biosynthetic IlvA [Spirulina subsalsa]
Length=503

 Score =   324 bits (831),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 229/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + PE+KIIGVEP D++AM  SL  GERV L QVG FADGVAV+ VG
Sbjct  179   GGGLISGVAAYVKRLRPEIKIIGVEPLDSDAMYQSLKAGERVRLPQVGLFADGVAVRQVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF +C++ +D +V VG D  CA+IKDMFE+ R+I+EP+GAL+IAGA+AY +   ++ +
Sbjct  239   AETFRLCQQYVDDIVRVGTDDTCAAIKDMFEDTRSIVEPAGALAIAGAKAYVEQTGIEHQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I +  GANMNFDRLR +AE A++G QREAI +  +PE+PGS ++F + +G  N+TEF 
Sbjct  299   TLIAIACGANMNFDRLRFVAERAELGEQREAIFAVTIPEKPGSLRQFCDCLGKRNLTEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  + ++ +   V V  + +   +VE      L T+DLTD++L K HLRH++GG+  
Sbjct  359   YRIAD-QTEAHIFVGVQVENRADAAKLVESFESFGLKTLDLTDDELTKLHLRHMVGGKSP  417

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +   ELL RF FPERPGAL++F+ + SP WNI+LF+YR +G     +LVG+QVP +E+ +
Sbjct  418   LAHHELLYRFEFPERPGALMKFVASMSPDWNISLFHYRNNGSDYGRILVGMQVPPHEMTQ  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             ++     LGY Y  E  + A+ L +
Sbjct  478   WRAFLETLGYRYWDENDNPAYHLFL  502



>ref|WP_009522955.1| threonine dehydratase [Ralstonia sp. PBA]
 gb|EIZ03202.1| threonine dehydratase [Ralstonia sp. PBA]
Length=506

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 221/316 (70%), Gaps = 2/316 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K V PEVK+IGV+  D++AM  S   G+RV L  VG F+DG AVK+ G
Sbjct  182   GGGLIAGVAAYIKAVRPEVKVIGVQTVDSDAMKRSKDAGKRVELKDVGLFSDGTAVKLAG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF + REL+D +V V  DA+CA+IKD+F++ R+ILEP+GAL++AG +AY +   LK +
Sbjct  242   KETFRLVRELVDEIVLVDTDAICAAIKDVFQDTRSILEPAGALAVAGLKAYAEREKLKNQ  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGANMNFDRLR +AE ADVG  REA+ +  +PEE GSFK+F ELVG   +TEF 
Sbjct  302   QLVAIASGANMNFDRLRFVAERADVGESREAVFAVTIPEERGSFKRFCELVGNRAVTEFN  361

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +AQ+ +   + + ++ E D +          T+DL+ ++L K H+R+++GG   
Sbjct  362   YRIAD-KAQAHIFVGLQIASRAESDKIAAAFRKQGFATLDLSQDELAKQHIRYMVGGHSP  420

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             + +DELL RF FPERPGAL+ FL +  P WNI+LF+YR  G   +N+LVG+QVP N+   
Sbjct  421   LAQDELLYRFEFPERPGALMRFLSSMHPNWNISLFHYRNQGADTSNILVGIQVPKNDKRA  480

Query  426   FKQRANDLGYEYAIET  379
             F++  + LGY Y  E+
Sbjct  481   FREFLSSLGYHYVDES  496



>ref|WP_028451783.1| threonine dehydratase [Chitinilyticum aquatile]
Length=504

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 229/315 (73%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PEVKIIGVEP DANAM LSL  G+RV L QVG FADGVAVK VGEETF +CR+L
Sbjct  189   YIKSLRPEVKIIGVEPTDANAMYLSLKLGDRVNLPQVGIFADGVAVKQVGEETFRLCRDL  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DAMCA+IKD+FE+ R+ILEP+GAL+IAGA+A+     ++G+ ++ + SGAN
Sbjct  249   VDDVILVDTDAMCAAIKDVFEDTRSILEPAGALAIAGAKAWAAREGVQGKTLVAIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A++G QREAI++  +PE+PGSFK F EL+G  NITEF YRYSS  A +
Sbjct  309   MNFDRLRYVAEQAEMGEQREAIIAVTIPEKPGSFKTFCELLGARNITEFNYRYSSAEA-A  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              V   +SV  + E+  ++E++  + L  IDL+DN+L K H+RHL+GGR   V  E L RF
Sbjct  368   HVFVGLSVQNRHEIVDLIEKLANAGLAAIDLSDNELAKLHIRHLVGGRAPQVTHERLLRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FL+  +  WNI+LF+YR HG     VLVG+QVP ++  +F +    +GY
Sbjct  428   EFPERPGALMGFLNGMNGGWNISLFHYRNHGADYGRVLVGIQVPESDDAQFAEFLQLMGY  487

Query  396   EYAIE-TSEAFQLLM  355
              +  E T+ A+QL +
Sbjct  488   PWWEESTNPAYQLFL  502



>ref|WP_028499919.1| threonine dehydratase [Microvirgula aerodenitrificans]
Length=510

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 220/320 (69%), Gaps = 2/320 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + P++K+IGV+  D+++MA S+  G RV L  VG F+DG AVK+ GEETF +CRE 
Sbjct  190   YIKRLRPDIKVIGVQTFDSDSMARSISVGHRVELKDVGLFSDGTAVKLAGEETFRLCREF  249

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FEE R+ILEP+GALS+AG +AY +   L G+ +I V SGAN
Sbjct  250   LDEVILVDTDAICAAIKDVFEETRSILEPAGALSVAGLKAYVEREQLAGQTLIAVASGAN  309

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR ++E +++G QREA+L+  +PE PGSFKKF+ LVG  NITEF YRY   +  +
Sbjct  310   MNFDRLRHVSERSELGEQREAVLAVTIPETPGSFKKFISLVGRRNITEFNYRYGDAKT-A  368

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              V   + V  + ++ A+V  +  S L  +DLTDN+L K H+RHL+GG     DE + RF 
Sbjct  369   HVFVGIQVEKRGDVAAIVSELAASGLEALDLTDNELAKLHIRHLVGGHAPAADERVFRFE  428

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL+ FL A    WNI+LF+YR HG     VLVG+QV +N+   F +   +LGY 
Sbjct  429   FPERPGALMRFLSAMRTDWNISLFHYRNHGTDYGRVLVGVQVAANDHAAFNRFLFELGYA  488

Query  393   YAIET-SEAFQLLMN*LNRS  337
             Y  ET + A++L +  L RS
Sbjct  489   YVDETENPAYKLFLGKLERS  508



>gb|ETW99107.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Entotheonella 
sp. TSY1]
Length=531

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 231/331 (70%), Gaps = 3/331 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL++GIA++VK + P++K+IGVEP D+  M  +L  G+R+ L QVG FADGVAVK+ G
Sbjct  195   GGGLMSGIASYVKRLRPDIKMIGVEPVDSATMYHALQQGQRIELPQVGLFADGVAVKMAG  254

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +CREL+D ++ V  DA+CA+IKD+FE+ R+ILEP+GALSIAG + Y   + L+ +
Sbjct  255   DETFRLCRELVDEIILVDNDAICAAIKDVFEDTRSILEPAGALSIAGVKDYIAAHKLRDQ  314

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR ++E A++G  REAIL+  +PE PGSF+ F  L+G  N+TEF 
Sbjct  315   TLVAVASGANMNFDRLRHVSERAELGESREAILAVTIPERPGSFRAFCALLGTRNVTEFN  374

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+    ++ V   V+V ++ E  A++E +    L ++DL+ N++ K H+RH++GG   
Sbjct  375   YRYADTE-EAHVFVGVTVDSREETRALIELLEQHGLRSLDLSYNEMAKLHIRHMVGGHAP  433

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               + E L RF FPERPGAL+ FL++ SP WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  434   HAKYEQLYRFEFPERPGALMAFLNSMSPNWNISLFHYRNHGSDPGRVLVGIQVPPEDHLA  493

Query  426   FKQRANDLGYEYAIET-SEAFQLLMN*LNRS  337
             F+   + +GY Y  E+ + A+ L ++   RS
Sbjct  494   FQTFLDKIGYVYCDESQNPAYHLFVDAAARS  524



>ref|WP_027785407.1| threonine dehydratase [Burkholderia cepacia]
Length=507

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQS-AHIFVGVQIRRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_027810296.1| threonine dehydratase [Burkholderia cenocepacia]
Length=507

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GERV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_011634235.1| threonine dehydratase [Nitrosomonas eutropha]
 ref|YP_747380.1| threonine dehydratase [Nitrosomonas eutropha C91]
 gb|ABI59415.1| L-threonine ammonia-lyase [Nitrosomonas eutropha C91]
Length=503

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 225/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + P+++IIGVEP D+NAM  SL  G  V L QVG FADGVAV+ VG+ETF +CR
Sbjct  187   AAYVKRLRPDIRIIGVEPTDSNAMYRSLQAGYCVELSQVGLFADGVAVRQVGQETFRLCR  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D ++ V  DA+CA+IKD+FE+ R+I+EPSGALS+AG + Y K  NL  E +I + SG
Sbjct  247   ELVDDILLVDSDAICAAIKDIFEDTRSIVEPSGALSVAGLKVYAKQNNLLHETLIAIASG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR ++E A++G QREAIL+  +PE+PGSFK+F  LVG  NITEF YRY+  + 
Sbjct  307   ANMNFDRLRHVSERAELGEQREAILAVTIPEKPGSFKQFCNLVGARNITEFNYRYADPQ-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLC  583
             ++ V   +SV  + E   +++ +  ++L   D+TDN++ K H+RH++GG    V  E+L 
Sbjct  366   KAHVFVGISVRNREEALNLIQILHANNLRAEDMTDNEMAKLHIRHMVGGHSREVSHEVLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FP+RPGAL+ FL+  S +WNI+LF+YR HG     VL+G+QV   + DEF    +DL
Sbjct  426   RFEFPDRPGALMNFLNKMSDRWNISLFHYRNHGADFGRVLIGIQVLPQDKDEFMHFLDDL  485

Query  402   GYEYAIETSE-AFQLLM  355
             GYE+  E++  A+Q  +
Sbjct  486   GYEFDDESNNPAYQFFL  502



>ref|XP_005706433.1| threonine dehydratase [Galdieria sulphuraria]
 gb|EME29913.1| threonine dehydratase [Galdieria sulphuraria]
Length=606

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 226/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAGI++ +K + PEVK+IGVEP D++AM  SL  GERV+L QVG FADGVAVK VG
Sbjct  277   GGGLIAGISSVLKRLRPEVKVIGVEPVDSDAMKQSLEVGERVILKQVGVFADGVAVKQVG  336

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++ +D ++ V  D +CA+IKD+FE+ R+ILEP+GALSIAG ++Y         
Sbjct  337   EETFRLCQKYVDEIILVDTDEICAAIKDVFEDTRSILEPAGALSIAGLKSYVDRQKCSDM  396

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N+I + SGANMNFDRLR ++E A++G  REA+ +  +PEEPGSF+K ++++G  ++TEF 
Sbjct  397   NLIAIASGANMNFDRLRYVSERAEIGEYREAVFAVTIPEEPGSFRKLIQVIGDCSVTEFN  456

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY +G  ++ V   + +  K      ++R   +    ++L++N++ K HLRHL+GG+ +
Sbjct  457   YRY-AGPPEAHVFVGLGISDKEGAQQALKRFHDAGYKALNLSENEVAKLHLRHLVGGKAN  515

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              + DEL+ RF FPERPGALL+FL A  P WNI LF+YR HG     VLVGLQVPS E DE
Sbjct  516   GLTDELIFRFEFPERPGALLKFLMALRPDWNICLFHYRNHGTDVGRVLVGLQVPSKERDE  575

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
              K     LGY    ET   A++L +
Sbjct  576   LKDSIESLGYAAVEETDNVAYRLFL  600



>ref|WP_013440989.1| threonine dehydratase, biosynthetic [Methylovorus sp. MP688]
 ref|YP_004038599.1| threonine dehydratase, biosynthetic [Methylovorus sp. MP688]
 gb|ADQ83363.1| threonine dehydratase, biosynthetic [Methylovorus sp. MP688]
Length=503

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 219/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+KIIGVE  DANAM LSL  G+RVMLDQVG FADG AVK VGEETF + RE 
Sbjct  189   YVKQVRPEIKIIGVEASDANAMQLSLDQGQRVMLDQVGLFADGAAVKQVGEETFRLAREY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+ AG + Y K + L+G+ +I + SGAN
Sbjct  249   VDEMILVDNDAICAAIKDVFEDTRSILEPAGALATAGLKEYAKRHQLQGKTLIGIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             +NFDRLR +AE A++G +REA+L+  +PE+PGSFK F  L+G  +ITEF YRYS  +A  
Sbjct  309   INFDRLRFVAERAEIGEKREAVLAVTIPEKPGSFKTFCRLLGGRSITEFNYRYSDPQAAH  368

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
             + +  +++    E  A+VE +    L T+DLTDN++ K HLRHL+GG     + E + RF
Sbjct  369   IYV-GIAIQDPAESRALVEMLQAHGLATLDLTDNEVAKLHLRHLVGGHAPQAKHECVYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGAL+ FLD     WNI+LF+YR HG     VLVG+QVP  +   F     +LGY
Sbjct  428   EFPEKPGALMNFLDTMGHNWNISLFHYRNHGADFGRVLVGMQVPPEDQQAFADFLQNLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  E+ + A++L +
Sbjct  488   PYWNESHNPAYELFL  502



>ref|WP_034208369.1| threonine dehydratase [Burkholderia cepacia]
 gb|KGC04509.1| threonine ammonia-lyase, biosynthetic [Burkholderia cepacia]
Length=507

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA S+  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSIDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CREL+DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++  
Sbjct  243   EETFRLCRELLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENR  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQS-AHIFVGVQIRRRDESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_011546192.1| threonine dehydratase [Burkholderia cenocepacia]
 ref|YP_621998.1| threonine dehydratase [Burkholderia cenocepacia AU 1054]
 gb|ABF77025.1| L-threonine ammonia-lyase [Burkholderia cenocepacia AU 1054]
 gb|KGY44831.1| threonine dehydratase [Burkholderia cepacia]
Length=507

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_015829182.1| threonine dehydratase [Methylovorus glucosotrophus]
 ref|YP_003049939.1| threonine dehydratase [Methylovorus glucosetrophus SIP3-4]
 gb|ACT49412.1| threonine dehydratase, biosynthetic [Methylovorus glucosetrophus 
SIP3-4]
Length=503

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 219/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+KIIGVE  DANAM LSL  G+RVMLDQVG FADG AVK VGEETF + RE 
Sbjct  189   YVKQVRPEIKIIGVEASDANAMQLSLDQGQRVMLDQVGLFADGAAVKQVGEETFRLAREY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+ AG + Y K + L+G+ +I + SGAN
Sbjct  249   VDEMILVDNDAICAAIKDVFEDTRSILEPAGALATAGLKEYAKRHQLQGKTLIGIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             +NFDRLR +AE A++G +REA+L+  +PE+PGSFK F  L+G  +ITEF YRYS  +A  
Sbjct  309   INFDRLRFVAERAEIGEKREAVLAVTIPEKPGSFKTFCRLLGGRSITEFNYRYSDPQAAH  368

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
             + +  +++    E  A+VE +    L T+DLTDN++ K HLRHL+GG     + E + RF
Sbjct  369   IYV-GIAIQDPAESRALVEMLQAHGLATLDLTDNEVAKLHLRHLVGGHAPQAKHECVYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGAL+ FLD     WNI+LF+YR HG     VLVG+QVP  +   F     +LGY
Sbjct  428   EFPEKPGALMNFLDTMGHNWNISLFHYRNHGADFGRVLVGMQVPPEDQQAFTDFLQNLGY  487

Query  396   EYAIET-SEAFQLLM  355
              Y  E+ + A++L +
Sbjct  488   PYWNESHNPAYELFL  502



>ref|WP_006477833.1| Threonine dehydratase [Burkholderia cenocepacia]
 gb|EAY63724.1| Threonine dehydratase [Burkholderia cenocepacia PC184]
 gb|ESS37778.1| Threonine dehydratase biosynthetic [Burkholderia cenocepacia 
KC-01]
Length=507

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_012329211.1| threonine dehydratase [Burkholderia cenocepacia]
 ref|YP_001766045.1| threonine dehydratase [Burkholderia cenocepacia MC0-3]
 gb|ACA91923.1| threonine dehydratase, biosynthetic [Burkholderia cenocepacia 
MC0-3]
Length=507

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_027806087.1| threonine dehydratase [Burkholderia cenocepacia]
Length=507

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_011694396.1| threonine dehydratase [Burkholderia cenocepacia]
 ref|YP_836379.1| threonine dehydratase [Burkholderia cenocepacia HI2424]
 gb|ABK09486.1| L-threonine ammonia-lyase [Burkholderia cenocepacia HI2424]
Length=507

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 230/326 (71%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_031293175.1| threonine dehydratase [Leptolyngbya sp. Heron Island J]
Length=506

 Score =   323 bits (827),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM  SL  G+RV L QVG FADGVAV  VGEETF +C+
Sbjct  187   AAYVKRLRPEIKIIGVEPKDADAMYQSLKLGQRVKLSQVGLFADGVAVSQVGEETFWLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ VG D  CA+IKD+FE+ R+I+EP+GAL+IAGA+AY K   +K E ++ V  G
Sbjct  247   QYVDDIIRVGTDDTCAAIKDVFEDTRSIVEPAGALAIAGAKAYVKQTGIKDETLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A++G QREAI +  +PE+PGS K+F E +G  N+TEF YR +  +A
Sbjct  307   ANMNFDRLRFVAERAELGEQREAIFAVTIPEQPGSLKRFCEQIGKRNLTEFNYRIAD-QA  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +  AM ++   +   T+DLTD++L K HLRH++GG  ++ ++E L 
Sbjct  366   EAHIFVGLEICDRDDAIAMKDQFEANGFKTLDLTDDELTKMHLRHMVGGHSALAKNERLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVPS E+DE++     L
Sbjct  426   RFEFPERPGALMKFVSSISPNWNISLFHYRNNGSDYGRIVVGMQVPSEEMDEWQAFLETL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E  + A+QL +
Sbjct  486   GYRYWEENDNPAYQLFL  502



>ref|WP_039360117.1| threonine dehydratase [Mumia flava]
 gb|KHL11867.1| threonine dehydratase [Mumia flava]
Length=507

 Score =   322 bits (826),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLEAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          T+DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQA-AHIFVGVQIKRRGESAEIAANFESHGFQTVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADHAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_012696459.1| threonine dehydratase [Laribacter hongkongensis]
 ref|YP_002794977.1| threonine dehydratase [Laribacter hongkongensis HLHK9]
 gb|ACO73968.1| IlvA [Laribacter hongkongensis HLHK9]
Length=507

 Score =   322 bits (826),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 223/314 (71%), Gaps = 2/314 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + P+V++IGV+  D++AMA S+  G+RV L  VG F+DG AVK+VGEETF +CREL
Sbjct  189   YIKRLKPQVRVIGVQTADSDAMARSIAAGQRVELKDVGLFSDGTAVKLVGEETFRLCREL  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R+ILEP+GAL++AG +AY +   L G+ ++ V SGAN
Sbjct  249   LDEVILVDTDAICAAIKDVFEDTRSILEPAGALALAGLKAYVEREQLGGQTLVAVASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR ++E +++G +REAIL+  +PE+PGSFKKF+ L+G  NITEF YRY   R ++
Sbjct  309   MNFDRLRHVSERSELGERREAILAVTIPEQPGSFKKFIALLGNRNITEFNYRYGDAR-EA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              V   +    +  +  +++ + +S LH IDLTDN+L K H+RHL+GG     +E + RF 
Sbjct  368   HVFVGMQTEKRDVMAGILQELAVSGLHGIDLTDNELAKLHVRHLMGGHAPARNERVLRFE  427

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FL      WNI+LF+YR HG     VLVGLQVP ++  +F +  + LGY 
Sbjct  428   FPERPGALMKFLSTLHTDWNISLFHYRNHGADYGRVLVGLQVPDSDAGKFYESLDQLGYP  487

Query  393   YAIET-SEAFQLLM  355
             Y  ET + A++L +
Sbjct  488   YLDETDNPAYRLFL  501



>ref|WP_034418162.1| threonine dehydratase, partial [Candidatus Entotheonella sp. 
TSY1]
Length=503

 Score =   322 bits (825),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 228/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL++GIA++VK + P++K+IGVEP D+  M  +L  G+R+ L QVG FADGVAVK+ G
Sbjct  180   GGGLMSGIASYVKRLRPDIKMIGVEPVDSATMYHALQQGQRIELPQVGLFADGVAVKMAG  239

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF +CREL+D ++ V  DA+CA+IKD+FE+ R+ILEP+GALSIAG + Y   + L+ +
Sbjct  240   DETFRLCRELVDEIILVDNDAICAAIKDVFEDTRSILEPAGALSIAGVKDYIAAHKLRDQ  299

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR ++E A++G  REAIL+  +PE PGSF+ F  L+G  N+TEF 
Sbjct  300   TLVAVASGANMNFDRLRHVSERAELGESREAILAVTIPERPGSFRAFCALLGTRNVTEFN  359

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+    ++ V   V+V ++ E  A++E +    L ++DL+ N++ K H+RH++GG   
Sbjct  360   YRYADTE-EAHVFVGVTVDSREETRALIELLEQHGLRSLDLSYNEMAKLHIRHMVGGHAP  418

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
               + E L RF FPERPGAL+ FL++ SP WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  419   HAKYEQLYRFEFPERPGALMAFLNSMSPNWNISLFHYRNHGSDPGRVLVGIQVPPEDHLA  478

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+   + +GY Y  E+ + A+ L +
Sbjct  479   FQTFLDKIGYVYCDESQNPAYHLFV  503



>gb|ESA35477.1| l-threonine ammonia-lyase [Leptolyngbya sp. Heron Island J]
Length=509

 Score =   322 bits (826),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM  SL  G+RV L QVG FADGVAV  VGEETF +C+
Sbjct  190   AAYVKRLRPEIKIIGVEPKDADAMYQSLKLGQRVKLSQVGLFADGVAVSQVGEETFWLCQ  249

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ VG D  CA+IKD+FE+ R+I+EP+GAL+IAGA+AY K   +K E ++ V  G
Sbjct  250   QYVDDIIRVGTDDTCAAIKDVFEDTRSIVEPAGALAIAGAKAYVKQTGIKDETLVAVACG  309

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A++G QREAI +  +PE+PGS K+F E +G  N+TEF YR +  +A
Sbjct  310   ANMNFDRLRFVAERAELGEQREAIFAVTIPEQPGSLKRFCEQIGKRNLTEFNYRIAD-QA  368

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +  AM ++   +   T+DLTD++L K HLRH++GG  ++ ++E L 
Sbjct  369   EAHIFVGLEICDRDDAIAMKDQFEANGFKTLDLTDDELTKMHLRHMVGGHSALAKNERLY  428

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVPS E+DE++     L
Sbjct  429   RFEFPERPGALMKFVSSISPNWNISLFHYRNNGSDYGRIVVGMQVPSEEMDEWQAFLETL  488

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E  + A+QL +
Sbjct  489   GYRYWEENDNPAYQLFL  505



>ref|WP_029049573.1| threonine dehydratase [Cupriavidus sp. amp6]
Length=512

 Score =   322 bits (826),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 224/316 (71%), Gaps = 2/316 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE+K+IGV+  D++AM  S+  G+RV L +VG F+DG AVK+VG
Sbjct  188   GGGLISGVAAYIKAVRPEIKVIGVQTFDSDAMKRSVDAGKRVELKEVGLFSDGTAVKLVG  247

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF I REL+D ++ V  DA+CA +KD+F++ R+ILEP+GAL++AG +AY +   LKG+
Sbjct  248   KETFRITRELVDDIILVDTDAICAGVKDVFQDTRSILEPAGALAVAGLKAYAEREKLKGQ  307

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ +  GANMNFDRLR +AE A+VG  RE + +  +PEE GSFK+F ELVG  ++TEF 
Sbjct  308   HLVAIACGANMNFDRLRFVAERAEVGEAREGVFAVTIPEERGSFKRFCELVGTRSVTEFN  367

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +   + + +   V + ++ E D +          T+DL++++L K H+R+++GGR +
Sbjct  368   YRIAD-TSVAHIFVGVQIASRAENDKIAASFRKHGFDTLDLSNDELAKQHIRYMVGGRSA  426

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DELL RF FPERPGAL+ FL + SP WNI+LF+YR  G   +N+LVG+QVP NE   
Sbjct  427   LAHDELLYRFEFPERPGALMRFLSSMSPNWNISLFHYRNQGADTSNILVGIQVPKNEKRA  486

Query  426   FKQRANDLGYEYAIET  379
             F+   + LGY +  ET
Sbjct  487   FRAFLSTLGYVHWDET  502



>ref|WP_011886005.1| threonine dehydratase [Burkholderia vietnamiensis]
 ref|YP_001120668.1| threonine dehydratase [Burkholderia vietnamiensis G4]
 gb|ABO55833.1| L-threonine ammonia-lyase [Burkholderia vietnamiensis G4]
Length=507

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GERV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLQKGERVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEFLDGVVTVDTDALCAAIKDVFQDTRSVLEPSGALAVAGAKRYVEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  ++TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRSVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          T+DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIRRRGESAEIAANFDAHGFKTVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIET-SEAFQLLMN  352
             F++    LGY Y  E+ + A++L ++
Sbjct  482   FERFLAALGYPYVEESVNPAYRLFLS  507



>ref|WP_018008744.1| L-threonine dehydratase biosynthetic IlvA [Cupriavidus taiwanensis]
Length=512

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 224/316 (71%), Gaps = 2/316 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE+K+IGV+  D++AM  S+  G+R+ L +VG F+DG AV++VG
Sbjct  188   GGGLISGVAAYIKAVRPEIKVIGVQTVDSDAMKRSVDAGKRIELKEVGLFSDGTAVRLVG  247

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF I REL+D ++    DA+CA +KD+F++ R+ILEP+GAL++AG +AY +   LKGE
Sbjct  248   KETFRITRELVDDIILCDTDAICAGVKDVFQDTRSILEPAGALAVAGLKAYAEREKLKGE  307

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             +++ +  GANMNFDRLR +AE A+VG  RE + +  +PEE GSFK+F ELVG  N+TEF 
Sbjct  308   HLVAIACGANMNFDRLRFVAERAEVGEAREGVFAVTIPEERGSFKRFCELVGTRNVTEFN  367

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +   + + +   V + ++ E D +          T+DL++++L K H+R+++GGR +
Sbjct  368   YRIAD-TSMAHIFVGVQIASRAENDKIAASFRKHGFDTLDLSNDELAKQHIRYMVGGRSA  426

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DELL RF FPERPGAL++FL + SP WNI+LF+YR  G   +N+LVG+QVP NE   
Sbjct  427   LAHDELLYRFEFPERPGALMKFLSSMSPNWNISLFHYRNQGADTSNILVGIQVPKNEKRA  486

Query  426   FKQRANDLGYEYAIET  379
             F+   + LGY +  ET
Sbjct  487   FRAFLSTLGYVHWDET  502



>ref|WP_034179012.1| threonine dehydratase [Burkholderia pyrrocinia]
 gb|KFL55329.1| threonine dehydratase [Burkholderia pyrrocinia]
Length=507

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GERV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLKTGERVELTEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREYLDGVVTVDTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYTEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   ALVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQS-AHIFVGVQIRRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F+     LGY Y  E++  A++L ++
Sbjct  482   FEGFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_009343705.1| Threonine dehydratase I [Raphidiopsis brookii]
 gb|EFA72431.1| Threonine dehydratase I [Raphidiopsis brookii D9]
Length=503

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 224/316 (71%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             A+VK + PE+KIIGVEP DA+AM  SL  G RV L QVG FADGVAVK VGEETF +C+E
Sbjct  188   AYVKRLRPEIKIIGVEPVDADAMYQSLKAGHRVRLPQVGLFADGVAVKEVGEETFRLCQE  247

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
              +D ++ V  DA CA+IKD+FE+ R+ILEP+GALSIA A+ Y +   ++G+ ++ V  GA
Sbjct  248   YVDEIMLVDTDATCAAIKDVFEDTRSILEPAGALSIAAAKYYAEREQIQGKTLVSVACGA  307

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR +AE A+ G +REAI + N+PE+PGS K+F E +G  N+TEF YR +  R +
Sbjct  308   NMNFDRLRFVAERAEFGERREAIFAVNIPEKPGSLKQFCECLGDRNLTEFNYRIADDR-E  366

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLCR  580
             + +   V +  + +   +V++  L  L TIDLTD++L K HLRH++GG  S+   ELL R
Sbjct  367   AHIFVGVQIENRADAAKIVDKFELHGLKTIDLTDDELTKLHLRHMVGGHSSLAHHELLYR  426

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVP  E+ E+++  + LG
Sbjct  427   FEFPERPGALMKFVGSMSPDWNISLFHYRNNGADYGRIVVGMQVPPGEMQEWREFLDSLG  486

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  487   YRYWEETQNPAYKLFL  502



>ref|WP_014723627.1| MULTISPECIES: threonine dehydratase biosynthetic [Burkholderia]
 ref|YP_006333586.1| threonine dehydratase biosynthetic [Burkholderia sp. KJ006]
 gb|AFJ86855.1| Threonine dehydratase biosynthetic [Burkholderia sp. KJ006]
Length=507

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  GERV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLQKGERVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEFLDGVVTVDTDALCAAIKDVFQDTRSVLEPSGALAVAGAKRYVEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  ++TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRSVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          T+DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIRRRGESAEIAANFDAHGFKTVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>gb|KER66669.1| threonine dehydratase [Burkholderia cepacia]
Length=507

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLSAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQA-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_034295593.1| threonine dehydratase [Herbaspirillum sp. RV1423]
Length=508

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 226/331 (68%), Gaps = 11/331 (3%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK V P++KIIGV+  D++AMA SL  G R+ L  VG F+DG AVK+VG
Sbjct  179   GGGLISGVAAYVKAVRPDIKIIGVQTADSDAMARSLKAGRRITLQDVGLFSDGTAVKLVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYN----  976
             EETF I R+L+D ++ V  DA+C +IKD+F++ R+I+EP+GALS+AGA+AY +       
Sbjct  239   EETFRIARQLVDDIIIVDTDAVCTAIKDIFQDTRSIVEPAGALSVAGAKAYIERAKDSKK  298

Query  975   -LKGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
              ++ E++I +  GANMNFDRLR +AE+ADVG  REA+ +  +PEE GSFK+F E+VGP N
Sbjct  299   PIRNESLITIACGANMNFDRLRFVAEMADVGEAREAVFAVTIPEERGSFKRFCEVVGPRN  358

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKM--ELDAMVERMILSDLHTIDLTDNDLVKDHLRH  625
             +TEF YR S  ++  +    V + T    E   + +    +   T+DLT ++L K H+RH
Sbjct  359   VTEFNYRISDEKSAHIF---VGIQTSNIDEPARIAKSFEKNGFSTLDLTHDELAKVHIRH  415

Query  624   LIGGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQV  448
             L+GG+ ++ +DELL RF FPERPGAL+ FLD  +P WNI+LF+YR  G     +LVGLQV
Sbjct  416   LVGGKSALAQDELLYRFEFPERPGALMRFLDNMNPNWNISLFHYRNQGGDVGRILVGLQV  475

Query  447   PSNEIDEFKQRANDLGYEYAIETSEAFQLLM  355
             P  E+  F+   ++LGY +  E+      L 
Sbjct  476   PKKEMKTFRSFLDNLGYRHWDESKNPLYKLF  506



>ref|WP_006487895.1| MULTISPECIES: threonine ammonia-lyase, biosynthetic [Burkholderia 
cepacia complex]
 ref|YP_002230023.1| threonine dehydratase [Burkholderia cenocepacia J2315]
 emb|CAR51175.1| threonine dehydratase biosynthetic [Burkholderia cenocepacia 
J2315]
 emb|CCE51070.1| Threonine dehydratase biosynthetic [Burkholderia cenocepacia 
H111]
 gb|EPZ90976.1| threonine ammonia-lyase, biosynthetic [Burkholderia cenocepacia 
K56-2Valvano]
 gb|ERI30752.1| threonine ammonia-lyase, biosynthetic [Burkholderia cenocepacia 
BC7]
 emb|CDN61323.1| Threonine dehydratase biosynthetic [Burkholderia cenocepacia 
H111]
 gb|AIO48522.1| threonine ammonia-lyase, biosynthetic [Burkholderia cepacia]
 gb|KGB94326.1| threonine ammonia-lyase, biosynthetic [Burkholderia cepacia]
Length=507

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AM  SL  GER+ L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMKQSLDAGERIELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCREFLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADEKS-AHIFVGVQIRRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_012777653.1| threonine dehydratase [Methylotenera mobilis]
 ref|YP_003047723.1| threonine dehydratase [Methylotenera mobilis JLW8]
 gb|ACT47196.1| threonine dehydratase, biosynthetic [Methylotenera mobilis JLW8]
Length=503

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 220/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+KIIGVE  DA AM  SL  G+RVML+QVG FADG AVK VGE TF +C++ 
Sbjct  189   YVKAVRPEIKIIGVEARDAEAMTESLQQGQRVMLEQVGLFADGAAVKQVGEHTFALCQQY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL+ AG +AY     L+G+ +I + SGAN
Sbjct  249   VDEMIIVDNDAICAAIKDVFEDTRSILEPAGALATAGLKAYAAREKLEGKTLISIASGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR IAE A++G +REA+L+  +PE+PG+FK F  L+G  NITEF YRYS    ++
Sbjct  309   MNFDRLRFIAERAELGEKREAVLAVTIPEKPGAFKAFCHLLGNRNITEFNYRYSDP-TEA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCRF  577
              +   V+V+   E   +V+ +    L  +DL++N++ K HLRHL+GG     E+E++ RF
Sbjct  368   HIFVGVAVNDPTESAQLVKDLAAQGLPALDLSENEVAKLHLRHLVGGHAPQAENEVVFRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPE+PGAL++FLD     WNI+LF+YR HG     VL G+QVP NE+ EF    N+LGY
Sbjct  428   EFPEKPGALMKFLDTMGHDWNISLFHYRNHGADFGRVLAGMQVPPNELTEFSDFLNNLGY  487

Query  396   EYAIETSE-AFQLLM  355
              +  ET+  A++L +
Sbjct  488   PHWEETNNPAYKLFL  502



>ref|WP_011353168.1| threonine dehydratase [Burkholderia lata]
 ref|YP_370302.1| threonine dehydratase [Burkholderia lata]
 gb|ABB09658.1| L-threonine ammonia-lyase [Burkholderia lata]
Length=507

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 228/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLEAGRRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQA-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_019495845.1| L-threonine dehydratase biosynthetic IlvA [Calothrix sp. PCC 
7103]
Length=503

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 226/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE+KIIGVEP DA+AM  SL  G+RV L QVG FADGVAV+ VG
Sbjct  179   GGGLISGVAAYIKRLRPEIKIIGVEPVDADAMNQSLKAGKRVRLSQVGLFADGVAVREVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+E +D ++ V  D  CA+IKD+FE+ R+I+EP+GAL+IAGA+AY +   ++G+
Sbjct  239   EETFRLCQEYVDEIILVNTDDTCAAIKDVFEDTRSIVEPAGALAIAGAKAYVEREQIEGQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I +  GANMNFDRLR +AE A+ G QREAI +  +PE+ GS  KF E +G  N+TEF 
Sbjct  299   TLIAIACGANMNFDRLRFVAERAEYGEQREAIFAVTIPEQAGSLHKFCECIGRRNLTEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +  + +   + +  + +   MVE        T+DLTD++  K HLRH++GGR  
Sbjct  359   YRIADEKV-AHIFVGMQIQKRADRAKMVETFENCGFPTLDLTDDEFTKLHLRHMVGGRSL  417

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  +ELL RF FPERPGAL++F+ + SP WNI++F+YR +G     ++VG+QVP  E+ E
Sbjct  418   LAHNELLYRFEFPERPGALMKFVSSMSPNWNISVFHYRNNGSDYGKIVVGIQVPPQEMQE  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             ++   + LGY Y  E  + A++L +
Sbjct  478   WQAFLDTLGYTYWDENDNPAYKLFL  502



>ref|WP_011136640.1| threonine dehydratase [Chromobacterium violaceum]
 ref|NP_902763.1| threonine dehydratase [Chromobacterium violaceum ATCC 12472]
 gb|AAQ60761.1| threonine dehydratase [Chromobacterium violaceum ATCC 12472]
Length=509

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 230/316 (73%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +F+K + PE+KIIGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF ICRE
Sbjct  190   SFIKRLKPEIKIIGVQPVDSDAMRQSIEKGERVELKDVGLFADGVAVKLVGEETFRICRE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I+EP+GAL++AGA+AY +    +G++++ ++ GA
Sbjct  250   LLDEIILVDSDAICAAIKDIFEDTRSIVEPAGALAVAGAKAYIEREGCEGQSLVAISCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REAI++  +PE+PGSFK+F  ++G  NITEF YR++   + 
Sbjct  310   NMNFDRLRHVSERSELGERREAIIAVTIPEKPGSFKRFCSVIGGRNITEFNYRFADP-SV  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   V +  K +++ ++  +  ++L  IDLTDN+L K H+RHL+GG    ++DE + R
Sbjct  369   AHVFVGVQIAGKEDVEKLLRDLRAAELDGIDLTDNELAKLHIRHLVGGHAPQLKDERVLR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FP+RPGAL+ FL+A    WNI+LF+YR HG     VLVG+QVPS +   F+Q  + LG
Sbjct  429   FEFPDRPGALMRFLEAMRTDWNISLFHYRNHGADYGRVLVGIQVPSGDAQAFQQFLDTLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYIEETENPAYRLFL  504



>ref|WP_011312875.1| L-threonine ammonia-lyase [Thiobacillus denitrificans]
 ref|YP_316121.1| L-threonine ammonia-lyase [Thiobacillus denitrificans ATCC 25259]
 gb|AAZ98316.1| threonine dehydratase I [Thiobacillus denitrificans ATCC 25259]
Length=505

 Score =   320 bits (820),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 225/325 (69%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + P++KI+GVEP DA+AMA SL    RV L +VG FADGVAVK VG
Sbjct  181   GGGLIAGMAAYIKRLRPQIKIVGVEPEDADAMARSLCKNTRVTLPRVGIFADGVAVKKVG  240

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF + +  +D ++ V  DA+CA+IKD+FE+ R+ILEP+GALSIAG +A      LKG+
Sbjct  241   KETFRLAQLYVDEIIRVNNDAICAAIKDVFEDTRSILEPAGALSIAGMKAAIAGDRLKGK  300

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +  V SGANMNFDRLR IAE A++G +REAIL+  +PE PGSFK F  L+G  NITEF 
Sbjct  301   TLAAVASGANMNFDRLRHIAERAELGEKREAILAVTIPETPGSFKTFCGLLGARNITEFN  360

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+  R  + V   +SV  + E   +VE +    L  IDL+DN++ K H+RHL+GGR  
Sbjct  361   YRYADPRV-ARVFVGLSVPGEGESKRVVELLGRHGLEAIDLSDNEMAKLHIRHLVGGRAP  419

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
                +E+L RF FPERPGAL++FL + S  WNI+LF+YR HG     VLVG+QVP  E   
Sbjct  420   DAVNEVLYRFEFPERPGALMQFLQSMSRGWNISLFHYRNHGTDYGRVLVGIQVPDKEKPV  479

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F++    LGY Y  E+ + A+ L +
Sbjct  480   FQKFLEGLGYRYWDESRNPAYTLFL  504



>ref|WP_009691933.1| threonine dehydratase [Burkholderia cenocepacia]
 gb|EGD01732.1| threonine dehydratase [Burkholderia sp. TJI49]
 gb|AIO32163.1| threonine ammonia-lyase, biosynthetic [Burkholderia cenocepacia]
Length=507

 Score =   320 bits (819),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLEAGKRVELAEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVDTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSF++F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  ++ + +   V +  + E   +          T+DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQS-AHIFVGVQIRRRGESAEIAANFESHGFRTVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQTDHAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_026097029.1| threonine dehydratase [Ideonella sp. B508-1]
Length=501

 Score =   320 bits (819),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 216/316 (68%), Gaps = 2/316 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE+K+IGV+  D++AMA S+  G RV L  VG F+DG AVK+VG
Sbjct  177   GGGLISGVAAYIKAVRPEIKVIGVQTVDSDAMARSVEAGRRVTLGDVGLFSDGTAVKLVG  236

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + REL+DG V V  D +CA++KD+F++ R+++EP+GAL +AG + Y   +  KG+
Sbjct  237   EETFRLARELVDGYVRVTTDELCAAMKDIFQDTRSVVEPAGALGVAGLKQYAATHKCKGQ  296

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
               + +  GANMNFDRLR +AE A+ G QREA+ +  +PEE GSF++F ELVG  ++TEF 
Sbjct  297   TFVAIACGANMNFDRLRFVAERAEYGEQREALFAVTIPEERGSFRRFCELVGSRSVTEFN  356

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR S  R Q+ V   +S+    E D +          T++LTD++L K+H+RH++GGR S
Sbjct  357   YRISDTR-QAHVFVGMSISKPDEADKIARSFQRHRFATVNLTDDELAKEHVRHMVGGRSS  415

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             + EDE + RF FPERPGAL+ FL A SP WNI+LF+YR  G     +LVGLQVP ++   
Sbjct  416   LAEDERIYRFEFPERPGALMRFLSAMSPDWNISLFHYRNQGADYGRILVGLQVPKSDKKA  475

Query  426   FKQRANDLGYEYAIET  379
             FK   + L Y    ET
Sbjct  476   FKAFLDGLAYPCVDET  491



>ref|WP_026688207.1| threonine dehydratase [Azovibrio restrictus]
Length=510

 Score =   320 bits (819),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 216/304 (71%), Gaps = 6/304 (2%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K V PEVK+IGVE  DA+AM  S+  G+RV LDQVG FADG AVK VGEETF +C+EL
Sbjct  192   YIKAVRPEVKVIGVETFDADAMKRSIAAGKRVRLDQVGLFADGTAVKFVGEETFRVCKEL  251

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEPSGAL+IAGA+ Y + + LK + ++ V SGAN
Sbjct  252   LDDIILVDTDAICAAIKDVFEDTRSILEPSGALAIAGAKEYARQHKLKDKVLVAVASGAN  311

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
              NFDRLR +AE A++G QREA+L+  LPE+PG++KKFV L+G  NITEF YRY   RA++
Sbjct  312   TNFDRLRFVAERAEIGEQREAVLAVTLPEQPGAYKKFVALIGKHNITEFNYRYHH-RAEA  370

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVED----EL  589
              V   + V  + E   +VE +      T+DL++++  K H+RH++GG    V D    E 
Sbjct  371   HVYVGMQVANRAESLKLVESLKKHGYPTLDLSEDETAKLHVRHMVGGHAPQVRDGGMSER  430

Query  588   LCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAN  409
             + RF FPERPGAL+ FL+  S  WNI+LF+YR HG   A VLVG+QVP  E+DEF+   +
Sbjct  431   VYRFEFPERPGALMNFLNQMSAGWNISLFHYRNHGADIARVLVGMQVPPGEMDEFQAFLD  490

Query  408   DLGY  397
              LGY
Sbjct  491   KLGY  494



>ref|WP_026072273.1| threonine dehydratase [Nodosilinea nodulosa]
Length=503

 Score =   320 bits (819),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 224/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP +A+AMA SL  GERV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYVKRLRPEIKIIGVEPIEADAMARSLKAGERVRLSQVGLFADGVAVRQVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ VG D +CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   +  + ++ V  G
Sbjct  247   QYVDEIILVGTDDICAAIKDVFEDTRSILEPAGALAIAGAKAYVEREGITDQTLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A++G  REAI +  +PE PGS K F E +G  N+TEF YR +    
Sbjct  307   ANMNFDRLRFVAERAEIGEHREAIFAVTIPETPGSLKAFCECIGTRNLTEFNYRIADNH-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + V  + +   M +      L T+DLTD++L K HLRH++GG+ S+  DELL 
Sbjct  366   EAHIFVGLEVQGRADAATMAQIFESKGLKTLDLTDDELSKMHLRHMVGGKSSLAHDELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F++A SP WNI+LF+YR +G     ++ G+QVP +E+ ++++  N L
Sbjct  426   RFEFPERPGALMKFVNAMSPDWNISLFHYRNNGSDYGRIVAGIQVPPHEMTQWQEFLNTL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY+Y  E  + A++L +
Sbjct  486   GYQYWDENQNPAYKLFL  502



>ref|WP_011429063.1| threonine dehydratase [Synechococcus sp. JA-3-3Ab]
 ref|YP_473635.1| threonine dehydratase [Synechococcus sp. JA-3-3Ab]
 gb|ABC98372.1| threonine dehydratase [Synechococcus sp. JA-3-3Ab]
Length=503

 Score =   319 bits (818),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 228/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+GIAA+VK + PE+KIIGVEP DA+AM  SL  G RV L QVG FADGVAV+ VG
Sbjct  179   GGGLISGIAAYVKRLRPEIKIIGVEPLDADAMYRSLRAGRRVRLSQVGLFADGVAVREVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C++ +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAG +AY     ++G+
Sbjct  239   EETFRLCQQYVDEILLVSTDDTCAAIKDVFEDTRSILEPAGALAIAGLKAYVSRTGIQGQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A++G QREAI +  +PEE GS ++F   +G  N+TEF 
Sbjct  299   TLVAVASGANMNFDRLRFVAERAEIGEQREAIFAVTIPEERGSLRRFCAHIGQRNLTEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +    ++ +   + V  + +  A    +  +   T+DLTD++L K HLRH++GGR  
Sbjct  359   YRIADTH-EAHIFVGLQVRDRADAQAAALDLERAGFKTLDLTDDELAKLHLRHMVGGRSP  417

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             + E+ELL RF FPERPGAL++FL   SP WNI+LF+YR +G     VL+G+QVP++E+  
Sbjct  418   LAENELLYRFEFPERPGALMQFLSCMSPNWNISLFHYRNNGADYGRVLIGMQVPTSEMPA  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             +++  + L Y Y  E+ + A++L +
Sbjct  478   WQRFLDTLNYRYWDESHNPAYKLFL  502



>ref|WP_027789147.1| threonine dehydratase [Burkholderia cepacia]
 gb|AIO25102.1| threonine ammonia-lyase, biosynthetic [Burkholderia cepacia ATCC 
25416]
Length=507

 Score =   319 bits (818),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGV+ V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVLTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQA-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_021161327.1| Threonine dehydratase biosynthetic [Burkholderia sp. AU4i]
 gb|ERJ36176.1| Threonine dehydratase biosynthetic [Burkholderia sp. AU4i]
Length=507

 Score =   319 bits (818),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 229/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLDAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGV+ V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVLTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAEREGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          ++DLT ++L K+H+R+++GGR  
Sbjct  363   YRIADAQA-AHIFVGVQIKRRGESAEIAANFESHGFKSVDLTHDELSKEHIRYMVGGRSP  421

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_017326871.1| L-threonine dehydratase biosynthetic IlvA [Synechococcus sp. 
PCC 7336]
Length=503

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/315 (49%), Positives = 223/315 (71%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V PE+ +IGVEP DA+AM+ SL  G+RV L+QVG FADGVAV+ VG+ETF +CRE 
Sbjct  189   YVKQVRPEIAVIGVEPVDADAMSRSLAAGKRVRLEQVGLFADGVAVRQVGKETFRLCREY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D VV VG D  CA+IKD+FE+ R+I+EP+GAL+IAGA+AY +   ++GE ++ +  GAN
Sbjct  249   VDEVVLVGTDDTCAAIKDVFEDTRSIVEPAGALAIAGAKAYVERTGIEGETLVALACGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A++G +REAI +  +PE+PGS ++F E +G  N+TEF YR +  R  +
Sbjct  309   MNFDRLRFVAERAELGERREAIFAVTIPEQPGSLRRFCECIGRRNLTEFNYRIAD-RTVA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLCRF  577
              +   + +  + +   M E    ++  T+DLTD++L K H+RH++GGR  +  +ELL RF
Sbjct  368   HIFVGLQIQDRADAAQMQETFERNEFETVDLTDDELAKMHIRHMVGGRSPLAHNELLYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL++F+ A SP WNI+LF+YR HG     ++VG+QVP  E+ E++   + LGY
Sbjct  428   EFPERPGALMKFVGAMSPNWNISLFHYRNHGADYGRIVVGMQVPPEEMQEWQAFLDTLGY  487

Query  396   EYAIETSE-AFQLLM  355
              Y  E +  A++L +
Sbjct  488   RYWDENNNPAYKLFL  502



>ref|WP_035382601.1| threonine dehydratase [Ferriphaselus sp. R-1]
Length=505

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 221/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V P++K+IGV+ +D++AM  SL  G+RV L+ VG F+DG AVK+VGEETF +C+  
Sbjct  191   YVKQVRPDIKVIGVQTNDSDAMFQSLQAGQRVQLNDVGLFSDGTAVKLVGEETFRVCQHY  250

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D +V V  DA+CA+IKD+F++ R+ILEP+GAL++AGA+ Y K   LKG+ +I V  GAN
Sbjct  251   VDEIVRVDTDAVCAAIKDVFQDTRSILEPAGALAVAGAKLYAKREKLKGKTLIPVACGAN  310

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A++G +REAIL+  +PE PGSF+KF  L+G  NITEF YRY+  +A +
Sbjct  311   MNFDRLRFVAERAEIGEKREAILAVTIPETPGSFRKFCALLGNRNITEFNYRYADPKA-A  369

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS-VEDELLCRF  577
              V   V V    E   +V  +  + L  +DLTDN++ K HLRHL+GG  + V DE+L RF
Sbjct  370   QVFVGVQVKDPAETAKLVATLQQNQLRALDLTDNEMAKLHLRHLVGGHSAGVSDEILFRF  429

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP ++ D  +   + LGY
Sbjct  430   EFPERPGALMNFLNRMSHNWNISLFHYRNHGADYGRVLVGMQVPHHDKDALRAFLDGLGY  489

Query  396   EYAIET-SEAFQLLM  355
              Y  E+ + A++L +
Sbjct  490   PYWDESENPAYRLFL  504



>ref|WP_012080959.1| threonine dehydratase [Janthinobacterium sp. Marseille]
 ref|YP_001354806.1| threonine dehydratase [Janthinobacterium sp. Marseille]
 gb|ABR88443.1| threonine dehydratase [Janthinobacterium sp. Marseille]
Length=507

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 219/321 (68%), Gaps = 7/321 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK V PE+K+IGV+  D++AMA SL  G RV +  VG FADG AVK+VG
Sbjct  179   GGGLIAGVAAYVKAVRPEIKVIGVQTSDSDAMARSLQAGRRVTMADVGLFADGTAVKLVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYN----  976
             EETF + ++ +D ++ V  + +C +IKD+F++ R+ILEPSGAL++AGA+AY +       
Sbjct  239   EETFRLAKQYVDEIIVVDTNEVCTAIKDVFQDTRSILEPSGALAVAGAKAYIERARASKK  298

Query  975   -LKGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
              LK E ++ + SGANMNFDRLR +AE+ADVG  RE + +  +PEE GSFK+F EL+GP N
Sbjct  299   PLKNETLVTIASGANMNFDRLRFVAEMADVGAAREGVFAVTIPEERGSFKRFCELIGPRN  358

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S  +  + +   + +  + E   + +        T+DLT ++L K H+RHL+
Sbjct  359   VTEFNYRISDAKL-AHIFVGMQIADRDEAGKITKLFEKHGFKTLDLTHDELAKGHIRHLV  417

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+  + +DE+L RF FPERPGAL+ FLD+ +P WNI+LF+YR  G     +LVGLQVP 
Sbjct  418   GGKSELTQDEILYRFEFPERPGALMRFLDSVAPNWNISLFHYRNQGGDVGRILVGLQVPK  477

Query  441   NEIDEFKQRANDLGYEYAIET  379
              E+  F+     LGY +  E+
Sbjct  478   KEMKAFRASLAGLGYRHWDES  498



>ref|WP_007192294.1| threonine dehydratase, biosynthetic [Thiocapsa marina]
 gb|EGV19273.1| threonine dehydratase, biosynthetic [Thiocapsa marina 5811]
Length=510

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 228/332 (69%), Gaps = 4/332 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK + PEV++IGVEP DA  +  +L  G RV L QVG FADGVAVK++G
Sbjct  179   GGGLIAGVAAYVKWLMPEVRVIGVEPQDAPTLHAALAAGRRVELAQVGLFADGVAVKLIG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + RE +D VV V  D +CA++KD+F++ R I EP+GAL++AG + Y + + +KGE
Sbjct  239   EETFRVARERVDEVVLVSTDEICAAVKDIFDDTRGIAEPAGALAVAGMKRYVETHKIKGE  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             ++I + SGAN+NFDRLR IAE A++G +REA+L+  +PE PGSF  F  ++G   ITEF 
Sbjct  299   HLIAIESGANVNFDRLRHIAERAELGERREALLAVEIPERPGSFLAFCRVIGRRQITEFN  358

Query  783   YRYS-SGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
             YRYS + RAQ  V   ++     E   ++ R++      +D+T+N+  K H+R+++GG  
Sbjct  359   YRYSDATRAQVFVGVELA-RADEERAELIGRLVEKGFGVLDMTENETAKLHIRYMVGGHA  417

Query  606   -SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
               +E E L RF FPERPGALL+FL A   +WNI+LF+YR HG A   VL+G Q+P++E  
Sbjct  418   EGIEGETLVRFEFPERPGALLDFLSALGKRWNISLFHYRNHGAAYGRVLMGAQIPADETG  477

Query  429   EFKQRANDLGYEYAIET-SEAFQLLMN*LNRS  337
              F+Q  + LGY+Y  ET + A++L      RS
Sbjct  478   AFRQALDTLGYQYWDETENPAYRLFAGSEPRS  509



>ref|WP_017877779.1| L-threonine dehydratase biosynthetic IlvA [Janthinobacterium 
sp. CG3]
Length=511

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 224/322 (70%), Gaps = 7/322 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P++KIIGV+  D++AMA SL  GERV L  VG F+DG AV++VG
Sbjct  182   GGGLISGVAAYVKQIRPDIKIIGVQTLDSDAMARSLKAGERVTLPDVGLFSDGTAVRLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNL---  973
             EETF + +  +D V+ V  DA+CA+IKD+F + R+ILEP+GAL+IAGA+AY +  +L   
Sbjct  242   EETFRLAQLYVDEVIIVDTDAICAAIKDVFTDTRSILEPAGALAIAGAKAYIERASLSKH  301

Query  972   --KGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
               + E ++ +  GANMNFDRLR +AE A++G  REA+ +  +PE+ GSFK+F +LVG  N
Sbjct  302   PVQNETLVTIACGANMNFDRLRFVAERAELGESREAVFAVTMPEQRGSFKRFCQLVGARN  361

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S   +Q+ V   V +  + E   +  +    +  T+DLT ++L K H+RHL+
Sbjct  362   VTEFNYRISD-ESQAHVFVGVQIANRNESGVLARKFEEHEFKTLDLTHDELAKSHIRHLV  420

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+  + +DELL RF FPERPGAL+ FLD+ +P WNI+L +YR+ G     +L+GLQVP 
Sbjct  421   GGKSRLAQDELLYRFEFPERPGALMRFLDSMAPNWNISLCHYRSQGGDVGRILIGLQVPQ  480

Query  441   NEIDEFKQRANDLGYEYAIETS  376
             +E+ EF Q    LGY Y  E+S
Sbjct  481   DEMGEFGQFLTTLGYRYWDESS  502



>ref|WP_018972123.1| hypothetical protein [Rudaea cellulosilytica]
Length=512

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 222/326 (68%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK V PE+K+IGV+  D++AMA SL  GERV L +VG F+DG AVK+ G
Sbjct  186   GGGLIAGVAAYVKAVRPEIKVIGVQTEDSDAMARSLEQGERVELREVGLFSDGTAVKLAG  245

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +CRE +D V+ V  DA+CA+IKD+F + R++LEP+GAL++AGA+ Y +  NL+ E
Sbjct  246   EETFRLCREHVDEVLRVDTDALCAAIKDVFADTRSMLEPAGALAVAGAKQYAERENLRDE  305

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              +I + SGAN+NFDRLR +AE A+VG  REA+ +  +PEE GSF++F  L+G  +ITEF 
Sbjct  306   TLIAIASGANLNFDRLRFVAERAEVGEAREALFAVTIPEERGSFRRFCTLLGARSITEFN  365

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR    + Q+ +   V +  + E   + E         +DLT ++L K HLR++IGGR  
Sbjct  366   YRIGDPK-QARLFVGVQIRDRDEPARIAEAFAQGGFEVLDLTHDELAKLHLRYMIGGRGD  424

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DELL RF FPERPGAL  FLDA  P WNI+LF+YR HG     +LVG+QVP  +   
Sbjct  425   LATDELLYRFDFPERPGALGRFLDALDPAWNISLFHYRNHGADYGRILVGIQVPPADRAS  484

Query  426   FKQRANDLGYEYAIET-SEAFQLLMN  352
             F      LGY Y  E+ + A++LL+ 
Sbjct  485   FADFLARLGYAYRDESENPAYRLLLR  510



>ref|WP_022654027.1| L-threonine dehydratase biosynthetic IlvA [Aquaspirillum serpens]
Length=509

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 220/314 (70%), Gaps = 2/314 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PE+++IGV+ +D++AMA S+  G RV L  VG F+DG AVK+VGEETF +CR+L
Sbjct  189   YIKRLKPEIRVIGVQTYDSDAMARSIEAGHRVELKDVGLFSDGTAVKLVGEETFRLCRDL  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ V  DA+CA+IKD+FE+ R+ILEP+GAL++AG +AY +   L  + ++ V  GAN
Sbjct  249   LDEIIRVDTDAICAAIKDVFEDTRSILEPAGALALAGLKAYVEREELANQTLVAVACGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR ++E +++G QREAI + ++PE PGSFK+F  LVG  NITEF YRY    +Q+
Sbjct  309   MNFDRLRHVSERSELGEQREAIFAVSIPERPGSFKQFCSLVGRRNITEFNYRYGDA-SQA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSVEDELLCRFI  574
              V   V +  + + D ++  +  S +  +DLTDN+L K H+RHL+GG     +E + RF 
Sbjct  368   HVFVGVQIEDRRDTDVILNELAASGIAAVDLTDNELAKLHIRHLVGGHAPALNERVLRFE  427

Query  573   FPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGYE  394
             FPERPGAL++FL A    WNI+LF+YR HG     VLVG+QVP NE+ +F+    +LGY 
Sbjct  428   FPERPGALMKFLAAMRTDWNISLFHYRNHGTDYGRVLVGVQVPQNELADFQHFLENLGYP  487

Query  393   YAIET-SEAFQLLM  355
             Y  ET + A++L +
Sbjct  488   YIEETDNPAYRLFL  501



>ref|WP_013030866.1| threonine dehydratase, biosynthetic [Sideroxydans lithotrophicus]
 ref|YP_003525355.1| threonine dehydratase, biosynthetic [Sideroxydans lithotrophicus 
ES-1]
 gb|ADE12968.1| threonine dehydratase, biosynthetic [Sideroxydans lithotrophicus 
ES-1]
Length=505

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 221/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V P++K+IGV+  D++AMA SL   +RV L+ VG F+DG AVK+ GEETF +C++ 
Sbjct  191   YVKQVRPDIKVIGVQTTDSDAMARSLKSRKRVTLNDVGLFSDGTAVKLAGEETFRVCKQY  250

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D VV V  DA+CA+IKD+F++ R+ILEP+GAL++AGA+ Y K   LKGE ++ V SGAN
Sbjct  251   VDEVVLVDTDAVCAAIKDVFQDTRSILEPAGALAVAGAKLYAKREQLKGETLVTVCSGAN  310

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE +++G +REAIL+  +PE PGSF+KF  L+G  NITEF YRY+  +A +
Sbjct  311   MNFDRLRFVAERSEIGEKREAILAVTIPETPGSFRKFCTLLGKRNITEFNYRYADPKA-A  369

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS-VEDELLCRF  577
              V   + V  + E   +V+++    L T+DL+DN++ K HLRHL+GG     +DE++ RF
Sbjct  370   QVFVGIQVKDQSETADLVDKLQRGKLPTLDLSDNEMAKLHLRHLVGGHAPEAKDEIIFRF  429

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL+ FL++    WNI+LF+YR HG     VLVG+QVP  +    K   + LGY
Sbjct  430   EFPERPGALMNFLNSMDHSWNISLFHYRNHGADYGRVLVGMQVPRTDKKALKTFLDTLGY  489

Query  396   EYAIET-SEAFQLLM  355
              Y  E+ + A++L +
Sbjct  490   PYWDESDNPAYRLFL  504



>ref|WP_031401113.1| threonine dehydratase [Burkholderia sp. MSh1]
 gb|KFG94816.1| threonine dehydratase [Burkholderia sp. MSh1]
Length=507

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 227/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLEAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAERDGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          T DLT ++L K+H+R+++GG   
Sbjct  363   YRIADAQA-AHIFVGVQIRRRGESAEIAANFESHGFRTADLTHDELSKEHIRYMVGGHSP  421

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_034199374.1| threonine dehydratase [Burkholderia sp. MSh2]
 gb|KEZ03068.1| threonine dehydratase [Burkholderia sp. MSh2]
Length=507

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 227/326 (70%), Gaps = 3/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL +G+AA+VK V PE+K+IGV+  D+ AMA SL  G+RV L +VG FADG AVK+VG
Sbjct  183   GGGLASGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLEAGKRVELSEVGLFADGTAVKLVG  242

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C E +DGVV V  DA+CA+IKD+F++ R++LEPSGAL++AGA+ Y +   ++ +
Sbjct  243   EETFRLCSEYLDGVVTVNTDALCAAIKDVFQDTRSVLEPSGALAVAGAKLYAERDGIENQ  302

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ VTSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSFK+F  LVG  N+TEF 
Sbjct  303   TLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCSLVGDRNVTEFN  362

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +  +A + +   V +  + E   +          T DLT ++L K+H+R+++GG   
Sbjct  363   YRIADAQA-AHIFVGVQIRRRGESAEIAANFESHGFRTADLTHDELSKEHIRYMVGGHSP  421

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP  +  E
Sbjct  422   LAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGLQVPQADRAE  481

Query  426   FKQRANDLGYEYAIETSE-AFQLLMN  352
             F++    LGY Y  E++  A++L ++
Sbjct  482   FERFLAALGYPYVEESANPAYRLFLS  507



>ref|WP_026101469.1| threonine dehydratase [cyanobacterium PCC 7702]
Length=503

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 221/316 (70%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             A+VK + PE+KIIGVEP DA+AM  SL  G+RV L QVG FADGVAV+ VGEETF +C+E
Sbjct  188   AYVKRLRPEIKIIGVEPVDADAMYQSLKAGKRVRLSQVGLFADGVAVREVGEETFRLCQE  247

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
              +D +V V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++G+ +I V  GA
Sbjct  248   YVDDIVLVNTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGQTLIAVACGA  307

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR +AE A++G  REAI +  +PEEPGS ++F   +G  N+TEF YR +  + Q
Sbjct  308   NMNFDRLRFVAERAELGEHREAIFAVTIPEEPGSLRRFCRCMGKRNLTEFNYRIADEK-Q  366

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLCR  580
             + +   V +  + +   MV +       T+DLTD++L K HLRH++GG  S+  +ELL R
Sbjct  367   AHIFVGVQIENRADRAKMVAKFTECGFQTLDLTDDELTKLHLRHMVGGHSSLAHNELLYR  426

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FPERPGAL++F+D+ SP WNI++F+YR +G     +L+G+QVP  E+ +++   + LG
Sbjct  427   FEFPERPGALMKFVDSMSPNWNISMFHYRNNGADYGRILIGIQVPPQEMAQWQAFLDTLG  486

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  E  + A++L +
Sbjct  487   YRYWDENQNPAYKLFL  502



>ref|XP_006430341.1| hypothetical protein CICLE_v10011319mg [Citrus clementina]
 gb|ESR43581.1| hypothetical protein CICLE_v10011319mg [Citrus clementina]
Length=519

 Score =   318 bits (816),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+ +VKIIGVEP+DANAMALSLHHGERVMLD VGGFADGVAVK VGEETF IC+EL
Sbjct  293   YVKRVSTQVKIIGVEPYDANAMALSLHHGERVMLDHVGGFADGVAVKEVGEETFRICKEL  352

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGA+AYCKYY L G+N++ +TSGAN
Sbjct  353   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAKAYCKYYGLSGKNVVAITSGAN  412

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+ +T +PE+ GSFK+F EL+GPMNITEF+YR+SS +A +
Sbjct  413   MNFDKLRVVTELANVGRQQEAVFATVMPEQSGSFKQFCELLGPMNITEFKYRFSSDKA-A  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +VLY V VHT  EL+AM ERM  S L T +LT +DLVKDHLR+L+
Sbjct  472   VVLYSVGVHTVAELEAMQERMESSQLKTYNLTQSDLVKDHLRYLV  516



>ref|WP_012807069.1| threonine dehydratase [Candidatus Accumulibacter phosphatis]
 ref|YP_003165548.1| threonine dehydratase [Candidatus Accumulibacter phosphatis clade 
IIA str. UW-1]
 gb|ACV33619.1| threonine dehydratase, biosynthetic [Candidatus Accumulibacter 
phosphatis clade IIA str. UW-1]
Length=503

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 234/325 (72%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE +IIGVE  DA+AMA SL+ G+RV L+ VG FADG AVK VG
Sbjct  179   GGGLISGVAAYIKRLRPETRIIGVEAADADAMARSLNAGKRVRLEHVGLFADGAAVKYVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF +C+  +D +V V  DA+CA+IKD+FE+ R +LEP+GAL++AGA+AY   + LK  
Sbjct  239   EETFRLCQMYVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGALAVAGAKAYAASHRLKDR  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++   SGAN+NFDRLR +AE A++G QREA+ +  LPE+PG++++F+ L+G  N+TEF 
Sbjct  299   TLVATASGANLNFDRLRFVAERAEIGEQREAVFAVTLPEKPGAYRQFLSLIGARNVTEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY+  RA + +   V V ++ E   +++ +   D  T+DLTD+++ K H+RHL+GGR  
Sbjct  359   YRYNDQRA-AHIFVGVQVASRAESVRLLDHLRRHDYPTLDLTDDEMAKGHVRHLVGGRSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              + +E++ RF FPERPGAL+ FL+  S  WNI+LF+YR HG     VLVG+QVP +E+D+
Sbjct  418   QITNEIVYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHGADYGRVLVGMQVPPDELDD  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+     LGY +  ET + A++L +
Sbjct  478   FEVFLKTLGYAHWNETDNPAYRLFL  502



>gb|KDO60994.1| hypothetical protein CISIN_1g048400mg [Citrus sinensis]
Length=519

 Score =   318 bits (816),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             +VK V+ +VKIIGVEP+DANAMALSLHHGERVMLD VGGFADGVAVK VGEETF IC+EL
Sbjct  293   YVKRVSTQVKIIGVEPYDANAMALSLHHGERVMLDHVGGFADGVAVKEVGEETFRICKEL  352

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +DGVV V RDA+CASIKDMFEE+R+ILEP+GAL++AGA+AYCKYY L G+N++ +TSGAN
Sbjct  353   VDGVVLVSRDAICASIKDMFEEKRSILEPAGALALAGAKAYCKYYGLSGKNVVAITSGAN  412

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFD+LR + ELA+VG Q+EA+ +T +PE+ GSFK+F EL+GPMNITEF+YR+SS +A +
Sbjct  413   MNFDKLRVVTELANVGRQQEAVFATVMPEQSGSFKQFCELLGPMNITEFKYRFSSDKA-A  471

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +VLY V VHT  EL+AM ERM  S L T +LT +DLVKDHLR+L+
Sbjct  472   VVLYSVGVHTVAELEAMQERMESSQLKTYNLTQSDLVKDHLRYLV  516



>ref|WP_039754705.1| threonine dehydratase [Chromobacterium sp. C-61]
Length=509

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 230/316 (73%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +F+K + P++K+IGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF ICRE
Sbjct  190   SFIKRLKPDIKVIGVQPVDSDAMRQSIAKGERVELKDVGLFADGVAVKLVGEETFRICRE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I+EP+GAL++AGA+AY +    + + ++ ++ GA
Sbjct  250   LLDEIILVDTDAICAAIKDIFEDTRSIVEPAGALAVAGAKAYVEREGCENQTLVAISCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REAI++  +PE+PGSFK+F  ++G  NITEF YR++     
Sbjct  310   NMNFDRLRHVSERSELGERREAIIAVTIPEKPGSFKRFCTVIGGRNITEFNYRFADP-GT  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   V +  K +L+ ++  +   +L +IDLTDN+L K H+RHL+GG    ++DE + R
Sbjct  369   AHVFVGVQISGKQDLEGILASLNAHELESIDLTDNELAKLHIRHLVGGHAPQLKDERVLR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FP+RPGAL+ FL+A S  WNI+LF+YR HG     VLVG+QVP ++  EF++  ++LG
Sbjct  429   FEFPDRPGALMRFLEAMSVDWNISLFHYRNHGADYGRVLVGVQVPVSDDAEFQRFLDNLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYVEETQNPAYKLFL  504



>ref|WP_015196219.1| L-threonine ammonia-lyase [Calothrix parietina]
 ref|YP_007135536.1| L-threonine ammonia-lyase [Calothrix sp. PCC 6303]
 gb|AFY99563.1| L-threonine ammonia-lyase [Calothrix sp. PCC 6303]
Length=503

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 222/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM  SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYVKRIRPEIKIIGVEPVDADAMRQSLQAGHRVRLPQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ V  DA CA+IKD+FE+ R+I+EP+GAL+IAGA+ Y +   ++GE +I +  G
Sbjct  247   QYVDEIILVDTDATCAAIKDVFEDTRSIVEPAGALAIAGAKQYVEREGIEGETLIAIACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G QREAI +  +PE PGS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGEQREAIFAVKIPETPGSLRKFGESIGRRNLTEFSYRIADEQI  366

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
              + +   V +  + E   MVE        T+DLT+++L K HLRH++GGR  + ++ELL 
Sbjct  367   -AHIFVGVQIQNRAERLKMVEAFEECGFSTVDLTEDELTKLHLRHMVGGRSHLAQNELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI++F+YR HG     ++VG+QVP  E+ E++   + L
Sbjct  426   RFEFPERPGALMKFVSSMSPNWNISMFHYRNHGADYGRIVVGMQVPPQEMAEWQAFLDQL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY+Y  E+ + A++L +
Sbjct  486   GYQYWDESHNPAYKLFL  502



>ref|WP_019923396.1| L-threonine dehydratase biosynthetic IlvA [Duganella zoogloeoides]
Length=511

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 224/322 (70%), Gaps = 7/322 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA+VK + P++KIIGV+  D++AMA S+  GER+ L  VG F+DG AV++VG
Sbjct  182   GGGLISGVAAYVKAIRPDIKIIGVQTMDSDAMARSIKAGERITLADVGLFSDGTAVRLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNL---  973
             EETF + ++ +D ++ V  DA+ A+IKD+F + R+ILEP+GAL+IAGA+AY +   L   
Sbjct  242   EETFRLTQQYVDDIIIVDTDAISAAIKDVFTDTRSILEPAGALAIAGAKAYVERAALSKN  301

Query  972   --KGENIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMN  799
               K E +I +  GANMNFDRLR +AE A++G  REA+ +  LPE+ GSFK+F  LVGP N
Sbjct  302   PVKNETLITIACGANMNFDRLRFVAERAELGEAREALFAVTLPEQRGSFKRFCSLVGPRN  361

Query  798   ITEFRYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLI  619
             +TEF YR S  + ++ V   V +  + E  A+      +D  T+DLT ++L K H+RHL+
Sbjct  362   VTEFNYRISD-KDEAHVFVGVQIADRGESSALARTFEANDFRTLDLTHDELAKAHVRHLV  420

Query  618   GGRCSVED-ELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG+ ++ + ELL RF FPERPGAL+ FL++ +P WNI+L +YR+ G     +L+GLQVP 
Sbjct  421   GGKSALANSELLYRFEFPERPGALMRFLNSMAPNWNISLCHYRSQGGDVGRILIGLQVPP  480

Query  441   NEIDEFKQRANDLGYEYAIETS  376
              E+D+F Q    LGY Y  ET+
Sbjct  481   GEMDQFGQFLTTLGYRYWDETA  502



>ref|WP_023067781.1| threonine ammonia-lyase, biosynthetic [Lyngbya aestuarii]
 gb|ERT06034.1| threonine ammonia-lyase, biosynthetic [Lyngbya aestuarii BL J]
Length=503

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM+ SL  G RV L QVG FADGVAV+ VG+ETF +C+
Sbjct  187   AAYVKRLRPEIKIIGVEPIDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGDETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ VG D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++ + ++ V  G
Sbjct  247   QYVDEIILVGTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREQIQDKTLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A++G +REAI +  +PE+PGS ++F + +G  ++TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAELGERREAIFAVTIPEKPGSLRQFCDCLGKRSLTEFNYRIADEK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   V +  + +   ++E     DL T+DLTDN+LVK HLRH++GGR  +   ELL 
Sbjct  366   EAHIFVGVQIKNRADAAQLMETFEAQDLKTLDLTDNELVKLHLRHMVGGRSPLAHHELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVP  E+++++   + L
Sbjct  426   RFEFPERPGALMKFVASISPNWNISLFHYRNNGSDYGRIVVGMQVPPQEMEQWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E  + A+QL +
Sbjct  486   GYRYWDENKNPAYQLFL  502



>ref|WP_028990311.1| threonine dehydratase [Thermithiobacillus tepidarius]
Length=503

 Score =   317 bits (813),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 222/325 (68%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+A F+K++ P+V+IIGVEP +A+AM  SL  G R+ LDQVG FADGVAV+ VG
Sbjct  179   GGGLIAGVAGFLKVLMPQVRIIGVEPFEADAMYQSLQAGRRIALDQVGIFADGVAVREVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E TF I ++ +D ++ V  D +CA+IKD+F++ R ++EP+GALS+AG +AY     + G+
Sbjct  239   EHTFAIVKDTVDEIIRVSNDEICAAIKDVFDDTRAVMEPAGALSVAGLKAYVAREGVSGQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A++G QREA+ +  +PE PG+F+ F + +G   ITEF 
Sbjct  299   RLVAVLSGANMNFDRLRFVAERAELGEQREALFAVTIPERPGAFRAFCKAIGRRVITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR  SGR  + +   +S  ++ +   + E +      T DL+D+++ K H+RHL+GG   
Sbjct  359   YRL-SGRDSAHIFVGISTQSRKDARILTETLSRQGYATTDLSDDEMAKLHIRHLVGGHSP  417

Query  603   -VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
              V +EL+ RF FPERPGAL+EFLD     WNI+LF+YR HG     VL G++VP  E+ E
Sbjct  418   EVRNELVYRFEFPERPGALMEFLDKLGGHWNISLFHYRNHGADFGRVLAGIEVPPAELPE  477

Query  426   FKQRANDLGYEYAIE-TSEAFQLLM  355
             F++    LGY YA E  + A+QL +
Sbjct  478   FQRFLEQLGYPYAEEGGNPAYQLFL  502



>ref|WP_024302367.1| threonine dehydratase [Pseudogulbenkiania sp. MAI-1]
Length=509

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 225/316 (71%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +++K + PE+K+IGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF +C+E
Sbjct  190   SYIKRLKPEIKVIGVQPVDSDAMKQSIDKGERVELKDVGLFADGVAVKLVGEETFRLCKE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I EP+GAL++A  +AY +    +G+ ++ +  GA
Sbjct  250   LLDEIILVDTDAICAAIKDIFEDTRSITEPAGALAVAATKAYIEREGCQGKTLVAINCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REAI++  LPE+PGSFKKF  ++G  +ITEF YRY+  +  
Sbjct  310   NMNFDRLRHVSERSELGERREAIIAVTLPEQPGSFKKFCTVIGNRSITEFNYRYADDKT-  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   + + +K ++  +++ +  SDL  IDLTDN+L K H+RHL+GG   ++ DE + R
Sbjct  369   AHVFVGIQISSKDDVTRIIDDLKSSDLEGIDLTDNELAKLHIRHLVGGHAPALRDERILR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FPERPGAL+ FL+A    WNI+LF+YR HG     VLVG+QVPS +   F+   + LG
Sbjct  429   FEFPERPGALMRFLEAMRTDWNISLFHYRNHGADYGRVLVGIQVPSYDSAAFQSFLDSLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYVEETDNPAYKLFL  504



>ref|WP_016490271.1| threonine dehydratase [Pseudomonas resinovorans]
 ref|YP_008100664.1| threonine dehydratase [Pseudomonas resinovorans NBRC 106553]
 dbj|BAN46059.1| threonine dehydratase [Pseudomonas resinovorans NBRC 106553]
Length=511

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 225/326 (69%), Gaps = 4/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAAFVK + PEVK+IGVEP D+N +  ++  GERV+L QVG FADGVAV  +G
Sbjct  186   GGGLVAGIAAFVKYLRPEVKVIGVEPDDSNCLQAAMAAGERVVLGQVGLFADGVAVAQIG  245

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             + TF IC++ +D V+ V  D +CA+IKD++++ R+I EP+GAL++AG + Y +   L+G 
Sbjct  246   QHTFDICKQHVDEVITVSTDEICAAIKDIYDDTRSITEPAGALAVAGIKRYVEREGLRGH  305

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGAN+NFDRLR +AE A++G QREAI++  +PE PGSFK F E +G   ITEF 
Sbjct  306   TLVAIDSGANINFDRLRHVAERAELGEQREAIIAVTIPERPGSFKAFCEAIGKRQITEFN  365

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDA-MVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
             YRY++  A++ +   V  H + +  A +VE +       +DLTDN+L K H+RH++GG  
Sbjct  366   YRYNTD-AEAHIFVGVQTHPETDPRAVLVENLRSQGFPVLDLTDNELAKLHIRHMVGGHA  424

Query  606   S-VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
             + + DE++ RF FPERPGAL  FL+    +WNIT+F+YR HG A   V+ GLQVP  E  
Sbjct  425   ARISDEMVFRFEFPERPGALFNFLNKLGGRWNITMFHYRNHGAADGRVVAGLQVPIEERP  484

Query  429   EFKQRANDLGYEYAIET-SEAFQLLM  355
             +  +  + +GY Y  E+ + A+QL +
Sbjct  485   QVCEALDAIGYPYWNESDNPAYQLFL  510



>gb|ETW99105.1| L-threonine dehydratase biosynthetic IlvA [Candidatus Entotheonella 
sp. TSY2]
Length=402

 Score =   314 bits (804),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 220/318 (69%), Gaps = 3/318 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             A++VK + PE+KIIGVEP D+  M  +L  G+RV L QVG FADGVAVK+ GEETF +CR
Sbjct  71    ASYVKRLRPEIKIIGVEPVDSATMYHALQKGQRVELPQVGLFADGVAVKMAGEETFRLCR  130

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             +L+D ++ V  DA+CA+IKD+FE+ R+ILEP+GALS+AG + Y   + L  + ++ V SG
Sbjct  131   DLVDEIILVDNDAICAAIKDVFEDTRSILEPAGALSVAGVKDYVAKHKLCDQTLVAVASG  190

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR ++E A++G  REAIL+  +PE PGSFK F  L+G  N+TEF YRY+    
Sbjct  191   ANMNFDRLRHVSERAELGEAREAILAVTIPERPGSFKAFCALLGSRNVTEFNYRYADTE-  249

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS-VEDELLC  583
             ++ V   V+V ++ E  A++ER+    L  +DL+ N++ K H+RH++GG     + E L 
Sbjct  250   EAHVFVGVTVDSREETQALIERLEQHGLRALDLSHNEMAKLHIRHMVGGHAPHAKYEQLY  309

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL+ FL++ SP WNI+LF+YR HG     VLVG+QVP  +   F+   + +
Sbjct  310   RFEFPERPGALMAFLNSMSPNWNISLFHYRNHGSDPGRVLVGIQVPPEDHLAFQTFLDKI  369

Query  402   GYEYAIET-SEAFQLLMN  352
             GY Y  E+ + A+ L ++
Sbjct  370   GYVYCDESQNPAYHLFVD  387



>ref|WP_027457085.1| threonine dehydratase [Dechloromonas agitata]
Length=510

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 226/319 (71%), Gaps = 7/319 (2%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PEVK+IGVE  DA+AM  SL  G+RV L+QVG FADG AVK VGEETF +C+E 
Sbjct  192   YIKRLRPEVKVIGVETFDADAMKQSLAAGKRVRLNQVGLFADGTAVKFVGEETFRLCKEY  251

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R+ILEPSGAL++AGA+ Y + + LK +N++ +TSGAN
Sbjct  252   LDDVILVDTDAICAAIKDVFEDTRSILEPSGALAVAGAKEYARQHKLKDKNLVAITSGAN  311

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR ++E A+ G +REA+ +  LPE+PG++KKF+ L+G  N+TEF YRY +  +++
Sbjct  312   MNFDRLRFVSERAEFGERREAVFAVTLPEKPGAYKKFLALIGNRNVTEFNYRYHTA-SEA  370

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVED----EL  589
              V   V V  + E   +VE +      T+DLT++++ K+H+RH++GG   +V D    EL
Sbjct  371   HVYVGVQVADRKESLKLVESLQKHGYPTLDLTEDEMAKNHVRHMVGGHAPAVCDKGLKEL  430

Query  588   LCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAN  409
             + RF FPERPGAL+ FL   S  WNI+LF+YR HG     VLVG+QVP +E+  FK    
Sbjct  431   IYRFEFPERPGALMNFLTQMSAGWNISLFHYRNHGADYGRVLVGMQVPPSEMSAFKDFLK  490

Query  408   DLGYEYAIET-SEAFQLLM  355
             +LGY +  E+ + A++L +
Sbjct  491   NLGYAHWDESENPAYKLFL  509



>ref|WP_028993818.1| threonine dehydratase [Azonexus hydrophilus]
Length=510

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 221/319 (69%), Gaps = 7/319 (2%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PE+K+IGVE  DA+AM  S+  G RV L QVG FADG AVK VGEETF +C+E 
Sbjct  192   YIKRLRPEIKVIGVETFDADAMKQSIEKGHRVRLPQVGLFADGTAVKFVGEETFRLCKEY  251

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R+ILEPSGAL++AGA+ Y +   LK +N++ VTSGAN
Sbjct  252   LDEVILVDTDAICAAIKDVFEDTRSILEPSGALAVAGAKEYARQNKLKDKNLVAVTSGAN  311

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A+ G QREA+ +  LPE+PG++KKF+ L+G  +ITEF YRY +  +++
Sbjct  312   MNFDRLRFVAERAEFGEQREAVFAVTLPEKPGAYKKFLSLIGKRSITEFNYRYHTA-SEA  370

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-----EDEL  589
              V   V V  + E   +V+ +      T+DL+D+++ K+H+RHL+GG           EL
Sbjct  371   HVFVGVQVTDRKESLKLVDSLQKHGYPTLDLSDDEMAKNHVRHLVGGHAPAVCEQGMREL  430

Query  588   LCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAN  409
             L RF FPERPGAL+ FL   S  WNI+LF+YR HG     VLVG+QVP  E+ +F++   
Sbjct  431   LYRFEFPERPGALMNFLSQMSAGWNISLFHYRNHGADYGRVLVGMQVPPAEMKQFREFLK  490

Query  408   DLGYEYAIET-SEAFQLLM  355
             +LGY +  E+ + A++L +
Sbjct  491   NLGYAHWDESENPAYKLFL  509



>ref|WP_006216278.1| threonine ammonia-lyase [Achromobacter piechaudii]
 gb|EFF78162.1| threonine ammonia-lyase, biosynthetic [Achromobacter piechaudii 
ATCC 43553]
Length=502

 Score =   317 bits (812),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 225/325 (69%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K + PE+KIIGV+  D++AM  S+  G RV L+ VG F+DG AVK+VG
Sbjct  179   GGGLISGVAAYIKQLRPEIKIIGVQTEDSDAMLRSVRAGRRVQLNDVGLFSDGTAVKMVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
              ETF + R+ +D  V V  D++CA+IKD+F++ R++LEP+GA+++AGA+ Y   +NLKG+
Sbjct  239   AETFKLTRQYVDDFVVVNTDSICAAIKDVFQDTRSVLEPAGAMAVAGAKQYAAEHNLKGK  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ +  GANMNFDRLR +AE A+VG  REA+ +  +PE+ GSF++F ELVG  ++TEF 
Sbjct  299   TLVAIACGANMNFDRLRFVAERAEVGEMREAVFAVTMPEQRGSFRRFCELVGERSVTEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR S    ++ V   + V +  E D +          T+DLT +++ K HLRH++GGR +
Sbjct  359   YRISDAD-RAHVFVGIQVSSAAEPDKIAANFRRHGFDTLDLTHDEMAKTHLRHMVGGRST  417

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  +ELL RF FPERPGAL+ FL+A +P WNI+LF+YR  G     +L+G+QVP  +  +
Sbjct  418   LARNELLYRFEFPERPGALMRFLNAMNPDWNISLFHYRNQGADYGRILIGIQVPPADKKQ  477

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
             F+    +LGY +  ET + A++L +
Sbjct  478   FRTFVAELGYPHWNETDNPAYKLFL  502



>ref|WP_011289843.1| threonine dehydratase [Dechloromonas aromatica]
 ref|YP_287319.1| threonine dehydratase [Dechloromonas aromatica RCB]
 gb|AAZ48849.1| L-threonine ammonia-lyase [Dechloromonas aromatica RCB]
Length=510

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 226/319 (71%), Gaps = 7/319 (2%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PE+K+IGVE  DA+AM  SL  G+RV +DQVG F+DG AVK+VGEETF +C+E 
Sbjct  192   YIKRLRPEIKVIGVETFDADAMKQSLAAGKRVRVDQVGLFSDGTAVKLVGEETFRLCKEY  251

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D V+ V  DA+CA+IKD+FE+ R+ILEP+GAL++AGA+ Y + + LK +N+I +TSGAN
Sbjct  252   LDEVILVDTDAICAAIKDVFEDTRSILEPAGALAVAGAKEYARQHKLKDKNLIAITSGAN  311

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A+ G QREA+ +  LPE+PG++KKF+ L+G  N+TEF YR+ +  +++
Sbjct  312   MNFDRLRFVAERAEFGEQREAVFAVTLPEKPGAYKKFLGLIGHRNVTEFNYRFHTA-SEA  370

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-----EDEL  589
              V   V V  + E   +V+ +      T+DLTD+++ K+H+RH++GG           EL
Sbjct  371   HVFVGVQVADRKESLKLVDSLQKHGYPTLDLTDDEMAKNHIRHMVGGHAPAVCEKGMREL  430

Query  588   LCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAN  409
             L RF FPE+PGAL+ FL   S  WNI+LF+YR HG     VLVG+QVP +++ +FK+   
Sbjct  431   LYRFEFPEKPGALMNFLTQMSAGWNISLFHYRNHGADYGRVLVGMQVPPDDMGKFKEFLT  490

Query  408   DLGYEYAIET-SEAFQLLM  355
             +LGY +  E+ + A++L +
Sbjct  491   NLGYAHWDESQNPAYKLFL  509



>gb|KFH64600.1| threonine ammonia-lyase, biosynthetic [Mortierella verticillata 
NRRL 6337]
Length=552

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 216/316 (68%), Gaps = 0/316 (0%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK V P +KIIG E HDANAM  SL  G+R+ L  VG FADG AVKVVG
Sbjct  228   GGGLIAGVAAYVKRVAPHIKIIGCETHDANAMTASLKAGKRIQLTDVGLFADGAAVKVVG  287

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EE F +C+  +D ++ V  D +CA+IKD+FE+ R+I+EP+G L++AG + + + +NL  +
Sbjct  288   EEPFRLCQSFVDEMIEVTNDEICAAIKDIFEDTRSIVEPAGGLAVAGCKKWLREHNLTNK  347

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
               I VTSGANMNF+RLR +AE A +G Q+EA+LS  +PE+PG+F K    + P+ +TEF 
Sbjct  348   TCIAVTSGANMNFERLRFVAERALLGEQKEALLSVVIPEQPGAFLKLYHHIHPLMVTEFS  407

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YRY+ GR   + +  +    + E+  ++E++   D+   D++++++ K H R++IGGR  
Sbjct  408   YRYAHGRKAQIFMSFLCSDRRREVPVIMEKLADEDMQAWDISEDEMAKSHARYMIGGRSE  467

Query  603   VEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEF  424
               +E + RF FPERPGALL+FL+     WN++LF+YR HG     VL GLQVP  E +EF
Sbjct  468   AANERMFRFEFPERPGALLQFLEGLRAGWNVSLFHYRNHGSDMGKVLAGLQVPEEENEEF  527

Query  423   KQRANDLGYEYAIETS  376
              +  ++L Y +  ET+
Sbjct  528   AKYLSNLNYHWVEETN  543



>ref|WP_015203624.1| L-threonine ammonia-lyase [Crinalium epipsammum]
 ref|YP_007143020.1| L-threonine ammonia-lyase [Crinalium epipsammum PCC 9333]
 gb|AFZ13510.1| L-threonine ammonia-lyase [Crinalium epipsammum PCC 9333]
Length=503

 Score =   317 bits (811),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 222/315 (70%), Gaps = 3/315 (1%)
 Frame = -2

Query  1293  FVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICREL  1114
             ++K + PE+KIIGVEP DA+AM  SL  G RV L QVG FADGVAV+ VGEETF +C+E 
Sbjct  189   YIKRLRPEIKIIGVEPIDADAMHQSLKAGHRVRLSQVGLFADGVAVREVGEETFRLCQEY  248

Query  1113  IDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGAN  934
             +D ++ VG D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   + GE +I V  GAN
Sbjct  249   VDEIILVGTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYAEREQIAGETLIAVACGAN  308

Query  933   MNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQS  754
             MNFDRLR +AE A+ G +REAI + N+PEEPGS +KF E +G  N+TEF YR +  + ++
Sbjct  309   MNFDRLRFVAERAEFGERREAIFAVNIPEEPGSLRKFCECLGRRNLTEFNYRIADEK-EA  367

Query  753   LVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLCRF  577
              +   + +  + +   M +        TIDLTD++L K HLRH++GGR ++  +ELL RF
Sbjct  368   HIFVGLQIQNRADAIQMAQTFESCGFKTIDLTDDELTKLHLRHMVGGRSTLAHNELLYRF  427

Query  576   IFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLGY  397
              FPERPGAL++F+ + SP WNI++F+YR +G     ++VG+QVP NE+ +++   + LGY
Sbjct  428   EFPERPGALMKFVASMSPDWNISVFHYRNNGADYGRIVVGVQVPPNEMAQWQAFLDSLGY  487

Query  396   EYAIETSE-AFQLLM  355
              Y  E++  A++L +
Sbjct  488   RYWDESNNPAYKLFL  502



>ref|WP_018412054.1| L-threonine dehydratase biosynthetic IlvA [Methyloversatilis 
sp. NVD]
Length=503

 Score =   317 bits (811),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 226/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + P  +IIGVE  DA+AMA SL  G+R+ LD VG FADG AVK+VG
Sbjct  179   GGGLIAGVAAYIKRLRPNTRIIGVEASDADAMARSLAAGKRIQLDSVGLFADGAAVKLVG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + ++ +D +V V  D +CA+IKD+FE+ R+ILEP+GAL++AGA+A+    NLKG+
Sbjct  239   EETFRLAQQYVDEMVLVNTDEICAAIKDVFEDTRSILEPAGALAVAGAKAWVTRNNLKGK  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ V SGANMNFDRLR +AE A++G  REA+L+  LPE PG++++ V L+G  N+TE  
Sbjct  299   TLVAVASGANMNFDRLRFVAERAEIGESREAVLAVTLPERPGAYRELVSLLGRRNVTELN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-  607
             YRY     ++     V V  + E  ++VE +      ++DLTD+++ K H+R+++GGR  
Sbjct  359   YRYKDAN-EAHAFVGVQVSGRDEAASVVEHLGAHGFPSLDLTDDEMAKLHVRYMVGGRSP  417

Query  606   SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +V  E + RF FPERPGAL++FL+A S  WNI+LF+YR HG     VLVG+QVP  +   
Sbjct  418   AVGREQVFRFEFPERPGALMKFLEAMSRDWNISLFHYRNHGADYGRVLVGMQVPPEDAQA  477

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
              +   + LGY +  ET+  A++L +
Sbjct  478   LQDFLDSLGYAWHEETANPAYKLFL  502



>ref|WP_014086873.1| threonine dehydratase, biosynthetic [Pseudogulbenkiania sp. NH8B]
 ref|YP_004846925.1| threonine dehydratase, biosynthetic [Pseudogulbenkiania sp. NH8B]
 dbj|BAK76511.1| threonine dehydratase, biosynthetic [Pseudogulbenkiania sp. NH8B]
Length=509

 Score =   317 bits (811),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 224/316 (71%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +++K + PE+KIIGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF ICRE
Sbjct  190   SYIKRLKPEIKIIGVQPVDSDAMKQSIDKGERVELKDVGLFADGVAVKLVGEETFRICRE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I EP+GAL++A  +AY +    +G+  + +  GA
Sbjct  250   LLDEIILVDTDAICAAIKDIFEDTRSITEPAGALAVAAVKAYVEREGCQGKTFVAINCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REA+++  +PE+PGSFKKF  +VG  NITEF YRY+  +  
Sbjct  310   NMNFDRLRHVSERSELGERREAVIAVTIPEKPGSFKKFCSVVGNRNITEFNYRYADDKT-  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   V + +K ++  +++ +  ++L  +DLTDN+L K H+RHL+GG   ++ DE + R
Sbjct  369   AHVFVGVQIRSKDDVTRIIDDLKSNELDGLDLTDNELAKLHIRHLVGGHAPALRDERILR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FPERPGAL+ FLDA    WNI+LF+YR HG     VLVG+QVP  + + F+   + LG
Sbjct  429   FEFPERPGALMRFLDAMRTDWNISLFHYRNHGADYGRVLVGIQVPGYDNEAFQSFLDSLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYVEETDNPAYKLFL  504



>ref|WP_024976674.1| threonine dehydratase [Ralstonia pickettii]
Length=506

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 222/310 (72%), Gaps = 3/310 (1%)
 Frame = -2

Query  1302  IAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGIC  1123
             +AA+VK V P+VK+IGV+  D++AMA S+  G+RV L +VG FADG AVK+VG+ETF I 
Sbjct  189   VAAYVKAVRPDVKVIGVQSVDSDAMARSVAAGKRVELKEVGLFADGTAVKLVGKETFRIT  248

Query  1122  RELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTS  943
             REL+D ++ V  DA+CA++KD+F++ R++LEPSGAL++AG + Y + + LK E+++ V S
Sbjct  249   RELVDEIITVDTDAICAALKDVFQDTRSLLEPSGALALAGLKQYAETHKLKNESLVAVAS  308

Query  942   GANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVG-PMNITEFRYRYSSG  766
             GANMNFDRLR +AE A+VG  REA+ +  +PEE GSFK+F ELVG   N+TEF YR +S 
Sbjct  309   GANMNFDRLRFVAERAEVGEAREAVFAVTIPEERGSFKRFCELVGWSRNVTEFNYRIASK  368

Query  765   RAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDEL  589
              A + +   V + ++ E D + E        T+DL++++L K H+R+++GGR  + E+E 
Sbjct  369   DA-AHIFVGVQIASRAEGDKIAENFRKHGFPTLDLSNDELAKQHIRYMVGGRSPLAENEH  427

Query  588   LCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAN  409
             L RF FPERPGAL++FL + SP WNI+LF+YR  G   +N+LVG+QVP NE  EFK    
Sbjct  428   LYRFEFPERPGALMKFLSSMSPNWNISLFHYRNQGADSSNILVGIQVPKNEKREFKAFLA  487

Query  408   DLGYEYAIET  379
              LGY Y  E+
Sbjct  488   TLGYTYWDES  497



>ref|WP_013436321.1| Threonine dehydratase [Burkholderia rhizoxinica]
 ref|YP_004030236.1| Threonine dehydratase [Burkholderia rhizoxinica HKI 454]
 emb|CBW76092.1| Threonine dehydratase (EC 4.3.1.19) [Burkholderia rhizoxinica 
HKI 454]
Length=523

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 227/325 (70%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK + PE+KIIGV+  D+ AMA S+  GERV L +VG F+DG AVK+VG
Sbjct  199   GGGLIAGVAAYVKALRPEIKIIGVQTDDSCAMARSIAKGERVTLSEVGLFSDGTAVKLVG  258

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + ++ +D  V V  DA+CA+IKD+F++ R++LEP+GAL++AGA+AY +   L+G 
Sbjct  259   EETFRLVQQYVDDFVTVDTDALCAAIKDVFQDTRSVLEPAGALAVAGAKAYAEREKLEGR  318

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
               + +TSGANMNFDR+R +AE A+VG  REA+ +  +PEE GSF++F EL+G  N+TEF 
Sbjct  319   TFVAITSGANMNFDRMRFVAERAEVGEAREAVFAATIPEERGSFRRFCELIGARNVTEFN  378

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR +    Q+ +   V +  + E   + +         ++LT+++L K H+R+++GG   
Sbjct  379   YRVADAE-QAHIFVGVQIQRRDESQLIAQTFEKHGFAIVNLTNDELSKQHVRYMVGGHSP  437

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE L RF FPERPGAL++FL + +P WNI+LF+YR  G   +++LVGLQVP +E  +
Sbjct  438   LARDERLYRFAFPERPGALMKFLSSMAPDWNISLFHYRNGGADYSSILVGLQVPMDEEAQ  497

Query  426   FKQRANDLGYEYAIETSE-AFQLLM  355
             F+Q    LGY +  ET+  A+QL +
Sbjct  498   FQQFLAALGYAHWDETANPAYQLFL  522



>ref|WP_015078860.1| threonine dehydratase [Anabaena sp. 90]
 ref|YP_006995509.1| threonine dehydratase [Anabaena sp. 90]
 gb|AFW93696.1| threonine dehydratase [Anabaena sp. 90]
Length=503

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 222/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + P++KIIGVEP DANAM  SL  GERV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYVKRLRPDIKIIGVEPVDANAMYQSLQAGERVRLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ V  DA CA+IKD+FE+ R+ILEP+GAL+IAGA+ Y +   ++ + ++ V  G
Sbjct  247   QYVDEIILVDTDATCAAIKDVFEDTRSILEPAGALAIAGAKLYAEREQIQNKTLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PE  GS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVRIPEARGSLRKFCECIGKRNLTEFNYRIADQK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   V +  + +   MVE      L TIDLTD++L K HLRH++GG   + E+ELL 
Sbjct  366   EAHIFVGVQIENRADAAKMVENFESHGLKTIDLTDDELTKLHLRHMVGGHSPLAENELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVP +E  E++   ++L
Sbjct  426   RFEFPERPGALMQFVTSMSPDWNISLFHYRNNGADYGRIVVGMQVPPHETTEWQSFLDNL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E+ + A++L +
Sbjct  486   GYHYCNESDNPAYKLFL  502



>ref|WP_013213542.1| threonine deaminase [Ralstonia solanacearum]
 ref|YP_003753539.1| threonine deaminase [Ralstonia solanacearum PSI07]
 emb|CBJ52282.1| threonine deaminase [Ralstonia solanacearum PSI07]
 emb|CCA81141.1| threonine deaminase [blood disease bacterium R229]
 emb|CCA88818.1| threonine deaminase [Ralstonia syzygii R24]
Length=507

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 224/312 (72%), Gaps = 3/312 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL++GIAA+VK V P++K+IGV+  D++AMA S+  G+RV L +VG FADG AVK+VG
Sbjct  182   GGGLVSGIAAYVKTVRPDIKVIGVQTIDSDAMARSVAAGKRVELKEVGLFADGTAVKLVG  241

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             +ETF + REL+D V+ V  DA+CA++KD+F++ R++LEPSGAL++AG + Y   + LK +
Sbjct  242   KETFRLTRELVDEVITVDTDAICAALKDVFQDTRSLLEPSGALALAGLKQYAAQHKLKDQ  301

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVG-PMNITEF  787
              ++ V SGANMNFDRLR +AE A+VG  REA+ +  +PEE GSFK+F EL+G   N+TEF
Sbjct  302   ALVAVASGANMNFDRLRFVAERAEVGEAREAVFAVTIPEERGSFKRFCELIGWSRNVTEF  361

Query  786   RYRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
              YR +  + ++ +   V + ++ E D + E         ++L++++L K H+R+++GG  
Sbjct  362   NYRIAD-KNEAHIFVGVQIASRAEGDKIAEGFRKHGFPALNLSNDELAKQHIRYMVGGHS  420

Query  606   SV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
              + E+ELL RF FPERPGAL++FL + SP WNI+LF+YR  G   +N+LVG+QVP NE  
Sbjct  421   PLAENELLYRFEFPERPGALMKFLSSMSPNWNISLFHYRNQGADSSNILVGIQVPKNEKR  480

Query  429   EFKQRANDLGYE  394
             EFK     LGY+
Sbjct  481   EFKAFLATLGYK  492



>ref|WP_021477527.1| L-threonine dehydratase biosynthetic IlvA [Pseudogulbenkiania 
ferrooxidans]
 gb|ERE05769.1| L-threonine dehydratase biosynthetic IlvA [Pseudogulbenkiania 
ferrooxidans EGD-HP2]
Length=509

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 229/316 (72%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +F+K + PE+KIIGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF ICRE
Sbjct  190   SFIKRLKPEIKIIGVQPVDSDAMRQSIEKGERVELKDVGLFADGVAVKLVGEETFRICRE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I+EP+GAL++AG +AY +    +G++++ ++ GA
Sbjct  250   LLDEIILVDSDAICAAIKDIFEDTRSIVEPAGALAVAGVKAYIEREGCEGQSLVAISCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REAI++  +PE+PGSFK+F  ++G  NITEF YR++   + 
Sbjct  310   NMNFDRLRHVSERSELGERREAIIAVTIPEKPGSFKRFCSVIGGRNITEFNYRFADP-SV  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   V +  + +++ ++  +  ++L  IDLTDN+L K H+RHL+GG    ++DE + R
Sbjct  369   AHVFVGVQIAGRDDVERLIGDLREAELDGIDLTDNELAKLHIRHLVGGHAPQLKDERVLR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FP+RPGAL+ FL+A    WNI+LF+YR HG     VLVG+QVPS +   F+Q  + LG
Sbjct  429   FEFPDRPGALMRFLEAMRTDWNISLFHYRNHGADYGRVLVGIQVPSGDAQAFQQFLDTLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYIEETENPAYRLFL  504



>ref|WP_008939564.1| threonine dehydratase [Marinobacter santoriniensis]
 gb|EMP55171.1| threonine dehydratase [Marinobacter santoriniensis NKSG1]
Length=511

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 232/328 (71%), Gaps = 8/328 (2%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AG+AA++K + PE+K+IGVEP D+N +  ++  GERV+LD+VG FADGVAV+ +G
Sbjct  179   GGGLVAGMAAYIKYLRPEIKVIGVEPEDSNCLQAAMKAGERVILDEVGIFADGVAVRQIG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EE + IC++ +D V+ V  D +CA+IKD+FE+ R+I EP+GALS+AG + Y +   L+GE
Sbjct  239   EEPWKICKDNVDEVITVSTDEICAAIKDVFEDTRSIAEPAGALSVAGLKKYVQREQLEGE  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N+  V SGANMNFDRLR I+E  ++G QREAIL+  +PE+PG+FK F+  +   +ITEF 
Sbjct  299   NLAAVLSGANMNFDRLRYISERTEIGEQREAILAVTIPEKPGAFKTFINALHKRSITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTK---MELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGG  613
             YRYS   AQ+ V++ V +  +      D +V+ +  +    +DLTD+DL K H+RH++GG
Sbjct  359   YRYSD--AQNAVIF-VGIQIQAGGYGRDELVQELRETGYSVVDLTDSDLAKQHIRHMVGG  415

Query  612   RC-SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNE  436
                S+ +E + +F FPERPGALL+FL +   +WNI++F+YR HG A + VL+G QV   E
Sbjct  416   HAPSISNEKVYQFEFPERPGALLKFLMSLGTRWNISMFHYRNHGAAYSRVLLGAQVSDGE  475

Query  435   IDEFKQRANDLGYEYAIET-SEAFQLLM  355
               +F++  + +G+ Y   T +EA++L +
Sbjct  476   EQDFEKMLDKVGFRYEDMTENEAYRLFL  503



>ref|WP_026795625.1| MULTISPECIES: threonine dehydratase [Planktothrix]
Length=503

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 223/318 (70%), Gaps = 3/318 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA++K + PE+KIIGVEP DA+AM+ SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYIKRLRPEIKIIGVEPVDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             E +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++GE +I +  G
Sbjct  247   EYVDEIILVDTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGETLIAIACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEEPGS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVTIPEEPGSLRKFCECIGKRNLTEFNYRIADEK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +   ++E    +   TIDLTD++L K HLRH++GGR ++   ELL 
Sbjct  366   EAHIFVGMQIKNRADAAQIIEYFQENGFKTIDLTDDELTKLHLRHMVGGRSTLAHHELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++ G+QVP  E+ E++   + L
Sbjct  426   RFEFPERPGALMKFVCSMSPNWNISLFHYRNNGSDYGRIVAGIQVPPEEMGEWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLMN  352
             GY Y  E  + A++L ++
Sbjct  486   GYRYWDENKNPAYKLFLS  503



>ref|WP_025513893.1| threonine dehydratase [Proteobacteria bacterium JGI 0001009-D17]
Length=524

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 214/316 (68%), Gaps = 2/316 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLI+G+AA++K V PE+K+IGV+ +D++AM  S+  G+RV L  VG FADG AVK+VG
Sbjct  200   GGGLISGVAAYIKSVRPEIKVIGVQTNDSDAMLRSVKSGKRVQLHDVGLFADGTAVKMVG  259

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EETF + R L+D  + V  DA CA+IKD+F++ R+ILEPSGALS+A  + Y +    KG+
Sbjct  260   EETFRLARALVDEYIVVDTDAACAAIKDVFQDTRSILEPSGALSVAAIKQYVERERCKGK  319

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
               + +T GANMNFDRLR +AE A+VG +REA+ +  +PEE GSFK+  EL+GP  +TEF 
Sbjct  320   TFVAITCGANMNFDRLRFVAERAEVGEEREALFAVTIPEERGSFKRLCELIGPRAVTEFN  379

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR S  + Q+ VL  ++   + E D +          T+DLT ++L K H+RH++GGR +
Sbjct  380   YRISDAQ-QAHVLVGLATANRGESDKLARTFERHGFETLDLTHDELAKQHIRHMVGGRSA  438

Query  603   V-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             + +DE L RFIFPERPGAL+ FL    P WNI+LF+YR  G     +LVG+QVP  +  +
Sbjct  439   LAKDERLYRFIFPERPGALMRFLSTMHPDWNISLFHYRNQGADYGRILVGIQVPRADRKD  498

Query  426   FKQRANDLGYEYAIET  379
             F+     L Y Y  E+
Sbjct  499   FRDFLETLAYPYEDES  514



>ref|WP_026785842.1| MULTISPECIES: threonine dehydratase [Planktothrix]
Length=503

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 223/318 (70%), Gaps = 3/318 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA++K + PE+KIIGVEP DA+AM+ SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYIKRLRPEIKIIGVEPVDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             E +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++GE +I +  G
Sbjct  247   EYVDEIILVDTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGETLIAIACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEEPGS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVTIPEEPGSLRKFCECIGKRNLTEFNYRIADQK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +   ++E    +   TIDLTD++L K HLRH++GGR ++   ELL 
Sbjct  366   EAHIFVGMQIKNREDAAKIIEYFQENGFKTIDLTDDELTKLHLRHMVGGRSTLAHHELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++ G+QVP  E+ E++   + L
Sbjct  426   RFEFPERPGALMKFVCSMSPNWNISLFHYRNNGSDYGRIVAGIQVPPEEMGEWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLMN  352
             GY Y  E  + A++L ++
Sbjct  486   GYRYWDENKNPAYKLFLS  503



>ref|WP_016952509.1| L-threonine dehydratase biosynthetic IlvA [Anabaena sp. PCC 7108]
Length=503

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 221/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + P++KIIGVEP DANAM  SL  GERV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYVKRLRPDIKIIGVEPVDANAMYQSLQAGERVRLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ V  DA CA+IKD+FE+ R+ILEP+GAL+IAGA+ Y +   ++ + +I V  G
Sbjct  247   QYVDEIILVDTDATCAAIKDVFEDTRSILEPAGALAIAGAKLYAEREQIQNQTLIAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEE GS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVRIPEERGSLRKFCECIGKRNLTEFNYRIADNK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +   +VE      L TIDLTD++L K HLRH++GG   + E+ELL 
Sbjct  366   EAHIFVGMQIENRADAAKIVENFESHGLITIDLTDDELTKLHLRHMVGGHSPLAENELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVP +E  E++   + L
Sbjct  426   RFEFPERPGALMQFVTSMSPDWNISLFHYRNNGADYGRIVVGMQVPPHETVEWQSFLDTL  485

Query  402   GYEYAIETSE-AFQLLM  355
             GY Y  E+   A+QL +
Sbjct  486   GYRYWDESQNLAYQLFL  502



>ref|WP_022988357.1| L-threonine dehydratase biosynthetic IlvA [Marinobacter sp. ES-1]
 gb|ERP94684.1| L-threonine dehydratase biosynthetic IlvA [Marinobacter sp. ES-1]
Length=511

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 232/326 (71%), Gaps = 4/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA++K + P++K+IGVEP D+N +  ++  GERV+LD+VG FADGVAVK +G
Sbjct  179   GGGLIAGMAAYIKYLRPDIKVIGVEPEDSNCLQAAMAAGERVILDEVGIFADGVAVKQIG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             EE + IC++ +D V+ V  D +CA+IKD+FE+ R+I EP+GALS+AG + Y +   L+GE
Sbjct  239   EEPWNICKDAVDEVITVSTDEICAAIKDVFEDTRSIAEPAGALSVAGMKKYIEREQLEGE  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
             N+  V SGANMNFDRLR I+E  ++G +REAIL+  +PE+PG+FK F+  +   +ITEF 
Sbjct  299   NLAGVLSGANMNFDRLRYISERTEIGEKREAILAVTIPEKPGAFKTFINALHKRSITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHT-KMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
             YRY+   +++++   + +    +  + +V+ +  S    IDLTD+DL K H+RH++GG  
Sbjct  359   YRYADA-SEAVIFVGIQIQAGGLGREELVQELRESGYSVIDLTDSDLAKQHIRHMVGGHA  417

Query  606   -SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
              SV +E++ +F FPERPGALL+FL +   +WNI+LF+YR HG A + VL+G QV   EI 
Sbjct  418   PSVSNEVIYQFEFPERPGALLKFLMSLGTRWNISLFHYRNHGAAYSRVLLGAQVNEAEIP  477

Query  429   EFKQRANDLGYEYAIET-SEAFQLLM  355
             +F++    +G+ Y   T +EA++L +
Sbjct  478   DFEKMLEKVGFRYENMTDNEAYRLFL  503



>ref|WP_026098107.1| threonine dehydratase [Oscillatoria sp. PCC 10802]
Length=503

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 224/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM  SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYVKRLRPEIKIIGVEPVDADAMHQSLKAGHRVRLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             E +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL++AGA+AY +   ++G+ ++ V  G
Sbjct  247   EYVDDIILVDTDDTCAAIKDVFEDTRSILEPAGALAVAGAKAYVEREQIQGQTLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEE GS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVTIPEERGSLRKFCECIGKRNLTEFNYRIADEK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   V +  + +   MV     + L T+DLTD++L K HLRH++GGR  +  +ELL 
Sbjct  366   EAHIFVGVQIQNRADAANMVATFEANGLKTLDLTDDELTKLHLRHMVGGRSPLAHNELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI++F+YR +G     ++VG+QVP +E++E++   + L
Sbjct  426   RFEFPERPGALMKFVTSMSPDWNISVFHYRNNGSDYGRIVVGMQVPPHEMEEWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E+ + A++L +
Sbjct  486   GYRYWDESQNPAYKLFL  502



>dbj|BAP90004.1| threonine dehydratase [Burkholderiales bacterium GJ-E10]
Length=519

 Score =   316 bits (809),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 219/325 (67%), Gaps = 3/325 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGLIAG+AA+VK V PEVKIIGV+  D++AMA SL  G RV L +VG F+DG AV++VG
Sbjct  195   GGGLIAGVAAYVKAVQPEVKIIGVQTVDSDAMARSLAAGRRVQLAEVGLFSDGTAVRMVG  254

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             + TF +CR  +D +V V  DA+CA+IKD+F++ R+ILEP+GALS+AG + Y     L+  
Sbjct  255   KYTFDLCRRYVDEIVTVDTDALCAAIKDVFQDTRSILEPAGALSVAGCKQYAAGKRLRER  314

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ +TSGANMNFDRLR +AE A+VG QREA+ +  LPEE GSFK+F  L+G   ITEF 
Sbjct  315   TLVAITSGANMNFDRLRFVAERAEVGEQREALFAVTLPEERGSFKRFCGLLGTRAITEFN  374

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCS  604
             YR S   A + +   V    + +  A+      +   T DLTD++L K+HLR+++GG   
Sbjct  375   YRISDA-ATAHIFVGVETAGRDDARALARSFEQAGFATSDLTDDELAKEHLRYMVGGHSP  433

Query  603   VE-DELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDE  427
             +  DE + RF FPERPGAL+ FL A SP WNI+LF+YR  G     +LVG+Q P  +   
Sbjct  434   LAVDERVFRFEFPERPGALMRFLSAMSPAWNISLFHYRNQGSDYGRILVGMQAPKRDRAA  493

Query  426   FKQRANDLGYEYAIET-SEAFQLLM  355
              K+   DLGY+Y  ET S A++L +
Sbjct  494   VKRFLADLGYQYQEETGSGAYRLFL  518



>ref|WP_027248872.1| threonine dehydratase [Planktothrix agardhii]
Length=503

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 223/318 (70%), Gaps = 3/318 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA++K + PE+KIIGVEP DA+AM+ SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYIKRLRPEIKIIGVEPVDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             E +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++GE +I +  G
Sbjct  247   EYVDEIILVDTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGETLIAIACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEEPGS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVTIPEEPGSLRKFCECIGKRNLTEFNYRIADEK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +   ++E    +   TIDLTD++L K HLRH++GGR ++   ELL 
Sbjct  366   EAHIFVGMQIKNREDAAQIIEYFQENGFKTIDLTDDELTKLHLRHMVGGRSTLAHHELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++ G+QVP  E+ E++   + L
Sbjct  426   RFEFPERPGALMKFVCSMSPNWNISLFHYRNNGSDYGRIVAGIQVPPEEMGEWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLMN  352
             GY Y  E  + A++L ++
Sbjct  486   GYRYWDENKNPAYKLFLS  503



>ref|WP_004364990.1| threonine dehydratase [Pseudomonas aeruginosa]
 gb|ABJ15294.1| threonine dehydratase, biosynthetic [Pseudomonas aeruginosa UCBPP-PA14]
 gb|EKA47821.1| threonine dehydratase [Pseudomonas aeruginosa CI27]
 gb|EOT10678.1| threonine ammonia-lyase, biosynthetic [Pseudomonas aeruginosa 
PA14]
 gb|ERV25358.1| threonine ammonia-lyase, biosynthetic [Pseudomonas aeruginosa 
BL16]
 gb|ERV78807.1| threonine ammonia-lyase, biosynthetic [Pseudomonas aeruginosa 
BWHPSA027]
 gb|ETV12068.1| threonine ammonia-lyase, biosynthetic [Pseudomonas aeruginosa 
BWHPSA044]
 gb|EZO62451.1| threonine ammonia-lyase, biosynthetic [Pseudomonas aeruginosa 
BWH058]
Length=504

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 222/326 (68%), Gaps = 4/326 (1%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK + PE+K+IGVEP ++N +  ++  GERVML QVG FADGVAV  +G
Sbjct  179   GGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGERVMLGQVGLFADGVAVAQIG  238

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             + TF IC++ +D V+ V  D +CA+IKD++++ R+I EP+GAL++AG + Y +    +G+
Sbjct  239   QHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITEPAGALAVAGIKKYVERERAEGQ  298

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGAN+NFDRLR +AE A++G +REAI++  +PE PGSFK F E VG   ITEF 
Sbjct  299   TLVAIDSGANVNFDRLRHVAERAELGERREAIIAVTIPERPGSFKAFCEAVGKRQITEFN  358

Query  783   YRYSSGRAQSLVLYRVSVHTKME-LDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC  607
             YRY SG +++ +   V  H + +  +A+V  +       +DLTDN+L K H+RH++GG  
Sbjct  359   YRYHSG-SEAHIFVGVQTHPENDPREALVAYLREKGFPVLDLTDNELAKLHIRHMVGGHA  417

Query  606   -SVEDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEID  430
               V DE++ RF FPERPGAL  FL     +WNI++F+YR HG A   V+ GLQVP +E  
Sbjct  418   VKVSDEMVFRFEFPERPGALFNFLTKLGGRWNISMFHYRNHGAADGRVVAGLQVPEDERH  477

Query  429   EFKQRANDLGYEYAIETSE-AFQLLM  355
                Q    +GY Y  ET+  A+QL +
Sbjct  478   LIPQTLEAIGYPYWDETANPAYQLFL  503



>gb|KEI68621.1| IlvA [Planktothrix agardhii NIVA-CYA 126/8]
Length=503

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 223/318 (70%), Gaps = 3/318 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA++K + PE+KIIGVEP DA+AM+ SL  G RV L QVG FADGVAV+ VGEETF +C+
Sbjct  187   AAYIKRLRPEIKIIGVEPVDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGEETFRLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             E +D ++ V  D  CA+IKD+FE+ R+ILEP+GAL+IAGA+AY +   ++GE +I +  G
Sbjct  247   EYVDEIILVDTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGETLIAIACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A+ G +REAI +  +PEEPGS +KF E +G  N+TEF YR +  + 
Sbjct  307   ANMNFDRLRFVAERAEFGERREAIFAVTIPEEPGSLRKFCECIGKRNLTEFNYRIADEK-  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +   ++E    +   TIDLTD++L K HLRH++GGR ++   ELL 
Sbjct  366   EAHIFVGMQIKNREDAAQIIEYFQENGFKTIDLTDDELTKLHLRHMVGGRSTLAHHELLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++ G+QVP  E+ E++   + L
Sbjct  426   RFEFPERPGALMKFVCSMSPNWNISLFHYRNNGSDYGRIVAGIQVPPEEMGEWQAFLDTL  485

Query  402   GYEYAIET-SEAFQLLMN  352
             GY Y  E  + A++L ++
Sbjct  486   GYRYWDENKNPAYKLFLS  503



>ref|WP_008953892.1| threonine dehydratase, biosynthetic [Pseudogulbenkiania ferrooxidans]
 gb|EEG08364.1| threonine dehydratase, biosynthetic [Pseudogulbenkiania ferrooxidans 
2002]
Length=509

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 224/316 (71%), Gaps = 3/316 (1%)
 Frame = -2

Query  1296  AFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICRE  1117
             +++K + PE+K+IGV+P D++AM  S+  GERV L  VG FADGVAVK+VGEETF ICRE
Sbjct  190   SYIKRLKPEIKVIGVQPVDSDAMKQSIDKGERVELKDVGLFADGVAVKLVGEETFRICRE  249

Query  1116  LIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSGA  937
             L+D ++ V  DA+CA+IKD+FE+ R+I EP+GAL++A  +AY +    +G+  + +  GA
Sbjct  250   LLDEIILVDTDAICAAIKDIFEDTRSITEPAGALAVAAVKAYVEREGCQGKTFVAINCGA  309

Query  936   NMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRAQ  757
             NMNFDRLR ++E +++G +REA+++  +PE+PGSFKKF  +VG  NITEF YRY+  +  
Sbjct  310   NMNFDRLRHVSERSELGERREAVIAVTIPEKPGSFKKFCSVVGNRNITEFNYRYADDKT-  368

Query  756   SLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRC-SVEDELLCR  580
             + V   V + +K ++  +++ +  ++L  +DLTDN+L K H+RHL+GG   ++ DE + R
Sbjct  369   AHVFVGVQISSKDDVTRIIDDLKSNELDGLDLTDNELAKLHIRHLVGGHAPALRDERILR  428

Query  579   FIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDLG  400
             F FPERPGAL+ FLDA    WNI+LF+YR HG     VLVG+QVP  + + F+   + LG
Sbjct  429   FEFPERPGALMRFLDAMRTDWNISLFHYRNHGADYGRVLVGIQVPGCDNEAFQTFLDSLG  488

Query  399   YEYAIET-SEAFQLLM  355
             Y Y  ET + A++L +
Sbjct  489   YPYVEETDNPAYKLFL  504



>ref|WP_012761143.1| threonine dehydratase [Ralstonia pickettii]
 ref|YP_002980318.1| threonine dehydratase [Ralstonia pickettii 12D]
 gb|ACS61646.1| threonine dehydratase, biosynthetic [Ralstonia pickettii 12D]
Length=506

 Score =   315 bits (807),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/309 (51%), Positives = 221/309 (72%), Gaps = 3/309 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK V P+VK+IGV+  D++AMA S+  G+RV L +VG FADG AVK+VG+ETF I R
Sbjct  190   AAYVKAVRPDVKVIGVQSVDSDAMARSVAAGKRVELKEVGLFADGTAVKLVGKETFRITR  249

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             EL+D ++ V  DA+CA++KD+F++ R++LEPSGAL++AG + Y + + LK E+++ V SG
Sbjct  250   ELVDEIITVDTDAICAALKDVFQDTRSLLEPSGALALAGLKQYAETHKLKNESLVAVASG  309

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVG-PMNITEFRYRYSSGR  763
             ANMNFDRLR +AE A+VG  REA+ +  +PEE GSFK+F ELVG   N+TEF YR +S  
Sbjct  310   ANMNFDRLRFVAERAEVGEAREAVFAVTIPEERGSFKRFCELVGWSRNVTEFNYRIASKD  369

Query  762   AQSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELL  586
             A + +   V + ++ E D + E        T+DL++++L K H+R+++GGR  + E+E L
Sbjct  370   A-AHIFVGVQIASRAEGDKIAENFRKHGFPTLDLSNDELAKQHIRYMVGGRSPLAENEHL  428

Query  585   CRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRAND  406
              RF FPERPGAL++FL + SP WNI+LF+YR  G   +N+LVG+QVP NE  EFK     
Sbjct  429   YRFEFPERPGALMKFLSSMSPNWNISLFHYRNQGADSSNILVGIQVPKNEKREFKAFLAT  488

Query  405   LGYEYAIET  379
             LGY Y  E+
Sbjct  489   LGYTYWDES  497



>ref|WP_006515732.1| L-threonine ammonia-lyase [Leptolyngbya sp. PCC 7375]
 gb|EKV01335.1| L-threonine ammonia-lyase [Leptolyngbya sp. PCC 7375]
Length=503

 Score =   315 bits (807),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 222/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  1299  AAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVGEETFGICR  1120
             AA+VK + PE+KIIGVEP DA+AM  SL  G+RV L QVG FADGVAV  VGEETF +C+
Sbjct  187   AAYVKRLRPEIKIIGVEPKDADAMYQSLKLGQRVKLSQVGLFADGVAVSQVGEETFWLCQ  246

Query  1119  ELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGENIIVVTSG  940
             + +D ++ VG D  CA+IKD+FE+ R+I+EP+GAL+IAGA+AY K   +K E ++ V  G
Sbjct  247   QYVDDIIRVGTDDTCAAIKDVFEDTRSIVEPAGALAIAGAKAYVKQTGIKDETLVAVACG  306

Query  939   ANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFRYRYSSGRA  760
             ANMNFDRLR +AE A++G QREAI +  +PE+ GS K+F + +G  N+TEF YR +    
Sbjct  307   ANMNFDRLRFVAERAELGEQREAIFAVTIPEQSGSLKRFCDHIGKRNLTEFNYRIADN-T  365

Query  759   QSLVLYRVSVHTKMELDAMVERMILSDLHTIDLTDNDLVKDHLRHLIGGRCSV-EDELLC  583
             ++ +   + +  + +  AM ER   +   T+DLTD++L K HLRH++GG  ++ ++E L 
Sbjct  366   EAHIFVGLQICDRNDAIAMKERFEANGFKTLDLTDDELTKMHLRHMVGGHSNLAKNERLY  425

Query  582   RFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPSNEIDEFKQRANDL  403
             RF FPERPGAL++F+ + SP WNI+LF+YR +G     ++VG+QVP  E++E++     L
Sbjct  426   RFEFPERPGALMKFVSSMSPNWNISLFHYRNNGSDYGRIVVGMQVPPEEMNEWQAFLETL  485

Query  402   GYEYAIET-SEAFQLLM  355
             GY Y  E  + A+QL +
Sbjct  486   GYRYWEENDNPAYQLFL  502



>ref|WP_038706016.1| threonine dehydratase [Pseudomonas mosselii]
 gb|AIN58266.1| threonine dehydratase [Pseudomonas mosselii SJ10]
Length=520

 Score =   315 bits (808),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 221/330 (67%), Gaps = 12/330 (4%)
 Frame = -2

Query  1323  GGGLIAGIAAFVKMVNPEVKIIGVEPHDANAMALSLHHGERVMLDQVGGFADGVAVKVVG  1144
             GGGL+AGIAA+VK + PEVK+IGVEP D+N +  +L  GERV+L QVG FADGVAV  VG
Sbjct  195   GGGLVAGIAAYVKYLRPEVKVIGVEPQDSNCLQAALAAGERVVLPQVGTFADGVAVAQVG  254

Query  1143  EETFGICRELIDGVVFVGRDAMCASIKDMFEERRNILEPSGALSIAGAEAYCKYYNLKGE  964
             E  F +CR  +D VV VG D +CA+IKD++++ R+I EPSGAL++AG + Y     L+G+
Sbjct  255   EHCFELCRHFVDEVVTVGSDELCAAIKDIYDDTRSITEPSGALAVAGIKRYVAREGLQGQ  314

Query  963   NIIVVTSGANMNFDRLRCIAELADVGGQREAILSTNLPEEPGSFKKFVELVGPMNITEFR  784
              ++ + SGAN+NFDRLR +AE A++G QREAI++  +PE PGSF+ F   +G   ITEF 
Sbjct  315   TLVAIDSGANVNFDRLRHVAERAELGEQREAIIAVTIPERPGSFRAFCLALGKRQITEFN  374

Query  783   YRYSSGRAQSLVLYRVSVHTKMELDAMVERMILSDL-----HTIDLTDNDLVKDHLRHLI  619
             YRY  G+   L    V V T  + D    + +L+ L       +DLTDN+L K H+RH +
Sbjct  375   YRYYPGKEARLF---VGVQTHPQQDP--RQQLLASLGEQGYQVLDLTDNELAKLHVRHTV  429

Query  618   GGRCSV-EDELLCRFIFPERPGALLEFLDAFSPQWNITLFNYRAHGEAGANVLVGLQVPS  442
             GG  +    E + RF FPERPGALL FL+    +WNI+LF+YR HG A A V  GL+VP 
Sbjct  430   GGHAAPGAGERVLRFEFPERPGALLGFLERLGKRWNISLFHYRNHGAAQARVFAGLEVPE  489

Query  441   NEIDEFKQRANDLGYEYAIET-SEAFQLLM  355
             +E+    +  +++GY+Y  ET + A++L M
Sbjct  490   DELAGLPRALDEMGYQYWDETENPAYRLFM  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3533760161090