BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25267_g1_i1 len=2209 path=[733:0-553 1286:554-578 168:579-770
1501:771-778 66:779-849 253:850-873 1602:874-912 316:913-989
1714:990-1008 598:1009-1099 1823:1100-1150 1874:1151-1177
1901:1178-1214 1938:1215-1252 1976:1253-1254 1978:1255-1315
2038:1316-1332 456:1333-1391 2113:1392-1403 2125:1404-1446
2167:1447-1449 526:1450-1474 2194:1475-1502 2222:1503-1549
2268:1550-1569 687:1570-1649 2367:1650-1693 2411:1694-2208]

Length=2209
                                                                      Score     E

ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               488   7e-161   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               474   3e-155   
dbj|BAM36727.1|  nicotine N-demethylase                                 468   2e-153   
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               468   8e-153   
dbj|BAM36726.1|  nicotine N-demethylase                                 463   2e-151   
dbj|BAM36723.1|  nicotine N-demethylase                                 463   2e-151   
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           463   3e-151   
dbj|BAM36724.1|  nicotine N-demethylase                                 461   8e-151   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               460   2e-150   
dbj|BAM36725.1|  nicotine N-demethylase                                 458   2e-149   
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    456   2e-148   
gb|ABC69375.1|  CYP82M1v4                                               454   7e-148   Nicotiana tabacum [American tobacco]
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   454   8e-148   Nicotiana tabacum [American tobacco]
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           454   1e-147   
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               454   1e-147   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           454   1e-147   Vitis vinifera
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             453   2e-147   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                453   2e-147   Vitis vinifera
gb|ABD39477.1|  CYP82E4v6                                               453   2e-147   Nicotiana tabacum [American tobacco]
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               452   2e-147   
gb|ABD39479.1|  CYP82E4v8                                               453   2e-147   Nicotiana tabacum [American tobacco]
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               452   3e-147   
gb|ADP65809.1|  nicotine N-demethylase                                  452   3e-147   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           452   4e-147   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           452   5e-147   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               452   6e-147   
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 451   8e-147   Nicotiana tabacum [American tobacco]
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 451   9e-147   Nicotiana tabacum [American tobacco]
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               451   1e-146   
gb|ABC69374.1|  CYP82M1v3                                               451   1e-146   Nicotiana tabacum [American tobacco]
gb|ABD39476.1|  CYP82E4v5                                               451   1e-146   Nicotiana tabacum [American tobacco]
gb|ABC69371.1|  CYP82E5                                                 451   1e-146   Nicotiana tabacum [American tobacco]
gb|ABD39474.1|  CYP82E4v3                                               450   2e-146   Nicotiana tabacum [American tobacco]
gb|ABX56037.1|  CYP82E5v2                                               450   3e-146   Nicotiana tabacum [American tobacco]
gb|ABC69373.1|  CYP82M1v2                                               450   3e-146   Nicotiana tabacum [American tobacco]
gb|ABC69376.1|  CYP82M1v5                                               450   3e-146   Nicotiana tabacum [American tobacco]
gb|ABD39478.1|  CYP82E4v7                                               449   4e-146   Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               449   5e-146   Nicotiana tabacum [American tobacco]
gb|ABD39475.1|  CYP82E4v4                                               449   5e-146   Nicotiana tabacum [American tobacco]
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             449   7e-146   
gb|ABD39481.1|  CYP82E4v11                                              448   1e-145   Nicotiana tabacum [American tobacco]
gb|ABD39480.1|  CYP82E4v10                                              447   2e-145   Nicotiana tabacum [American tobacco]
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                447   3e-145   Vitis vinifera
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           447   3e-145   
gb|ABD39482.1|  CYP82E4v12                                              446   9e-145   Nicotiana tabacum [American tobacco]
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               445   9e-145   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     449   1e-144   Vitis vinifera
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               446   1e-144   
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               446   2e-144   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           445   2e-144   Nicotiana sylvestris
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               446   2e-144   
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               445   3e-144   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           443   9e-144   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 442   4e-143   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           441   6e-143   
gb|ABD39483.1|  CYP82E2v2                                               440   2e-142   Nicotiana tabacum [American tobacco]
emb|CDP15065.1|  unnamed protein product                                439   5e-142   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   439   5e-142   Nicotiana tabacum [American tobacco]
emb|CAN61061.1|  hypothetical protein VITISV_018742                     439   6e-142   Vitis vinifera
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           438   1e-141   
emb|CBI36491.3|  unnamed protein product                                440   1e-141   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               436   7e-141   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             436   1e-140   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                435   2e-140   Vitis vinifera
gb|ABD39485.1|  CYP82E2v4                                               434   3e-140   Nicotiana tabacum [American tobacco]
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             434   5e-140   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           433   1e-139   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   432   1e-139   
gb|ABD39484.1|  CYP82E2v3                                               432   1e-139   Nicotiana tabacum [American tobacco]
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         431   7e-139   
gb|ABC69420.1|  CYP82E8                                                 431   7e-139   Nicotiana tabacum [American tobacco]
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               430   1e-138   Vitis vinifera
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               430   2e-138   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   5e-138   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    430   6e-138   Vitis vinifera
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               429   6e-138   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     428   8e-138   Vitis vinifera
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           428   1e-137   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               428   1e-137   
ref|XP_010104162.1|  Cytochrome P450 82C4                               426   1e-137   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   2e-137   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               427   2e-137   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   2e-137   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               427   2e-137   
ref|XP_007049681.1|  Cytochrome P450                                    427   3e-137   
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               426   7e-137   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     424   1e-136   Vitis vinifera
dbj|BAA35080.1|  putative cytochrome P450                               425   1e-136   Nicotiana tabacum [American tobacco]
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               425   2e-136   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           425   2e-136   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               424   3e-136   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             424   3e-136   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               425   4e-136   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           424   4e-136   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             423   1e-135   Populus trichocarpa [western balsam poplar]
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         422   3e-135   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             421   5e-135   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     420   5e-135   Vitis vinifera
ref|XP_010106089.1|  Cytochrome P450 82C4                               421   8e-135   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    422   1e-134   
ref|XP_006376421.1|  cytochrome P450 family protein                     419   3e-134   
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   3e-134   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    419   6e-134   
ref|XP_002510298.1|  cytochrome P450, putative                          418   7e-134   Ricinus communis
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    418   7e-134   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               417   9e-134   
emb|CDP15728.1|  unnamed protein product                                416   4e-133   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     416   6e-133   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   8e-133   
ref|XP_002531094.1|  cytochrome P450, putative                          415   1e-132   Ricinus communis
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               415   2e-132   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    415   2e-132   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               412   7e-132   
emb|CDP15727.1|  unnamed protein product                                415   7e-132   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   411   4e-131   
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               410   4e-131   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               410   5e-131   
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               411   5e-131   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               410   7e-131   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             410   1e-130   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             409   1e-130   Populus trichocarpa [western balsam poplar]
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    410   1e-130   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           409   2e-130   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    409   3e-130   Vitis vinifera
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             408   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               409   4e-130   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             408   6e-130   
emb|CBI29738.3|  unnamed protein product                                414   7e-130   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     407   8e-130   
emb|CBI37514.3|  unnamed protein product                                424   1e-129   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               407   1e-129   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             407   1e-129   
gb|KEH25406.1|  cytochrome P450 family protein                          407   1e-129   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           406   3e-129   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               405   8e-129   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             404   2e-128   
ref|XP_002531093.1|  cytochrome P450, putative                          404   2e-128   Ricinus communis
gb|KHG29587.1|  Cytochrome P450 protein                                 404   2e-128   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               404   3e-128   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           403   4e-128   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    403   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           403   5e-128   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     403   5e-128   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    403   5e-128   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           403   5e-128   Vitis vinifera
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         404   6e-128   
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 402   1e-127   
emb|CDY23316.1|  BnaA08g12300D                                          402   1e-127   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               402   2e-127   
emb|CDY53704.1|  BnaC03g67210D                                          401   2e-127   
emb|CDP03915.1|  unnamed protein product                                399   2e-127   
ref|XP_002869304.1|  CYP82C4                                            401   2e-127   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               401   3e-127   
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             401   3e-127   
ref|XP_002869302.1|  CYP82C4                                            400   4e-127   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               400   5e-127   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    400   7e-127   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           400   7e-127   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         400   7e-127   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               400   8e-127   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               397   2e-126   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    399   2e-126   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               399   2e-126   
emb|CDP00859.1|  unnamed protein product                                399   2e-126   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             399   3e-126   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    397   3e-126   
ref|XP_007017415.1|  Cytochrome P450, putative                          398   4e-126   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     396   4e-126   Vitis vinifera
gb|KHG07864.1|  Cytochrome P450 protein                                 397   5e-126   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               397   6e-126   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             397   8e-126   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               397   9e-126   
ref|XP_002510313.1|  cytochrome P450, putative                          397   1e-125   Ricinus communis
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           397   1e-125   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             397   2e-125   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             396   2e-125   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         396   2e-125   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               396   2e-125   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               396   3e-125   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     393   4e-125   Vitis vinifera
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             395   5e-125   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   9e-125   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           403   9e-125   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               394   1e-124   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               394   1e-124   Vitis vinifera
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           393   2e-124   Vitis vinifera
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               394   3e-124   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     393   3e-124   
ref|XP_002510297.1|  cytochrome P450, putative                          393   3e-124   Ricinus communis
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             394   3e-124   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           393   3e-124   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   393   4e-124   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             393   4e-124   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     393   4e-124   Vitis vinifera
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               392   7e-124   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    392   7e-124   
gb|ABK28662.1|  unknown                                                 392   7e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    392   7e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               392   8e-124   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    407   8e-124   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   9e-124   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               391   1e-123   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               391   1e-123   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               397   1e-123   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     390   1e-123   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             391   2e-123   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   2e-123   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           391   2e-123   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             391   2e-123   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       388   3e-123   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             390   3e-123   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   390   4e-123   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     390   4e-123   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     390   5e-123   Vitis vinifera
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             388   5e-123   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                390   6e-123   Vitis vinifera
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             389   8e-123   
ref|XP_010106082.1|  Cytochrome P450 82A3                               389   1e-122   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               388   1e-122   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               390   1e-122   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           389   1e-122   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     387   1e-122   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           389   1e-122   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                392   2e-122   Vitis vinifera
ref|XP_010092357.1|  Cytochrome P450 82A3                               389   2e-122   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             389   2e-122   
emb|CBI32510.3|  unnamed protein product                                390   3e-122   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           387   4e-122   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           388   4e-122   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           387   4e-122   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               388   5e-122   
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             387   5e-122   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               387   7e-122   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    386   1e-121   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           387   1e-121   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           386   1e-121   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           385   2e-121   
dbj|BAF98469.1|  cytochrome P450                                        385   2e-121   Coptis japonica var. dissecta
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     385   2e-121   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           386   3e-121   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           385   3e-121   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               385   3e-121   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               385   3e-121   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             385   4e-121   
ref|XP_007017413.1|  Cytochrome P450                                    385   4e-121   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   385   6e-121   
ref|XP_007047111.1|  Cytochrome P450                                    385   7e-121   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                384   8e-121   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               384   9e-121   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             384   1e-120   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             384   1e-120   
ref|XP_010091295.1|  Cytochrome P450 82G1                               385   1e-120   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             382   1e-120   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             384   1e-120   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   384   1e-120   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   1e-120   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    384   2e-120   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   2e-120   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               398   2e-120   Vitis vinifera
emb|CAN66846.1|  hypothetical protein VITISV_002367                     383   2e-120   Vitis vinifera
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 383   2e-120   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         383   3e-120   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             382   4e-120   
ref|XP_006375029.1|  putative cytochrome P450 family protein            382   4e-120   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               382   4e-120   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           382   5e-120   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         382   5e-120   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                382   8e-120   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               382   9e-120   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       382   1e-119   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           381   1e-119   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     382   1e-119   
ref|XP_010106088.1|  Cytochrome P450 82A4                               380   2e-119   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               380   2e-119   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   2e-119   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               380   2e-119   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               380   3e-119   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   380   4e-119   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             379   4e-119   
gb|KHG26594.1|  Cytochrome P450                                         380   4e-119   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    380   4e-119   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           379   4e-119   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               379   4e-119   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               380   5e-119   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           379   5e-119   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         379   6e-119   
emb|CDP15067.1|  unnamed protein product                                378   6e-119   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               379   6e-119   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    379   6e-119   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            379   7e-119   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               393   7e-119   
gb|KEH18125.1|  cytochrome P450 family protein                          378   9e-119   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     375   1e-118   
ref|XP_007017411.1|  Cytochrome P450, putative                          379   1e-118   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   377   1e-118   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    379   1e-118   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           379   1e-118   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         379   1e-118   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           378   1e-118   
gb|KGN59915.1|  Cytochrome P450                                         378   2e-118   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    378   3e-118   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    377   3e-118   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           377   3e-118   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               377   4e-118   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           378   4e-118   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         377   5e-118   
ref|XP_002510312.1|  cytochrome P450, putative                          377   5e-118   
ref|XP_010686309.1|  PREDICTED: cytochrome P450 CYP82D47-like           377   5e-118   
emb|CBI40977.3|  unnamed protein product                                377   6e-118   
ref|XP_010106083.1|  Cytochrome P450 82A3                               377   6e-118   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    377   6e-118   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             374   9e-118   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    376   1e-117   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         376   1e-117   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           375   1e-117   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    375   2e-117   
ref|XP_009758036.1|  PREDICTED: cytochrome P450 82C4-like               372   2e-117   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    375   3e-117   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    375   3e-117   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    375   4e-117   
ref|XP_010686299.1|  PREDICTED: cytochrome P450 CYP82D47-like           375   4e-117   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           374   4e-117   
gb|KHN36187.1|  Cytochrome P450 82A3                                    375   4e-117   
emb|CDP07593.1|  unnamed protein product                                372   5e-117   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         374   7e-117   
gb|KHN04536.1|  Cytochrome P450 82A1                                    372   8e-117   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    374   8e-117   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           374   9e-117   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               374   9e-117   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               372   1e-116   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           374   1e-116   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     377   1e-116   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               374   1e-116   
ref|XP_002885694.1|  CYP82G1                                            373   1e-116   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    372   1e-116   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             373   1e-116   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   374   1e-116   
emb|CBI19610.3|  unnamed protein product                                385   2e-116   
gb|KHN42044.1|  Cytochrome P450 82A3                                    373   2e-116   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             373   2e-116   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    372   3e-116   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               372   4e-116   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    379   5e-116   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           372   5e-116   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                371   6e-116   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             370   7e-116   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    371   8e-116   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     378   9e-116   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    370   1e-115   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    371   1e-115   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             371   1e-115   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           371   1e-115   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               370   2e-115   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               370   2e-115   
gb|ABK55756.1|  P450 monooxygenase-like protein                         370   2e-115   
gb|KHG24650.1|  Cytochrome P450 protein                                 370   2e-115   
gb|KHG01223.1|  Cytochrome P450 protein                                 370   3e-115   
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   367   3e-115   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           370   3e-115   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     370   3e-115   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               370   4e-115   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               367   4e-115   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               370   4e-115   
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             367   5e-115   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             369   5e-115   
gb|KHG01290.1|  Cytochrome P450                                         369   6e-115   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    369   6e-115   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     369   6e-115   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                369   7e-115   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         370   7e-115   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               369   7e-115   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             369   9e-115   
emb|CDP16080.1|  unnamed protein product                                369   1e-114   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             370   1e-114   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         368   1e-114   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         368   2e-114   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               368   2e-114   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               368   2e-114   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                367   2e-114   
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   2e-114   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               368   2e-114   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         366   3e-114   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   4e-114   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               367   4e-114   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   4e-114   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     366   5e-114   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   5e-114   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               366   7e-114   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               367   7e-114   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               364   9e-114   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               366   9e-114   
ref|XP_010106079.1|  Cytochrome P450 82A3                               366   1e-113   
gb|EYU23761.1|  hypothetical protein MIMGU_mgv1a004606mg                365   1e-113   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               366   1e-113   
gb|AII31758.1|  cytochrome P450 monooxygenase                           365   1e-113   
ref|NP_189154.1|  cytochrome P450, family 82, subfamily G, polype...    365   2e-113   
gb|AII31759.1|  cytochrome P450 monooxygenase                           365   2e-113   
emb|CDP07595.1|  unnamed protein product                                375   2e-113   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           365   2e-113   
gb|KHG29694.1|  Cytochrome P450                                         365   2e-113   
gb|KHN22284.1|  Cytochrome P450 82A3                                    362   3e-113   
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    364   3e-113   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               364   3e-113   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             364   3e-113   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           364   3e-113   
ref|XP_002885686.1|  CYP82G1                                            363   5e-113   
gb|AII31760.1|  cytochrome P450 monooxygenase                           364   5e-113   
gb|KHG29695.1|  Cytochrome P450                                         363   5e-113   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           364   6e-113   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             363   6e-113   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    364   6e-113   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                363   7e-113   
gb|KHN42045.1|  Cytochrome P450 82C4                                    361   8e-113   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    364   8e-113   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               363   9e-113   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               363   9e-113   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           363   9e-113   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           363   1e-112   
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    363   1e-112   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               363   1e-112   
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           363   1e-112   
emb|CBI19611.3|  unnamed protein product                                374   1e-112   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   2e-112   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    363   2e-112   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   3e-112   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               362   3e-112   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               362   3e-112   
ref|XP_011073191.1|  PREDICTED: cytochrome P450 82C4-like               362   3e-112   
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   3e-112   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   4e-112   
gb|ABB20912.1|  P450 mono-oxygenase                                     362   4e-112   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    362   4e-112   
ref|XP_010106080.1|  Cytochrome P450 82A3                               365   4e-112   
ref|XP_010513989.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    361   4e-112   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    361   7e-112   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               361   8e-112   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             360   8e-112   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               359   9e-112   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               360   1e-111   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           361   1e-111   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               360   1e-111   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           360   2e-111   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               359   2e-111   
gb|AAS90126.1|  cytochrome P450                                         360   2e-111   
ref|XP_010466938.1|  PREDICTED: cytochrome P450 82G1-like               360   2e-111   
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           357   2e-111   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    360   3e-111   
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         359   6e-111   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         358   6e-111   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               358   6e-111   
ref|XP_006418652.1|  hypothetical protein EUTSA_v10002489mg             358   7e-111   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           358   8e-111   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               358   1e-110   
gb|KHN36186.1|  Cytochrome P450 82A3                                    358   1e-110   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     357   2e-110   
ref|XP_002510308.1|  cytochrome P450, putative                          357   2e-110   
gb|KHN00733.1|  Cytochrome P450 82A4                                    357   3e-110   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               357   3e-110   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               356   4e-110   
ref|XP_003618354.1|  Cytochrome P450                                    357   4e-110   
gb|AGO03797.1|  cytochrome P450-like protein                            356   4e-110   
emb|CBI32505.3|  unnamed protein product                                370   5e-110   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               356   7e-110   
ref|XP_007047112.1|  Cytochrome P450                                    361   7e-110   
ref|XP_008464762.1|  PREDICTED: cytochrome P450 CYP82D47-like           356   9e-110   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               355   1e-109   
gb|KEH30997.1|  cytochrome P450 family protein                          355   1e-109   
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     354   1e-109   
ref|XP_010036784.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    355   1e-109   
ref|XP_010036783.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    354   2e-109   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           357   3e-109   
gb|KHG07801.1|  Cytochrome P450                                         354   3e-109   
ref|XP_010036782.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    354   3e-109   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           354   4e-109   
ref|XP_007136642.1|  hypothetical protein PHAVU_009G061400g             352   4e-109   
ref|NP_001240972.1|  cytochrome P450 82A3                               353   5e-109   
ref|XP_003619137.1|  Cytochrome P450                                    353   6e-109   
ref|XP_003619141.1|  Cytochrome P450                                    353   8e-109   
ref|XP_010089020.1|  Cytochrome P450 82A3                               352   9e-109   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           352   1e-108   
gb|KHN16362.1|  Cytochrome P450 82A3                                    352   2e-108   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               352   2e-108   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               352   2e-108   
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           352   2e-108   
ref|XP_002510311.1|  cytochrome P450, putative                          352   2e-108   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           352   3e-108   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               352   3e-108   
gb|KEH37856.1|  cytochrome P450 family protein                          351   4e-108   
ref|XP_002510301.1|  cytochrome P450, putative                          350   4e-108   
ref|XP_002883585.1|  CYP82G1                                            350   5e-108   
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           350   5e-108   
ref|XP_009136105.1|  PREDICTED: cytochrome P450 82G1                    350   7e-108   
gb|AJD25200.1|  cytochrome P450 CYP82D70                                350   7e-108   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    364   7e-108   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     364   9e-108   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             350   9e-108   
gb|KHN22283.1|  Cytochrome P450 82C4                                    347   1e-107   
ref|XP_006297446.1|  hypothetical protein CARUB_v10013469mg             349   2e-107   
gb|EYU23760.1|  hypothetical protein MIMGU_mgv1a026908mg                348   2e-107   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           350   2e-107   



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   488 bits (1256),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 242/490 (49%), Positives = 334/490 (68%), Gaps = 14/490 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             GG P++GHL QF    +  L + LAT+ADK GPVF  R+GLP ILVVSS +AVKD   TN
Sbjct  42    GGWPVIGHLLQFSGADDIPLSRKLATLADKYGPVFTFRLGLPCILVVSSYDAVKDCLCTN  101

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DKA A RP   AG Y+GYNNA L     G +WRK+RK+V+ E+LS+++LEK K + +SE+
Sbjct  102   DKAFAARPASLAGEYIGYNNAMLFLANYGPYWRKIRKIVLQEVLSSSRLEKLKFVRVSEI  161

Query  1596  NLSVKQLYGSVTKNRE-----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDA  1432
               S+ +LY  ++   E     V+V++  WI  + L+++ K++A K Y   VE G + ++A
Sbjct  162   QTSINELYSLISVAGENVDFPVKVNVTNWIEKLTLSLIVKMIAGKSYG-RVEKGGNEEEA  220

Query  1431  VVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR  1252
                ++A KD M ++ EF   DAFP  +F W+D +G ++ MK+     D VLQ W+DEH++
Sbjct  221   ERFKKALKDFMYISMEFVLWDAFPIALFKWIDFQGHVKFMKRTFKDIDCVLQNWLDEHLK  280

Query  1251  ---RGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
                R D+  G + DF D+M+ ++  E  A   ++R+T IKATA++M+ DA++TT  ++ W
Sbjct  281   KKERVDVVDGNEQDFIDVMLSMMSNEDFA-DGHSRETTIKATALSMVLDASDTTAIHLNW  339

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
             +MA LLNH+DVMK++QEE+DTKVGR RWV++SD  NLVY QAVVKE +RLYP  PL  P 
Sbjct  340   VMATLLNHRDVMKKVQEELDTKVGRNRWVEESDIKNLVYFQAVVKETLRLYPPAPLLVPH  399

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGW  724
             ESI+DC V GYHIPKGT+L+VN  KL RDPKIW  P  F PERFLT ++  D   +Q+ +
Sbjct  400   ESIEDCIVQGYHIPKGTRLWVNTMKLQRDPKIWSNPNTFDPERFLTSQAGCDVRGQQYEF  459

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             I FG  RRSCP   YA+++ H  +A LLQGFDF+TPS  P+DM EG G+TM K  P++ +
Sbjct  460   IPFGSRRRSCPGITYAIQVTHLAIAHLLQGFDFSTPSNEPLDMKEGLGMTMRKVNPIEVM  519

Query  543   LTPRLPAASY  514
             +TPR P+  Y
Sbjct  520   ITPRFPSVLY  529



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   474 bits (1220),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/502 (48%), Positives = 340/502 (68%), Gaps = 25/502 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQF--KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             GG P++GHL QF    +  L + LAT+A+K GPVF  R+GLPRILVVSS EAV+D   TN
Sbjct  46    GGWPVIGHLLQFFGADDIPLSRKLATLAEKYGPVFTFRLGLPRILVVSSYEAVRDCLNTN  105

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DKA A RP   AG Y+GYNNA L   + G +WRK+RK+V+ E+LS+++LEK K + +SE+
Sbjct  106   DKAFAARPASLAGEYIGYNNAMLFLASYGPYWRKIRKIVLQEVLSSSRLEKLKIVRVSEV  165

Query  1596  NLSVKQLYG---------SVTKNR--------EVEVDMEEWIGYVNLNIMSKIMAKKRYN  1468
               S+K+L+          S+T +          V++++  WI  + L+++ K++A K Y 
Sbjct  166   QTSIKELFSLFPVTGDHSSITGDNFPVTGDYVPVKLNLTNWIEKLTLSLIVKMIAGKSYG  225

Query  1467  YSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTD  1288
                E G D ++A   ++A KD M ++ EF   DAFP  +F W+D +G ++ MK+     D
Sbjct  226   RLNEKGEDEEEAERFKKALKDFMYISMEFVLWDAFPIPLFKWIDFQGHVKFMKRTFKDID  285

Query  1287  AVLQGWIDEHVRRG---DLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQ  1117
              VLQ W+DEH+++    D+ AG + DF D+M+ ++  E  A  +YTR+T IKATA++M+ 
Sbjct  286   CVLQNWLDEHMKKREEVDVVAGNEQDFIDVMLSMMSNEDFA-DSYTRETTIKATALSMVL  344

Query  1116  DAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECM  937
             DA++TT  ++ W+MA LLNH+DVMK++QEE+DTKVGR RWV++SD  NLVY QAV+KE +
Sbjct  345   DASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWVEESDIKNLVYFQAVIKETL  404

Query  936   RLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-E  760
             RLYP  PL  P ES++DC V GYHIPKGT+L+VN  KL RDP+IW +P+ F PERFLT +
Sbjct  405   RLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRDPEIWSDPDTFDPERFLTCQ  464

Query  759   SVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPG  580
             +  D   +Q+ +I FG GRRSCP   YA ++ H  +A LLQGFDF TP   P++M EG G
Sbjct  465   AGFDVRGQQYEFIPFGSGRRSCPGITYASQVTHLAIAHLLQGFDFTTPFNEPLEMKEGLG  524

Query  579   VTMPKAKPVKALLTPRLPAASY  514
             +TM K  P++ L+TPRLP+  Y
Sbjct  525   MTMRKVNPIEVLITPRLPSVLY  546



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   468 bits (1204),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/519 (44%), Positives = 348/519 (67%), Gaps = 14/519 (3%)
 Frame = -2

Query  2046  VVAISGVLIILPFLYLSL--RkqknktkkpppepPGGLPILGHLFQFKKETH---LVKAL  1882
             + AI+GV+ ++ FL+  L  +K +  +K  PP+ PGG P++GHLF F  +     L + L
Sbjct  5     IEAIAGVVTLVTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1881  ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALA  1702
               +ADK GPV+  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNNA L 
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLF  124

Query  1701  FTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEW  1525
                 G +WRK RK+++ E+LS ++LEK+KH+ ++++   +K LY  +  N    +++ +W
Sbjct  125   LANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRIDGNSST-INLTDW  183

Query  1524  IGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFH  1345
             +  +N  ++ K++A K Y    E G  ++     + AFKD M L+ EF   DAFP  +F 
Sbjct  184   LEELNFGLIVKMIAGKNY----ESGKGDEQVERFKNAFKDFMILSMEFVLWDAFPIPLFK  239

Query  1344  WLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPA-GEDPDFFDIMMKVVDQEFIAGQ  1168
             W+D +G ++AMK+     D+V Q W++EH+++ ++ A G + DF D+++  +  E++  +
Sbjct  240   WVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL-DE  298

Query  1167  NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDD  988
              Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+N+++ +K+ QEEIDTKVG++RWV++
Sbjct  299   GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEE  358

Query  987   SDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPK  808
             SD  +LVYLQA+VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL RDPK
Sbjct  359   SDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPK  418

Query  807   IWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFD  628
             +WP P+ F PERF+   + D   + + +I FG GRRSCP   YAL++ H  +ARL+QGF+
Sbjct  419   LWPNPDNFDPERFVAADI-DFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFN  477

Query  627   FATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
             + TP+  P+DM EG G+T+ K  PV+ ++TPRL    YN
Sbjct  478   YRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELYN  516



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   468 bits (1204),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 237/509 (47%), Positives = 336/509 (66%), Gaps = 32/509 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             GG P++GHL QF    +  L + LAT+A+K GPVF  R+GLPR+LVVSS +AV+D    N
Sbjct  46    GGWPVIGHLLQFSGADDIPLSRKLATLAEKYGPVFTFRLGLPRVLVVSSYDAVRDCLNAN  105

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DKA A RP   AG Y+GYNNA L  ++ G +WRK+RK+V+ E+LS+++LEK K++ +SE+
Sbjct  106   DKAFAARPASLAGEYIGYNNAMLFLSSYGPYWRKIRKIVLQEVLSSSRLEKLKNVRVSEL  165

Query  1596  NLSVKQLYG---------SVTKNRE---------------VEVDMEEWIGYVNLNIMSKI  1489
               S+K+L+          SVT +                 V++++  WI  + L+++ K+
Sbjct  166   QTSIKELFSLFPVTGDHSSVTGDHSSITGDNLPVTGDYVPVKLNLTNWIEKLTLSLIVKM  225

Query  1488  MAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMK  1309
             +A K Y    E   D ++A   ++A KD M ++ EF   DAFP  +F W+D +G ++ MK
Sbjct  226   IAGKSYGRLNEKAEDEEEAERFKKALKDFMYISMEFVLWDAFPIPLFKWIDFQGHVKFMK  285

Query  1308  KVSDGTDAVLQGWIDEHVRRG---DLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKA  1138
             +     D VLQ W+DEHV++    D+ AG + DF D+M+ ++  E  A  +YTR+T IKA
Sbjct  286   RTFKDIDCVLQNWLDEHVKKREGVDVVAGNEQDFIDVMLSMMSNEDFA-DSYTRETTIKA  344

Query  1137  TAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQ  958
             TA++M+ DA++TT  ++ W+MA+LLNH+DVMK++QEE+DTK+ R RWV++SD  NLVY Q
Sbjct  345   TALSMVLDASDTTAIHLNWVMAILLNHRDVMKKVQEELDTKISRNRWVEESDIKNLVYFQ  404

Query  957   AVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKP  778
             AV+KE +RLYP  PL  P ES++DC V GYHIPKGT+L+VN  KL RDP+IW  P+ F P
Sbjct  405   AVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRDPEIWSNPDTFDP  464

Query  777   ERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPV  601
             ERFLT     D   +Q+ +I FG GRRSCP   YA ++ H  +A LLQGFDF+T    P+
Sbjct  465   ERFLTSQAGFDVRGQQYEFIPFGSGRRSCPGITYATQVTHLAIAHLLQGFDFSTLLNEPL  524

Query  600   DMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             DM EG G+TM K  P++ L+ PRLP+  Y
Sbjct  525   DMKEGLGMTMRKVNPIEVLIMPRLPSVLY  553



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   463 bits (1192),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/518 (44%), Positives = 345/518 (67%), Gaps = 14/518 (3%)
 Frame = -2

Query  2046  VVAISGVLIILPFLYLSL--RkqknktkkpppepPGGLPILGHLFQFKKETH---LVKAL  1882
             + AI G + ++ FL+  L  +K +  +K  PP+ PGG P++GHLF F  +     L + L
Sbjct  5     IEAIVGAVTLITFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1881  ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALA  1702
               +ADK GPV+  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNN  L 
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1701  FTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEW  1525
                 G +WRK RK+V+ E+LS ++LEK+KH+ ++++   +K LY  +  N    +++ +W
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRIDGNSST-INLTDW  183

Query  1524  IGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFH  1345
             +  +N  ++ K++A K Y    E G  ++     + AFKD M L+ EF   DAFP  +F 
Sbjct  184   LEELNFGLIVKMIAGKNY----ESGKGDEQVERFKNAFKDFMILSMEFVLWDAFPIPLFK  239

Query  1344  WLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPA-GEDPDFFDIMMKVVDQEFIAGQ  1168
             W+D +G ++AMK+     D+V Q W++EH+++ ++ A G + DF D+++  +  E++  +
Sbjct  240   WVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL-DE  298

Query  1167  NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDD  988
              Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+N+++ +K+ QEEIDTKVG++RWV++
Sbjct  299   GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEE  358

Query  987   SDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPK  808
             SD  +LVYLQA+VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL RDPK
Sbjct  359   SDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPK  418

Query  807   IWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFD  628
             +WP P+KF PERF+   + D   + + +I FG GRRSCP   YAL++ H  +ARL+QGF+
Sbjct  419   LWPNPDKFDPERFIAGDI-DFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFN  477

Query  627   FATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             + TP+  P+DM EG G+T+ K  PV+ ++TPRL    Y
Sbjct  478   YRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAHELY  515



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   463 bits (1191),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 215/483 (45%), Positives = 327/483 (68%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPV+  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G FWRK RK+++ E+LS ++LEK+KH+ +++
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNAMLFLANYGPFWRKNRKLIIQEVLSASRLEKFKHVRLAK  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +   +K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTGIKDLYSRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+++ ++
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREV  273

Query  1239  PA-GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
              A G + DF D+++  +  E++  + Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+
Sbjct  274   NAEGNEQDFIDVVLSKMSNEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLI  332

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+++ +K+ QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+++DC
Sbjct  333   NNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDC  392

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGR  703
              V+GYHIPKGT+L+ N+ KL RDPK+WP P+ F PERF+  ++ D   + + +I FG GR
Sbjct  393   VVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFVAANI-DFRGQHYEYIPFGSGR  451

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP   YAL++ H  +ARL+QGF++ TP+  P+DM EG G+T+ K  PV+ ++TPRL  
Sbjct  452   RSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITICKVNPVEVIITPRLAP  511

Query  522   ASY  514
               Y
Sbjct  512   ELY  514



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   463 bits (1191),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 323/484 (67%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  37    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  96

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK LA RP   AG  +GY  A   +   G ++ +VRK+ + ++LS+TKLEK KHI +SE
Sbjct  97    HDKDLAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQQVLSSTKLEKMKHIRVSE  156

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             M  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  157   METSIKELYSLALVKNNIQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  212

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ MKK+    D +LQGW+D+H+ + D
Sbjct  213   RKAFKGIMYVVGQIVLYDAIPFPLFKYFDFQGHIKLMKKIYKDLDYILQGWLDDHMMKKD  272

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   ED D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  273   V-NNEDQDAMDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  331

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERWV+D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  332   NNPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  391

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +VAGYHIPKGT+L++N WK+HRDP+IW EPE+F PERFLT     D   + F +I FG G
Sbjct  392   KVAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPERFLTSKANVDARGQNFEFIPFGSG  451

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+TPS  P+DM+EG GVT+PK   V+ L++PRLP
Sbjct  452   RRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKVNQVEVLISPRLP  511

Query  525   AASY  514
             +  Y
Sbjct  512   SKLY  515



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   461 bits (1187),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 327/483 (68%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPV+  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+++ E+LS ++LEK+KH+ +++
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAK  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +   +K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTGIKDLYSRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+++ ++
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREV  273

Query  1239  PA-GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
              A G + DF D+++  +  E++  + Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+
Sbjct  274   NAEGNEQDFIDVVLSKMSNEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLI  332

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+++ +K+ QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+++DC
Sbjct  333   NNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDC  392

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGR  703
              V+GYHIPKGT+L+ N+ KL RDPK+WP P+ F PERF+  ++ D   + + +I FG GR
Sbjct  393   VVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFVAANI-DFRGQHYEYIPFGSGR  451

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP   YAL++ H  +ARL+QGF++ TP+  P+DM EG G+T+ K  PV+ ++TPRL  
Sbjct  452   RSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITIRKVNPVEVIITPRLAP  511

Query  522   ASY  514
               Y
Sbjct  512   ELY  514



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   460 bits (1184),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/487 (44%), Positives = 324/487 (67%), Gaps = 16/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G++WRK RK+++ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNAMLFLANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+++ + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREK  273

Query  1239  -----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
                    G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W M
Sbjct  274   IMEVGTEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGM  332

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+L+N+++ +K+ QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+
Sbjct  333   ALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHEN  392

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITF  715
             ++DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF+   + D   + + +I F
Sbjct  393   VEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFIARDI-DFHGQHYEYIPF  451

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PVK ++TP
Sbjct  452   GSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITP  511

Query  534   RLPAASY  514
             RL    Y
Sbjct  512   RLAPELY  518



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   458 bits (1178),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/517 (44%), Positives = 343/517 (66%), Gaps = 13/517 (3%)
 Frame = -2

Query  2046  VVAISG-VLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH---LVKALA  1879
             + AI G V + L F +L  +K +  +K  PP+ PGG P++GHLF F  +     L + L 
Sbjct  5     IEAIVGLVTLTLLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1878  TMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF  1699
              +ADK GPV+  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNNA L  
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1698  TT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEWI  1522
                G +WRK RK+++ E+LS ++LEK+KH+ ++++   +K LY  +  N    +++ +W+
Sbjct  125   ANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRIDGNSST-INLTDWL  183

Query  1521  GYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
               +N  ++ K++A K Y    E G  ++     + AFKD M L+ EF   DAFP  +F W
Sbjct  184   EELNFGLIVKMIAGKNY----ESGKGDEQVERFKNAFKDFMILSMEFVLWDAFPIPLFKW  239

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPA-GEDPDFFDIMMKVVDQEFIAGQN  1165
             +D +G ++AMK+     D+V Q W++EH+++ ++ A G + DF D+++  +  E++  + 
Sbjct  240   VDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL-DEG  298

Query  1164  YTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDS  985
             Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+N+++ +K+ QEEIDTKVG++RWV++S
Sbjct  299   YSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEES  358

Query  984   DTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKI  805
             D  +LVYLQA+VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL RDPK+
Sbjct  359   DIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKL  418

Query  804   WPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDF  625
             W  P+KF PERF+   + D   + + +I FG GRRSCP   YAL++ H  +A L+QGF++
Sbjct  419   WSNPDKFDPERFIAGDI-DFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNY  477

Query  624   ATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              TP+  P+DM EG G+T+ K  PV+ ++TPRL    Y
Sbjct  478   RTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  514



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   456 bits (1173),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 326/482 (68%), Gaps = 9/482 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL        + + L  +AD+ GPVF +R+G+   LVVSS EAVKD FTTNDK
Sbjct  50    GAWPVIGHLHLLGGRVPVYRTLGGLADRYGPVFTVRLGVHTALVVSSWEAVKDCFTTNDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTTGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
              L  RP   AG YLGY+ AA  F+ G +WR++RK+V++E+LS  +LE  K++W SE++ S
Sbjct  110   ILNKRPASSAGKYLGYDYAAFGFSHGTYWRQMRKLVLLEVLSARRLESLKNVWESEIHTS  169

Query  1587  VKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFK  1408
             + +LY    K+    V + EWI  + LN +  ++A KRY  S + G +  +A   R+  K
Sbjct  170   INELY---KKHSGKVVVISEWIERLTLNTIVMMIAGKRYTDSTQ-GDETVEARSFRELIK  225

Query  1407  DVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPA--  1234
             + M ++G+F ++DA PF    W+D +G I++MK++S     V + WI EHVR  D  +  
Sbjct  226   EFMYISGQFVASDAIPFPPLRWMDFQGHIKSMKRISKELSTVFERWITEHVR-SDCKSRL  284

Query  1233  GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHK  1054
             G + DF D+M+  +D++F +   +TR+TIIKATA+ ++   ++TT  ++ W++++LLN++
Sbjct  285   GNEQDFIDVMLSTIDEKFTSF-GHTRETIIKATALNLILAGSDTTSIHLTWLLSLLLNNR  343

Query  1053  DVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVA  874
              VM++ QEEID KVG+ERWV +SD  NLVYLQAVVKE +RL+P  PL  P E+++DC VA
Sbjct  344   QVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVVKETLRLFPPGPLSVPHEAMEDCCVA  403

Query  873   GYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRS  697
             GYH+PKGT+L VN+WKLHRDP+IW EP+ F PERFLT  V  D   +   ++ FG GRRS
Sbjct  404   GYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPERFLTSHVAVDFTGQNHEFVPFGSGRRS  463

Query  696   CPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAAS  517
             CP   +A+++ H  LARLLQGFD ATPS  PVDM+EG  +T+PKA P++ ++TPRL    
Sbjct  464   CPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMTEGLSITLPKATPLEVVITPRLSDGL  523

Query  516   YN  511
             Y 
Sbjct  524   YQ  525



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   454 bits (1168),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 318/484 (66%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK LA RP   AG  +GY  A   +   G ++ +VRK+ +  +LS+TKLEK KHI +SE
Sbjct  101   HDKDLAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERW++D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRDP+IW EPEKF P RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P+DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   454 bits (1167),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 322/487 (66%), Gaps = 16/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGY NA L     G++WRK RK+++ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYKNAMLFLANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+++ + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREK  273

Query  1239  -----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
                    G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++   M
Sbjct  274   IMEVGTEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINCGM  332

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+L+N+++ +K+ QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+
Sbjct  333   ALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHEN  392

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITF  715
             ++DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF+   + D   + + +I F
Sbjct  393   VEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFIARDI-DFHGQHYEYIPF  451

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PVK ++TP
Sbjct  452   GSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITP  511

Query  534   RLPAASY  514
             RL    Y
Sbjct  512   RLAPELY  518



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   454 bits (1167),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/484 (45%), Positives = 318/484 (66%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK  A RP   AG  +GY  A   +   G ++ +VRK+ +  +LS+TKLEK KHI +SE
Sbjct  101   HDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERW++D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRDP+IW EPEKF P+RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPDRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P+DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   454 bits (1167),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/485 (45%), Positives = 323/485 (67%), Gaps = 11/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  PI+GHL  F   K   L +    ++D+ GP+F I++G+ R  V+++ EA KD FT N
Sbjct  42    GSWPIIGHLRGFGDGKNVPLARTFGKLSDQYGPIFTIKLGMYRYCVINNWEAAKDCFTIN  101

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DK LA RP   A  + GYN A  +F   G ++ +VRK+V+  +LS+T+LEK KH+  SE+
Sbjct  102   DKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKHVRTSEV  161

Query  1596  NLSVKQLYGSVTK-NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +S+K+LY    K +    +++ +W   + LNI+ K++A KRY  S+E    +++A   R
Sbjct  162   EISIKELYNLCGKGDNSNTINISKWFEKLTLNIIVKMIAGKRY-ISLEK---DEEAQCFR  217

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AF  +M L GEF   DA PF+IF ++D +G I+ MK++    D +LQ W++EH+ +  +
Sbjct  218   KAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKI  277

Query  1239  PA--GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                   + D  D M+ V   E      YTRDT+IKAT ++M+ D ++TT  ++ W+M++L
Sbjct  278   EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKATVLSMILDGSDTTAVHLTWLMSLL  337

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+  VM  +Q+EID KVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+++D
Sbjct  338   LNNPHVMSHVQKEIDNKVGKDRWVEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVED  397

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTE-SVPDGLARQFGWITFGF  709
             C VAGY+IPKGT+L+ N WK+ RDP+++ EP+KF PERFL E S  D   + F +I FG 
Sbjct  398   CTVAGYNIPKGTRLFPNAWKIQRDPRVYSEPDKFMPERFLNEHSNVDARGQHFEFIPFGS  457

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCP   +A ++AH  + RL+QGF+F TPS +PVDM+EG G+TMPKAKPV+ ++TPRL
Sbjct  458   GRRSCPGINFATQVAHLTIGRLIQGFNFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRL  517

Query  528   PAASY  514
              +  Y
Sbjct  518   NSMLY  522



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   454 bits (1168),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 237/528 (45%), Positives = 342/528 (65%), Gaps = 15/528 (3%)
 Frame = -2

Query  2073  HTAMDALIRVVAISGVL--IILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKET  1900
              ++MD L ++VAISG+L  ++L  ++  +        +  PEP G  P LGHL   + +T
Sbjct  23    QSSMDTLSQLVAISGILGLVLLYGVWRVMILAGKSKGRSAPEPFGAWPFLGHLPILRGQT  82

Query  1899  HLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGY  1720
              + + L  MADK GPVF+IR+G+ R LVVSS EAVK+ FTTNDK  A RP+  AG  LGY
Sbjct  83    PIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKILGY  142

Query  1719  NNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE--  1549
             N+A   F   GA WR++RK+ ++E+LS  +L+  KH+ ISE++LS+K LY S+ K  +  
Sbjct  143   NHAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLY-SLGKGSDWF  201

Query  1548  --VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSS  1375
               V+V M EW  +++ NI+ K++A KRY  +  HG  N++A       + ++ LTG F  
Sbjct  202   HPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHG--NEEARRAIATIQKLLFLTGAFVL  259

Query  1374  ADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKV  1195
             +DA P     W+D +G + +MK+V+   D+++ GW++EH  R +    +  DF D+M+ V
Sbjct  260   SDAIPG--VEWMDSQGYLGSMKQVAKEVDSLVGGWVEEHEMRLNSEGNKRQDFIDVMLSV  317

Query  1194  VDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTK  1015
             ++   + G  ++R+T+IKAT M ++    +T  +   W+++ LLN+K  +K  QEE+D K
Sbjct  318   LEDTSMFG--HSRETVIKATIMILIVGGTDTVSTTSTWLLSALLNNKHALKCAQEELDLK  375

Query  1014  VGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVN  835
             VGR RWV++SD  NL+YLQAV+KE +RLY   PL  P E+++DC VAGYHIPKGT+L+VN
Sbjct  376   VGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVN  435

Query  834   IWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHF  658
              WKLHRDP +W +PE F+PERFLT     D L + F  I FG GRRSCP    ALK+   
Sbjct  436   AWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPL  495

Query  657   ILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             ++ RLLQGFD +TP   PVDM EG  +T+ K  P++ +LTPRLP+  Y
Sbjct  496   VIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRLPSQFY  543



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   453 bits (1165),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/524 (44%), Positives = 342/524 (65%), Gaps = 17/524 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD L   +AI+G+L+++ +L+    +         P+P G LPI+GHL + +    + K 
Sbjct  1     MDFLSHPLAIAGLLVLVLYLWRVRIQSHKIKGMLAPQPSGALPIIGHLHKLR--VPVFKT  58

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA MADK GP+F I +G   +LV+S+ +AVK  FT ND   A RP    G YLGYN A  
Sbjct  59    LAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGF  118

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY-----GSVTKNREVE  1543
              F+  G +WR +RKMV+VELLS  +L+  KH+ ISE++  +K L+       +      +
Sbjct  119   GFSPYGPYWRDMRKMVMVELLSIRRLQNLKHVQISEVDAFIKGLFLLCKTEGLNGLNPTK  178

Query  1542  VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAF  1363
             V + +WI ++ LN++++++A KRY  S + G + +   ++    K+ M ++G   +AD  
Sbjct  179   VVISDWIEHLTLNVITRMIAGKRYFDSSDEGDEQRFGKIV----KEFMYVSGNPVAADVI  234

Query  1362  PFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQE  1183
              F    W+D +G ++AMK++    D+V+  W++EH  + +  + ++ DF D+MM V++  
Sbjct  235   GFP--SWIDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMMSVIEDN  292

Query  1182  FIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRE  1003
                G  YTR+TIIKAT+M ++   +ETT  N++WI+++LLN++  +K  QEE+D KVGR+
Sbjct  293   STLG--YTRETIIKATSMNLILAGSETTAINLIWILSLLLNNRHALKLAQEELDLKVGRD  350

Query  1002  RWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKL  823
             RW++D+D +NL YLQA+VKE +RLYP  PL  P E++QDC+V G+HIPKGT+L+VN+WKL
Sbjct  351   RWIEDTDIENLPYLQAIVKETLRLYPPGPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKL  410

Query  822   HRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILAR  646
             HRDP +WP+PE F PERFLT  V  D   + F +I FG GRRSCP + +AL++ H  L R
Sbjct  411   HRDPCLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGR  470

Query  645   LLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LLQGF+ ATP  MPVD++EG G+TMPKA  ++ +LTPRL    Y
Sbjct  471   LLQGFELATPMDMPVDLTEGLGITMPKATSLEVILTPRLSFEFY  514



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   453 bits (1165),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/525 (45%), Positives = 338/525 (64%), Gaps = 15/525 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVL--IILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV  1891
             MD   ++VAISG+L  ++L  ++  +        +  PEP G  P LGHL   + +T + 
Sbjct  1     MDTPSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIF  60

Query  1890  KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNA  1711
             + L  MADK GPVF+IR+G+ R LVVSS EAVK+ FTTNDK  A RP+  AG  LGYN A
Sbjct  61    RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYA  120

Query  1710  ALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE----V  1546
                F   GA WR++RK+ ++E+LS  +L+  KH+ ISE++LS+K LY S+ K  +    V
Sbjct  121   GFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLY-SLGKGSDWVHPV  179

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V M EW  +++ NI+ K++A KRY  +  HG +     +     ++ ++L+G F  +DA
Sbjct  180   KVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEEARRAI--ATIQEFLSLSGAFVLSDA  237

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
              P     W+D++G + +MK+V+   D+++ GW++EH  R +       DF D+M+ V++ 
Sbjct  238   IPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLED  295

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               + G  ++R+T+IKAT + ++    ET  +   W+++ LLN+K  +KR QEE+D KVGR
Sbjct  296   TSMFG--HSRETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGR  353

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              RWV++SD  NL+YLQAV+KE +RLY   PL  P E+++DC VAGYHIPKGT+L+VN WK
Sbjct  354   GRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWK  413

Query  825   LHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP +W +PE F+PERFLT     D L + F  I FG GRRSCP    ALK+   ++ 
Sbjct  414   LHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIG  473

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGFD +TP   PVDM EG  +T+ K  P++ +LTPRLP+  Y
Sbjct  474   RLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRLPSQFY  518



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   453 bits (1165),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 320/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+WP+P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLLRDPKLWPDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   452 bits (1164),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/521 (43%), Positives = 335/521 (64%), Gaps = 20/521 (4%)
 Frame = -2

Query  2046  VVAISGVLIILPFL--YLSLRkqknktkkpppepPGGLPILGHLFQFKKETH---LVKAL  1882
             + AI G + ++ FL  +L  +K +  +K  P + PGG P++GHLF F  +     L + L
Sbjct  5     IEAIVGAVTLITFLLYFLCTKKSQKHSKPLPTKIPGGWPVIGHLFHFNNDGDDRPLARKL  64

Query  1881  ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALA  1702
               +ADK GPVF  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNN  L 
Sbjct  65    GDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1701  FTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEW  1525
                 G +WRK RK+V+ E+LS ++LEK+K +  + +  S+K LY  +  N    +++ +W
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRINGNSST-INLSDW  183

Query  1524  IGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFH  1345
             +  +N  ++ K++A K Y    E G  ++     + AFKD M L+ EF   DAFP  +F 
Sbjct  184   LEELNFGLIVKMIAGKNY----ESGKGDEQVERFKNAFKDFMVLSMEFVLWDAFPIPLFK  239

Query  1344  WLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL----PAGEDPDFFDIMMKVVDQEFI  1177
             W+D +G I+AMK+     D+V Q W++EH+ + +       G + DF D+++  + +E++
Sbjct  240   WVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSKEYL  299

Query  1176  AGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERW  997
               + Y+RDT+IKAT  +++ DAA+T   ++ W MA+L+N+++ +K+ QEEIDTKVG++RW
Sbjct  300   -DEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRW  358

Query  996   VDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHR  817
             V++SD  +LVYLQA+VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL R
Sbjct  359   VEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQR  418

Query  816   DPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQ  637
             DPK+WP P+ F PERF    V D   + + +I FG GRRSCP   YAL++ H  +A L+Q
Sbjct  419   DPKLWPNPDNFDPERF----VIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQ  474

Query  636   GFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             GF++ TP+  P+DM EG G+T+ K   V+ L+ PRL    Y
Sbjct  475   GFNYRTPTNEPLDMKEGAGITIRKVNSVEVLIKPRLAPELY  515



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   453 bits (1165),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 320/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRAFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+VN+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFVNVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   452 bits (1164),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/525 (44%), Positives = 344/525 (66%), Gaps = 19/525 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD L   +AI+G+L+++ +L+    +         P+P G LPI+GHL + +    + K 
Sbjct  1     MDFLSHPLAIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRGP--IFKT  58

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA MADK GP+F I +G   +LV+S+ +AVK  FT ND   A RP    G YLGYN A  
Sbjct  59    LAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGF  118

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE------V  1546
              F+  G +WR +RKMV+VELLS+ +L+  KH+ ISE++  +K L+  + K  E       
Sbjct  119   GFSPYGPYWRDMRKMVMVELLSSRRLQNLKHVQISEVDAFIKGLF-LLCKTEEHNGLNPT  177

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V + +WI ++ LN++++++A KRY  S   G + +   ++    K+ M ++G   ++D 
Sbjct  178   KVVISDWIEHLTLNVITRMIAGKRYFDSSYEGDEQRFGKIV----KEFMYVSGNPVASDV  233

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
               F    W+D +G I+AMK++    D+V+  W++EH  +    + +D DF D+M+ V++ 
Sbjct  234   IGFP--SWIDFKGQIKAMKRIMKELDSVMGSWVEEHYAKKQTDSRDDHDFIDVMISVIED  291

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
                 G  YTR+TIIKAT++ ++   +ETT  N++WI+++LLN++ V+K  QEE+D KVGR
Sbjct  292   NSTLG--YTRETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGR  349

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
             +RW++D+D +NL YLQA+VKE +RLYP  PL  P E++QDC+V G+ IPKGT+L+VN+WK
Sbjct  350   DRWIEDTDIENLPYLQAMVKETLRLYPPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWK  409

Query  825   LHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP +WP+PE F PERFLT  V  D   + F +I FG GRRSCP + +AL++ H  L 
Sbjct  410   LHRDPSLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLG  469

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGF+ ATP  MPVD++EG G+TMPKA  ++ +LTPRLP   Y
Sbjct  470   RLLQGFELATPLDMPVDLTEGLGITMPKATSLEVILTPRLPFEFY  514



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   452 bits (1163),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 337/520 (65%), Gaps = 16/520 (3%)
 Frame = -2

Query  2046  VVAISG-VLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH---LVKALA  1879
             V AI G V + L F ++  +K +  +K  PP+ PGG P++GHLF F  ++    L + L 
Sbjct  5     VEAIVGLVTLTLLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1878  TMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF  1699
              +ADK GPVF  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNNA L  
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1698  TT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEWI  1522
             T  G +WRK RK+V+ E+L  ++LEK KH+   E+  S+K LY  +  N    +++ +W+
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRIDGNSST-INLTDWL  183

Query  1521  GYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
               +N  ++ K++A K Y    E G  ++     R+AFKD + L+ EF   DAFP  +F W
Sbjct  184   EELNFGLIVKMIAGKNY----ESGKGDEQVERFRKAFKDFIILSMEFVLWDAFPIPLFKW  239

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL----PAGEDPDFFDIMMKVVDQEFIA  1174
             +D +G ++AMK+     D+V Q W++EHV++ +       G + DF D+++  +  E++ 
Sbjct  240   VDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLSKMSNEYL-  298

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
              + Y+RDT+IKAT  +++ DAA+T   +M W MA+L+N++  +K+ QEEID KVG++RWV
Sbjct  299   DEGYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKDRWV  358

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             ++SD  +LVYLQ +VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL RD
Sbjct  359   EESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRD  418

Query  813   PKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             PK+W  P+KF PERF    + D   + + +I FG GRRSCP   YA+++ H  +A L+QG
Sbjct  419   PKLWSNPDKFDPERFFAADI-DFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQG  477

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             F++ TP+  P+DM EG G+T+ K  P++ ++TPRL    Y
Sbjct  478   FNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   452 bits (1163),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 337/520 (65%), Gaps = 16/520 (3%)
 Frame = -2

Query  2046  VVAISG-VLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH---LVKALA  1879
             V AI G V + L F ++  +K +  +K  PP+ PGG P++GHLF F  ++    L + L 
Sbjct  5     VEAIVGLVTLALLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1878  TMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF  1699
              +ADK GPVF  R+GLP +LVVSS EA+KD F+TND   + RP    G YLGYNNA L  
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1698  TT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEWI  1522
             T  G +WRK RK+V+ E+L  ++LEK KH+   E+  S+K LY  +  N    +++ +W+
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRIDGNSST-INLTDWL  183

Query  1521  GYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
               +N  ++ K++A K Y    E G  ++     R+AFKD + L+ EF   DAFP  +F W
Sbjct  184   EELNFGLIVKMIAGKNY----ESGKGDEQVERFRKAFKDFIILSMEFVLWDAFPIPLFKW  239

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL----PAGEDPDFFDIMMKVVDQEFIA  1174
             +D +G ++AMK+     D+V Q W++EHV++ +       G + DF D+++  +  E++ 
Sbjct  240   VDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLSKMSNEYL-  298

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
              + Y+RDT+IKAT  +++ DAA+T   +M W MA+L+N++  +K+ QEEID KVG++RWV
Sbjct  299   DEGYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGKDRWV  358

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             ++SD  +LVYLQ +VKE +RLYP  PL  P E+++DC V+GYHIPKGT+L+ N+ KL RD
Sbjct  359   EESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRD  418

Query  813   PKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             PK+W  P+KF PERF    + D   + + +I FG GRRSCP   YA+++ H  +A L+QG
Sbjct  419   PKLWSNPDKFDPERFFAADI-DFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQG  477

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             F++ TP+  P+DM EG G+T+ K  P++ ++TPRL    Y
Sbjct  478   FNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   452 bits (1162),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/486 (45%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L  T  G +WRK RK+V+ E+LS ++LEK KH+   +
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGK  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     R
Sbjct  159   IQTSIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFR  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD + L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EHV++ + 
Sbjct  214   KAFKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++  + Y+RDT+IKAT  +++ DAA+T   +M W MA
Sbjct  274   MEVNAQGNEQDFIDVVLSKMSNEYL-DEGYSRDTVIKATVFSLVLDAADTVALHMNWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  +K+ QEEID KVG+ERWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF  + + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFFADDI-DYRGQHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+  +T R
Sbjct  452   SGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITAR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   452 bits (1162),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 214/480 (45%), Positives = 321/480 (67%), Gaps = 14/480 (3%)
 Frame = -2

Query  1932  LGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGR  1753
             +GHL+ F  +T L   LA +ADK G +F IR+G+ R ++VS+ E VK+ FTTNDK LAGR
Sbjct  48    IGHLYLFISKTPLALILANLADKYGHIFSIRLGIHRAIIVSNWEIVKECFTTNDKVLAGR  107

Query  1752  PNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQL  1576
             P   AG+YLGYNNAA  F   G +WR +RK+V++E+LS+ +L+++KHI ++E+  ++K+L
Sbjct  108   PASSAGIYLGYNNAAFGFADYGPYWRNIRKLVLLEVLSSKRLDQFKHIRVTEVETNIKEL  167

Query  1575  YGSVTKNREV---EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKD  1405
             Y S+ K+      +V+M +W   + LN++ K++  KRY    E G          +  K+
Sbjct  168   YSSILKSGSTNPSKVNMSKWFEQLTLNVIMKMITGKRYKTEDEKGRH------FTRTTKE  221

Query  1404  VMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP-AGE  1228
              M  + +F  +D  P     W D +G I++MKK+S   D ++  WIDEH+ + +L    +
Sbjct  222   YMYESVQFVLSDVIPLPFLKWFDFQGRIKSMKKLSQEMDKIVTSWIDEHLMKRELAIKDD  281

Query  1227  DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDV  1048
             D DF D+M+  +D++F+ G  YTR+TIIKAT + ++   ++TT  ++ W++++L+N+K V
Sbjct  282   DQDFIDVMLSKIDEQFMYG--YTRETIIKATILNIILAGSDTTSIHLTWLLSLLVNNKHV  339

Query  1047  MKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGY  868
             M + QEEID K+G+ERWV++ D  NLVYLQA+VKE +RLYP  PL  P  +++DC V GY
Sbjct  340   MDQAQEEIDMKIGKERWVEECDIKNLVYLQAIVKETLRLYPPGPLAIPHAAMEDCTVGGY  399

Query  867   HIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCP  691
              +PKGT+L VN+WKLHRDP+IW +PEKF PERF+ + S  D   + F +I FG GRRSCP
Sbjct  400   KVPKGTRLMVNVWKLHRDPQIWSDPEKFMPERFMKSHSEIDISGQNFEFIPFGSGRRSCP  459

Query  690   ASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
                +A+++ H  LARLLQGF+F+T   +PVD++ G  +T+PKA P++  + PRL    Y 
Sbjct  460   GITFAMQVTHLTLARLLQGFNFSTLGDLPVDLTVGNSITLPKANPLEVFVMPRLAPMLYQ  519



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   451 bits (1161),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 319/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   451 bits (1160),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 319/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 319/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 317/484 (65%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK  A RP   AG  +GY  A   +   G ++ +VRK+ +  +LS+TKLEK KHI +SE
Sbjct  101   HDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID K+G+ERW++D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKMGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRDP+IW EPEKF P RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P+DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   451 bits (1159),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 319/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVVKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   451 bits (1159),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +L+VSS EAVKD F+T
Sbjct  39    GGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLIVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L  T  G +WRK RK+V+ E+LS ++LEK KH+   +
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGK  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     R
Sbjct  159   IQTSIKSLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFR  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +A+KD + L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EHV++ + 
Sbjct  214   KAYKDFIILSMEFVLWDAFPIPLFKWVDFQGYVKAMKRTFKDIDSVFQNWLEEHVKKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++  + Y+RDT+IKAT  +++ DAA+T   +M W MA
Sbjct  274   MEVNAQGNEQDFIDVVLSKMSNEYL-DEGYSRDTVIKATVFSLVLDAADTVALHMNWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  +K+ QEEID KVG+ERWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF  + + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFFADDI-DYRGQHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+  +T R
Sbjct  452   SGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITAR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   450 bits (1158),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPSDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   450 bits (1157),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/486 (45%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGY+NA L  T  G +WRK RK+V+ E+LS ++LEK KH+   +
Sbjct  99    NDAIFSNRPAFLYGEYLGYSNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGK  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     R
Sbjct  159   IQTSIKSLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFR  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD + L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EHV++ + 
Sbjct  214   KAFKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++  + Y+RDT+IKAT  +++ DAA+T   +M W MA
Sbjct  274   MEVNAQGNEQDFIDVVLSKMSNEYL-DEGYSRDTVIKATVFSLVLDAADTVALHMNWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  +K+ QEEID KVG+ERWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF  + + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFFADDI-DYRGQHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+  +T R
Sbjct  452   SGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITAR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   450 bits (1157),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 316/484 (65%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK  A RP   AG  +GY  A   +   G ++ +VRK+ +  +LS+TKLEK KHI +SE
Sbjct  101   HDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERW++D+D  NLVYLQA+VKE +RL+P VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLFPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRDP+IW EPEKF P RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPTDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   450 bits (1157),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 316/484 (65%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK  A RP   AG  +GY  A   +   G ++ +VRK+ +  + S+TKLEK KHI +SE
Sbjct  101   HDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVPSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERW++D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRDP+IW EPEKF P RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P+DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   449 bits (1156),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 319/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLVVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AF+D M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFEDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   449 bits (1156),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 316/484 (65%), Gaps = 11/484 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK---KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL Q     K     + L  +ADK GPVF +R+G+   L+V++ EA KD  TT
Sbjct  41    GAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTT  100

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +DK  A RP   AG  +GY  A   +   G ++ +VRK+ +  +LS+TKLEK KHI +SE
Sbjct  101   HDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSE  160

Query  1599  MNLSVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             +  S+K+LY  ++ KN   +V++ +W   + LNI+ K +  KRY+ ++E   ++++A   
Sbjct  161   LETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYS-NIE---EDEEAQRF  216

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R+AFK +M + G+    DA PF +F + D +G I+ M K+    D++LQGW+D+H+   D
Sbjct  217   RKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKD  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
             +   +D D  D M+KV          +++ T+IK+T ++++ D  +TT  +++W+M++LL
Sbjct  277   V-NNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N+  VMK+ QEEID KVG+ERW++D+D  NLVYLQA+VKE +RLYP VP   P E++QDC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V GYHIPKGT+LY+N WK+HRD +IW EPEKF P RFLT     D   + F +I FG G
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDSEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSG  455

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP   +A  + H    RLLQGFDF+ PS  P+DM+EG GVT+PK   V+ L+TPRLP
Sbjct  456   RRSCPGLGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLP  515

Query  525   AASY  514
             +  Y
Sbjct  516   SKLY  519



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   449 bits (1155),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPV   R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVLTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   449 bits (1154),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 229/525 (44%), Positives = 342/525 (65%), Gaps = 19/525 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD L   +AI+G+L+++ +L+    +         P+P G LPI+GHL + +    + K 
Sbjct  1     MDFLSHPLAIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRGP--IFKT  58

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA MADK GP+F I +G   +LV+S+ +AVK  FT ND   A R     G YLGYN A  
Sbjct  59    LAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRSRSTVGKYLGYNYAGF  118

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY------GSVTKNREV  1546
              F+  G +WR +RKMV+VELLS+ +LE  K + ISE++  +K L+      G    N   
Sbjct  119   GFSPYGTYWRDMRKMVMVELLSSRRLETLKRVQISEVDAFIKGLFLLCKTEGHNGLN-PT  177

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V + +WI ++ LN++++++A KRY  S + G + +   +L    K+ M ++G   +AD 
Sbjct  178   KVVISDWIEHLTLNVITRMIAGKRYFDSSDEGDEQRFGKIL----KEFMYVSGNPVAADV  233

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
               F    W+D +G ++AMK++    D+V+  W++EH  + +  + ++ DF D+M+ V++ 
Sbjct  234   IGFP--SWIDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMISVIED  291

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
                 G  YTR+TIIKAT++ ++   +ETT  N++WI+++LLN++ V+K  QEE+D KVGR
Sbjct  292   NSTLG--YTRETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGR  349

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
             +RW++D+D +NL YLQA+VKE +RLYP  PL  P E++QDC+V G+HI KGT L+VN+WK
Sbjct  350   DRWIEDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWK  409

Query  825   LHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP +WP+PE F PERFLT  V  D   + F +I FG GRRSCP + +AL++ H  L 
Sbjct  410   LHRDPSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLG  469

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGF+ ATP  MPVD++EG G+TMPK+  ++ +LTPRLP   Y
Sbjct  470   RLLQGFELATPMDMPVDLTEGVGITMPKSTSLEVILTPRLPLVFY  514



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   448 bits (1153),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLAQKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             +D   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    DDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT   ++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFGLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTIAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   447 bits (1151),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 319/487 (66%), Gaps = 17/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   D+FP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDSFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLMNNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWITF  715
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   +  G   Q + +I F
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI--GFRGQYYKYIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ P
Sbjct  451   GSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAP  510

Query  534   RLPAASY  514
             RL    Y
Sbjct  511   RLAPELY  517



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   447 bits (1151),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 221/483 (46%), Positives = 310/483 (64%), Gaps = 11/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL   + +  + + L  MADK+GPVF+IR+G+ R LVVS+ EA K+ FTTNDK
Sbjct  43    GAWPFVGHLHLLQGKVPVFRTLGAMADKVGPVFVIRLGMYRALVVSNHEAAKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP+  A   LGYN  A      G  WR++RK+ ++E+LST +L    H+ +SE++ 
Sbjct  103   VFASRPSSSASKILGYNYVAFGLAPYGPLWREIRKLCMLEILSTRRLSDLMHVHVSELHA  162

Query  1590  SVKQLYGSVTKNREV---EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K LY        V   +V + EW  ++N N++ +++A KRY  +V HG +   +    
Sbjct  163   GIKDLYILGKDYNWVNPKKVVISEWFEHLNFNVVLRMVAGKRYFNNVVHGGEEAGSAT--  220

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
                K ++ L G F ++D  PF    W+D++G + +MK+V+   D+VL+ W++EH  R + 
Sbjct  221   AVIKKLVPLAGAFVASDVIPF--LEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNS  278

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              A    DF DIM+  +    + G  Y+R+TIIKAT M ++   ++TT     W+++ LLN
Sbjct  279   EASSRQDFIDIMLTKLKDASLFG--YSRETIIKATVMMLIVAGSDTTSITSTWLLSALLN  336

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             ++ VMK  QEE+D KVGR+RWV+ SD  NLVYL+A+VKE +RLYP VPL  P E+++DC 
Sbjct  337   NRHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCH  396

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGR  703
             V GYHIPKGT+L VN WKLHRDP +W  PE+F+PERFLT  +  D L + F  I FG GR
Sbjct  397   VGGYHIPKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGR  456

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP    AL+M H  +A+LLQGFD ATPS  PVDM+E   +TMPK  P++ +LTPRLPA
Sbjct  457   RSCPGINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLPA  516

Query  522   ASY  514
               Y
Sbjct  517   ELY  519



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   447 bits (1150),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL  DPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQCDPKLWSDPDTFDPERFIAIDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   446 bits (1147),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 212/486 (44%), Positives = 318/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EAVKD F+T
Sbjct  39    GGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNNA L     G +WRK RK+V+ E+LS ++LEK+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQASIKNLYTRIDGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M L+ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+I+AT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIEATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N++  + + QEEIDTKV ++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQKALTKAQEEIDTKVCKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W +P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDI-DFRGQYYKYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+  P+DM EG G+T+ K  PV+ ++ PR
Sbjct  452   PGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   445 bits (1144),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 211/486 (43%), Positives = 315/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  7     GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  66

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  67    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  126

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  127   IQTSIKNLYTRINGNSST-INLSDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  181

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+AMK+     D+V Q W++EH+ + + 
Sbjct  182   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREK  241

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  242   MEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  300

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  301   LLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  360

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF+   + D     + +I FG
Sbjct  361   KDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFIAGDI-DFRGHHYEFIPFG  419

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  420   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPR  479

Query  531   LPAASY  514
             L    Y
Sbjct  480   LAPELY  485



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   449 bits (1155),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 315/484 (65%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL        + + L  MAD  GPVF+IR+G+ R LVVSS +AVK+  TTNDK
Sbjct  128   GAWPFIGHLHLLNSPMPIFRTLTAMADXHGPVFMIRLGMXRALVVSSHKAVKECLTTNDK  187

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   AG  LGYN A   F   G  WR++RK+ V ELLS  +L++ KH+ +SE+++
Sbjct  188   AFASRPISSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRRLDELKHVLVSELDV  247

Query  1590  SVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              ++ LY S+ K       ++V M EW+     N++ +++A KRY  +  HG  N++A   
Sbjct  248   CIRDLY-SLGKETNWVNPIKVAMSEWLEQXTFNVVLRMVAGKRYFGNGVHG--NEEARHA  304

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
                 K  ++LTG F ++D  PF    W+D++G + +MK+V+   D  ++GW++EHV + +
Sbjct  305   IAVIKKFLSLTGAFVASDVIPF--VEWMDLQGHLGSMKRVAGQLDPFVEGWVEEHVTKLN  362

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
                    DF D+M+ V+    I G  +TR+T+IKAT M ++   +ETT     WI++ LL
Sbjct  363   SDPSSRQDFIDVMLSVLKDNSIFG--HTRETVIKATVMTLIVGGSETTSIVSTWILSALL  420

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N++  +KR QEEID KVGR RWV++SD +NL+YLQAVVKE +RLYP  PL  P E+++DC
Sbjct  421   NNRHALKRAQEEIDLKVGRGRWVEESDIZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDC  480

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
              V  YHIPKGT+L+VN+WKLHRDP +W +PE+F+PERFLT +   +   + F  I F  G
Sbjct  481   NVCEYHIPKGTRLFVNVWKLHRDPGVWSDPEEFQPERFLTTNANLNVFGQHFELIPFSSG  540

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP  A AL++ H  +ARLLQG+D  TP   PVDM+EG G+TMP+A P++ +LTPRLP
Sbjct  541   RRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLP  600

Query  525   AASY  514
             +  Y
Sbjct  601   SLLY  604



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   446 bits (1146),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 209/486 (43%), Positives = 321/486 (66%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  + +   L + L  +ADK G VF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFHFNDDGNDRPLARKLGDLADKYGLVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G Y+GYNNA L     G +WRK RK+V+ E+LS ++L+K+KH+  + 
Sbjct  99    NDAIFSNRPAFLYGEYIGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLKKFKHVRFAR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  + +N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRIDRNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AFKD M ++ EF   DAFP  +F W+D +G ++AMK+     D+V Q W++EH+ + + 
Sbjct  214   KAFKDFMIISMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  +  E++ G+ Y+RDT+IKAT  +++ DAA+T   ++ W MA
Sbjct  274   MEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMA  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ +K+ QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E+I
Sbjct  333   LLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENI  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GY+I KGT+L+ N+ KL RDPK+WP P+ F PERF+   + D   + + +I FG
Sbjct  393   EDCVVSGYYISKGTRLFANVMKLQRDPKLWPNPDNFDPERFVAAGI-DFRGQHYEYIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF+++TP+  P+DM EG G+T+ K  PV+ ++  R
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYSTPNDEPLDMKEGAGITIRKVNPVEVIIMSR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/485 (45%), Positives = 321/485 (66%), Gaps = 11/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  PI+GHL  F   +   L +    ++++ GP+F I++G+ R  V+++ EA KD FT N
Sbjct  42    GSWPIIGHLRGFGDGENVPLARTFGKLSNQYGPIFTIKLGMYRYCVINNWEAAKDCFTIN  101

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DK LA RP   A  + GYN A  +F   G ++ +VRK+V+  +LS+T+LEK K++ ISE+
Sbjct  102   DKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKNVRISEV  161

Query  1596  NLSVKQLYGSVTKNREVE-VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +S+K+LY    K      +++ +W   + LNI+ K++A KRY  S+E    +Q+A   R
Sbjct  162   EISIKELYNIWGKGENSNTINISKWFEKLTLNIIVKMIAGKRY-ISLEK---DQEAQCFR  217

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +AF  +M L GEF   DA PF+IF ++D +G I+ MK++    D +LQ W++EH+ +  +
Sbjct  218   RAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKI  277

Query  1239  PA--GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                   + D  D M+ V   E      YTRDT+IKA  ++M+ D ++TT  ++ W+M++L
Sbjct  278   EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKAIVLSMILDGSDTTAVHLTWLMSLL  337

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+  VM   Q+EID+KVG++RW+++SD  +LVYLQA+VKE +RLYP  PL  P E+++D
Sbjct  338   LNNPRVMNNAQKEIDSKVGKDRWIEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVED  397

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTE-SVPDGLARQFGWITFGF  709
             C VAGY+IPKGT+L+ N WK+ RDP+++ EP+KF PERFL E S  D   + F +I FG 
Sbjct  398   CTVAGYNIPKGTRLFANAWKIQRDPRVYSEPDKFIPERFLNEHSNVDARGQHFEFIPFGS  457

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCP   +A ++AH  + RL+QGF F TPS +PVDM+EG G+TMPKAKPV+ ++TPRL
Sbjct  458   GRRSCPGINFATQVAHLTIGRLIQGFSFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRL  517

Query  528   PAASY  514
              +  Y
Sbjct  518   NSMLY  522



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   445 bits (1145),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 211/486 (43%), Positives = 315/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRINGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+AMK+     D+V Q W++EH+ + + 
Sbjct  214   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  274   MEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG++RWV++SD  +LVYLQA+VKE +RLYP  PL  P E++
Sbjct  333   LLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+W  P+KF PERF+   + D     + +I FG
Sbjct  393   KDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFIAGDI-DFRGHHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 228/527 (43%), Positives = 330/527 (63%), Gaps = 13/527 (2%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppep--PGGLPILGHLFQFKKETHLV  1891
             MD+ +++  I+ ++ +L FL+ + R +     K    P   G  P++GHL     +  L+
Sbjct  1     MDSSLQLTIIAILVSLLVFLWHTKRNRGGSKNKSKEAPIPAGAWPLIGHLHLLGGDDQLL  60

Query  1890  -KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNN  1714
              + L TMAD+ GP F I +G  R  VVSS E  K+ FT+NDKALA RP   A  ++GYN 
Sbjct  61    YRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTSNDKALASRPTTVAAKHMGYNY  120

Query  1713  AALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE--VE  1543
             A   F     FWR++RK+  +ELLS  +LE  KH+ +SE+N+ ++ LY S  +NR   V 
Sbjct  121   AVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVMVSELNMVMRDLYNSWVQNRSRPVL  180

Query  1542  VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQD-AVVLRQAFKDVMTLTGEFSSADA  1366
             V++  W+  + LN++ +++A KRY +      DN D A   ++A      L G F  +DA
Sbjct  181   VELNRWLEDLTLNMVVRMVAGKRY-FGASASCDNDDEARRCQKAINQFFHLIGIFVVSDA  239

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGEDPDFFDIMMKV  1195
              PF    W D++G  RAMKK +   DA+L+GW+ EH  +   G++ A  + DF DIM+ +
Sbjct  240   LPF--LRWFDVQGHERAMKKTAKELDAILEGWLKEHREQRVDGEIKAEGEQDFIDIMLSL  297

Query  1194  VDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTK  1015
                  ++   Y  DT IK+T +A++   ++TT   + W +++LLN++  +K+ QEE+D  
Sbjct  298   QKGGHLSNFQYDSDTSIKSTCLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLN  357

Query  1014  VGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVN  835
             VG ER V++SD  NL Y+QA++KE +RLYP  PL  PRE+ +DC VAGYH+P GT+L VN
Sbjct  358   VGMERQVEESDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVN  417

Query  834   IWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFI  655
             +WK+HRDP++W EP  F+PERFLT    D   + F  I FG GRRSCP  ++AL++ H  
Sbjct  418   LWKIHRDPRVWQEPSAFRPERFLTSDAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLT  477

Query  654   LARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LARLL  F+FATPS  PVDM+E PG+T+PKA P++ LLTPRLPA  Y
Sbjct  478   LARLLHAFEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLY  524



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   445 bits (1144),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/519 (44%), Positives = 332/519 (64%), Gaps = 18/519 (3%)
 Frame = -2

Query  2040  AISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH--LVKALATMAD  1867
             AI  +L +    Y  L  +K+     PPE  GG P++GHLF F    +  L + L+ +AD
Sbjct  16    AIVALLTLAFLFYFILSTKKSSKLPLPPEIAGGWPVIGHLFYFNDGDNRPLARKLSDLAD  75

Query  1866  KIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-G  1690
             K GPVF  R+GL R+LV+SS +AVK+ +T ND   A RP    G Y+GYNNA L     G
Sbjct  76    KYGPVFTFRLGLHRMLVISSYDAVKECYTKNDAVFANRPACLYGEYIGYNNAILFLANYG  135

Query  1689  AFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVE--VDMEEWIGY  1516
             ++WR +RK+++ E+LS ++LEK KH+ I ++   +K L  S  +N EV+  +++ +W+  
Sbjct  136   SYWRNIRKLIIQEVLSNSRLEKLKHVKIEKIRNEIKNL-NSRIQNSEVKSVINLTDWLEK  194

Query  1515  VNLNIMSKIMAKKRYNYSVEHGADNQDAVV-LRQAFKDVMTLTGEFSSADAFPFRIFHWL  1339
             +N  ++ K++A K Y    E G D  + V   R+ FK  + L+ EF   DAFP R+F W+
Sbjct  195   MNFGLIVKMIAGKNY----ESGGDGDEEVERFRETFKKFLVLSMEFVLWDAFPIRLFKWI  250

Query  1338  DMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP----DFFDIMMKVVDQEFIAG  1171
             D +G ++ MK+     D++ Q W+DEHV+R +    ED     DF D+M+  +  E +  
Sbjct  251   DFQGHVKLMKETFKDIDSISQRWLDEHVKR-NTEVNEDEKYERDFIDVMLSKMSDERLH-  308

Query  1170  QNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVD  991
             Q ++RD  IKAT  +M+ DAA+T   ++ W M +L+N++ V+K+ QEEIDTKVG+ RW+D
Sbjct  309   QGHSRDNAIKATIFSMVMDAADTVPHHINWGMTLLINNQHVLKKAQEEIDTKVGKARWID  368

Query  990   DSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDP  811
             D+D  NLVYLQA+VKE +RLYP  PL  P E+ ++C V+GY IPKGT+LY N+ KL  DP
Sbjct  369   DNDIKNLVYLQAIVKETLRLYPPSPLLVPHENTEECVVSGYRIPKGTRLYANVMKLQLDP  428

Query  810   KIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGF  631
             K+WP PE+F P+RFL+  + +   + + +I FG GRRSCP  +YAL+M H  +  L+QGF
Sbjct  429   KVWPNPEQFNPDRFLSTDI-NFRGQDYEFIPFGSGRRSCPGISYALQMEHLTIGHLIQGF  487

Query  630   DFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             ++ TPS  P+D+ EG G+TMPK  PV+ ++TPRL    Y
Sbjct  488   NYQTPSNEPLDLQEGIGMTMPKVNPVEVIITPRLATELY  526



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   443 bits (1140),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 225/484 (46%), Positives = 311/484 (64%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL      T + + LA MADK GPVF+IR+G+ R LVVSS EAVK+  TTNDK
Sbjct  42    GAWPFVGHLHLLSGPTPIFRTLAAMADKHGPVFMIRLGMHRALVVSSHEAVKECLTTNDK  101

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP+  AG  LGYN A   F   G  WR++RK+ V ELLS   L + KH+ +SE+++
Sbjct  102   AFASRPSSSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRPLNELKHVLVSELDV  161

Query  1590  SVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              ++ LY S+ K       ++V M EW+  +  N++ +++A KRY  +  HG  N++A   
Sbjct  162   CIRDLY-SLGKETNWVNPIKVAMSEWLEQLTFNVVLRMVAGKRYFGNGVHG--NEEARHA  218

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
                 K  + LTG F ++DA PF    W+D++G + +MK+V++  D  ++GW++EHV +  
Sbjct  219   IAVIKKFIFLTGVFVASDAIPF--VEWMDLQGHLGSMKRVAEQLDPFVEGWVEEHVTKLK  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
                    DF D+M+ V+    + G  + R+T+IKAT M ++   +ETT    +WI++ LL
Sbjct  277   SDPSSRQDFIDVMLSVLKDNSMFG--HRRETVIKATVMTLIVGGSETTSIASIWILSALL  334

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N++  +KR QEE+D KVGR RWV++SD  NL+YLQA VKE +RLYP  PL  P E+IQDC
Sbjct  335   NNRHTLKRAQEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDC  394

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFG-WITFGFG  706
              V GYHIPKGT+L VN+WKLHRDP  W +PE+F+PERFLT      +  Q    I F  G
Sbjct  395   SVCGYHIPKGTRLLVNVWKLHRDPDAWSDPEEFQPERFLTTHANLNVFGQHSELIPFSSG  454

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RRSCP  A AL++ H  +ARLLQG+D  TP   PVDM+EG G+ MPK  P++ +LTPRLP
Sbjct  455   RRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRLP  514

Query  525   AASY  514
             +  Y
Sbjct  515   SLLY  518



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   442 bits (1137),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 228/536 (43%), Positives = 339/536 (63%), Gaps = 21/536 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLII-LPFLYLSLRkqknktkkpppep-------PGGLPILGHLFQFK  1909
             MD L  ++ +SGV+II L  LY   R+  N                 G  PI+GHL    
Sbjct  1     MDFLSHLLPLSGVVIIALIALYNHRRRSINTDTNTNTNKGNFAPEPSGAWPIIGHLHLLG  60

Query  1908  KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVY  1729
              +  + + L  MADK+GPVF +R+G+ R +VVSS EAVKD FTTND+ LA RP+  AG+Y
Sbjct  61    GKIPISRILGAMADKLGPVFTLRLGVHRTVVVSSREAVKDCFTTNDRVLAKRPSSTAGIY  120

Query  1728  LGYNNAALAFTTGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVT---K  1558
             LGYN+A   F+ G +WR+VRK+V+ E+L+  +L+  + +  +E+  S+ +L+  V     
Sbjct  121   LGYNHAGFGFSHGPYWREVRKLVLAEVLTPRRLDSLRPVREAELAASLGELHELVRGSDD  180

Query  1557  NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGAD---NQDAVVLRQAFKDVMTLTG  1387
             ++E EV + EW+  + L+ +  ++A KR   +   G D    ++A  LR   K  M ++G
Sbjct  181   DQEREVAISEWLERLTLDTIMMMLAGKRC--AERDGGDAAAEEEAKSLRHIIKQFMYISG  238

Query  1386  EFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGEDPDF  1216
             +F  +D+ PF    WLD++G I++MK+++D    + +GWI EHV R    D   G + DF
Sbjct  239   QFVVSDSIPFPPLRWLDLQGHIKSMKRIADELSEICEGWIGEHVERRRIDDGGLGIERDF  298

Query  1215  FDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRI  1036
              D+M+  +D +F+    +TR+TIIKAT + ++   ++TT ++M WI+++LLN+   M++ 
Sbjct  299   IDVMLSAIDDKFMR-FGHTRETIIKATLLNLILAGSDTTSTHMTWILSLLLNNTRAMQQT  357

Query  1035  QEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPK  856
             Q EID KVG++RWV +SD  NLVYLQAVVKE +RL+P  PL  P E+++DC VAGYH+ +
Sbjct  358   QAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPPGPLAVPHEAMEDCRVAGYHVAR  417

Query  855   GTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAY  679
             GT++ VN+WKLHRDP++W EP++F PERFLT     D       +I FG GRRSCP   +
Sbjct  418   GTRILVNVWKLHRDPRVWEEPDEFVPERFLTRHADVDFTGHHHEFIPFGSGRRSCPGITF  477

Query  678   ALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
             A ++ H  +ARL+QGF+F TP   PVDM+EG G+T+PKA  ++ L+ PRL    Y 
Sbjct  478   ATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPKATLLRVLVAPRLAPFMYQ  533



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   441 bits (1135),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 221/526 (42%), Positives = 344/526 (65%), Gaps = 13/526 (2%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD    ++AI G+L+ + +L+    + +       P+  G LPI+GHL +   +  L + 
Sbjct  1     MDFPSHLLAIVGILLFVLYLWRVKVQSRKTKGMLAPQASGALPIIGHLHKLGGKKPLCRT  60

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA+MADK GP+F IR+G    LV+++ +AVK+ FT ND A A R     G YLGYN A  
Sbjct  61    LASMADKYGPIFTIRLGKHPALVINNYDAVKECFTKNDIAFASRSKSAQGRYLGYNYAGF  120

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY---GSVTKNREVEVD  1537
              F   G +WR +RKMV VELLS+ +L+  KH+ I E++  +K LY    +  +N + +V 
Sbjct  121   GFAPYGTYWRNMRKMVTVELLSSRRLQTLKHVQICEVDSFIKGLYEICKTKGENGQSKVV  180

Query  1536  MEEWIGYVNLNIMSKIMAKKRYN--YSVEHGADNQ-DAVVLRQAFKDVMTLTGEFSSADA  1366
             + EWI ++ LN++++++A KRY    +V + +DN+ +   +R   K+ M + G+ + +D 
Sbjct  181   ISEWIEHLTLNVITQMIAGKRYFDLGTVGNDSDNEGENKRIRGMVKEFMCVAGKPAVSDV  240

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGEDPDFFDIMMKVVD  1189
               F   HW+D+ G ++ MK++    D+++ GWI+EH   R ++ + +  DF D+M+ V++
Sbjct  241   IGFP--HWIDLMGQVKNMKRIGKDFDSLMAGWIEEHKNARKEIDSRDKLDFIDVMLSVIE  298

Query  1188  QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVG  1009
                + G  +TR+TIIKAT+  ++   ++TT +++ WI+++LLN++ V+K  QEEI+ +VG
Sbjct  299   DNTVLG--HTRETIIKATSQTLILAGSDTTATSLTWILSLLLNNRHVLKHAQEEINLQVG  356

Query  1008  RERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIW  829
              ERWV+D+D  +L YLQA+VKE +RLYP  PL    E+++DC+V G++IPKGT+L+ N+W
Sbjct  357   TERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSTSHEAMEDCQVCGFYIPKGTRLFTNLW  416

Query  828   KLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFIL  652
             KLHRDP +W +PE F P+RFL T++  D   + F +I FG GRRSCP   +A+++ H  L
Sbjct  417   KLHRDPSVWSDPEVFCPDRFLTTQASIDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTL  476

Query  651   ARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              RL+QGF+ ATP  MPVDM+EG GVTMPKA  ++ +LTPRLP   Y
Sbjct  477   GRLIQGFELATPLDMPVDMAEGLGVTMPKATSLEVVLTPRLPCQFY  522



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   440 bits (1131),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/486 (43%), Positives = 315/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP +  G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  99    NDAIFSNRPALLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRINGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+AMK+     D+V Q W++EH+ + + 
Sbjct  214   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  274   IEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG++RWV++SD  +LVYLQA+VK+ +RLYP  PL  P E++
Sbjct  333   LLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+   P+KF PERF+   + D     + +I FG
Sbjct  393   KDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDI-DFRGHHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   439 bits (1130),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 316/486 (65%), Gaps = 21/486 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             GG P +GHL Q      + + L  MADK GPVF +R+G+ + LVVSS EAVK+ FTTNDK
Sbjct  43    GGWPFIGHLLQLSPNVPIARNLGAMADKYGPVFSLRLGMRQTLVVSSWEAVKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A + RP      Y+GYN AA+ F   G +WR++RK+V++ELLS  +LE+ KH+ ISE+  
Sbjct  103   AFSYRPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVMLELLSNRRLERLKHVRISEIEN  162

Query  1590  SVKQLYG---SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             ++K L+    S + +   +V+M +W   + LNIM + ++  RY  S      N      R
Sbjct  163   NIKVLFDGWKSSSNDPPAKVNMGKWFEDLFLNIMVRKISGTRYTDSEVGSKRNAQ---FR  219

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +  K+ +   G+F  +D  PF +  W+DM+G ++++K+VS   D+++Q WIDEH  R   
Sbjct  220   RVVKEFVHFLGQFVVSDVIPFPLLKWIDMQGHLKSIKRVSKELDSIIQIWIDEHNERRMK  279

Query  1248  ----GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
                 GD    E  DF D ++ V   E++ G  ++R+T+IKAT M+++  A ETT  ++ W
Sbjct  280   ISEQGD----EQQDFIDALLSVTKDEYLFG--HSRETVIKATLMSLVIAAFETTSIHLTW  333

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLN+K VM++ QEEID+ VG+ERW ++SD +NLVYLQA+VKE +RLYP  PL  PR
Sbjct  334   TLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPAPLSLPR  393

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGW  724
             ++++DC V+GY I  GTQL+VN+WKL RDP+IW EP++F PERFL   V   G   +F +
Sbjct  394   QAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGEVDFSGKNFEFSF  453

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
               FG GRRSCP    A ++ H  LARLLQGFD  TPS +PVDM+E   ++M KA P++ +
Sbjct  454   TPFGSGRRSCPGIPLATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGKATPLEVV  513

Query  543   LTPRLP  526
             + PRLP
Sbjct  514   ILPRLP  519



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   439 bits (1128),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 209/486 (43%), Positives = 314/486 (65%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRINGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+AMK+     D+V Q W++EH+ + + 
Sbjct  214   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  274   MEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG++RWV++SD  +LVYLQA+VK+ +RLYP  PL  P E++
Sbjct  333   LLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+   P+KF PERF+   + D     + +I FG
Sbjct  393   KDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDI-DFRGHHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   439 bits (1130),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 234/549 (43%), Positives = 338/549 (62%), Gaps = 39/549 (7%)
 Frame = -2

Query  2064  MDALIRVVAISGVL--IILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV  1891
             MD   ++VAISG+L  ++L  ++  +        +  PEP G  P LGHL   + +T + 
Sbjct  1     MDTPSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIF  60

Query  1890  KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNA  1711
             + L  MADK GPVF+IR+G+ R LVVSS EAVK+ FTTNDK  A RP+  AG  LGYN A
Sbjct  61    RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYA  120

Query  1710  ALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE----V  1546
                F   GA WR++RK+ ++E+LS  +L+  KH+ ISE++LS+K LY S+ K  +    V
Sbjct  121   GFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLY-SLGKGSDWVHPV  179

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V M EW  +++ NI+ K++A KRY  +  HG +     +     ++ ++L+G F  +DA
Sbjct  180   KVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEEARRAI--ATIQEFLSLSGAFVLSDA  237

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
              P     W+D++G + +MK+V+   D+++ GW++EH  R +       DF D+M+ V++ 
Sbjct  238   IPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLED  295

Query  1185  EFIAGQNYTRDTIIKATAMA------------------------MLQDAAETTVSNMVWI  1078
               + G  ++R+T+IKAT +                         ++    ET  +   W+
Sbjct  296   TSMFG--HSRETVIKATIVVRSSPIHELLLLSWKSVFLQPTLKILIVGGTETVATTSTWL  353

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             ++ LLN+K  +KR QEE+D KVGR RWV++SD  NL+YLQAV+KE +RLY   PL  P E
Sbjct  354   LSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHE  413

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWI  721
             +++DC VAGYHIPKGT+L+VN WKLHRDP +W +PE F+PERFLT     D L + F  I
Sbjct  414   AMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADFDVLGQHFELI  473

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP    ALK+   ++ RLLQGFD +TP   PVDM EG  +T+ K  P++ +L
Sbjct  474   PFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVIL  533

Query  540   TPRLPAASY  514
             TPRLP+  Y
Sbjct  534   TPRLPSQFY  542



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/526 (42%), Positives = 344/526 (65%), Gaps = 13/526 (2%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD    ++AI G+L+ + +L+    +         P+P G LPI+GHL +      L + 
Sbjct  1     MDFPSHLLAIVGILLFVLYLWRVKIQSHKTKGMLAPQPSGALPIIGHLHKLGGXNPLCRT  60

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA+MADK GP+F I++G    LV+S+ +AVK+ FT ND A A R     G YLGYN AAL
Sbjct  61    LASMADKYGPIFTIQLGKHPALVISNYDAVKECFTKNDIAFATRSKSAQGRYLGYNYAAL  120

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY---GSVTKNREVEVD  1537
              F+  G +WR +RKM +VELLS+ +L+  KH+ ISE++  +K LY    +  +N + +V 
Sbjct  121   GFSQYGTYWRNMRKMAIVELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQSKVV  180

Query  1536  MEEWIGYVNLNIMSKIMAKKRYN--YSVEHGADNQ-DAVVLRQAFKDVMTLTGEFSSADA  1366
             + EWI ++ LN++++++A KRY     V + +DN+ +   +R+  K+ M + G+   +D 
Sbjct  181   ISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREMVKEFMCVAGKPVVSDV  240

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGEDPDFFDIMMKVVD  1189
               F    W+D+ G ++ MK++    D+++  WI+EH   R ++ + +  DF D+M+ V++
Sbjct  241   IGFP--DWIDLMGQVKNMKRIGKDFDSLMASWIEEHKNAREEIDSRDKLDFIDVMLSVIE  298

Query  1188  QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVG  1009
                + G  ++R+TIIKAT+  ++   ++TT +++ WI+++LLN++ ++K  QE I+ +VG
Sbjct  299   DNTVLG--HSRETIIKATSQNLILAGSDTTATSLTWILSLLLNNRHILKHAQEXINLQVG  356

Query  1008  RERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIW  829
              ERWV+D+D  +L YLQA+VKE +RLYP  PL  P E+ +DC+V G+HIPKGT+L+ N+W
Sbjct  357   TERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSVPHEAXEDCQVCGFHIPKGTRLFANLW  416

Query  828   KLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFIL  652
             KLHRDP +W +PE F P+RFL T++  D   + F +I FG GRRSCP   +A+++ H  L
Sbjct  417   KLHRDPSVWSDPEVFCPDRFLTTQASTDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTL  476

Query  651   ARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              RL+QGF+ ATP  MPVDM+EG G+TMPKA  ++ +LTPRLP+  Y
Sbjct  477   GRLIQGFELATPLDMPVDMAEGLGITMPKATSLEVVLTPRLPSQFY  522



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   440 bits (1131),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 232/538 (43%), Positives = 338/538 (63%), Gaps = 20/538 (4%)
 Frame = -2

Query  2139  AKCVYIQTFFAKWTSELQTRSIHTAMDALIRVVAISGVL--IILPFLYLSLRkqknktkk  1966
             A C+ I  ++    S  Q+      MD   ++VAISG+L  ++L  ++  +        +
Sbjct  7     ALCIDILYYYMNQQSLRQSN-----MDTPSQLVAISGILGLVLLYGVWRVMTLAGKSKGR  61

Query  1965  pppepPGGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDV  1786
               PEP G  P LGHL   + +T + + L  MADK GPVF+IR+G+ R LVVSS EAVK+ 
Sbjct  62    SAPEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKEC  121

Query  1785  FTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIW  1609
             FTTNDK  A RP+  AG  LGYN A   F   GA WR++RK+ ++E+LS  +L+  KH+ 
Sbjct  122   FTTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQ  181

Query  1608  ISEMNLSVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADN  1441
             ISE++LS+K LY S+ K  +    V+V M EW  +++ NI+ K++A KRY  +  HG + 
Sbjct  182   ISELDLSIKDLY-SLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEE  240

Query  1440  QDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDE  1261
                 +     ++ ++L+G F  +DA P     W+D++G + +MK+V+   D+++ GW++E
Sbjct  241   ARRAI--ATIQEFLSLSGAFVLSDAIPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEE  296

Query  1260  HVRRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
             H  R +       DF D+M+ V++   + G  ++R+T+IKAT + ++    ET  +   W
Sbjct  297   HEIRLNSEGSRMQDFIDVMLSVLEDTSMFG--HSRETVIKATIVILIVGGTETVATTSTW  354

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
             +++ LLN+K  +KR QEE+D KVGR RWV++SD  NL+YLQAV+KE +RLY   PL  P 
Sbjct  355   LLSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPH  414

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGW  724
             E+++DC VAGYHIPKGT+L+VN WKLHRDP +W +PE F+PERFLT     D L + F  
Sbjct  415   EAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFEL  474

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVK  550
             I FG GRRSCP    ALK+   ++ RLLQGFD +TP   PVDM EG  +T+ K  P++
Sbjct  475   IPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLE  532



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   436 bits (1122),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 226/530 (43%), Positives = 336/530 (63%), Gaps = 15/530 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLY-LSLRkqknktkkpppep---PGGLPILGHLFQFKKETH  1897
             MD  + + +I  V  +L FLY  SLR +K+   +   +     G  PI+GHL        
Sbjct  1     MDLFLLLSSIVVVFSLLLFLYNASLRGRKSSNVRKTKKAPEPAGAWPIIGHLHLLGGGDQ  60

Query  1896  LV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGY  1720
             L+ + L  MADK GP F IR+G     VVSS E VK+ FT NDKALA RP   A  ++GY
Sbjct  61    LLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGY  120

Query  1719  NNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKN--RE  1549
             + A   F     FWR++RK+  +ELLS  +LE  KH+ ISE+ + +++L+G   KN  R 
Sbjct  121   DYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVEMGLRELHGLWAKNNSRP  180

Query  1548  VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSAD  1369
             V V++++W+  + LN++ +++A KRY +      D+ +A   ++A      L G F+ +D
Sbjct  181   VLVELKKWLEDMTLNMVVRMVAGKRY-FGASATCDDSEARQCQKAINQFFHLIGIFTVSD  239

Query  1368  AFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGEDPDFFDIMMK  1198
             A PF  F WLD +G   AMKK +   DA+L+GW++EH +R   G + +  + DF D+M+ 
Sbjct  240   ALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLS  297

Query  1197  VVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDT  1018
             + ++  ++   ++ D  IK+T +A++   ++TT   + W +++LLN+ +++K+ QEE+D 
Sbjct  298   LQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQ  357

Query  1017  KVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYV  838
             ++G +R VDDSD  NLVYLQA++KE +RLYP  PL  PRE+++DC VAGYHIP GT+L V
Sbjct  358   QIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIV  417

Query  837   NIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAH  661
             N+WK+ RDP++W  P  F+PERFLT     D   +QF  I FG GRRSCP +++AL++ H
Sbjct  418   NVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLH  477

Query  660   FILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
               LARLL  F+ ATPS  PVDM+E PG+T+PKA P++ +L+PRLP   Y 
Sbjct  478   LTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPNPYG  527



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   436 bits (1120),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/485 (44%), Positives = 306/485 (63%), Gaps = 10/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  P++GHL     +  L+ + L TMAD+ GP F I +G  R  VVSS E  K+ FTTND
Sbjct  45    GAWPLIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTND  104

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +LE  KH+ +SE+N
Sbjct  105   KALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRVSELN  164

Query  1593  LSVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
               +K+LY S  +NR   V V++  W+  + LN++ +++A KRY +      D+ +A   +
Sbjct  165   TGIKELYNSWVQNRSQPVVVELNRWLEDLTLNMVVRMVAGKRY-FGASATCDDDEARRCQ  223

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F  +DA PF    W D++G  RAMKK +   D++L+GW+ EH  +   
Sbjct  224   KAINQFFHLIGIFVVSDALPF--LRWFDLQGHERAMKKTAKELDSILEGWLQEHRMQRVD  281

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G++    + DF D+M+ +     ++   Y  DT IK+T +A++   ++T+   + W +++
Sbjct  282   GEVKVEGEQDFIDVMLDLQKTGHLSNFQYDSDTSIKSTCLAIILGGSDTSAGTLTWAISL  341

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ QEE+D  VG ER V++SD  NL YLQA++KE +RLYP  PL  PRE+ +
Sbjct  342   LLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYLQAIIKETLRLYPAGPLLGPREAQE  401

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGF  709
             DC V GY +P GT+L VN+WK+HRDP++W EP  F+PERFLT    D   + F  I FG 
Sbjct  402   DCNVGGYDVPAGTRLVVNLWKIHRDPRVWEEPSAFRPERFLTSDAVDVRGQNFELIPFGS  461

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCP  ++AL++ H  LARLL  F+FATPS  PVDM+E PG+T+PKA P++ LLTPRL
Sbjct  462   GRRSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDMTESPGLTIPKATPLEVLLTPRL  521

Query  528   PAASY  514
             P   Y
Sbjct  522   PPQLY  526



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   435 bits (1118),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 303/483 (63%), Gaps = 11/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL     +  + + L  MADK+GPVF+IR+G+ R LVVS+ EA K+ FTTNDK
Sbjct  43    GAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN  A   LGYN AA AF   G +WR++RK+ ++E+LST +L    H+ +SE++ 
Sbjct  103   IFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHA  162

Query  1590  SVKQLYGSVTKNREV---EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K LY     N  V   +V + EW  ++  N++ +++A KRY  +V HG +   + +  
Sbjct  163   GIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVAGKRYFNNVVHGGEEARSAI--  220

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              A K V+ L G   ++D  PF    W+D++G + +MK V+   D++++ W+ EH  R + 
Sbjct  221   AAIKKVLLLVGASVASDVIPF--LEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNS  278

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              A    DF DIM+  +    + G  Y+R+TIIKAT + M+   ++TT     W+++ LLN
Sbjct  279   EASSSLDFIDIMLTKLKDASLFG--YSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLN  336

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +K VMK  QEE+D KVGR+RWV+ SD  NLVY++A+VKE +RLY   PL  P E+++DC 
Sbjct  337   NKHVMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCH  396

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             V GYHI KGT+L VN WKLHRDP +W  PE+F+PERFLT     D   + F  I FG GR
Sbjct  397   VGGYHISKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGR  456

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP     L+M H  +ARLLQGFD   PS  PVDM+EG  V + K  P++ +LTPRLPA
Sbjct  457   RSCPGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLPA  516

Query  522   ASY  514
               Y
Sbjct  517   ELY  519



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/486 (43%), Positives = 312/486 (64%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA+KD F+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  ++  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRINGNSST-INLTDWLEELDFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+AMK+     D+V Q W++EH+ + + 
Sbjct  214   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  274   MEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG+ RWV++SD  +LVYLQA+VK+ +RLYP  PL  P E +
Sbjct  333   LLINNQNALMKAQEEIDTKVGKYRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHEYV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+   P+KF PERF+   + D     + +I FG
Sbjct  393   KDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDI-DFRGHHYEFIPFG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   434 bits (1116),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 316/487 (65%), Gaps = 11/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK GP F IR+G     VVSS E VK+ FT ND
Sbjct  37    GAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTIND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GY+ A   F     FWR++RK+  +ELLS  +LE  KH+ ISE++
Sbjct  97    KALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVD  156

Query  1593  LSVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + ++ LYG   KN  R V V++++W+  + LN++ +++A KRY +      D+ +A   +
Sbjct  157   MGLRDLYGLWAKNDSRPVLVELKKWLEDMTLNMVVRMVAGKRY-FGASATCDDSEARQCQ  215

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F+ +DA PF  F WLD +G   AMKK +   DA+L+GW++EH +R   
Sbjct  216   KAINQFFHLIGIFTVSDALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQRRVS  273

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G + +  + DF D+M+ + ++  ++   ++ D  IK+T +A++   ++TT   + W +++
Sbjct  274   GGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTWAISL  333

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+ +++K+ QEE+D ++G +R VDDSD  NLVYLQA++KE +RLYP  PL  PRE+++
Sbjct  334   LLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAME  393

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGYHIP GT+L VN+WK+ RDP++W  P  F+PERFLT     D   +QF  I FG
Sbjct  394   DCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFG  453

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP +++AL++ H  LARLL  F+ ATPS  PVDM+E PG+T+PKA P++ +L+PR
Sbjct  454   SGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPR  513

Query  531   LPAASYN  511
             LP   Y 
Sbjct  514   LPPNPYG  520



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   433 bits (1114),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 340/527 (65%), Gaps = 13/527 (2%)
 Frame = -2

Query  2067  AMDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVK  1888
             +MD    +VAI G+ + + +L+    +         P+P G LPI+GHL +   +  L +
Sbjct  14    SMDLPSHLVAIGGIFLFILYLWRVKIQSHKTKGILTPQPSGALPIIGHLHKLGGKKPLCR  73

Query  1887  ALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAA  1708
              LA+MADK GP+F IR+G    LV+S+ +AVK+ FT ND     RP    G YLGYN A 
Sbjct  74    TLASMADKYGPIFTIRLGKDPALVISNYDAVKECFTKNDIVFGARPKSAHGRYLGYNYAG  133

Query  1707  LAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY---GSVTKNREVEV  1540
               F+  G +WR +RK+V+ ELLS+ +L+  KH+ ISE++  +K LY    +  +N + +V
Sbjct  134   FGFSPYGTYWRNMRKVVIAELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQGKV  193

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGADNQ-DAVVLRQAFKDVMTLTGEFSSAD  1369
              + EWI ++ LN++++++A KRY     V + +DN+ +   +R+  K+ M ++G    +D
Sbjct  194   VISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISD  253

Query  1368  AFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGEDPDFFDIMMKVV  1192
                +    W+D  G ++ MK++    D++   WI+EH   R ++ + +  DF D+M+ V+
Sbjct  254   MIGYP--DWIDFLGEVKNMKRIGKELDSLTASWIEEHNNARKEIDSRDKLDFIDVMLSVI  311

Query  1191  DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKV  1012
             +   + G  YTR+TIIKAT+  ++   ++TT  ++ W++++LLN++ V+K  QEEI+  V
Sbjct  312   EDNTVLG--YTRETIIKATSQNLIIAGSDTTAISLKWVISLLLNNRHVLKHAQEEINLIV  369

Query  1011  GRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNI  832
             G ERWV+D+D +NL YLQA+VKE +RLYP  PL  P E+++DC+V G+HIPKGT+L+VN+
Sbjct  370   GTERWVEDTDIENLTYLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIPKGTRLFVNL  429

Query  831   WKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFI  655
             WKLHRDP +W +PE F P+RFL T++  D     F +I FG GRRSCP   +A+++ H  
Sbjct  430   WKLHRDPTVWSDPEMFYPDRFLTTQASIDVSGNHFEFIPFGSGRRSCPGLTFAMQVIHLT  489

Query  654   LARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             L RL+QGF+ ATP  MPVDM+EG GVT+PKA  ++ +LTPRLP   Y
Sbjct  490   LGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIEFY  536



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   432 bits (1111),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 316/487 (65%), Gaps = 11/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK GP F IR+G     VVSS E VK+ FT ND
Sbjct  15    GAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTIND  74

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GY+ A   F     FWR++RK+  +ELLS  +LE  KH+ ISE++
Sbjct  75    KALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVD  134

Query  1593  LSVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + ++ L+G   KN  R V V++++W+  + LN++ +++A KRY +      D+ +A   +
Sbjct  135   MGLRDLHGLWAKNNSRPVLVELKKWLEDMTLNMVVRMVAGKRY-FGASATCDDSEARQCQ  193

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F+ +DA PF  F WLD +G   AMKK +   DA+L+GW++EH +R   
Sbjct  194   KAINQFFHLIGIFTVSDALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQRRVS  251

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G + +  + DF D+M+ + ++  ++   ++ D  IK+T +A++   ++TT   + W +++
Sbjct  252   GGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTWAISL  311

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+ +++K+ QEE+D ++G +R VDDSD  NLVYLQA++KE +RLYP  PL  PRE+++
Sbjct  312   LLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAME  371

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGYHIP GT+L VN+WK+ RDP++W  P  F+PERFLT     D   +QF  I FG
Sbjct  372   DCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFG  431

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP +++AL++ H  LARLL  F+ ATPS  PVDM+E PG+T+PKA P++ +L+PR
Sbjct  432   SGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPR  491

Query  531   LPAASYN  511
             LP   Y 
Sbjct  492   LPPNPYG  498



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   432 bits (1112),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/486 (43%), Positives = 311/486 (64%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETH---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             GG P++GHLF F  +     L + L  +ADK GPVF  R+GLP +LVVSS EA KD F+T
Sbjct  39    GGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEATKDCFST  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND   + RP    G YLGYNN  L     G +WRK RK+V+ E+LS ++LEK+K +  + 
Sbjct  99    NDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTR  158

Query  1599  MNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +  S+K LY  +  N    +++ +W+  +N  ++ K++A K Y    E G  ++     +
Sbjct  159   IQTSIKNLYTRINGNSST-INLTDWLEELNFGLIVKMIAGKNY----ESGKGDEQVERFK  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              AFKD M L+ EF   DAFP  +F W+D +G I+ MK+     D+V Q W++EH+ + + 
Sbjct  214   NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKTMKRTFKDIDSVFQNWLEEHINKREK  273

Query  1239  ----PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   G + DF D+++  + +E++  + Y+RDT+IKAT  +++ DAA+T   ++ W M 
Sbjct  274   MEVGAEGNEQDFIDVVLSKLSKEYL-DEGYSRDTVIKATVFSLVLDAADTVALHINWGMT  332

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +L+N+++ + + QEEIDTKVG++RWV++SD  +LVYLQA+VK+ +RLYP  PL  P E++
Sbjct  333   LLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENV  392

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFG  712
             +DC V+GYHIPKGT+L+ N+ KL RDPK+   P+KF PERF+   + D     + +I  G
Sbjct  393   KDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDI-DFRGHHYEFIPSG  451

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP   YAL++ H  +A L+QGF++ TP+   +DM EG G+T+ K  PV+ ++TPR
Sbjct  452   SGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEVLDMKEGAGITIRKVNPVELIITPR  511

Query  531   LPAASY  514
             L    Y
Sbjct  512   LAPELY  517



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   431 bits (1107),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 215/521 (41%), Positives = 327/521 (63%), Gaps = 14/521 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGV--LIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV  1891
             MD    +VAI+GV  L++L  L+   +          PE PG LPI+GHL +   E  L 
Sbjct  1     MDFPSHIVAIAGVISLVLLYNLWRFGKNGTKNKGLSVPEAPGALPIIGHLHRLGGEKTLA  60

Query  1890  KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNA  1711
             + +  +ADK GP+F +R+G  + +++S+ EA+K+ FTTND   + RP      Y+GYN A
Sbjct  61    RTMGDLADKCGPIFTVRLGAHKAIIISNYEAMKETFTTNDILFSSRPPSSQAKYIGYNYA  120

Query  1710  ALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDM  1534
             A  F   G +WR +RK++++ELLS  +++  +H+ +SE+N  +K LY    K    ++DM
Sbjct  121   AFGFAPYGTYWRNMRKLIMIELLSVQRIKLMRHVQVSEVNNMIKDLYSDSKK----KIDM  176

Query  1533  EEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFR  1354
              E + ++ LNI+++++A KRY      G D +    + +  ++ M + G     D  PF 
Sbjct  177   SEMLEHLILNIITRMVAGKRYFDGNSEGRD-EHGRPIGKIMREFMFVVGALVPGDLIPF-  234

Query  1353  IFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQEFIA  1174
                W D++G+ + MKKVS   D ++  WI+EH  + +     + DF D+M+ V++ +   
Sbjct  235   -LGWWDIQGIKKTMKKVSKELDVIMSTWIEEHKTKKN-KTDSNKDFIDVMLSVIEDDTTF  292

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
             G     D IIK+TAM+++   ++TT   M W ++ LLN++  ++R+QEE+D KVGR+RWV
Sbjct  293   GHKC--DVIIKSTAMSLIVAGSDTTSITMTWALSSLLNNRKTLERLQEELDQKVGRDRWV  350

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             DDSD + L Y  AV+KE +RLYP  PLG PRE+ +DC +AGYHIPKGT+L+ N+WKLHRD
Sbjct  351   DDSDIEKLDYFSAVIKETLRLYPPGPLGVPREATEDCTIAGYHIPKGTRLFTNLWKLHRD  410

Query  813   PKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQ  637
             P +W +PE+FKPERFLT++   D   + F ++ FG GRRSCP   +A+++ +  LARLLQ
Sbjct  411   PNVWADPEEFKPERFLTDNANLDVSGQHFEYLPFGAGRRSCPGLNFAMQVMNITLARLLQ  470

Query  636   GFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              +DF TP   PVDM+EG G+ +PK  P++ +LTPRL    Y
Sbjct  471   AYDFRTPGNEPVDMTEGKGIALPKITPLEVVLTPRLAPELY  511



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   431 bits (1107),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 308/487 (63%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK----KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFT  1780
             GG P++GHLF FK    ++ H  + L  +ADK GPVF  R+G  R L VSS EA+K+ FT
Sbjct  42    GGWPVIGHLFYFKNNGDEDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFT  101

Query  1779  TNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWIS  1603
             TND   A RP++  G YL YNNA LA    G +W+K RK+V  E+LS ++LEK+KH+  S
Sbjct  102   TNDIHFADRPSLLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQEVLSVSRLEKFKHVRFS  161

Query  1602  EMNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +  ++KQLY     +  V++++ +WI  +  +I+ K++  K YN        N    +L
Sbjct  162   IIQKNIKQLYNC--DSPMVKINLSDWIDKLTFDIILKMVVGKNYN--------NGHGEIL  211

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--  1249
             + AF+  M    E    D F    F WLD+ G I+AMK+     D ++QGW+DEH+++  
Sbjct  212   KVAFQKFMVQAMEMELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRE  271

Query  1248  -GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
               D+    + DF D+++  +  E + G+ Y+ DT IKAT   ++ DA +T   ++ W+MA
Sbjct  272   TKDVGGENEQDFIDVVLSKMSDEHL-GEGYSHDTTIKATVFTLVLDATDTLALHIKWVMA  330

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +++N+K VMK+ QEE+DT VGR+RWV++SD  NLVYLQA+VKE +RL+P  PL     S+
Sbjct  331   LMINNKHVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSV  390

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITF  715
             +DC V GYHIPKGT L  NI KL RDP+ WP P+KF PERFL T +  D   + +  I F
Sbjct  391   EDCVVNGYHIPKGTALLTNIMKLQRDPQTWPNPDKFDPERFLTTHATIDYRGQHYESIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRR+CPA  Y+L++ H  +A ++QGF FAT +  P+DM +G G+T+PK   V+ L+TP
Sbjct  451   GTGRRACPAMNYSLQVEHLSIAHMIQGFSFATTTNEPLDMKQGVGLTLPKKTDVEVLITP  510

Query  534   RLPAASY  514
             RLP   Y
Sbjct  511   RLPPTLY  517



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/525 (43%), Positives = 320/525 (61%), Gaps = 14/525 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLY---LSLRkqknktkkpppepPGGLPILGHLFQFKKETHL  1894
             MD L +++A +G+ + L F Y   +      N      P+PPG  PI+GHL     +  +
Sbjct  1     MDLLTQLLAFAGLFLGLLFWYNRWIVRTLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPI  60

Query  1893  VKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNN  1714
              + L  MADK GPVF+I++G+   +VVSS EAVK+ FTTNDK  A RP       LGYN 
Sbjct  61    FRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNY  120

Query  1713  AALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR---EV  1546
             A       G FWR++RK+ VVE+LS  +L + K + ISE++  +K LY     N     +
Sbjct  121   AMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIKDLYSLGKDNNWISPI  180

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V M EW  ++  N   +++A KRY  +  HG +     ++    K  ++L+G F  +D 
Sbjct  181   KVVMSEWFEHLTFNFALRMIAGKRYFDNAVHGNEEARGAII--TIKKYLSLSGAFVPSDV  238

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
             FPF     LD++G + +MK V++  D ++  W++EHV R     G   DF D+++  V  
Sbjct  239   FPF--LERLDLQGYLGSMKHVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLLSTVQD  296

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               + G  +TR+T+IKAT + ++   +++T     WI++ LLN+++ MK  QEE+D KVGR
Sbjct  297   TSMFG--HTRETVIKATIVNLIVGGSDSTSITSTWILSALLNNREAMKHAQEELDLKVGR  354

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              RWV++SD   L YL+A++KE +RLYP  PL  P E+ QDC V GYHIPKGT+L+VN WK
Sbjct  355   SRWVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWK  414

Query  825   LHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP++W  PE+F+PERFL + +  D    QF  I FG GRR+CP    AL+M H   A
Sbjct  415   LHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFA  474

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGFD ATPS  PVDM+EG   TMPK  P++ +LTPRLP+  Y
Sbjct  475   RLLQGFDMATPSNAPVDMTEGISFTMPKLTPLRVMLTPRLPSHLY  519



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/526 (42%), Positives = 339/526 (64%), Gaps = 13/526 (2%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD    ++AI+G+L+ + +L+    +         P+P G LPI+GHL +   +  L + 
Sbjct  1     MDFPSHLLAIAGILLFVLYLWRVKIQSHKTKGVLTPQPSGALPIIGHLHKLGGKNPLCRT  60

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA+MADK GP+F IR+G    LV+S+ +AVK+ FT ND   A RP    G YLGYN A  
Sbjct  61    LASMADKYGPIFTIRLGKHPALVISNHDAVKECFTKNDIVFAARPKSAHGRYLGYNYAGF  120

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY---GSVTKNREVEVD  1537
              F+  G +WR +RKMV+ ELLS+ +L+  KH+ ISE++  +K LY    +   N + +V 
Sbjct  121   GFSPYGTYWRNMRKMVIAELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGXNGQSKVV  180

Query  1536  MEEWIGYVNLNIMSKIMAKKRYN--YSVEHGADNQ-DAVVLRQAFKDVMTLTGEFSSADA  1366
             + EWI ++ L ++++++A KRY     V + +DN+ +   +R+  K+ M ++G    +D 
Sbjct  181   ISEWIEHLTLXVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISDM  240

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGEDPDFFDIMMKVVD  1189
               +    W+D  G ++ MK++    DA+   WI+EH   R ++ + +  DF D+M+ V++
Sbjct  241   IGYP--DWIDFLGQVKNMKRIGKELDALTASWIEEHNNARKEIDSRDKLDFIDVMLSVIE  298

Query  1188  QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVG  1009
                + G  +TR+TIIKAT+  ++   ++TT  ++ WI+++LLN++ V+K  QEEI+ KVG
Sbjct  299   DNTVLG--HTRETIIKATSQNLIIAGSDTTAISLKWIISLLLNNRHVLKHAQEEINLKVG  356

Query  1008  RERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIW  829
              ERWV+D+D +NL  LQA+VKE +RLYP  PL  P E+++DC+V G+HI KGT+L+VN+W
Sbjct  357   TERWVEDTDIENLTXLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIXKGTRLFVNLW  416

Query  828   KLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFIL  652
             KLHRDP +W +PE F P+RFL T++  D     F +I FG GRRSCP   +A+++ H  L
Sbjct  417   KLHRDPTMWSDPEMFYPDRFLTTQASIDASGNHFEFIPFGSGRRSCPGLTFAMQVIHLTL  476

Query  651   ARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              RL+QGF+ ATP  MPVDM+EG GVT+PKA  ++ +LTPRLP   Y
Sbjct  477   GRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIELY  522



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   429 bits (1102),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 228/525 (43%), Positives = 341/525 (65%), Gaps = 19/525 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD L   +AI+G+L++  +L+    +         P+P G LPI+GHL + +    + K 
Sbjct  1     MDFLSHPLAIAGLLVLALYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRGP--IFKT  58

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA MADK GP+F I +G   +LV+S+ +AVK  FT ND   A RP    G YLGYN A  
Sbjct  59    LAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSTTGKYLGYNYAGF  118

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY------GSVTKNREV  1546
              F+  G +WR +RKMV+VELLS+ +LE  KH+ ISE++  +K L+      G    N   
Sbjct  119   GFSPYGTYWRDMRKMVMVELLSSRRLETLKHVQISEVDAFIKGLFLLCKTEGHNGLN-PT  177

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V + +WI  + LN++++++A KRY  S + G + +   +L    K+ M ++G+  ++D 
Sbjct  178   KVVISDWIERLTLNVITRMIAGKRYFDSSDEGDEQRFGKIL----KEFMYVSGKPVASDV  233

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
               F    W+D +G I+AMK++    D+ +   ++EH  + +  + ++ DF D+M+ V++ 
Sbjct  234   IGFP--SWIDFKGQIKAMKRIMKELDSFMGNLVEEHYAKKETNSRDEHDFIDVMISVIED  291

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
                 G  YTR+TIIKAT++ ++   +ETT  +++WI+++LLN++ V+K  QEE+D KVGR
Sbjct  292   NSTLG--YTRETIIKATSLNLILAGSETTAISLIWILSLLLNNRHVLKLAQEELDLKVGR  349

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
             +RW++D+D +NL YLQA+VKE +RLYP  PL  P E++QDC+V G+HI KGT L+VN+WK
Sbjct  350   DRWIEDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWK  409

Query  825   LHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP +WP+PE F PERFLT  V  D   + F +I FG GRRSCP + +AL++ H  L 
Sbjct  410   LHRDPSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLG  469

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGF+ ATP  MPVD++EG G+TMPK+  ++ +LTPRLP   Y
Sbjct  470   RLLQGFELATPMDMPVDLTEGLGITMPKSTSLEVILTPRLPFEFY  514



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   430 bits (1106),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 215/483 (45%), Positives = 301/483 (62%), Gaps = 11/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL     +  + + L  MADK GPVF+I++G+   +VVSS EAVK+ FTTNDK
Sbjct  91    GAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDK  150

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP       LGYN A   F   G FWR++RK+ VVE+LS  +L + K + ISE++ 
Sbjct  151   VFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDA  210

Query  1590  SVKQLYGSVTKNR---EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              ++ LY     N     +EV M EW  ++  N + +++A KRY  +  HG +     ++ 
Sbjct  211   CIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEEARGAII-  269

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              A K  ++L+G F  +D FPF     LD++G + +MK V++  D ++  W++EHV R   
Sbjct  270   -AIKKFLSLSGAFVPSDVFPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMRLKS  326

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
               G   DF D+++  V    + G  ++R+T+IKAT   ++   +++T     WI++ LLN
Sbjct  327   EPGSRHDFIDVLLSAVQDTSMFG--HSRETVIKATIGNLIVGGSDSTSITSTWILSALLN  384

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +++ MKR QEE+D KVGR RWV++SD   L YL+A++KE +RLY   PL  P E+ QDC 
Sbjct  385   NREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCH  444

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGR  703
             V GYHIPKGT+L+VN WKLHRDP++W  PE+F+PERFL + +  D    QF  I FG GR
Sbjct  445   VCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGR  504

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             R+CP    AL+M H   ARLLQGFD ATPS  PVDM+EG   TMPK  P+  +LTPRLP+
Sbjct  505   RACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLCVMLTPRLPS  564

Query  522   ASY  514
               Y
Sbjct  565   HLY  567



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   429 bits (1102),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 226/519 (44%), Positives = 320/519 (62%), Gaps = 23/519 (4%)
 Frame = -2

Query  2040  AISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH----LVKALATM  1873
             AI   L+ L F++  L   +  +K   PE PGG P++GHLF FK +      L + L  +
Sbjct  16    AIIAGLVTLAFVFYFLWNFRKSSKTLAPEIPGGWPVIGHLFYFKNDADHDRTLAQKLGDL  75

Query  1872  ADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT  1693
             ADK GPVF  ++G  R LVVSS +A+K+ FTTND   + RP +  G +L YNNA L    
Sbjct  76    ADKHGPVFTYKLGFRRFLVVSSYDAIKECFTTNDIRFSNRPALLYGDHLCYNNAMLFIAK  135

Query  1692  -GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEWIGY  1516
              G +WRK+RK+V  E+LS  +LEK+K+I  S +  +VK+LY       +  +++ +WI  
Sbjct  136   YGPYWRKIRKLVNQEVLSVNRLEKFKYIRFSIVQENVKELYDHC----DSTINLTDWIDK  191

Query  1515  VNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLD  1336
             ++ +I+ K++A K YN        N    +L+ AF+  M +  EF   D FP  +F W+D
Sbjct  192   LSFDIILKMIAGKSYN--------NGHGEILKIAFQKFMVIAMEFELYDIFPIPLFKWVD  243

Query  1335  MEGLIRAMKKVSDGTDAVLQGWIDEHVRR----GDLPAGEDPDFFDIMMKVVDQEFIAGQ  1168
               G ++ +K+     D V QGW+DEH+++     ++    + DF D M+     E + G 
Sbjct  244   FSGNVKVVKETFKDIDTVFQGWLDEHIKKRESNNEVLDENEQDFIDSMLSKTSNERL-GD  302

Query  1167  NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDD  988
              Y+  T IKAT  +++ DA ET   ++ W+MA+L+N+K  MK+ QEEIDT VG++RWV++
Sbjct  303   TYSPSTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQEEIDTIVGKDRWVEE  362

Query  987   SDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPK  808
             SD  NLVYLQA+VKE +RLYP  PL  P ES++DC V GYHIPKGT L  N+ KL RDPK
Sbjct  363   SDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRDPK  422

Query  807   IWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGF  631
             +W +P KF PERFLT     D   + +  I FG GRR+CPA  YAL++ +  +A L+QGF
Sbjct  423   MWLDPNKFDPERFLTTHAKIDYRGQHYELIPFGTGRRACPAMTYALQVEYLSIAHLIQGF  482

Query  630   DFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             +F TPS  P+DM EG G+T PK  P++ L+TPRLP   Y
Sbjct  483   NFNTPSNEPLDMKEGVGITSPKKNPIEVLITPRLPTMLY  521



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   428 bits (1101),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 223/525 (42%), Positives = 315/525 (60%), Gaps = 14/525 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepP---GGLPILGHLFQFKKETHL  1894
             MD L  ++A +G+ + L   Y   R +           P   G  PI+GHL     +  +
Sbjct  1     MDLLTHLLAFAGLFLGLLXWYNRWRVRXLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPI  60

Query  1893  VKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNN  1714
              + L  MADK GPVF+I++G+   +VVSS EAVK+ FTTNDK  A RP       LGYN 
Sbjct  61    FRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNY  120

Query  1713  AALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR---EV  1546
             A   F   G FWR++RK+ VVE+LS  +L + K + ISE++  ++ LY     N     +
Sbjct  121   AGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQDLYSLGKDNNWISPI  180

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             EV M EW  ++  N + +++A KRY  +  HG +     ++  A K  ++L+G F  +D 
Sbjct  181   EVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEEARGAII--AIKKFLSLSGAFVPSDV  238

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
             FPF     LD++G + +MK V++  D ++  W++EHV R     G   DF D+++  V  
Sbjct  239   FPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMRLKSEPGSRHDFIDVLLSAVQD  296

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               + G  ++R+T+IKAT   ++   +++T     WI++ LLN+++ MK  QEE+D KVGR
Sbjct  297   TSMFG--HSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKXAQEELDLKVGR  354

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              RWV++SD   L YL+A++KE +RLY   PL  P E+ QDC V GYHIPKGT+L+VN WK
Sbjct  355   SRWVEESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWK  414

Query  825   LHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP++W  PE+F+PERFL + +  D    QF  I FG GRR+CP    AL+M H   A
Sbjct  415   LHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFA  474

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             RLLQGFD ATPS  PVDM+EG   TMPK  P+  +LTPRLP+  Y
Sbjct  475   RLLQGFDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPRLPSHLY  519



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   428 bits (1100),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 329/520 (63%), Gaps = 17/520 (3%)
 Frame = -2

Query  2037  ISGVLIILPFLYLSL----RkqknktkkpppepPGGLPILGHLFQFK---KETHLVKALA  1879
             +  +L IL F++ ++    R     T+K  P+ PG  PI+GHL Q     K       LA
Sbjct  5     LEAILGILAFVFFAIIIWRRSNTLTTEKLAPQVPGAWPIIGHLHQLSGIDKNVPFAHTLA  64

Query  1878  TMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF  1699
              +ADK GP+F +RMG+   L++++ E  KD  TT+DK  A RP   AG  +GY  A   +
Sbjct  65    ALADKYGPIFTLRMGMYPYLIINNWEGAKDCLTTHDKDFAARPTSMAGQSIGYKYARFTY  124

Query  1698  TT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG---SVTKNREVEVDME  1531
             +  G ++  VRK+ + ++LS+TKLEK +HI + E+  S+K LY       KN EV +++ 
Sbjct  125   SNFGLYYNHVRKLALTQVLSSTKLEKMRHIRVVELENSIKDLYSLTQVANKNNEV-INIT  183

Query  1530  EWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRI  1351
             +W   + LN + K +  KRYN ++E    +++A   R+AFK +M + G+    D  PF +
Sbjct  184   QWFHQLTLNTIVKTICGKRYN-NIE---KDEEAKRFRKAFKGIMYVVGQIVLYDVVPFPL  239

Query  1350  FHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQEFIAG  1171
             F ++D +G I+ M  +    D++LQGW+++H+++ DL   +D D  D M+K    +    
Sbjct  240   FKYVDFQGHIKLMNNIYKDLDSILQGWLEDHMKKKDLNNDDDEDAIDAMLKATYVDEFKA  299

Query  1170  QNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVD  991
               Y++ T+IK+T ++++ D ++TT  +M+WIM++LLN+   MK+ QEEIDTKVG+ RWV 
Sbjct  300   YGYSQATVIKSTILSLILDGSDTTAVHMIWIMSLLLNNPHAMKQAQEEIDTKVGKSRWVG  359

Query  990   DSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDP  811
             +SD  NLVYLQA+VKE  RLYP VPL  P E++QDC+VAGY IPKGT+ Y+N WK+HRDP
Sbjct  360   ESDVKNLVYLQAIVKETSRLYPPVPLLLPHEAVQDCKVAGYDIPKGTRTYINAWKIHRDP  419

Query  810   KIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             KIW E EKF PERFLT +S  D   + F +I FG GRRSCP   +A  + H   ARLLQG
Sbjct  420   KIWSESEKFMPERFLTSKSSVDARGQHFEFIPFGSGRRSCPGINFATLVTHLTFARLLQG  479

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             F F+T S  P+DM+EG G+T+PK   V+ L+TPRL +  Y
Sbjct  480   FAFSTSSNTPIDMTEGVGITLPKVNQVEILVTPRLSSNFY  519



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   428 bits (1101),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 305/490 (62%), Gaps = 14/490 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             GG PI+GHL        L+ + L  MADK GP F IR+G  R  VVSS E  KD FT ND
Sbjct  41    GGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVND  100

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             +ALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +L+  +H+  SE++
Sbjct  101   RALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLRHVRTSELD  160

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             + +K+LY    +N   R   V++  W+  + LN++ +++A KRY  +     D  +A   
Sbjct  161   MGIKELYSLWVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCEDGDEARRC  220

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++A      L G F  ADA PF    WLD++G  +AMKK +   D +L GW++EH +R  
Sbjct  221   QKAIGQFFHLIGIFVVADALPF--LWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQRRG  278

Query  1242  LPAGE------DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
                GE      D DF D+M+ + ++  ++   Y+ DT IK+T +A++   ++TT   + W
Sbjct  279   ASHGEAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAGTLTW  338

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLN+ D MK  QEE+D  VG ER V++SD  NLVYLQA++KE +RLYP  PL  PR
Sbjct  339   AISLLLNNPDAMKMAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPR  398

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGW  724
             E+++DC VAGY +P GT+L VN+WK+ RDP++W  P  F PERFL + S  D   +QF  
Sbjct  399   EALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWENPSAFVPERFLESHSHVDVRGQQFNL  458

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FGFGRRSCP  ++A+++ H  LARLL GF   T SG  VD++E PG+T+PKA P++ L
Sbjct  459   MPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKATPLEVL  518

Query  543   LTPRLPAASY  514
             L+PRLP+  Y
Sbjct  519   LSPRLPSELY  528



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   426 bits (1096),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 217/489 (44%), Positives = 304/489 (62%), Gaps = 39/489 (8%)
 Frame = -2

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICA-----------  1738
             +A +ADK GP+F+ R+G+  +LV+S+ EAVK+ FTTND   A RP+ CA           
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  1737  ----------------GVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIW  1609
                             G +LGY+ AA  F   G +WR +RK+V++ELLS  +LE  +H+ 
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  1608  ISEMNLSVKQLYGSVTKNR--EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQD  1435
             +SE+   V  LYG   KN     EV + EWI +  LNI+++++A KRY +         +
Sbjct  121   VSEVETLVNGLYGQCKKNGFGPTEVVISEWIEHFTLNIITEMIAGKRY-FDSSGKVVGGE  179

Query  1434  AVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
             A  + +  K+ M ++G F  +D  P  +  W+D  G ++AMK++    D ++Q W++EH 
Sbjct  180   AERIGKVIKEYMCISGAFIVSDLIP--VPKWVDFNGNLKAMKRIGREIDVLIQSWVEEHK  237

Query  1254  RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
             R     A +  DF DIM+ ++++    G  Y RDTIIK T   ++   ++TT  N+ WI+
Sbjct  238   RS---EASDKQDFIDIMLSLIEENHELG--YARDTIIKGTVSTLIIAGSDTTAINLTWIL  292

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN++  + R QEE+D  VG+ERWV+ SD  NLVYLQA+VKE +RLYP  PL  P ++
Sbjct  293   ALLLNNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRLYPPGPLAVPHQA  352

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
              +DC V G+H+ KGT+L+VN+WKLHRDP  WP+PE F PERFLT     D L + F  I 
Sbjct  353   REDCTVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSHAGIDVLGQHFELIP  412

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP  A+AL++ H  LARLLQGF FAT    PVDMSEG G+T+P+A PV+A+LT
Sbjct  413   FGSGRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGLGITLPRATPVEAVLT  472

Query  537   PRLPAASYN  511
             PRLPA  Y 
Sbjct  473   PRLPAELYQ  481



>ref|XP_009770601.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 307/487 (63%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKK----ETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFT  1780
             GG P++GHLF FK     + H  + L  +ADK GPVF  R+G  R L VSS EA+K+ F+
Sbjct  42    GGWPVIGHLFYFKNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFS  101

Query  1779  TNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWIS  1603
             TND   A RP +  G YL YNNA LA    G +W+K RK+V  ELLS ++LEK+KH+  S
Sbjct  102   TNDIHFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFS  161

Query  1602  EMNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +  ++K+LY     +  V++++ +WI  +  +I+ K++  K YN        N    +L
Sbjct  162   IVQKNIKELYDG--DSPMVKINLSDWIDKLTFDIILKMIVGKTYN--------NGHGEIL  211

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--  1249
             + AF+  M    E    D F    F WLD+ G I+AMK+     D ++QGW+DEH+++  
Sbjct  212   KAAFQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRE  271

Query  1248  -GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
               D+    + DF D+++     E + G  Y+ DT IKAT   ++ DA +T   ++ W+MA
Sbjct  272   TKDVGGENEQDFIDVVLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMA  330

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +++N+K+VMK+ QEE+DT VGR+RWV++SD  NLVYLQA+VKE +RL+P  PL     S+
Sbjct  331   LMINNKNVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSV  390

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITF  715
             +DC V GYHIPKGT L  NI KL RDP+IW +P+KF PERFL T +  D   + +  I F
Sbjct  391   KDCVVNGYHIPKGTALLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRR+CPA  Y+L++ H  +A ++QGF+FAT +  P+DM +G G+T+PK   V+ L+TP
Sbjct  451   GTGRRACPAMNYSLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITP  510

Query  534   RLPAASY  514
             RLP   Y
Sbjct  511   RLPPTLY  517



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   427 bits (1099),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 312/487 (64%), Gaps = 13/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK G  F IR+G  R  VVSS E VK+ FT ND
Sbjct  42    GAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECFTIND  101

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +LE  KH+  SE++
Sbjct  102   KALASRPTTVAAKHMGYNYAVFGFAPYSAFWREMRKIATIELLSNRRLEMLKHVRASEVD  161

Query  1593  LSVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + +++LY S   N    V V++++W+  + LN++ +++A KRY +     +D+ +A   +
Sbjct  162   IGIRELYNSWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRY-FGSAAASDDGEARRCQ  220

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +A      L G F  +DA PF    WLD++G  RAMK  +   DA+L+GW+DEH R+  +
Sbjct  221   KAINQFFRLIGIFLVSDALPF--LGWLDLQGHERAMKNTAKELDAILEGWLDEH-RQRRV  277

Query  1239  PAG----EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
              AG    ++ DF D+M+ + ++  ++   Y  +T IK+T +A++   ++TT   + W ++
Sbjct  278   SAGIKDEDEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAGTLTWAIS  337

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN++ ++K+ QEE+D  VG+ER V+DSD  NLVYLQA++KE +RLYP  PL  PRE++
Sbjct  338   LLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLGPREAM  397

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
             +DC+VAGYH+P GT+L VN+WK+ RDP++W  P  F PERFLT     D   +QF  I F
Sbjct  398   EDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQFELIPF  457

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP  ++AL++ H  LARLL  F  ATP   PVD++E  G+T+PKA P++ +LTP
Sbjct  458   GSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKATPLEVILTP  517

Query  534   RLPAASY  514
             RLP   Y
Sbjct  518   RLPPKLY  524



>ref|XP_009792748.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 307/487 (63%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKK----ETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFT  1780
             GG P++GHLF FK     + H  + L  +ADK GPVF  R+G  R L VSS EA+K+ F+
Sbjct  42    GGWPVIGHLFYFKNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFS  101

Query  1779  TNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWIS  1603
             TND   A RP +  G YL YNNA LA    G +W+K RK+V  ELLS ++LEK+KH+  S
Sbjct  102   TNDIHFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFS  161

Query  1602  EMNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +  ++K+LY     +  V++++ +WI  +  +I+ K++  K YN        N    +L
Sbjct  162   IVQKNIKELYDG--DSPMVKINLSDWIDKLTFDIILKMVVGKTYN--------NGHGEIL  211

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--  1249
             + AF+  M    E    D F    F WLD+ G I+AMK+     D ++QGW+DEH+++  
Sbjct  212   KAAFQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRE  271

Query  1248  -GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
               D+    + DF D+++     E + G  Y+ DT IKAT   ++ DA +T   ++ W+MA
Sbjct  272   TKDVGGENEQDFIDVVLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMA  330

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +++N+K+VMK+ QEE+DT VGR+RWV++SD  NLVYLQA+VKE +RL+P  PL     S+
Sbjct  331   LMINNKNVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSV  390

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITF  715
             +DC V GYHIPKGT L  NI KL RDP+IW +P+KF PERFL T +  D   + +  I F
Sbjct  391   KDCVVNGYHIPKGTALLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRR+CPA  Y+L++ H  +A ++QGF+FAT +  P+DM +G G+T+PK   V+ L+TP
Sbjct  451   GTGRRACPAMNYSLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITP  510

Query  534   RLPAASY  514
             RLP   Y
Sbjct  511   RLPPTLY  517



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 306/490 (62%), Gaps = 14/490 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             GG PI+GHL        L+ + L  MADK GP F IR+G  R  VVSS E  KD FT ND
Sbjct  41    GGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVND  100

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             +ALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +L+  KH+  SE++
Sbjct  101   RALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKHVRTSELD  160

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             + +K+LY    +N   R   V++  W+  + LN++ +++A KRY  +     D  +A   
Sbjct  161   MGIKELYNLGVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCEDGDEARRC  220

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++A      L G F  ADA PF    WLD++G  +AMKK +   D +L GW++EH +R  
Sbjct  221   QKAIGQFFHLIGIFVVADALPF--LWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQRRG  278

Query  1242  LPAGE------DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
                G+      D DF D+M+ + ++  ++   Y+ DT IK+T +A++   ++TT   + W
Sbjct  279   ASHGKAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAGTLTW  338

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++L+N+   MK+ QEE+D  VG ER V++SD  NLVYLQA++KE +RLYP  PL  PR
Sbjct  339   AISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPR  398

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGW  724
             E+++DC VAGY +P GT+L VN+WK+ RDP++W  P  F PERFL + S  D   +QF  
Sbjct  399   EALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERFLESHSHVDVRGQQFNL  458

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FGFGRRSCP  ++A+++ H  LARLL GF   T SG  +D++E PG+T+PKA P++AL
Sbjct  459   MPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPGLTIPKATPLEAL  518

Query  543   LTPRLPAASY  514
             L+PRLP+  Y
Sbjct  519   LSPRLPSELY  528



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   427 bits (1097),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 224/516 (43%), Positives = 322/516 (62%), Gaps = 9/516 (2%)
 Frame = -2

Query  2046  VVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMAD  1867
             V AI G+L +L    +     +N  K   PEP G  P++GHL     +  L K L  MAD
Sbjct  8     VQAIEGLLALLVLYVIWRYIARNSNKSRIPEPSGSWPLIGHLHLLGGKETLCKKLGAMAD  67

Query  1866  KIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-G  1690
             K GP++ +++G  R+LVVSS E  KD  T ND+ALA RP+I AG ++GYNNA  A    G
Sbjct  68    KYGPLYSLKLGHRRVLVVSSWEIAKDCLTNNDRALATRPSIAAGRHIGYNNAIFALAPYG  127

Query  1689  AFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE--VEVDMEEWIGY  1516
              +WR +RK+V +ELLS+ +LEK KHI  SEM+L +K+L+    +N +   +V M E +  
Sbjct  128   EYWRNIRKIVTIELLSSYRLEKLKHIRFSEMDLFIKELFRLCVENADNCAQVTMSEVLER  187

Query  1515  VNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLD  1336
             +  NI  +++  KR+  S    A +Q      +A K  + L+G F  ADA PF    W+D
Sbjct  188   LTFNINLRMLVGKRFASSSYAQAHSQ-PWRYEKAIKQTLYLSGIFVLADALPF--LEWMD  244

Query  1335  MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGE-DPDFFDIMMKVVDQEFIAGQNYT  1159
             ++G +R+MK+ +   D+++  W++ H+RR     G  + DF D+M+  + Q+ +    +T
Sbjct  245   IQGHVRSMKQTAKELDSIISVWLENHLRRKRESQGSCESDFMDVMLANLPQDAVIS-GHT  303

Query  1158  RDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDT  979
             RDTI+KAT + +     E+T   M W++++LLNH  V+K  Q+E+D  VG +RWV++SD 
Sbjct  304   RDTIVKATTLILTMTGGESTSVTMTWVLSLLLNHPSVLKAAQQELDLHVGIDRWVEESDI  363

Query  978   DNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWP  799
              +L YLQA+VKE +RLYP  PL   RE+++DC +AGYH+PKGT+L VN+WKL RDP++W 
Sbjct  364   KSLKYLQAIVKETLRLYPPGPLTGIREAMEDCCIAGYHVPKGTRLIVNLWKLQRDPRVWE  423

Query  798   EPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFA  622
              P +F+PERFLT     D   + F +I F  GRRSCPA  + L++ H  LA+LLQGFD  
Sbjct  424   NPGEFQPERFLTTHADFDVRGQNFEYIPFSSGRRSCPAITFGLQVVHLTLAKLLQGFDIR  483

Query  621   TPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             TP G PVDM EG G+ +PK  P+  +LTPRL    Y
Sbjct  484   TPDGKPVDMGEGLGLALPKRTPLDVVLTPRLAHEFY  519



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   426 bits (1094),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 229/529 (43%), Positives = 324/529 (61%), Gaps = 22/529 (4%)
 Frame = -2

Query  2073  HTAMDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH-  1897
             H  +  L  + AI   L+ L F++  L   +  +K  PPE PGG P++GHLF FK +   
Sbjct  3     HHLLLLLSPIEAIIAGLVTLAFVFYFLWNFRKSSKTLPPEIPGGWPVIGHLFYFKNDGDH  62

Query  1896  ---LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYL  1726
                L + L  +ADK GPVF  ++G  R LVVSS EA+K+ FTTND   + RP +  G +L
Sbjct  63    DRTLAQKLGDLADKHGPVFTYKLGFRRFLVVSSYEAIKECFTTNDIRFSNRPALLYGDHL  122

Query  1725  GYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE  1549
              YNNA L     G +WRK+RK+V  E+LS  +LEK+K I  S +  +VK+LY       +
Sbjct  123   CYNNAMLFIAKYGPYWRKIRKLVNQEVLSVNRLEKFKCIRFSIVQKNVKELYDHC----D  178

Query  1548  VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSAD  1369
               +++ +WI  ++ +I+ K++A K YN        N    +L+ AF+  M +  EF   D
Sbjct  179   STINLTDWIDKLSFDIILKMIAGKSYN--------NGHGEILKIAFQKFMVIAMEFELYD  230

Query  1368  AFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR---RGDLPAGEDPDFFDIMMK  1198
              FP  +F W+D  G I+ +K+     D V QGW+DEH++   R +     + DF D M+ 
Sbjct  231   IFPIPLFKWVDFSGNIKVVKETFKDIDTVFQGWLDEHIKKRERNETLDENEEDFIDSMLS  290

Query  1197  VVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDT  1018
                 E + G  ++ +T IKAT  +++ DA ET   ++ W+MA+L+N+K  MK+ Q+EIDT
Sbjct  291   KTSNEHL-GDTHSPNTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQKEIDT  349

Query  1017  KVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYV  838
              VG++RWV++SD  NLVYLQA+VKE +RLYP  PL  P ES++DC V GYHIPKGT L  
Sbjct  350   IVGKDRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLP  409

Query  837   NIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAH  661
             N+ KL RDPKIW +P+KF PERFLT     D   + + +I FG GRR+CPA  YAL++ +
Sbjct  410   NVMKLQRDPKIWSDPDKFDPERFLTTHAKIDYRGQHYEFIPFGTGRRACPAMTYALQVEY  469

Query  660   FILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
               +A L+QGF+F TPS   +DM EG G+T PK  P++ L+TPRL    Y
Sbjct  470   LSIAHLIQGFNFNTPSNESLDMKEGVGITSPKKNPIEVLITPRLSTTLY  518



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   424 bits (1091),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 324/523 (62%), Gaps = 29/523 (6%)
 Frame = -2

Query  2064  MDALIRVVAISGVL--IILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV  1891
             MD   ++VAISG+L  ++L  ++  +        K  PEP G  P LGHL   + +T + 
Sbjct  1     MDTPSQLVAISGILGLVLLYGVWRVMTLAGKSKGKSAPEPSGAWPFLGHLPLLRGQTPIF  60

Query  1890  KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNA  1711
             + L  MADK GPVF+IR+G+ R LVVSS EAVK+ FTTNDKA A RP+  AG  LGYN+A
Sbjct  61    RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKAFASRPSSSAGKILGYNHA  120

Query  1710  ALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHI--WISEMNLSVKQLYGSVTKNREVEV  1540
                F   GA WR++RK+ ++E+LS +  +  K    W+                   V+V
Sbjct  121   GFGFAPYGALWREMRKLSMMEILSASSPQCVKSCSDWV-----------------HPVKV  163

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFP  1360
              M EW  +++ NI+ K++A KR   + +HG  N++A         ++ LTG F  +DA P
Sbjct  164   VMSEWFQHLSFNIVLKMIAGKRSFNTSDHG--NEEARRAIATIHKLLFLTGAFVLSDAIP  221

Query  1359  FRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQEF  1180
                  W+D++G + +MK+V+   D+++ GW++EH  R +    +  DF D+M+ V++   
Sbjct  222   G--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEMRLNREGNKRQDFIDVMLSVLEDTS  279

Query  1179  IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRER  1000
             + G  Y+R+T+IKAT M ++    +T  +   W+++ LLN+K  +K  QEE+D KVGR R
Sbjct  280   MFG--YSRETVIKATIMILIVGGTDTLSTTSTWLLSALLNNKHALKCAQEELDLKVGRGR  337

Query  999   WVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLH  820
             WV++SD  NL+YLQAV+KE +RLY   PL  P E+++DC VAGYHIPKGT+L+VN WKLH
Sbjct  338   WVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWKLH  397

Query  819   RDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARL  643
             RDP +W +PE F+PERFLT     D L + F  I FG GRRSCP    ALK+   ++ RL
Sbjct  398   RDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRL  457

Query  642   LQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LQGFD +TP   PVDM EG  +T+ K  P++ +LTPRLP+  Y
Sbjct  458   LQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRLPSQFY  500



>dbj|BAA35080.1| putative cytochrome P450 [Nicotiana tabacum]
 gb|AAK62347.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=519

 Score =   425 bits (1092),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/487 (44%), Positives = 305/487 (63%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKK----ETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFT  1780
             GG P++GHLF F      + H  + L  +ADK GPVF  R+G  R L VSS EA+K+ F+
Sbjct  42    GGWPVIGHLFYFNNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFS  101

Query  1779  TNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWIS  1603
             TND   A RP +  G YL YNNA LA    G +W+K RK+V  ELLS ++LEK+KH+  S
Sbjct  102   TNDIHFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFS  161

Query  1602  EMNLSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +  ++KQLY     +  V++++ +WI  +  +I+ K++  K YN        N    +L
Sbjct  162   IVQKNIKQLYNC--DSPMVKINLSDWIDKLTFDIILKMVVGKTYN--------NGHGEIL  211

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--  1249
             + AF+  M    E    D F    F WLD+ G I+AMK+     D ++QGW+DEH+++  
Sbjct  212   KAAFQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRE  271

Query  1248  -GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
               D+    + DF D+++     E + G  Y+ DT IKAT   ++ DA +T   ++ W+MA
Sbjct  272   TKDVGGENEQDFIDVLLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMA  330

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +++N+K+VMK+ QEE+DT VGR+RWV+++D  NLVYLQA+VKE +RL+P  PL     S+
Sbjct  331   LMINNKNVMKKAQEEMDTIVGRDRWVEENDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSV  390

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
             +DC V GYHIPKGT L  NI KL RDP+IW +P+ F PERFLT +   D   + +  I F
Sbjct  391   KDCVVNGYHIPKGTALLTNIMKLQRDPQIWVDPDTFDPERFLTTNAAIDYRGQHYELIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRR+CPA  Y+L++ H  +A L+QGF+FAT +  P+DM +G G+T+PK   V+ L+TP
Sbjct  451   GSGRRACPAMNYSLQVEHLSIAHLIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITP  510

Query  534   RLPAASY  514
             RLP   Y
Sbjct  511   RLPPTLY  517



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 221/499 (44%), Positives = 311/499 (62%), Gaps = 24/499 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQF-------------KKETHLVKALATMADKIGPVFIIRMGLPRILVVSS  1807
             G  PI+GHL Q                E  L   L  +ADK GPVF +R G+  I VVSS
Sbjct  46    GAWPIIGHLPQILSNTLDGRNRINKDGEIPLAHTLGALADKYGPVFTVRQGMFPIAVVSS  105

Query  1806  LEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKL  1630
              EA+K+ FTT DK LA R   C+  YLGY++A L F   G +WR VRK+VV  LLS+  L
Sbjct  106   YEAIKECFTTQDKNLANRVATCSCKYLGYDHANLTFANYGPYWRMVRKLVVNNLLSSKSL  165

Query  1629  EKWKHIWISEMNLSVKQLY----GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYS  1462
             E+ KH+ ISE+  S+K+LY     +  KN   +VD+  W   + LNI  K++  KRY+  
Sbjct  166   ERLKHVRISEVESSIKELYTLFVANEAKNVPTKVDIGHWFDDMMLNITVKMIGGKRYSQV  225

Query  1461  VEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAV  1282
                  + ++A   R+AF + M         DAFPF +  WLD++G I+ MK+++D  D +
Sbjct  226   NNKEEEKEEAERFRKAFNETMYYIAIVGIEDAFPFPLLQWLDLQGNIKVMKRIADEMDVI  285

Query  1281  LQGWIDEHV-RRGDLPAGEDPDFFDIMMKVVDQE-FIAGQNYTRDTIIKATAMAMLQDAA  1108
             LQ W+D+H  +R +  + +D D  DIM+  +D++ F  G  Y+R+TIIKAT + ++ DA 
Sbjct  286   LQRWLDDHTNKRKNNESNDDQDLIDIMLTELDKDDFQYG--YSRETIIKATMLTIVSDAT  343

Query  1107  ETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLY  928
              TT  +++WI+A LLN+K V++++ EEIDTKVG++RWV+DSD  NL+Y QA +KE +RLY
Sbjct  344   HTTAVHLIWIIACLLNNKHVLEKVHEEIDTKVGKDRWVEDSDIKNLMYFQATIKEVLRLY  403

Query  927   PVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-  751
             P  P+    E++ DC+V GYHI KGT+L+VN+WKL +D K WPEPEKF PERFLT     
Sbjct  404   PPSPM-LVHEALADCQVLGYHISKGTRLFVNVWKLQKDSKFWPEPEKFLPERFLTTKAKV  462

Query  750   DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTM  571
             D   +   +I FG GRRSCP    A+++ +  +ARLLQ FDF  P+  P+DM+EGPG T 
Sbjct  463   DVYGKDLEFIPFGSGRRSCPGITMAMQVTYLSIARLLQAFDFDLPNNDPLDMTEGPGFTA  522

Query  570   PKAKPVKALLTPRLPAASY  514
              K  P++ ++ PR+    Y
Sbjct  523   VKKVPLEVVVKPRMLPMYY  541



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 220/498 (44%), Positives = 318/498 (64%), Gaps = 22/498 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GH+     ET L + LA MADK GP+F IR+G+    ++SS EAV++ FTT+DK
Sbjct  41    GAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSREAVRECFTTHDK  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP   AG++LGY  A   F   G FWR++RK+ ++ELLST +L+  KH+  SE++ 
Sbjct  101   DLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLDNLKHVQASEIDT  160

Query  1590  SVKQLYGSVTKNR-------EVEVDMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGA---  1447
              VK L+     N           V + + +  + LNI+ +++A KRY    S   G+   
Sbjct  161   FVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLSSASTGSSAD  220

Query  1446  DNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWI  1267
             D+++A  LR+  K+ M ++G  + +D  PF    W D  G ++ MK+V+   D ++  W+
Sbjct  221   DDEEASHLRRVIKEFMYISGFPAVSDLVPFT--GWTDCVGTVKTMKRVARELDEIVGKWV  278

Query  1266  DEHV------RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAE  1105
             +EH       +RG++      DF D+M+ V+ ++ +A   ++ +T+IKAT + ++   ++
Sbjct  279   EEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATIVNIIVAGSD  338

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
             +T  N+ W++++LLNHK V+KR QEEID KVG++RWV DSD +NL+YLQA+VKE +RLYP
Sbjct  339   STSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYP  398

Query  924   VVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPD  748
               PL  P E+  DC V GY IPKGT+++VN WKLHRDP++W EPEKF PERFLT  S  D
Sbjct  399   PGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHSGVD  458

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
                + F +I FG GRR CP +A+AL+  H  LARLLQGFD AT     VDM+EG GV +P
Sbjct  459   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLP  518

Query  567   KAKPVKALLTPRLPAASY  514
             KA P++ +L PRLP+  Y
Sbjct  519   KATPLRVVLNPRLPSVLY  536



>ref|XP_006355071.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=525

 Score =   424 bits (1091),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 213/504 (42%), Positives = 318/504 (63%), Gaps = 18/504 (4%)
 Frame = -2

Query  2040  AISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETH---LVKALATMA  1870
             AI+ +L +    Y  L  +K+     PPE  GG P++GHLF F  +     L + L+ +A
Sbjct  13    AIAALLTLAFIFYFFLSTKKSSKPPLPPEIAGGWPVIGHLFYFDNDGDDRPLARKLSDLA  72

Query  1869  DKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-  1693
             DK GPVF  R+GLPR+LV+SS +AVKD ++ ND   A RP    G YLGYNNA L     
Sbjct  73    DKYGPVFTFRLGLPRVLVISSSDAVKDCYSKNDAVFANRPACLYGEYLGYNNAMLFLANY  132

Query  1692  GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEV-DMEEWIGY  1516
             G +WR +RK+V+ E+LS T+LEK K I + ++  ++K L+  +    E  V ++ +W+  
Sbjct  133   GPYWRNIRKLVIQEVLSNTRLEKLKQIKLCKIRNNIKNLHSRIQNTEEKSVVNLTDWLEE  192

Query  1515  VNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLD  1336
             +N  ++ +++A K Y    E G D +     ++AF+  + L+ EF   DAFP  +F W+D
Sbjct  193   LNFGLIVQMIAGKNY----ESGGDGE-MERFKEAFRKFLVLSMEFVLWDAFPIPLFKWID  247

Query  1335  MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP------AGEDPDFFDIMMKVVDQEFIA  1174
              +G ++ MKK     D++ Q W+DEHV+  +         G + DF D+M+  +  E + 
Sbjct  248   FQGHVKLMKKTFKDIDSIFQRWLDEHVKTRETSLMEVNGGGNERDFIDVMLSKMSNEHLH  307

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
              + Y+RDT+IKAT  +++ DAA+T   ++ W M +L+N++ V+K+ QEEID K+G++RW+
Sbjct  308   -EGYSRDTVIKATVFSLVLDAADTVSLHINWGMTLLINNQHVLKKAQEEIDMKIGKDRWI  366

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             DD+D  +LVYLQA++KE +RLYP  PL  P E+ +DC V+GYHIPKGT+LY N+ KL RD
Sbjct  367   DDNDIKDLVYLQAIIKEVLRLYPPGPLLVPHENTEDCVVSGYHIPKGTRLYTNVMKLQRD  426

Query  813   PKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
              KIW  P++F P+RF T  + D   + + +I FG GRRSCP   YAL++ +  +  L+QG
Sbjct  427   LKIWSNPDQFNPDRFFTTDI-DFRGQDYEFIPFGSGRRSCPGMTYALQVEYLTIGHLIQG  485

Query  633   FDFATPSGMPVDMSEGPGVTMPKA  562
             FD+ TPS  P+DM EGPG+TM K 
Sbjct  486   FDYKTPSDEPLDMKEGPGMTMRKV  509



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   424 bits (1090),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 213/487 (44%), Positives = 310/487 (64%), Gaps = 13/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK G  F IR+G  R  VVSS E VK+ FT N 
Sbjct  35    GAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECFTINA  94

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWR++RK+  +ELLS  +LE  KH+  SE++
Sbjct  95    KALASRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRASEVD  154

Query  1593  LSVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + +++LY S   N    V V++++W+  + LN++ +++A KRY +     +D+ +A   +
Sbjct  155   IGIRELYNSWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRY-FGSAAASDDGEARRCQ  213

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F  +DA PF    WLD++G  RAMK  +   DA+L+GW+DEH +R   
Sbjct  214   KAINQFFRLIGIFVVSDALPF--LGWLDLQGHERAMKNTAKELDAILEGWLDEHRQRRVS  271

Query  1248  -GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
              G    GE  DF D+M+ + ++  ++   Y  +T IK+T +A++   ++TT   + W ++
Sbjct  272   AGIKDEGEQ-DFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAGTLTWAIS  330

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN++ ++K+ QEE+D  VG+ER V+DSD  NLVYLQA++KE +RLYP  PL  PRE++
Sbjct  331   LLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLGPREAM  390

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
             +DC+VAGYH+P GT+L VN+WK+ RDP++W  P  F PERFLT     D   +QF  I F
Sbjct  391   EDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQFELIPF  450

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP  ++AL++ H  LARLL  F+ ATP   PVD++E  G+T+PKA P++ +LTP
Sbjct  451   GSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPLEVILTP  510

Query  534   RLPAASY  514
             RLP   Y
Sbjct  511   RLPPKLY  517



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   425 bits (1092),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 311/487 (64%), Gaps = 16/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +  L + L  +ADK GPVF IR+G+ R LV+SS E+VK+ F TND+
Sbjct  65    GAWPLIGHLRILNSQIPLFRTLGDLADKHGPVFSIRLGMRRTLVISSWESVKECFKTNDR  124

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
                 RP++ A  Y+GY++A   F   G +W ++RK+   ELLS ++LE  KH+ +SE+  
Sbjct  125   KFLNRPSVAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNSRLELLKHVRVSEIET  184

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
              +K+L+ + + N  V +DM +W   +  N+M +++A KRY      G   +D+    +  
Sbjct  185   CIKELHTTCS-NGSVLLDMSQWFSCIVANVMFRLIAGKRYC-----GGTGKDSGACGRLI  238

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQG-WIDEHVRRGD--L  1240
             K+   L+G   ++D  PF    W+D +G +++MK+V+   D V+ G W+ EH++R +  L
Sbjct  239   KEFFYLSGVLVTSDLIPFT--EWMDFQGHLKSMKRVAKELDDVVSGQWLVEHLQRREEGL  296

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQN---YTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                E+ DF D+M++ +D   I  +    Y R+TI+KATA+ +L    +TT   + W +++
Sbjct  297   VRKEEKDFMDVMLESLDSLAIGEEPIFVYKRETIVKATALNLLLAGIDTTSITLTWALSL  356

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLNH +V+KR Q+EID  VG  RWV++SD  NLVYLQA+VKE +RLYP  PL  PRES++
Sbjct  357   LLNHTEVLKRAQKEIDIHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLE  416

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFG  712
             DC V GY +P+GTQL VN WKLHRD +IW  P +F PERFLT     D   +QF ++ FG
Sbjct  417   DCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFG  476

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  + +L+M H  L+RLLQGF+F+TP    VDMSEG G+TMPKA P++ +LTPR
Sbjct  477   SGRRSCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTMPKATPLEVVLTPR  536

Query  531   LPAASYN  511
             L    Y 
Sbjct  537   LENEIYQ  543



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   424 bits (1091),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 222/497 (45%), Positives = 311/497 (63%), Gaps = 21/497 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL   + ET L + LA MADK GP+F I +G+    V+SS EAV++ FTT+DK
Sbjct  41    GAWPIIGHLHLLRGETPLARTLAAMADKQGPMFRIWLGVHPTTVISSREAVRECFTTHDK  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP   AGV+LGY +    F   G  WR++RK+ ++ELL T +L+  KH+  SE++ 
Sbjct  101   ELASRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITMLELLCTRRLDNLKHVQESEIDS  160

Query  1590  SVKQLYGSVTKNREVE-------VDMEEWIGYVNLNIMSKIMAKKRY----NYSVEHGAD  1444
              VK L      N +         V + E +  + LNIM++++A KRY    + S     D
Sbjct  161   FVKDLRTLCMTNTDDAQNGSSKGVVISELLELLTLNIMTRMLASKRYFGQLSASTGSSTD  220

Query  1443  NQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWID  1264
               +A  LR+  KD M L G    +D  PF    W D  G ++ MK+V+   D ++  W++
Sbjct  221   YDEASHLRELIKDFMYLFGLPVVSDFLPFP--EWTDCTGTVKTMKRVARELDEIVGKWVE  278

Query  1263  EH-VRRGDLPAGE----DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETT  1099
             EH ++R D   GE      DF D+M+ ++ ++  A   +  + +IKAT +  +   ++TT
Sbjct  279   EHKLKRCD-HRGEAIDVREDFIDVMLSMIGEDSFAKFGHPPERLIKATVVNNIVAGSDTT  337

Query  1098  VSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVV  919
                + W++++LLNHK ++KR QEE+D  VG+++W+ DSD +NL YLQA+VKE +RLYP  
Sbjct  338   YLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWIQDSDIENLPYLQAIVKETLRLYPTA  397

Query  918   PLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGL  742
             PL  P E+  DC V+GY IPKGT++ VN+WKLHRDP++W  PEKF PERFLT  S  D L
Sbjct  398   PLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRDPQVWSNPEKFLPERFLTNHSGMDAL  457

Query  741   ARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKA  562
              + F +I FG GRRSCP +  AL++ H  LARLLQGFD ATPS  PVDM+EG GVT+PKA
Sbjct  458   GQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQGFDLATPSNKPVDMTEGLGVTLPKA  517

Query  561   KPVKALLTPRLPAASYN  511
              P++ +LTPRLP   Y 
Sbjct  518   SPLRVILTPRLPPTLYE  534



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   423 bits (1087),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 219/532 (41%), Positives = 334/532 (63%), Gaps = 23/532 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppep-----PGGLPILGHLFQFKKET  1900
             MD    ++A+S VL ++  L+ +LR+ +   +K           G LP++GHL     + 
Sbjct  1     MDFSFHLLAVSTVLALV--LWYTLRRVRESRRKTEKGLQPPEPSGALPLIGHLHLLGAQK  58

Query  1899  HLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGY  1720
              L + LA MADK GP+F IR+G    +VVS+LEA+K+ FTT+D+ L+ RP    G +L Y
Sbjct  59    TLARTLAAMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEHLSY  118

Query  1719  NNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE--  1549
             N AA  F  +G FWR++RK+V ++LLS+ +L+  +H+ +SE+N  +  LY     N++  
Sbjct  119   NYAAFGFNNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLLSKSNKQGS  178

Query  1548  VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSAD  1369
              ++D+ E    + +N++++++A KRY  S E   +++   +  +  K+ M ++G F  +D
Sbjct  179   TKIDISECFERMTINMITRMIAGKRYFSSTEAEKEDEGKRI-GKLMKEFMYISGVFVPSD  237

Query  1368  AFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAG----EDPDFFDI  1207
               PF    W++   G ++ MK++S   D++++ WI EH ++R +        ED DF D+
Sbjct  238   VIPF--LGWMNNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMEDDDFIDV  295

Query  1206  MMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEE  1027
             M+ ++D        Y+R+TIIKATAM ++   A+TT   + WI++ LLN++  ++  QEE
Sbjct  296   MLSLLDDSMFG---YSRETIIKATAMTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEE  352

Query  1026  IDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQ  847
             +D KVGRERW +DSD  NLVY+QA++KE +RLYP  PL  P E+ +D  VAGYHIPKGT+
Sbjct  353   LDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATKDFCVAGYHIPKGTR  412

Query  846   LYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALK  670
             L+ N+WKLHRDP +W  P+++ PERFLT+    D L   F  I FG GRRSCP   +AL+
Sbjct  413   LFANLWKLHRDPNLWSNPDEYMPERFLTDHANVDVLGHHFELIPFGSGRRSCPGITFALQ  472

Query  669   MAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             + H   ARLLQGFD  TP+G  VDM+EG  +T+PKA P++  +TPRL    Y
Sbjct  473   VLHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKATPLEIQITPRLSPELY  524



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   422 bits (1084),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 212/494 (43%), Positives = 314/494 (64%), Gaps = 24/494 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LPILGHL     E  L + LA +ADK GP+F I +G+ R + VSS EA+K+ FT NDK
Sbjct  45    GALPILGHLHLLGAEKTLARTLALLADKYGPIFTIWLGVHRTVEVSSHEAIKECFTANDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP    G YL YN AA  F + G +WR +RK+VV++LLS+ +L+  KH+ +SE+N 
Sbjct  105   VLASRPKSSHGKYLSYNYAAFGFASYGPYWRDMRKLVVIQLLSSHRLKSLKHVQVSEVNT  164

Query  1590  SVKQLYG-SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
              +K LY  S+ +    ++ + E+  ++ LN++++++A KRY     +G ++++ + + + 
Sbjct  165   LIKDLYLLSLNQPSSNKIVISEFFEHLTLNMITRMIAGKRYCNC--NGGNDEEGIRIGKL  222

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG----  1246
              K+ M ++G F  +D  PF    W++  G ++AMK++S   D++LQ WIDEH  +G    
Sbjct  223   MKEFMYVSGVFVPSDVIPF--LWWMNFLGPVKAMKRLSKELDSLLQTWIDEHKLKGINKR  280

Query  1245  --------DLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSN  1090
                     D    E+ DF D+M+ +++  F     ++RD IIK T M ++   A+TT   
Sbjct  281   RDGGGGGGDFKNIEE-DFIDVMLSILEDNFFG---HSRDDIIKGTVMTLIIAGADTTSIT  336

Query  1089  MVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLG  910
             + WI++ LLN++  ++  Q+E+D KVG+ER V DSD +NLVYLQAVVKE +RLYP  PL 
Sbjct  337   LTWILSNLLNNRHALELAQQELDLKVGKERCVQDSDIENLVYLQAVVKETLRLYPPGPLA  396

Query  909   FPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT--ESVPDGLAR  736
              P E+I DC ++GY+IPKGT++  N+WKLHRDP IW  P+KF PERFL   ++  D   +
Sbjct  397   VPHEAINDCYISGYYIPKGTRVLANLWKLHRDPNIWSNPDKFLPERFLANRDNNVDFSGQ  456

Query  735   QFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKP  556
              F ++ FG GRRSCP   +A++  H  LARLLQ F   T    PVDM+EG G+T+PKA P
Sbjct  457   NFEYLPFGSGRRSCPGLNFAIQAIHLTLARLLQAFSLTTLFNQPVDMTEGLGITLPKATP  516

Query  555   VKALLTPRLPAASY  514
             ++  +TPRL +  Y
Sbjct  517   LEIQITPRLSSELY  530



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   421 bits (1082),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 213/489 (44%), Positives = 304/489 (62%), Gaps = 13/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK G  F IR+G  R  VVSS E  K+ FT ND
Sbjct  31    GAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAKECFTFND  90

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +LE  KH+  SE++
Sbjct  91    KALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKHVRTSELD  150

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
               +K+L     +N   R V V++  W+  + LN++ +++A KRY  +     D  +A   
Sbjct  151   TGIKELQNLWVQNGSSRPVVVELNRWLEELTLNVVVRMVAGKRYFGASAKCDDGDEARRC  210

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++A      L G F  +DA PF    WLD++G  +AMKK +   DA+L GW+DEH +R  
Sbjct  211   QKAIGQFFHLIGIFVVSDALPF--LWWLDLQGHEKAMKKTAKDLDAILGGWLDEHRQRRV  268

Query  1242  LPAGE-----DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
             L   +     D DF D+M+ + ++  ++   ++ DT IK+T +A++   ++TT   + W 
Sbjct  269   LSHEKGKTEADEDFIDVMLSLQEEGQLSNFQHSSDTSIKSTCLAIILGGSDTTAGTLTWA  328

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLN+  VMK+ QEE++ +VG ER VD+SD  NLVYLQA++KE +RLYP  PL  PRE
Sbjct  329   ISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLRLYPAGPLLGPRE  388

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWI  721
             +++DC VAGYH+P GT+L VN+WK+ RDP +W  P  F+PERFLT     D   +QF  +
Sbjct  389   ALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERFLTSHGHVDVRGQQFELM  448

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP  ++A+++ H  LARLL  F+F TP G  +DM+E PG+T+PKA P++ LL
Sbjct  449   PFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGLTIPKATPLEVLL  508

Query  540   TPRLPAASY  514
             TPRLP   Y
Sbjct  509   TPRLPGNLY  517



>emb|CAN66023.1| hypothetical protein VITISV_042713 [Vitis vinifera]
Length=491

 Score =   420 bits (1079),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 313/491 (64%), Gaps = 15/491 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVL--IILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV  1891
             MD   ++VAISG+L  ++L  ++  +        +  PEP G  P LGHL   + +T + 
Sbjct  1     MDTPSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIF  60

Query  1890  KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNA  1711
             + L  MADK GPVF+IR+G+ R LVVSS EAVK+ FTTNDK  A RP+  AG  LGYN A
Sbjct  61    RTLGAMADKHGPVFMIRLGVQRALVVSSREAVKECFTTNDKVFASRPSXSAGKJLGYNXA  120

Query  1710  ALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE----V  1546
                F   GA WR++RK+ ++E+LS  +L+  KH+ ISE++LS+K LY S+ K  +    V
Sbjct  121   GFXFAPYGALWREMRKLSMMEILSARRLDAJKHVQISELDLSIKDLY-SLGKGSDWVHPV  179

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             +V M EW  +++ NI  K++  KRY  +  HG +     +     ++ ++L G F  +DA
Sbjct  180   KVVMSEWFQHLSFNIXLKMIXGKRYFNTSGHGIEEARRAI--ATIQEFLSLXGAFVLSDA  237

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
              P     W+D++G + +MK+V+   D+++ GW++EH  R +    +  DF D+M+ V++ 
Sbjct  238   IPG--VEWMDLQGYLGSMKRVAKEXDSLVGGWVEEHEXRLNSEGNKXQDFIDVMLSVLED  295

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               + G  ++R+T+IKAT M ++    ET  +   W+++ LLN K  +KR QEE+D KVGR
Sbjct  296   TSMFG--HSRETVIKATIMILIVGGTETVATTSTWLLSALLNXKHALKRAQEELDLKVGR  353

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              RWV++SD  NL+YLQAV+KE +RLY   PL  P E+++DC VAGYHIPKGT+L+VN WK
Sbjct  354   GRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWK  413

Query  825   LHRDPKIWPEPEKFKPERFLTESV-PDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP +W +PE F+PERFLT     D L + F  I FG GRRSCP    ALK+   ++ 
Sbjct  414   LHRDPSVWSDPEDFQPERFLTSHADXDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIG  473

Query  648   RLLQGFDFATP  616
             RLLQGFD +TP
Sbjct  474   RLLQGFDLSTP  484



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   421 bits (1081),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 212/485 (44%), Positives = 301/485 (62%), Gaps = 9/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MAD  GP F IR+G  R  VV+S +  KD FT ND
Sbjct  46    GAWPIIGHLHLLGGGDQLLYRTLGAMADNYGPAFNIRLGSRRAFVVNSWDVAKDCFTAND  105

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +LE  KH+ ISE++
Sbjct  106   KALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRISEID  165

Query  1593  LSVKQLYGSVTKN-REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
               ++ LY  V      V V++  W+  + LN++ +++A KRY +      +  +A   ++
Sbjct  166   TGIQDLYDRVQNGAHPVVVELSRWLDELTLNMVVRMVAGKRY-FGALAECNGDEAQRCQK  224

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-GDL  1240
             A  +   L G F  +DA PF    WLD+ G  RAMK+ +   DA+L GW++EH RR    
Sbjct  225   AICEFFHLIGIFVVSDALPF--LWWLDLHGHERAMKRTAKELDAILGGWLEEHRRRRASK  282

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              A  D DF D+M+ + +   ++   Y  D  IK+T +A++   ++TT   + W +++LLN
Sbjct  283   MADSDQDFIDVMLSLQEGGELSNFQYDADISIKSTCLALILGGSDTTAGTLTWAISLLLN  342

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +   +K+ Q+E+D +VG  R VDDSD  NLVYLQA++KE +RLYP  PL  PRE+++DC 
Sbjct  343   NSHALKKAQQELDIEVGTNRLVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCT  402

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             V+GYH+P GT+L VN+WK+ RDP +W  PE F+PERFLT     D   +QF  I FG GR
Sbjct  403   VSGYHVPAGTRLVVNVWKIQRDPTVWSNPEAFEPERFLTTHAHVDVRGQQFELIPFGSGR  462

Query  702   RSCPASAYALKMAHFILARLLQGFDFATP-SGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RSCP +++AL++ H  LARLLQ F+F+ P  G PVDM+E PG+T+PKA P++ LL+PRLP
Sbjct  463   RSCPGASFALQVLHLTLARLLQAFEFSNPLDGRPVDMTENPGLTIPKAHPLEVLLSPRLP  522

Query  525   AASYN  511
                Y 
Sbjct  523   RELYG  527



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   422 bits (1085),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 208/481 (43%), Positives = 313/481 (65%), Gaps = 12/481 (2%)
 Frame = -2

Query  1932  LGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGR  1753
             LG L  +     L + LA MADK GPVF IR+G+ R L+VS+ EAVK+ FTTNDK LA R
Sbjct  114   LGLLILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAVKECFTTNDKILANR  173

Query  1752  PNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQL  1576
             P   AG YL Y++A   F   G +WR++RK+ V+ELLS  +L    H+ +SE++  +K L
Sbjct  174   PRSNAGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLTHVRVSEVDAFIKNL  233

Query  1575  YGSVTKNREV---EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKD  1405
                  K+ +    ++ + + +  +NLN+M + +A  RY +S   G ++++A    +  K+
Sbjct  234   CFFCKKSEQSPNQKISISQRLEVLNLNMMLRTIAGTRY-FSDADGENDKEAQRAMKLIKE  292

Query  1404  VMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAG  1231
                L G  + ++  PF    W+D  G  +++MK++S   D++++ W+DEH +RR  + A 
Sbjct  293   FSYLLGVTALSEVVPF--LKWIDFWGHQVKSMKRISKEMDSLIESWVDEHKLRRFKIGAK  350

Query  1230  EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKD  1051
              + DF D+++  ++ + + G  +TR+TIIKAT   ++   +++T   + WI++ L+N+++
Sbjct  351   NNQDFIDVLLSAIEDDSMFG--HTRETIIKATVTVLISAGSDSTSRTLTWILSNLMNNRN  408

Query  1050  VMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAG  871
              MKR QEE+D K+GR+RWV+D D + LVYLQA++KE  RLYP  PL  P ++++ C ++G
Sbjct  409   AMKRAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLYPAAPLSVPHQAMEYCRISG  468

Query  870   YHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTE-SVPDGLARQFGWITFGFGRRSC  694
             YHIPKGT+L+VN+WKL RDP+IW  PE+F+PERFLT     D L + F  I FG GRRSC
Sbjct  469   YHIPKGTRLFVNVWKLQRDPRIWSNPEEFEPERFLTSYQNVDILGQHFELIPFGSGRRSC  528

Query  693   PASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             P  ++AL++    +ARLLQGFD ATP   PVDM+E PG TM KA P++ +LTPRLP   Y
Sbjct  529   PGMSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTMSKATPLQLVLTPRLPDHLY  588

Query  513   N  511
              
Sbjct  589   Q  589



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   419 bits (1076),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 209/483 (43%), Positives = 308/483 (64%), Gaps = 10/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL + + +    K LA +ADK GP++ +R+G  RI+VVSS E VKD  TTND+
Sbjct  35    GAWPVIGHLPRLRGQDPACKTLAAIADKYGPIYSLRLGSHRIVVVSSWETVKDCLTTNDR  94

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA R NI AG ++GYNNAA A +  G +WR VRK+V ++LLS  +LE  KH+ + E++ 
Sbjct  95    ILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVRVLEVDA  154

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K L+ S  +  E   +V M +    +  NI  + +  KRY  S+ +  +N +    ++
Sbjct  155   FIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVGKRYCSSL-YDKENSEPWRYKK  213

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
             A +  + L+G F  +DA P+    W+D +G I AMK+ +   DAV+  W++EH+++    
Sbjct  214   AIEKALYLSGIFVMSDAIPW--LEWIDFQGHISAMKRTAKELDAVIGSWLEEHLKKEI--  269

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
              GE  DF D+++  +         Y+RD +IKAT + +    A +T   + W +++LLNH
Sbjct  270   QGES-DFMDVIISNLADGAAEMSGYSRDVVIKATTLILTLTGAGSTAVTLTWALSLLLNH  328

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
               V+K  QEE+D +VGRE+WV++SD  NL+YLQA+VKE +RLYP  PL   RE+++DC +
Sbjct  329   PSVLKAAQEELDKQVGREKWVEESDIQNLMYLQAIVKETLRLYPPGPLTGIREAMEDCHI  388

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRR  700
              GY++PKGT+L VNIWKLHRDP++W  P+ F+PERFLT     D   + F +I F  GRR
Sbjct  389   CGYYVPKGTRLVVNIWKLHRDPRVWKNPDDFQPERFLTTHADLDFRGQDFEFIPFSSGRR  448

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             SCPA    + + H  LARLLQGFD  T +G+PVDM+EGPG+ +PK  P++A++ PRL   
Sbjct  449   SCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVIKPRLGLP  508

Query  519   SYN  511
              YN
Sbjct  509   LYN  511



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   419 bits (1076),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 213/518 (41%), Positives = 324/518 (63%), Gaps = 19/518 (4%)
 Frame = -2

Query  2040  AISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMADKI  1861
              +S +L I+  LY   R+   K  + PP+P G  PI+GHL     E ++   LA +ADK 
Sbjct  11    TLSALLFIIVLLYNLWRRYPRKGAQSPPQPSGAWPIIGHLHLLDPELNIAHTLAELADKY  70

Query  1860  GPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTTGAFW  1681
             GPVF +  G  R +VVSS EAV + FT NDK+ A RP   AG +L Y++A+  F+ G +W
Sbjct  71    GPVFTLWFGAQRAVVVSSREAVFECFTRNDKSFANRPITSAGEHLVYDHASFGFSNGPYW  130

Query  1680  RKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY-GSVTKNR-----EVEVDMEEWIG  1519
             R++RK+V  E+LS  +LE  +++ ++E+  S+ +LY  + TK R       +V M  W+ 
Sbjct  131   REMRKLVSSEVLSARRLEAMRNLRVTEIATSIGELYLETTTKTRGQQPLPSKVVMSSWVE  190

Query  1518  YVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWL  1339
              + LNI+ K +A KRY      G    +    R+  ++   L+GEF  +D  P     W+
Sbjct  191   KMTLNIIVKTIAGKRY------GKGAAEVESFRKLIREFTVLSGEFVPSDVIPIPFLRWI  244

Query  1338  DMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG--EDPDFFDIMMKVVDQEFIAGQN  1165
             D +G I++MK+VS   D +++ W++EH++R     G  E+ DF D M+  +D +F     
Sbjct  245   DPKGHIKSMKRVSKELDVIIEKWVEEHMKRRGKGEGCTEEQDFIDAMLSTIDDKFA----  300

Query  1164  YTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDS  985
               + TIIKAT + ++    +TT  ++ W++++L+N+K  M   ++EID KVG +RWV +S
Sbjct  301   IPKLTIIKATVLNVILGGFDTTSVHLTWVLSLLVNNKHAMNLARQEIDDKVGNQRWVQES  360

Query  984   DTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKI  805
             D +NL YLQA++KE +RLYP +PL  P ++++DC ++ Y IPKGT L+VNIWKLH D + 
Sbjct  361   DINNLPYLQAIIKESLRLYPPLPLSIPHQAVEDCHLSNYLIPKGTLLFVNIWKLHHDARF  420

Query  804   WPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFD  628
             WPEP +F PERFLT  +  D + +Q+ +I FG GRRSCP + +A+++    +ARL+QGFD
Sbjct  421   WPEPNRFMPERFLTGHTQVDVMGQQYEYIPFGTGRRSCPGTTFAMQVTSLTVARLIQGFD  480

Query  627   FATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             FAT     VDM+EG G+TMP+  P++ L+TPRLP+  Y
Sbjct  481   FATEGNEAVDMAEGIGITMPRKNPLEVLVTPRLPSQLY  518



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   419 bits (1076),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 313/488 (64%), Gaps = 17/488 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP++GHL     +  L + LA +ADK GP+F IR+G    +VVS+LEA+K+ FTT+D+
Sbjct  47    GALPLIGHLHLLGAQKTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDR  106

Query  1767  ALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              L+ RP    G YL YN AA  FT +G FWR++RK+V ++LLS+ +L+  +H+ +SE+N 
Sbjct  107   ILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNT  166

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +  LY     N++   ++ + E    + +N++++++A KRY  S E  A+ ++   + +
Sbjct  167   LINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRYFSSTE--AEKEEGKRIGK  224

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGD  1243
               K+ M ++G F  +D  PF    W++   G ++ MK++S   D++++ WI EH ++R +
Sbjct  225   LMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLE  282

Query  1242  LPAG----EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
                     +D DF D+M+ ++D        Y+R+TIIKATAM ++   A+TT   + WI+
Sbjct  283   STENTNKMDDDDFIDVMLSLLDDSM---SGYSRETIIKATAMTLIIAGADTTSITLTWIL  339

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             + LLN++  ++  QEE+D KVGRERW +DSD  NLVY+QA++KE +RLYP  PL  P E+
Sbjct  340   SNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEA  399

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
              +D  VAGYH+PKGT+L+ N+WKLHRDP +W  P+++ PERFL +    D L   F  I 
Sbjct  400   TEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIP  459

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP   +AL++ H   ARLLQGFD  TP G  VDM+EG  +T+PKA P++  +T
Sbjct  460   FGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHIT  519

Query  537   PRLPAASY  514
             PRL    Y
Sbjct  520   PRLSPELY  527



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   418 bits (1074),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 212/487 (44%), Positives = 310/487 (64%), Gaps = 15/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L ++ADK GP F IR+G  R LVV+S E  K+ FT ND
Sbjct  43    GSWPIIGHLHLLGGADKLLHRTLGSLADKYGPAFNIRIGSHRALVVASKELAKECFTIND  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K LA R    A  ++ Y++A   F    + WR++RK+V++ELLS  +LE  KH+  SE++
Sbjct  103   KTLASRSTTAATKHMCYDHAVFGFAPYSSHWREMRKIVMLELLSNRRLEMVKHVQASEVD  162

Query  1593  LSVKQLYGSVTKNR--EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             L +++LY    +NR   V V+++++   + L+++ +++A KRY  S    +D+ +A   +
Sbjct  163   LGIRKLYNLWAQNRCLPVIVELKQFFEDLTLDVIVRVVAGKRYTGS----SDDDEARQYQ  218

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F  +DA PF    WLD+EG  +AMKK +   DAVL GW+DEH RR   
Sbjct  219   KAISQFFHLMGIFVVSDALPF--LRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHRRRRVS  276

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G++ +  D DF D+M+ + ++  ++G  Y  DT IK+T +A++  A++TT + +VW +++
Sbjct  277   GEVKSEGDQDFIDVMLSLEEKGHLSGFQYDADTSIKSTCLALIAGASDTTTTTLVWAISL  336

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K  +EE++  +G ER VD+SD  NLVYLQAV+KE +RLYPV PL  PRE ++
Sbjct  337   LLNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQAVIKETLRLYPVAPL-IPREFVE  395

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC V GYH+P GT+L VN+WK+ RDP +W +   F+PERFLT     D     F  + FG
Sbjct  396   DCRVGGYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPERFLTSHADIDVRGHHFELLPFG  455

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP +++AL   H  LAR L  FD ATP   PVDM+E  G T+PKA P++ LL+PR
Sbjct  456   SGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTERSGTTLPKATPLEVLLSPR  515

Query  531   LPAASYN  511
             LPA  Y+
Sbjct  516   LPAKLYS  522



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   418 bits (1075),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 208/486 (43%), Positives = 304/486 (63%), Gaps = 11/486 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PILGHL        L+ + L  MAD+ GP F IR+G     VVSS E  K+ FT ND
Sbjct  43    GAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWELAKECFTIND  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +LE  KH+ ISE++
Sbjct  103   KALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRISEVD  162

Query  1593  LSVKQLYGSVTKNREVEV--DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + +++LY     N  + V  ++++W+  + LN++ +++A KRY +       + +A   +
Sbjct  163   MGIRELYSLRHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRY-FGASAVCVDGEARRCQ  221

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A K+   L G F  +DA P  +  WLD+ G  +AMK  +   D +L+ W+ EH +R   
Sbjct  222   KAIKEFFRLIGMFVVSDALP--LLWWLDVHGHEKAMKMTAKELDDLLEAWLKEHRQRRIS  279

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G + A  + DF D+M+ + ++  +A   Y  D  IK+T +A++    +TT   + W +++
Sbjct  280   GGIKAEGEQDFIDVMLSLQEEGHLANFQYDADISIKSTCLALILGGTDTTAGTLTWAISL  339

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+ +++K+ QEE+D +VGRER VD+SD  NLVYLQA++KE +RLYP  PL  PRE++ 
Sbjct  340   LLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLYPAGPLLGPREAMN  399

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGYH+P GT+L VN+WK+ RDP++W  P  F PERFLT     D   +QF  I FG
Sbjct  400   DCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHANVDVRGQQFELIPFG  459

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP +++AL++ H  LAR L  F+ +TP   PVDM+E PG+T+PKA P++ LL PR
Sbjct  460   SGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKATPLEVLLKPR  519

Query  531   LPAASY  514
             +PA  Y
Sbjct  520   VPANVY  525



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   417 bits (1071),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/486 (44%), Positives = 310/486 (64%), Gaps = 14/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LPILGHL Q      L + LA MADK GP+F I +G  R LV+S+ EA K+ FTTND+
Sbjct  11    GALPILGHLHQLGGRNPLFQTLANMADKYGPIFTIWLGKNRALVISNYEAAKECFTTNDR  70

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP+   G YLGYN AA   +  G +WR  RK+VV+ELLS+ +LE  KH+ ISE++ 
Sbjct  71    VFATRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETLKHVQISEVDA  130

Query  1590  SVKQLYGSVTKNR----EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              V  LY SV KN+      +V +   I ++  N+M+KI+A KRY + V+    + +   +
Sbjct  131   FVIGLY-SVWKNKGHDGPSKVVISTGIEHLTCNVMTKIIAGKRY-FGVKSDEFDGEVKKI  188

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH--VRR  1249
             R+  K+ M      +   ++   I  W+D +G +R MK V    D+++  W++EH   +R
Sbjct  189   RKLMKEFMY--AAVNRVVSYVVGIPEWIDFKGHLRTMKNVGGQLDSLMTSWVEEHNTKKR  246

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              +  + E+ DF D+++  ++   + G  +TRDTIIK+TA+ ++   +ETT  ++ W++++
Sbjct  247   KNDSSNEEQDFIDVLLSEIEDGSMLG--HTRDTIIKSTALILVLAGSETTSVSLTWMLSL  304

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K  QEE+D  VGR RWV+D+D  NLVYLQA+ KE +RLYP  PL  P E+++
Sbjct  305   LLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPGPLSVPHEAME  364

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFG  712
             DC+V G+H+PKGT LYVN+WKLHRDP +WP+PE F PERFL T++  D   + F +I FG
Sbjct  365   DCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPERFLTTQASVDAFGQHFEFIPFG  424

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP    A ++ H  +ARL+QGF+ ATP    VDM+EG G++M +A  ++ +LT R
Sbjct  425   AGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARATALEVVLTAR  484

Query  531   LPAASY  514
             L    Y
Sbjct  485   LAYELY  490



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 296/489 (61%), Gaps = 15/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GHL     +  L + L +MADK GP+F +R+G    +VVSS E VKD FTTNDK
Sbjct  44    GALPFIGHLHHLGGQLPLARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCFTTNDK  103

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN+    Y+G NNA  +    G +WR VRKMV +ELL+  +LEK KH+  SE N 
Sbjct  104   TFASRPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRASEFNK  163

Query  1590  SVKQLYGSVTKNREVEVD------MEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAV  1429
              ++ LY   +KN   +VD      + EW   +  N++ +++  + ++ S + G DN +  
Sbjct  164   WIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQ-GNDNSEDR  222

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
              L++A K  + L+G F  +D  P+    WLD+ G I++MKK     D VL  W+ EH+++
Sbjct  223   RLKEAIKKALYLSGVFVFSDVIPW--IEWLDIGGHIKSMKKAGKELDEVLGQWLQEHIQK  280

Query  1248  GDLPAGEDP---DFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
                   E     DF D+M+  +  E      + RD IIK+T   ++   +E+T   ++W 
Sbjct  281   AKQSHPESEAVHDFMDVMLSTI-PEIGEISGHKRDAIIKSTTATLILTGSESTAETLIWA  339

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLNH +++K  Q E+D +VG++RW++++D  NL +LQA+VKE  RLYP  PL  PRE
Sbjct  340   LSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPLSGPRE  399

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWI  721
             + +DC +  + +PKG +L VN+WKLHRDP+IW +P +FKPERF+       L  Q F +I
Sbjct  400   ATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFMNSHENISLKGQSFEYI  459

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              F  GRR CPA  Y + +    LAR+LQ FD  TP GMPVDM EG GV +PK KP++ LL
Sbjct  460   PFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGLGVALPKLKPLEVLL  519

Query  540   TPRLPAASY  514
             TPRLP   Y
Sbjct  520   TPRLPVELY  528



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   416 bits (1069),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 216/491 (44%), Positives = 313/491 (64%), Gaps = 22/491 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GH+     ET L + LA MADK GP+F IR+G+    ++SS EAV++ FTT+DK
Sbjct  41    GAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSREAVRECFTTHDK  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP   AG++LGY  A   F   G FWR++RK+ ++ELLST +L+  KH+  SE++ 
Sbjct  101   DLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLDNLKHVQASEIDT  160

Query  1590  SVKQLYGSVTKNR-------EVEVDMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGA---  1447
              VK L+     N           V + + +  + LNI+ +++A KRY    S   G+   
Sbjct  161   FVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLSSASTGSSAD  220

Query  1446  DNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWI  1267
             D+++A  LR+  K+ M ++G  + +D  PF    W D  G ++ MK+V+   D ++  W+
Sbjct  221   DDEEASHLRRVIKEFMYISGFPAVSDLVPFT--GWTDCVGTVKTMKRVARELDEIVGKWV  278

Query  1266  DEHV------RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAE  1105
             +EH       +RG++      DF D+M+ V+ ++ +A   ++ +T+IKAT + ++   ++
Sbjct  279   EEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATIVNIIVAGSD  338

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
             +T  N+ W++++LLNHK V+KR QEEID KVG++RWV DSD +NL+YLQA+VKE +RLYP
Sbjct  339   STSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYP  398

Query  924   VVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPD  748
               PL  P E+  DC V GY IPKGT+++VN WKLHRDP++W EPEKF PERFLT  S  D
Sbjct  399   PGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHSGVD  458

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
                + F +I FG GRR CP +A+AL+  H  LARLLQGFD AT     VDM+EG GV +P
Sbjct  459   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLP  518

Query  567   KAKPVKALLTP  535
             KA P++ +L P
Sbjct  519   KATPLRVVLNP  529



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   416 bits (1068),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 331/533 (62%), Gaps = 20/533 (4%)
 Frame = -2

Query  2064  MDALIRV-VAISGVLIILPFLY----LSLRkqknktkkpppepPGGLPILGHLFQFKKET  1900
             MD+L++    I  +L +L F+Y    L  +  + K +K  PE  G  P++GHL       
Sbjct  1     MDSLLQSPTNIGALLAVLVFIYYLSSLISKNIEVKKRKMAPEAAGAWPVIGHLPLLGGPE  60

Query  1899  HLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGY  1720
                  L  MADK GP F IR+G+ R LVVS  E  K+ FT ND+ALA RP+  A  ++GY
Sbjct  61    LPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECFTINDRALATRPSGVAMKHMGY  120

Query  1719  NNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE--  1549
             N A  AF   G +WR+VRK+  +ELLS  +LE  KH+ +SE+N+SV++LYG   KN+   
Sbjct  121   NYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVRVSEVNMSVRELYGLWLKNKNAT  180

Query  1548  ----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEF  1381
                 V+V+M+ W G + LN + +++A KRY +       + +AV  +   +    L G+F
Sbjct  181   GADSVKVEMKRWFGDLTLNNVLRMVAGKRY-FGATAACGSAEAVRCQTVMRSFFRLVGQF  239

Query  1380  SSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH--VRRGDLPAGEDPDFFDI  1207
               ADA PF    WLDM+G  +AMK+ +   D++L+GW++EH  +R  +  A  + DF D+
Sbjct  240   VIADAIPF--LGWLDMQGHEKAMKRTAKELDSILEGWMEEHRKMRLSNDEANGEQDFMDV  297

Query  1206  MMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEE  1027
             M+ ++    ++G  Y  DTI KAT M ++    +T    + W +++L+N+++V+KR+Q+E
Sbjct  298   MLSILKDSKLSG--YDADTINKATCMNLILGGNDTIKVCLTWALSLLVNNQEVLKRVQDE  355

Query  1026  IDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQ  847
             +D  VG++R V++SD   L YLQAVVKE +RLYP  PL  P E++++C VAGYH+P GT+
Sbjct  356   LDRHVGKDRNVEESDMKKLEYLQAVVKEALRLYPPAPLSGPHEAMEECTVAGYHVPVGTR  415

Query  846   LYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALK  670
             + VN+ K+ RDP++W +P +F+PERFLT  V  D L + F  I FG GRR+CP ++  LK
Sbjct  416   ILVNLSKIQRDPRVWSDPLEFRPERFLTSHVGVDVLGQHFELIPFGSGRRACPGTSLGLK  475

Query  669   MAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
             + H  LARLL  F   TPSG PVDM+E  G+T  KA P++ LL PRLP+  Y 
Sbjct  476   VVHLALARLLHAFHLHTPSGAPVDMTESFGLTNLKATPLEVLLLPRLPSHLYQ  528



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   415 bits (1066),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 309/483 (64%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LPI+GHL    KE  L + L  +AD  GP+F I +G+ R +VVSS EA+K+ F++ND+
Sbjct  48    GALPIIGHLHLLGKENTLARTLGRLADNYGPIFTIWLGVHRTVVVSSYEAIKECFSSNDR  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP    G YL YN AA  F + G +W  +RK+V ++LLS+ +++  KH+ ISE+N 
Sbjct  108   ILASRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKLVAIQLLSSHRIKLLKHVQISEVNT  167

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
              +K+LY     N+++ +++ E   ++ LN++++++A KRY  S +  ++ Q+   + +  
Sbjct  168   LIKELYEKQGSNKKI-INISECFEHLTLNMITRMIAGKRYFSSADSDSE-QEGKRIGKIM  225

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRR--GDL  1240
             K+ M ++G F  +D  PF    W++  G ++ MK++S   D++ + WIDEH ++R   + 
Sbjct  226   KEFMYISGVFVPSDLIPF--LGWMNFAGPVKTMKRLSRELDSLTETWIDEHKLKRVKSEE  283

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
                 + DF D+M+ +++ +F     ++++ IIK T   ++   A+TT   + WI++ LLN
Sbjct  284   SKNMEEDFIDVMLSLLEDDFFG---HSKEDIIKGTVTNLIIAGADTTSITLTWILSNLLN  340

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             ++  ++  Q+E+D KVGR R V DSD DNLVYL A+VKE +RLYP  PL  P E+ +DC 
Sbjct  341   NRRTLELAQQELDLKVGRNRCVQDSDIDNLVYLNAIVKETLRLYPPGPLAVPHEASEDCS  400

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             +AGYHIPKGT+++ N+WKLHRDP +W  P +F PERFLT     D   + F +I FG GR
Sbjct  401   IAGYHIPKGTRVFANLWKLHRDPNVWSSPNEFVPERFLTSQANMDVSGQNFEYIPFGSGR  460

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP   +A++  H  LA+LLQ F F TP  +PVDM+EG G+T+PKA P++  + PRL  
Sbjct  461   RSCPGLNFAIQAIHLTLAKLLQAFSFTTPLNVPVDMTEGLGITLPKATPLEIHIIPRLSP  520

Query  522   ASY  514
               Y
Sbjct  521   ELY  523



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   415 bits (1067),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/488 (43%), Positives = 305/488 (63%), Gaps = 15/488 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GHL          +  + +A+K GP+FI+++G    LVV+S E  K+  TTNDK
Sbjct  56    GALPFIGHLHLLNARKPYFRTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDK  115

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   AG  LGYNNA   F+  G +WR++RKM ++E+LS+ KLEK KH+  +E   
Sbjct  116   VFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMAILEILSSYKLEKLKHVRDTETLS  175

Query  1590  SVKQLYGSVTKNREV-----EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
              VK LY S++  + V      V +   + +++ NI+ +++A KR+     +  DN+ A  
Sbjct  176   LVKDLYSSISCPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNE-AWR  234

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-R  1249
             LR A KD   L G F +ADA P     W+D +G +  MK+ +   D +L+ W++EH+R R
Sbjct  235   LRNAIKDATYLCGVFVAADAIPS--LSWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKR  292

Query  1248  GDLPAGE-DPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
             G+   G+ + DF D+M+    ++E I G  Y R+ +IKAT++ ++  A+ +T   + W +
Sbjct  293   GEEKDGKCESDFMDVMISAFQEEEEICG--YKREMVIKATSVLLILTASGSTAITLTWAL  350

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++LLNH  V+K  Q+E+DT +G+ERWV +SD +NL YLQA++KE +RLYP  PL   RE 
Sbjct  351   SLLLNHPKVLKAAQKELDTHLGKERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIREV  410

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
             ++DC VAGYH+PKGT+L +N+W L RDPK+WP P KF+PERFLT     + +++ F  I 
Sbjct  411   MEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIP  470

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             F  GRRSCP   + L++ H  LARLLQGFD  T  G  VDM+EG GV +PK   ++ +L 
Sbjct  471   FSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQ  530

Query  537   PRLPAASY  514
             PRLP   Y
Sbjct  531   PRLPLGLY  538



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   415 bits (1067),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/498 (43%), Positives = 313/498 (63%), Gaps = 22/498 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL     ET L + LA MADK GP+F IR+G+    ++SS EAV+  FTT+DK
Sbjct  41    GAWPIIGHLHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDK  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP    G++ GY  A   F   G  WR++RK+ ++ELLST +L+  KH+  SE++ 
Sbjct  101   DLASRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITMLELLSTRRLDNLKHVQASEIDT  160

Query  1590  SVKQLYGSVTKN-------REVEVDMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGA---  1447
              VK L+     N           V + + +  + LNI+ +++A KRY    S   G+   
Sbjct  161   FVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTD  220

Query  1446  DNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWI  1267
             D+++A  LR+  K+ M ++G  + ++  PF    W D  G ++ MK+V+   D ++  W+
Sbjct  221   DDEEASHLRKVIKEFMYISGFPTVSELVPFT--GWTDCVGTVKTMKRVAREMDEIVGKWV  278

Query  1266  DEHV------RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAE  1105
             +EH       +RG++      DF D+M+ V+ ++ +A   ++ +T+IKAT + ++   ++
Sbjct  279   EEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSD  338

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
             TT  N+ W++++LLNHK V+KR QEEID KVG+++WV DSD  +L YLQA+VKE +RLYP
Sbjct  339   TTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYP  398

Query  924   VVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPD  748
               PL  P E+  DC V GY IPKGT+++VN+WKLHRDP++W +PEKF PERFLT  S  D
Sbjct  399   PGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVD  458

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
                + F +I FG GRR CP +A+AL+  H  LARLLQGFD A  S   VDM+EG G+ +P
Sbjct  459   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLP  518

Query  567   KAKPVKALLTPRLPAASY  514
             KA P++ +L PRLP+  Y
Sbjct  519   KATPLRVVLNPRLPSMLY  536



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   412 bits (1060),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 207/483 (43%), Positives = 304/483 (63%), Gaps = 10/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL   + +    K LA + DK GP++ +R+G  RI+VVSS E VKD  TTND+
Sbjct  35    GAWPVIGHLPCLRGQDPACKTLAAIDDKYGPIYSLRLGSHRIVVVSSRETVKDCLTTNDR  94

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA R NI AG ++GYNNAA A +  G +WR VRK+V ++LLS  +LE  KH+   E++ 
Sbjct  95    ILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVRKLEVDA  154

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K L+ S  +  E   +V M +    +  NI  + +  KRY  ++ +  +N +    ++
Sbjct  155   FIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVGKRYCSTI-YDKENSEPWRYKK  213

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
             A +  + L+G F  +DA P+    W+D +G + AMK+ +   DAV+  W++EH+++    
Sbjct  214   AIEKALYLSGIFVMSDAIPW--LEWIDFQGHVSAMKRTAKELDAVIGSWLEEHLKKE--I  269

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
              GE  DF D+M+  +         Y+RD +IKAT + +    A +T   + W +++LLNH
Sbjct  270   QGES-DFMDVMISNLADGAAEMSGYSRDVVIKATTLILTLTGAGSTAVTLTWALSLLLNH  328

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
               V+K  QEE+D +VGRE+WV++SD  NLVYLQA+VKE +RLYP  PL   RE+++DC +
Sbjct  329   PSVLKAAQEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLYPPGPLTGIREAMEDCHI  388

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRR  700
              GY++PKGT+L VNIWKLHRDP++W  P  F+PERFLT     D   + F +I F  GRR
Sbjct  389   CGYYVPKGTRLVVNIWKLHRDPRVWKNPNDFQPERFLTTHADLDFRGQDFEFIPFSSGRR  448

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             SCPA    + + H  LARLLQGFD  T +G+PVDM+EGPG+ +PK  P++A++ PRL   
Sbjct  449   SCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVVKPRLGLR  508

Query  519   SYN  511
              Y+
Sbjct  509   LYD  511



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   415 bits (1066),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 207/490 (42%), Positives = 297/490 (61%), Gaps = 17/490 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GHL     +  L + L +MADK GP F +R+G    +VVSS E VK+ FT NDK
Sbjct  91    GALPFIGHLHHLGGQLPLARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECFTINDK  150

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN     Y+G NNA  A    G +WR VRKMV +ELL+  +LEK KH+  SE N 
Sbjct  151   TFASRPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRASEFNK  210

Query  1590  SVKQLYGSVTKNREVEVD------MEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAV  1429
              ++ LY   +KN   +VD      + EW   +  N++ +++  + ++ S + G DN +  
Sbjct  211   WIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQ-GNDNSEDR  269

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
              +++A K ++ L G F  +D  P+    WLD+ G I++MKK     D VL  W+ EH+++
Sbjct  270   RMKEAIKKMLYLGGVFVFSDVIPW--IEWLDIGGHIKSMKKAGKELDEVLGQWLQEHIQK  327

Query  1248  GDLPAGEDP---DFFDIMMKVVDQEF-IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
                   E     DF D+M+  + +   I+G  + RD IIK+T   ++   +E+T   ++W
Sbjct  328   AKQSHPESEAVHDFMDVMLSTIPETGEISG--HKRDAIIKSTTATLIMTGSESTAETLIW  385

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLNH +++K  Q E+D +VG++RW++++D  NL +LQA+VKE  RLYP  PL  PR
Sbjct  386   ALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPLSGPR  445

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGW  724
             E+ +DC +  + +PKG +L VN+WKLHRDP+IW +P +FKPERFL       L  Q F +
Sbjct  446   EATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFLNSHANISLKGQSFEY  505

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             I F  GRR CPA  Y + +    LAR+LQ FD ATP GMPVDM EG GV +PK KP++ L
Sbjct  506   IPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGLGVALPKLKPLEVL  565

Query  543   LTPRLPAASY  514
             LTPRLP   Y
Sbjct  566   LTPRLPVELY  575



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   411 bits (1057),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 226/539 (42%), Positives = 331/539 (61%), Gaps = 34/539 (6%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             M+ L   V I+ +L+   F+  +L K+    K+  PE  GG P++GHL    +   L K 
Sbjct  1     MEFLFTAVIITALLV---FVSRNLVKKAGNKKRGAPEAGGGWPVIGHLHLLGRPEPLHKV  57

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             L  +ADK GP+  I++G+ R LVVS+ E  K+  TT+DK  A RP   AG  L Y+++ L
Sbjct  58    LGKIADKYGPILTIKIGVHRTLVVSNWEIAKECLTTSDKVFATRPKTVAGHILCYDSSLL  117

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG---SVTKNREVEVD  1537
              F   G +WR++RK+  +ELLS+ +LE  K++  SE+   +K+LY    +      V VD
Sbjct  118   GFVPYGHYWRQIRKIATLELLSSYRLESLKYVRESEVRTCLKELYNLWDAGLDKAPVLVD  177

Query  1536  MEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMT----LTGEFSSAD  1369
             M++W  YV LN++ +++  KR N S+     + D     Q +KD ++      G+   +D
Sbjct  178   MKKWCEYVTLNVILRMVVGKRCNISISQKGTSSD-----QGWKDELSRFFEFMGKLVVSD  232

Query  1368  AFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP----AGEDPDFFDIMM  1201
             A PF    WLD+ G  R MKK +   D ++Q W+DEH R+GD       G + +F   M+
Sbjct  233   ALPF--LRWLDIGGDERLMKKTARELDLIMQRWLDEHRRKGDSGDYQIKGREENFMGAML  290

Query  1200  KVVD----QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQ  1033
              ++D    QEF  G++   DTI KAT +A++   ++TT   + W +++LLN++  +K+ Q
Sbjct  291   SILDDIGAQEF-PGRDA--DTINKATCLALILGGSDTTSGTLTWAISLLLNNRHALKKAQ  347

Query  1032  EEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKG  853
             EE+D +VG+ER VD+SDT+NLVYLQA++KE +RLYP  PL  PRE+++DC V+GYH+P G
Sbjct  348   EELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPAG  407

Query  852   TQLYVNIWKLHRDPKIWPEPEKFKPERFL----TESVPDGLARQFGWITFGFGRRSCPAS  685
             T+L +N WK+ RDP++W  P  F+PERFL      +  D   +QF  I FG GRRSCP +
Sbjct  408   TRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRRSCPGA  467

Query  684   AYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR-LPAASYN  511
             + AL++ H  LARLL  F+ ATP   PVDMSE PG+T+PKA P+K LL+PR LPA  Y 
Sbjct  468   SSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRLLPANPYG  526



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   410 bits (1055),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 217/511 (42%), Positives = 317/511 (62%), Gaps = 18/511 (4%)
 Frame = -2

Query  2022  IILPFLY----LSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMADKIGP  1855
             +IL FLY    +  R  ++K     PEP G  P+ GHL     +    K L  +ADK GP
Sbjct  6     LILVFLYCFWKILARNSESKKSTRAPEPSGAWPLFGHLPSLVGKDPACKTLGAIADKYGP  65

Query  1854  VFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWR  1678
             ++ ++ G+ R LVVSS E VKD   TND+ LA R  I AG ++ YNNAA A  T G +WR
Sbjct  66    IYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALATYGQYWR  125

Query  1677  KVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY----GSVTKNREVEVDMEEWIGYVN  1510
              VRK+  ++LLS  +LE  KH+ +SE++  +K L+    GSV  +   +V++ + +  + 
Sbjct  126   DVRKLATLQLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGSV--DSPAKVNISKLLESLT  183

Query  1509  LNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDME  1330
              NI  + +  KRY  S  +  +N +    ++A K  + L+G F  +DA PF    WLD +
Sbjct  184   FNINLRTIVGKRYCSST-YDKENSEPWRYKKAIKKALYLSGIFVMSDAIPF--LEWLDYQ  240

Query  1329  GLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGEDPDFFDIMMKVVDQEFIAGQNYT  1159
             G + AMKK +   DAV++ W+DEH+++   G+L +  + DF D+M+  + +       Y+
Sbjct  241   GHVSAMKKTAKELDAVIRNWLDEHLKKKIDGELGSDRESDFMDVMISNLAEGPDKISGYS  300

Query  1158  RDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDT  979
             RD +IKATA+ +    A +T + +VW +++LLN+  V+K  QEE+D +VGRERWV++SD 
Sbjct  301   RDVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDI  360

Query  978   DNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWP  799
              +L YLQA+VKE +RLYP  PL   RE+++DC + GY +PKGT+L VNIWKLHRDP++W 
Sbjct  361   QDLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWK  420

Query  798   EPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFA  622
              P +FKP+RFLT     D   +   +I F  GRRSCPA    L + H  LAR+LQGFD  
Sbjct  421   NPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQGFDLT  480

Query  621   TPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             T +G+PVDM EGPG+ +PK  P++ ++ PRL
Sbjct  481   TVAGLPVDMIEGPGIALPKETPLEVVIKPRL  511



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   410 bits (1053),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 302/487 (62%), Gaps = 10/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  P++GHL     KE  L + L  MAD  GP    R+G  R  VVSS E  K+ FT ND
Sbjct  16    GSWPVIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRVGSRRAFVVSSWEVAKECFTVND  75

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWRK+RK+  VELLS  +L+  KH+ ISE++
Sbjct  76    KALASRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIATVELLSNRRLQMLKHVRISEIS  135

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
               +K L+G  +K   +  V VD++ W+  +NLN++ K++A KRY  S     D ++A   
Sbjct  136   TGIKDLHGLWSKKGGSSPVLVDLKRWLEDMNLNMIVKMVAGKRYFGSSAKMEDAEEARQC  195

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++A      L G F  +DA PF    W D++G  + M+K +   D +L+ WIDEH RR  
Sbjct  196   QRAIARFFHLIGIFVVSDALPF--LGWFDLQGHEKEMRKTASELDGILERWIDEHQRRRV  253

Query  1242  LPAGE-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                 E D DF D+M+ +  +  ++   Y   T IK+T +A++   ++TT   + W +A+L
Sbjct  254   SGQSEGDSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLALILGGSDTTAGTLTWAIALL  313

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+++++K+ QEEID  VG+ R V+DSD +NLVYLQA++KE +RLYP  PL  PRE+++D
Sbjct  314   LNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMED  373

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT--ESVPDGLARQFGWITFG  712
             C VAGY +  GT+L VN+WK+ RDPK+W  PE+F+PERFLT  E+  D   + F  + FG
Sbjct  374   CTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKETEYDVRGQNFELMPFG  433

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP ++ AL++ H  LAR+L  FD  T S   VDM E PG+T+PKA P++ LLTPR
Sbjct  434   SGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGLTIPKATPLEVLLTPR  493

Query  531   LPAASYN  511
             L    Y 
Sbjct  494   LEQELYE  500



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   411 bits (1057),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 303/488 (62%), Gaps = 15/488 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GH+          +  + +A+K GP+FI+++G    LVV+S E  K+  TTNDK
Sbjct  56    GALPFIGHVHLLNARKPYFRTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDK  115

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   AG  LGYNNA   F+  G +WR++RKM  +E+LS+ KLEK KH+  +E   
Sbjct  116   VFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMATLEILSSYKLEKLKHVRDTETLS  175

Query  1590  SVKQLYGSVTKNREV-----EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
              VK LY S++  + V      V +   + +++ NI+ +++A KR+     +  DN+ A  
Sbjct  176   LVKDLYSSISYPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNE-AWR  234

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-R  1249
             LR A +D   L G F +ADA P     W+D +G +  MK+ +   D +L+ W++EH+R R
Sbjct  235   LRNAIRDATYLCGVFVAADAIPS--LSWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKR  292

Query  1248  GDLPAGE-DPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
             G+   G+ + DF D+M+    ++E I G  Y R+ +IKAT++ ++  A+ +T   + W +
Sbjct  293   GEEKDGKCESDFMDVMISAFQEEEEICG--YKREMVIKATSVLLILTASGSTAITLTWAL  350

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++LLNH  V+K  Q+E+DT +G+ERWV +SD  NL YLQA++KE +RLYP  PL   RE 
Sbjct  351   SLLLNHPKVLKAAQKELDTHLGKERWVQESDIKNLTYLQAIIKETLRLYPPAPLTGIREV  410

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
             ++DC VAGYH+PKGT+L +N+W L RDPK+WP P KF+PERFLT     + +++ F  I 
Sbjct  411   MEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIP  470

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             F  GRRSCP   + L++ H  LARLLQGFD  T  G  VDM+EG GV +PK   ++ +L 
Sbjct  471   FSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQ  530

Query  537   PRLPAASY  514
             PRLP   Y
Sbjct  531   PRLPLGLY  538



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   410 bits (1054),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 208/485 (43%), Positives = 302/485 (62%), Gaps = 14/485 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQF-KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD+ GPV  +R+G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSVSEIS  156

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSV---EHGADNQDA  1432
             + VK LY    KN     V VD++ W+  + LN++ +++A KRY   V   E   D ++A
Sbjct  157   MGVKDLYSLWVKNGGSEPVMVDLKRWLDNMTLNMIVRMVAGKRYFGGVVGSESSEDTEEA  216

Query  1431  VVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR  1252
                + A      L G F+ +DAFP     W D +G  + MK+     D +L+ WID H +
Sbjct  217   RQCKMAISKFFHLIGIFTVSDAFPR--LRWFDFQGHEKEMKQTGSELDVILERWIDNHRQ  274

Query  1251  RGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
                +   +  D DF D+M+ + +Q  ++   Y  +  IK+T +A++   +ETT S + W 
Sbjct  275   ERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLTWA  334

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +A+LLN+K+++K+ Q+EID  VGR+R V+DSD +NLVYLQA++KE +RLYP  PL  PRE
Sbjct  335   IALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGPRE  394

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGW  724
             +++DC VAGY++  GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  
Sbjct  395   AMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNFEL  454

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDM+E PG+T+PKA P++ L
Sbjct  455   MPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVL  514

Query  543   LTPRL  529
             ++PRL
Sbjct  515   ISPRL  519



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   410 bits (1053),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 306/484 (63%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     E  + K L  +ADK GP++ +R+G    L+VSS E VKD FTTND+
Sbjct  43    GAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDR  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP+I AG YLGY+NA  A    G +WR +RK+   +LLS+ +LE  KH+  SE++ 
Sbjct  103   VLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYSEVDT  162

Query  1590  SVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K LY   ++N     +V + + I  +  NI  +++A KR++ + E G    +   + +
Sbjct  163   FIKDLYSRCSENAFNPAKVVISKLIEQLTFNISLRLIAGKRFS-AREFGEQGSEGWRINR  221

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
             A K+   LTG F   DA P+    W+D +G I +M++ +   D V+  W++EH +R    
Sbjct  222   AIKEATYLTGVFVLGDAIPW--LEWIDFQGHIGSMRRTAKKIDDVIGNWLEEHAQRKLQG  279

Query  1236  AGEDPDFFDIMM-KVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              G   DF D+++ K+ D   ++G  +TRDT+IKATA+ ++   +E+T   ++W +++LLN
Sbjct  280   EG---DFMDVLLSKIEDNTVMSG--HTRDTVIKATALILIFTGSESTYLGIIWTLSLLLN  334

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             H   +K+ QEE+D  VGR+RWV++SD  NL YL+A+VKE +R+YP  P+   RE+++DCE
Sbjct  335   HPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCE  394

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             + GYH+PKGT+L VN+WKLHRDP++W  P +F+PERFLT     D   + F +I F FGR
Sbjct  395   IGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYIPFSFGR  454

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             RSCP     L++    LAR+LQGFD AT  G+PVDM EG G+ +PK  PV+ ++ PRL  
Sbjct  455   RSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVVIKPRLSD  514

Query  522   ASYN  511
               Y 
Sbjct  515   DLYQ  518



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   409 bits (1051),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 304/485 (63%), Gaps = 16/485 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +    + L  +A K GPVF IR+G+ R LV+SS E+VK+ F TND+
Sbjct  24    GAWPLIGHLRILNSQIPFFRILGDLAVKHGPVFSIRLGMRRTLVISSWESVKECFKTNDR  83

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
                 RP+  A  Y+GY++A   F   G +W ++RK+   ELLS  +LE  KH+ +SE+  
Sbjct  84    KFLNRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNRRLELLKHVRVSEIET  143

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
              +K+L+ + + N  V VDM +W   V  N+M +++A KRY   +      +D+    +  
Sbjct  144   CIKELHTTCS-NGSVLVDMSQWFSCVVANVMFRLIAGKRYCSGI-----GKDSGAFGRLV  197

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD--LP  1237
             ++   L G    +D  PF    W+D++G +++MK+V+   D V+ GW+ EH++R +    
Sbjct  198   REFFYLGGVLVISDLIPFT--EWMDLQGHVKSMKRVAKELDHVVSGWLVEHLQRREEGRV  255

Query  1236  AGEDPDFFDIMMK--VVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
               E+ DF D+M++   V  + I G  Y R+TI+KATA+ ++    +TT   + W +++LL
Sbjct  256   RKEEKDFMDVMLESLAVGDDPIFG--YKRETIVKATALNLILAGTDTTSVTLTWALSLLL  313

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             NH +V+KR Q+EID  VG  RWV++SD  NLVYLQA+VKE +RLYP  PL  PRES++DC
Sbjct  314   NHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLEDC  373

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFG  706
              V GY +P+GTQL VN WKLHRD +IW  P +F PERFLT     D   +QF ++ FG G
Sbjct  374   YVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSG  433

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR CP  + +L+M H  L+RLLQGF+F+TP    VDMSEG G+T+PKA P++ +LTPRL 
Sbjct  434   RRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATPLEVVLTPRLE  493

Query  525   AASYN  511
                Y 
Sbjct  494   NEIYQ  498



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   410 bits (1054),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/498 (42%), Positives = 313/498 (63%), Gaps = 27/498 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP++GHL     +  L + LA +ADK GP+F IR+G    +VVS+LEA+K+ FTT+D+
Sbjct  47    GALPLIGHLHLLGAQKTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDR  106

Query  1767  ALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              L+ RP    G YL YN AA  FT +G FWR++RK+V ++LLS+ +L+  +H+ +SE+N 
Sbjct  107   ILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNT  166

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +  LY     N++   ++ + E    + +N++++++A KRY  S E  A+ ++   + +
Sbjct  167   LINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRYFSSTE--AEKEEGKRIGK  224

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGD  1243
               K+ M ++G F  +D  PF    W++   G ++ MK++S   D++++ WI EH ++R +
Sbjct  225   LMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLE  282

Query  1242  LPAG----EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAM----------AMLQDAAE  1105
                     +D DF D+M+ ++D        Y+R+TIIKATAM           ++   A+
Sbjct  283   STENTNKMDDDDFIDVMLSLLDDSM---SGYSRETIIKATAMDQDVLFLHEQTLIIAGAD  339

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
             TT   + WI++ LLN++  ++  QEE+D KVGRERW +DSD  NLVY+QA++KE +RLYP
Sbjct  340   TTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYP  399

Query  924   VVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-D  748
               PL  P E+ +D  VAGYH+PKGT+L+ N+WKLHRDP +W  P+++ PERFL +    D
Sbjct  400   PGPLSVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLD  459

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
              L   F  I FG GRRSCP   +AL++ H   ARLLQGFD  TP G  VDM+EG  +T+P
Sbjct  460   VLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLP  519

Query  567   KAKPVKALLTPRLPAASY  514
             KA P++  +TPRL    Y
Sbjct  520   KATPLEIHITPRLSPELY  537



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   409 bits (1052),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 220/524 (42%), Positives = 323/524 (62%), Gaps = 17/524 (3%)
 Frame = -2

Query  2043  VAISGVLIILPFLYLS-LRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMAD  1867
             V   G++++L F+  + L  + N   +  P+P G  PI+GHL  F+    L   L  MAD
Sbjct  9     VVFFGLVLVLAFISFNHLLPETNTKARQAPQPSGAWPIIGHLHLFRASELLHPKLGAMAD  68

Query  1866  KIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-G  1690
             K GP F++R+G+ R LVVSS +A K  FTTNDK  + RP   A  ++GYN A   F   G
Sbjct  69    KYGPAFMLRLGMRRALVVSSWDAAKQCFTTNDKVFSTRPRTVAIKHMGYNYALPGFAPYG  128

Query  1689  AFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNRE---VEVDMEEWIG  1519
              +WR++RK+  VELLS  +L+ +KHI  SE++LS+K LY    KN     V V+M++W  
Sbjct  129   PYWREMRKISTVELLSHRRLDMFKHIRTSEIDLSMKDLYTRWVKNGHGSPVLVEMKQWFS  188

Query  1518  YVNLNIMSKIMAKKRYNYSVEHGADNQDAVV-LRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
              + +NI+++++A KRY  +  +   +++ V   ++A  + M L G F  +DA PF    W
Sbjct  189   DLTMNIVTRMIAGKRYFGAANYTDFSEEEVQKCKKAITEFMHLVGIFVVSDALPF--LGW  246

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG----EDPDFFDIMMKVVDQEFIA  1174
             LD++G  RAMK+ +   D +L+ W+ EH  +     G    ++ DF D+++ ++D     
Sbjct  247   LDLQGHERAMKRTAKQLDHMLESWLKEHRCKKRASEGIATADERDFMDVLLSILDDHQCI  306

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
             G  Y  DT++KAT + ++   ++TT   + W +++LLN++  +K+ Q+E+DTKVGR+  V
Sbjct  307   G--YGTDTVVKATCLGLILGGSDTTSVTLTWALSLLLNNRQALKKAQDELDTKVGRDGLV  364

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             ++SD  NLVYLQA+VKE +RLYP   +  PRE+++DC VAG+HIP GTQL VNIWKL RD
Sbjct  365   EESDIRNLVYLQAIVKETLRLYPAAAVSAPREAMEDCTVAGFHIPAGTQLLVNIWKLQRD  424

Query  813   PKIWPEPEKFKPERFLTESVPDGLAR--QFGWITFGFGRRSCPASAYALKMAHFILARLL  640
             P IWP P +F PERFLT    D   R   F  + FG GRR+CP  ++A+++ H  LARL+
Sbjct  425   PSIWPHPCEFSPERFLTSHAADIDVRGQHFELLPFGSGRRACPGISFAIQVLHLTLARLI  484

Query  639   QGFDFATP-SGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
             QGFD  TP     VDM++G G+T  K  P+  LLTPRL    Y 
Sbjct  485   QGFDLGTPCCDAMVDMTQGIGLTNHKKTPLDVLLTPRLHPLLYG  528



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/486 (43%), Positives = 306/486 (63%), Gaps = 11/486 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK GP F IR+G  R  VVSS E  K+ FT ND
Sbjct  43    GAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKECFTIND  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F     FWR++RK+  +ELLS  +LE  KH+  SE++
Sbjct  103   KALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEILKHVRTSEVD  162

Query  1593  LSVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + +++LYG   KN  R + V++  W+  + LN++ +++A KRY +     +D+ +A   +
Sbjct  163   MGIRELYGLWVKNSSRPLLVELNRWLEDMTLNVIVRMVAGKRY-FGAAAASDSSEARRCQ  221

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F  +DA PF    WLD++G  RAMK  +   D++L+GW++EH +R   
Sbjct  222   KAISQFFRLIGIFVVSDALPF--LWWLDLQGHERAMKTTAKELDSILEGWLEEHRQRRVS  279

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
               + A  + DF D+M+ + ++  ++G  Y  +T IK+T +A++   ++TT   + W +++
Sbjct  280   SLIKAEGEQDFIDVMLSLQEEGRLSGFQYDSETSIKSTCLALILGGSDTTAGTLTWAISL  339

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ QEE+D  VG ER V++SD  NLVYLQA++KE +RLYP  PL  PRE++ 
Sbjct  340   LLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLLGPREALD  399

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGY++P GT+L VNIWKL RDP +W  P  F+PERFL      D   +QF  + FG
Sbjct  400   DCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHADVDVKGQQFELMPFG  459

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  ++AL++ H  LARLL  F+ +TP   PVDM+E  G+T+PKA P++ LLTPR
Sbjct  460   SGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPLEVLLTPR  519

Query  531   LPAASY  514
             L +  Y
Sbjct  520   LNSKLY  525



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   408 bits (1049),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 300/480 (63%), Gaps = 10/480 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+ GHL     +    K L  +ADK GP++ ++ G+ R LVVSS E VKD   TND+
Sbjct  35    GAWPLFGHLPSLVGKDPACKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDR  94

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA R  I AG ++ YNNAA A    G +WR VRK+  ++LLS  +LE  KH+ +SE++ 
Sbjct  95    VLATRAGIAAGKHMFYNNAAFALAPYGQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDT  154

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K L+     N +   +V++ + +  +  NI  + +  KRY  S  +  +N +    ++
Sbjct  155   FIKGLHSFYAGNVDSPAKVNISKLLESLTFNINLRTIVGKRYCSST-YDKENSEPWRYKK  213

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---G  1246
             A K  + L+G F  +DA PF    WLD +G + AMKK +   DAV++ W++EH+++   G
Sbjct  214   AIKKALYLSGIFVMSDAIPF--LEWLDYQGHVSAMKKTAKELDAVIRNWLEEHLKKKIDG  271

Query  1245  DLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
             +L +  + DF D+M+  + +       Y+RD +IKATA+ +    A +T + +VW +++L
Sbjct  272   ELGSDRESDFMDVMISNLAEGPDKISGYSRDVVIKATALILTLTGAGSTATTLVWTLSLL  331

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+  V+K  QEE+D +VGRERWV++SD  NL YLQA+VKE +RLYP  PL   RE+++D
Sbjct  332   LNNPTVLKAAQEELDKQVGRERWVEESDIQNLKYLQAIVKETLRLYPPGPLTGIREAMED  391

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGF  709
             C + GY +PKGT+L VNIWKLHRDP++W  P +FKP+RFLT     D   +   +I F  
Sbjct  392   CSIGGYDVPKGTRLVVNIWKLHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSS  451

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCPA    L + H  LAR+LQGFD  T +G+PVDM EGPG+ +PK  P++ ++ PRL
Sbjct  452   GRRSCPAINLGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRL  511



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   409 bits (1050),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 226/539 (42%), Positives = 329/539 (61%), Gaps = 34/539 (6%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             M+ L   V I+ +L+   F+  +L K+    K+  PE  GG P++GHL    +   L K 
Sbjct  1     MEFLFTAVIITALLV---FVSRNLVKKAGNKKRGAPEAGGGWPVIGHLHLLGRPEPLHKV  57

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             L  +ADK GP+  I++G+ R LVVS+ E  K+  TT+DK  A RP   AG  L Y+++ L
Sbjct  58    LGKIADKYGPILTIKIGVHRTLVVSNWEIAKECLTTSDKVFATRPKTVAGDILCYDSSLL  117

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG---SVTKNREVEVD  1537
              F   G +WR++RK+  +ELLS+ +LE  K++  SE+   +K+LY    +      V VD
Sbjct  118   GFVPYGHYWRQIRKIATLELLSSYRLESLKYVRESEVRTCLKELYNLWDAGLDKVPVLVD  177

Query  1536  MEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMT----LTGEFSSAD  1369
             M++W  YV LN++ +++  KR N S+     + D     Q +KD ++      G+   +D
Sbjct  178   MKKWCEYVTLNVILRMVVGKRCNISISQKGASSD-----QGWKDELSRFFEFMGKLVVSD  232

Query  1368  AFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP----AGEDPDFFDIMM  1201
             A PF    WLD+ G  R MKK +   D ++Q W+DEH R+GD       G + +F   M+
Sbjct  233   ALPF--LRWLDIGGDERLMKKTARELDLIMQRWLDEHRRKGDSGDDQIKGREGNFMGAML  290

Query  1200  KVVD----QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQ  1033
              ++D    QEF  G++   DTI KAT +A++   ++TT   + W +++LLN++  +KR  
Sbjct  291   SILDDIGAQEF-PGRDA--DTINKATCLALILGGSDTTSGTLTWAISLLLNNRHALKRAH  347

Query  1032  EEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKG  853
             EE+D +VG+ER VD+SDT NLVYLQA++KE +RLYP  PL  PRE+++DC V+GYH+P G
Sbjct  348   EELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPAG  407

Query  852   TQLYVNIWKLHRDPKIWPEPEKFKPERFL----TESVPDGLARQFGWITFGFGRRSCPAS  685
             T+L +N WK+ RDP++W  P  F+PERFL      +  D   +QF  I FG GRRSCP +
Sbjct  408   TRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRRSCPGA  467

Query  684   AYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR-LPAASYN  511
             + AL++ H  LARLL  F+ ATP   PVDMSE PG+T+PKA P+K LL+PR LPA  Y 
Sbjct  468   SSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRLLPANPYG  526



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   408 bits (1048),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 215/500 (43%), Positives = 310/500 (62%), Gaps = 31/500 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             GG P++GHL        L K L  +ADK GP+  I++G+ R LVVS+ E  K+  TT+DK
Sbjct  37    GGWPVIGHLHLLGGPEPLHKVLGKIADKYGPILTIKIGVRRTLVVSNWEIAKECLTTSDK  96

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   AG  L Y+++ L F   G +WR++RK+  +ELLS+ +LE  K++  SE+  
Sbjct  97    VFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKYVRESEVRT  156

Query  1590  SVKQLYG---SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K+LY    +      V VDM++W  YV LN++ +++  KR N S+     + D     
Sbjct  157   CLKELYNLWDAGLDKAPVLVDMKKWCEYVTLNVILRMVVGKRCNISISQKGTSSD-----  211

Query  1419  QAFKDVMT----LTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR  1252
             Q +KD ++      G+   +DA PF    WLD+ G  R MKK +   D ++Q W+DEH R
Sbjct  212   QGWKDELSRFFEFMGKLVVSDALPF--LRWLDIGGDERLMKKTARELDLIMQRWLDEHRR  269

Query  1251  RGDLP----AGEDPDFFDIMMKVVD----QEFIAGQNYTRDTIIKATAMAMLQDAAETTV  1096
             +GD       G + +F   M+ ++D    QEF  G++   DTI KAT +A++   ++TT 
Sbjct  270   KGDSGDYQIKGREENFMGAMLSILDDIGAQEF-PGRDA--DTINKATCLALILGGSDTTS  326

Query  1095  SNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVP  916
               + W +++LLN++  +K+ QEE+D +VG+ER VD+SDT+NLVYLQA++KE +RLYP  P
Sbjct  327   GTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGP  386

Query  915   LGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL----TESVPD  748
             L  PRE+++DC V+GYH+P GT+L +N WK+ RDP +W  P  F+PERFL      +  D
Sbjct  387   LLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPSVWENPSAFQPERFLPGHGAHADVD  446

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
                +QF  I FG GRRSCP ++ AL++ H  LARLL  F+ ATP   PVDMSE PG+T+P
Sbjct  447   VRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHSFELATPLDQPVDMSESPGLTIP  506

Query  567   KAKPVKALLTPR-LPAASYN  511
             KA P+K LL+PR LPA  Y 
Sbjct  507   KATPLKVLLSPRLLPANPYG  526



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   414 bits (1065),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 209/470 (44%), Positives = 294/470 (63%), Gaps = 13/470 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL     +  + + L  MADK+GPVF+IR+G+ R LVVS+ EA K+ FTTNDK
Sbjct  43    GAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN  A   LGYN AA AF   G +WR++RK+ ++E+LST +L    H+ +SE++ 
Sbjct  103   IFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHA  162

Query  1590  SVKQLYGSVTKNREV---EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K LY     N  V   +V + EW  ++  N++ +++A KRY  +V HG +   + +  
Sbjct  163   GIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVAGKRYFNNVVHGGEEARSAI--  220

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              A K V+ L G   ++D  PF    W+D++G + +MK V+   D++++ W+ EH  R + 
Sbjct  221   AAIKKVLLLVGASVASDVIPF--LEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNS  278

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              A    DF DIM+  +    + G  Y+R+TIIKAT + M+   ++TT     W+++ LLN
Sbjct  279   EASSSLDFIDIMLTKLKDASLFG--YSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLN  336

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +K VMK  QEE+D KVGR+RWV+ SD  NLVY++A+VKE +RLY   PL  P E+++DC 
Sbjct  337   NKHVMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCH  396

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             V GYHI KGT+L VN WKLHRDP +W  PE+F+PERFLT     D   + F  I FG GR
Sbjct  397   VGGYHISKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGR  456

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             RSCP     L+M H  +ARLLQGFD   PS  PVDM+E  G+T+ K  P+
Sbjct  457   RSCPGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTE--GITIKKLVPL  504


 Score =   173 bits (439),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 131/205 (64%), Gaps = 12/205 (6%)
 Frame = -2

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG  1231
             K ++ L G F ++D  PF    W+D++G + +MK+V+   D+VL+ W++EH  R +  A 
Sbjct  499   KKLVPLAGAFVASDLIPF--LEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNTEAS  556

Query  1230  EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKD  1051
                DF DIM+  +    + G  Y+R+TIIKAT + ++   ++TT     W+++ LLN++ 
Sbjct  557   SRQDFIDIMLTKLKDASLFG--YSRETIIKATVLILIVVGSDTTSITSTWLLSALLNNRH  614

Query  1050  VMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVA-  874
             VMK  QEE+D KVGR+RWV+ SD  NLVYL+A+VKE +RL P +PL  P E+++D  V  
Sbjct  615   VMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPLEAMEDYHVGY  674

Query  873   -----GYHIPKGTQLYVN--IWKLH  820
                  GYHIPKGT+L  +  +W +H
Sbjct  675   HSNSPGYHIPKGTRLLSHFLLWNVH  699



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   407 bits (1047),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 307/490 (63%), Gaps = 20/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LPI+GH+     +  L + L  MADK GP+F IR G    L++S+ EAVK+ FTTND+
Sbjct  43    GALPIIGHIHLLGGKRTLAQTLGAMADKYGPIFSIRFGAFPALIISNHEAVKECFTTNDR  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP   AG YLGY++A   F   G +WR+ RK+ VVELLS+ +LE  KH+   E+N 
Sbjct  103   VLASRPKSNAGTYLGYDHAGFGFAPYGEYWRETRKLAVVELLSSHRLETSKHVLDFEVNA  162

Query  1590  SVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K LY    KN      +  +      + LN +++++A KRY   +  G D +D V  R
Sbjct  163   FIKNLYLFCKKNGPDANPKAVISHKFEALTLNTITRMIAGKRY---ISDG-DEEDDVEAR  218

Query  1419  ---QAFKDVMTLTGEFSSADAFPFRIFHWLD--MEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
                +  KD M ++G  + ++A PF    W++    G +++MK+V+   D+++  W+DEH 
Sbjct  219   HVIKVIKDFMYVSGLIAPSEAMPF--LGWMESIFGGPVKSMKRVAKEIDSIIGRWVDEHK  276

Query  1254  RRGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
              +  +   +  + DF D+++  + ++ + G  YTR+TIIKAT M +    A+TT   + W
Sbjct  277   LKRLMSEADHNNQDFIDLLLSAIGEDSMFG--YTRETIIKATVMNLFLAGADTTSIALTW  334

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
             I++ L+N++  +K  QEE+D  VGR++WV DSD + LVYLQAV+KE +RLYP  P+  P 
Sbjct  335   ILSNLMNNRHTLKTAQEELDLTVGRDKWVQDSDIEKLVYLQAVIKETLRLYPPGPISVPH  394

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGW  724
             E+ +DC ++GYH+ KGT++ VN+ +LHRDP+IW  P++F+PERFLT     D L + F  
Sbjct  395   EAREDCSISGYHVQKGTRVIVNLRRLHRDPRIWSNPDEFQPERFLTSHANVDVLGQHFEL  454

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             I FG GRRSCP    AL++ H  +AR LQGFD  TP    VDM+EG G+TMPKA P+  L
Sbjct  455   IPFGSGRRSCPGMPLALQITHLTIARTLQGFDLTTPFNESVDMTEGLGITMPKATPLDVL  514

Query  543   LTPRLPAASY  514
             L+PRLPAA Y
Sbjct  515   LSPRLPAALY  524



>emb|CBI37514.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score =   424 bits (1091),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 222/523 (42%), Positives = 318/523 (61%), Gaps = 14/523 (3%)
 Frame = -2

Query  2079  SIHTAMDALIRVVAISGVLIILPFLY---LSLRkqknktkkpppepPGGLPILGHLFQFK  1909
             S+H+ MD L +++A +G+ + L F Y   +      N      P+PPG  PI+GHL    
Sbjct  593   SLHSIMDLLTQLLAFAGLFLGLLFWYNRWIVRTLTHNSKGISAPKPPGAWPIIGHLHLLS  652

Query  1908  KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVY  1729
              +  + + L  MADK GPVF+I++G+   +VVSS EAVK+ FTTNDK  A RP       
Sbjct  653   GQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKL  712

Query  1728  LGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR  1552
             LGYN A       G FWR++RK+ VVE+LS  +L + K + ISE++  +K LY     N 
Sbjct  713   LGYNYAMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIKDLYSLGKDNN  772

Query  1551  ---EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEF  1381
                 ++V M EW  ++  N   +++A KRY  +  HG +     ++    K  ++L+G F
Sbjct  773   WISPIKVVMSEWFEHLTFNFALRMIAGKRYFDNAVHGNEEARGAII--TIKKYLSLSGAF  830

Query  1380  SSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMM  1201
               +D FPF     LD++G + +MK V++  D ++  W++EHV R     G   DF D+++
Sbjct  831   VPSDVFPF--LERLDLQGYLGSMKHVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLL  888

Query  1200  KVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEID  1021
               V    + G  +TR+T+IKAT + ++   +++T     WI++ LLN+++ MK  QEE+D
Sbjct  889   STVQDTSMFG--HTRETVIKATIVNLIVGGSDSTSITSTWILSALLNNREAMKHAQEELD  946

Query  1020  TKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLY  841
              KVGR RWV++SD   L YL+A++KE +RLYP  PL  P E+ QDC V GYHIPKGT+L+
Sbjct  947   LKVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLF  1006

Query  840   VNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMA  664
             VN WKLHRDP++W  PE+F+PERFL + +  D    QF  I FG GRR+CP    AL+M 
Sbjct  1007  VNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQML  1066

Query  663   HFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             H   ARLLQGFD ATPS  PVDM+EG   TMPK  P+++ + P
Sbjct  1067  HLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLRSSINP  1109


 Score =   419 bits (1078),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 217/512 (42%), Positives = 308/512 (60%), Gaps = 14/512 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepP---GGLPILGHLFQFKKETHL  1894
             MD L  ++A +G+ + L + Y   R +           P   G  PI+GHL     +  +
Sbjct  1     MDLLTHLLAFAGLFLGLLYWYNRWRVRTLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPI  60

Query  1893  VKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNN  1714
              + L  MADK GPVF+I++G+   +VVSS EAVK+ FTTNDK  A RP       LGYN 
Sbjct  61    FRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNY  120

Query  1713  AALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR---EV  1546
             A   F   G FWR++RK+ VVE+LS  +L + K + ISE++  ++ LY     N     +
Sbjct  121   AGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQDLYSLGKDNNWISPI  180

Query  1545  EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
             EV M EW  ++  N + +++A KRY  +  HG +     ++  A K  ++L+G F  +D 
Sbjct  181   EVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEEARGAII--AIKKFLSLSGAFVPSDV  238

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQ  1186
             FPF     LD++G + +MK V++  D ++  W++EHV R     G   DF D+++  V  
Sbjct  239   FPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMRLKSEPGSRHDFIDVLLSAVQD  296

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               + G  ++R+T+IKAT   ++   +++T     WI++ LLN+++ MKR QEE+D KVGR
Sbjct  297   TSMFG--HSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKRAQEELDLKVGR  354

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              RWV++SD   L YL+A++KE +RLY   PL  P E+ QDC V GYHIPKGT+L+VN WK
Sbjct  355   SRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWK  414

Query  825   LHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP++W  PE+F+PERFL + +  D    QF  I FG GRR+CP    AL+M H   A
Sbjct  415   LHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFA  474

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             RLLQGFD ATPS  PVDM+EG   TMPK  P+
Sbjct  475   RLLQGFDMATPSNAPVDMTEGISFTMPKLTPL  506



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   407 bits (1046),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 305/483 (63%), Gaps = 10/483 (2%)
 Frame = -2

Query  1944  GLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
              LP +GHL     +T L +  A+ ADK GP+F I +G    LV+S+ E++K+ FTTNDK 
Sbjct  45    ALPFIGHLHLLGNQTPLARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKI  104

Query  1764  LAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
             LA RP    G+YLGYN A   F   G ++ K+RK+ ++ELLS+ ++E  +H++ SE++  
Sbjct  105   LASRPKSSHGIYLGYNYAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTL  164

Query  1587  VKQLYGSVTKNREVE--VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
             V  L+  V  N +V   V + +W+  +  NI++K+++ KRY +      D+ +A  + + 
Sbjct  165   VNDLWLYVKDNNKVTKAVVISKWLEKLTFNIITKMISGKRY-FEYLQDVDDVEAHGIVKL  223

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
              K+ M ++GEF  +D  P  I  W   EG ++++MK+V    D V+  W+DEHV++ D  
Sbjct  224   IKEFMHISGEFVPSDLIP--IIGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDG  281

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
               E  DF D+M+ V++ +  +G +  RDTIIKA  M ++   ++TT + M WI+A+LLN+
Sbjct  282   VNEKHDFIDVMLSVIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNN  339

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
              + +KR QEEI+  +G++R V+ SD  NLVYLQA++KE +RLYP  PL  P E+ +DC +
Sbjct  340   TNALKRAQEEINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYI  399

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGL-ARQFGWITFGFGRR  700
              GY++PKGT+++ N+WKLHRDP IW E EKF PERF+ E   +      F ++ FG GRR
Sbjct  400   QGYNVPKGTRVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRR  459

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             +CP S +A ++    LARL+ GFD   P G  VDM EG G+T+PK  P+  +LTPRL   
Sbjct  460   ACPGSMFATQVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYE  519

Query  519   SYN  511
              YN
Sbjct  520   LYN  522



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   407 bits (1046),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 304/483 (63%), Gaps = 9/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP++GHL     +T L +  A +ADK GP+F IR+G    LV+ + EA+K+ FTTNDK
Sbjct  43    GALPLIGHLHLLGAQTPLARTFAALADKYGPMFQIRLGAYPALVICNQEAIKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP    GV+LGYN A   F   G +W K+RK+ ++ELLS  +L+   H++ SE++ 
Sbjct  103   VLASRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRKLTMLELLSARRLQFLSHVYESEIDT  162

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
              VK L+  +     V+V + EW+     NI+ K++A KRY +S     D+ +A  + +  
Sbjct  163   LVKDLWLYLGGKTHVKVTISEWLERFTFNIIIKMIAGKRY-FSYLEDVDDAEAHGVVKLI  221

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEHVRRGDL--  1240
             K+ M ++GEF  +D  P  +  W  + G ++++MK+++   D+++ GW++EH     L  
Sbjct  222   KEFMHISGEFVPSDLIP--VLGWFGVHGKVLKSMKRIAKDLDSLVGGWVEEHKNSDPLRN  279

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              + E  DF D+M+ V+  + ++G +  RDTIIKA    ++   ++TT + M WI+AML+ 
Sbjct  280   KSLEKHDFIDVMLSVIQDDPLSGHD--RDTIIKANVTNLVLAGSDTTSTTMTWILAMLMK  337

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             + + +KR QEEI+ +VGRER V+  D  NL+YLQAVVKE +RLYP  PL  P E+ +DC 
Sbjct  338   NPEALKRAQEEIEDEVGRERKVEACDLKNLIYLQAVVKETLRLYPPGPLLVPHEAREDCC  397

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRR  700
             + GY +PKGT+++ N+WKLHRDP++W E EKF PERFL E+      ++F ++ FG GRR
Sbjct  398   IQGYRVPKGTRVFANVWKLHRDPRVWSEAEKFSPERFLNENGEVDEGQRFEYLPFGSGRR  457

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             +CP S +A ++    LARLLQ F    P   PVD+ EG G+T+PK  P++ L T RLP  
Sbjct  458   ACPGSTFATQLTLITLARLLQAFHLDEPLDEPVDLEEGLGITLPKINPLQILFTSRLPNQ  517

Query  519   SYN  511
              Y+
Sbjct  518   FYS  520



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   407 bits (1045),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 307/482 (64%), Gaps = 15/482 (3%)
 Frame = -2

Query  1944  GLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
              LP++GHL    K+  L +  A+ +DK GPVF IR+G    L++S+ EA+K+ FTTNDK 
Sbjct  44    ALPLIGHLHLLGKQIPLARIFASFSDKYGPVFQIRLGAYPALIISNKEAIKECFTTNDKI  103

Query  1764  LAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
             LA RP    G++LGYN A  +F  +G ++ K++K+ +VELLS+ +LE  +H++ SE++  
Sbjct  104   LASRPKSSHGIHLGYNYAGFSFAPSGPYFSKLKKITMVELLSSRRLESLRHVYESEIHTW  163

Query  1587  VKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAVVLRQA  1414
             +K L   V  N  V+V + EW+  ++ N ++K++  KRY  N +VE    + + V L + 
Sbjct  164   IKDLSFYVKGNNNVKVVISEWLKRLSFNTITKMIGGKRYFENLNVEDVEAHGNIVNLIRE  223

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
             F   M + G+F   D  P  I  W   EG ++++MK+V    + ++  WI+EH+      
Sbjct  224   F---MLIAGDFVPKDLIP--IIGWFGFEGQVLKSMKRVGKDLETLVGSWIEEHIVNN---  275

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
             + E  DF D+M+ V++ + + G N  RDTIIKA    ++   +++T + + WI+A+LLN+
Sbjct  276   SNEKHDFIDVMLSVIEDDRVYGHN--RDTIIKANITDLMLAGSDSTSTTLTWIVALLLNN  333

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
             ++V+KR QEEID  +G+ R V+ SD  NLVYLQA++KE +RLYP  PL  P E+ +DC +
Sbjct  334   RNVLKRAQEEIDHHIGKGRRVESSDIKNLVYLQAILKETLRLYPAAPLLAPHEATEDCNI  393

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRR  700
              GY++PKGT+++ N+WKLHRDP IW EPEKF PERF+ E+   D  +  F ++ FG GRR
Sbjct  394   QGYYVPKGTRVFFNVWKLHRDPSIWSEPEKFLPERFINENGEIDHESHHFEYLPFGLGRR  453

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             +CP S +A + +   LA LL GFD   P    VDM EG G+T+PK  P++ +LTPRLP  
Sbjct  454   ACPGSLFATQNSLITLACLLHGFDLEVPMDEVVDMREGLGITLPKLTPLQVVLTPRLPFE  513

Query  519   SY  514
              Y
Sbjct  514   LY  515



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   406 bits (1043),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/485 (42%), Positives = 300/485 (62%), Gaps = 11/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+LGHL       ++ +AL  +AD +GPVF +R+G    LVVS+ EA ++ FTTNDK
Sbjct  39    GAWPVLGHLHLLGSHNNIGRALKAVADAVGPVFALRLGARPALVVSTWEAARECFTTNDK  98

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             ALAGRP   A   + YNNA + F+  G +WR+VRK+  VELLS  +L    H+  SE++ 
Sbjct  99    ALAGRPTSTASKLMCYNNAMVGFSPYGPYWRQVRKIFTVELLSHARLCSHAHVRASEVDA  158

Query  1590  SVKQLYGSVTK--NREVEVDMEEWIGYVNLNIMSKIMAKKR-YNYSVEHGADNQDAVVLR  1420
               K LYG   K       V+M +W   +  N++++++A KR + Y       N++A    
Sbjct  159   FAKTLYGLCRKVDGGPARVEMSKWFQELTFNVVARMVAGKRCFVYGAVDDGGNREARRFT  218

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV-RRGD  1243
              A   +M L G F  +D  PF    WLD+ G  RAMK+ +   D ++ GW+ EH  RR +
Sbjct  219   GAMHRMMELLGAFMVSDVVPF--LRWLDLGGYQRAMKRTAAEMDGIIGGWLREHRDRRSE  276

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
               A    DF D+M+  +++E     ++  DT+IKA ++A++    +TT   M+W +A+LL
Sbjct  277   GRAEGKEDFMDVMLSTMEKEGELFSDHDPDTVIKANSLALIIAGTDTTSVTMIWALALLL  336

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             NH +V++  QEE+D+ VG++R V +SD + LVYLQA+VKE +RLYP  P   P ++++DC
Sbjct  337   NHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETLRLYPPGPTLIPHQTMEDC  396

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V+G+ +P GTQ+ VN W +  DP++WP+P  F+PERFLT     D   R F  + FG G
Sbjct  397   QVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRGRHFELLPFGSG  456

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR+CP +++AL++ H  LAR++ GFD A   G PVDM+EG G T+PKA P++ L+TPRLP
Sbjct  457   RRACPGASFALQVVHLALARIIHGFDMA---GGPVDMTEGKGATLPKATPLQVLVTPRLP  513

Query  525   AASYN  511
                Y 
Sbjct  514   PGLYQ  518



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   405 bits (1040),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 301/486 (62%), Gaps = 18/486 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL  F  +    + L  MADK GP+F ++MGL R LVVS+ E  K+ FT NDK
Sbjct  48    GAWPLIGHLHLFGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNWEIAKECFTINDK  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN  A+A +  G +WR+ RKM  +ELLS  +L+K KH+  SE+  
Sbjct  108   PFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKLKHVRESEVKA  167

Query  1590  SVKQLYGSV--TKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             S+K L+ +   + + +V V+M+ WI  + L+I+ +I+A KRY         +QD+   ++
Sbjct  168   SIKGLFENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYT--------SQDSSDFQE  219

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDL  1240
                D   L G+F  +DA PF    WLD+ G  + MKK +   D V QGW+DEH  +RG  
Sbjct  220   HATDFFDLFGKFVVSDALPF--LRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKSKRGSS  277

Query  1239  PAGEDPDFFDIMMKVVDQEF--IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                 D DF  +M+ + D +   + G + T DT+IKA  ++++  A++TT   + W +A+L
Sbjct  278   EVKGDEDFMYVMLSLFDDKTKQLPGGDDT-DTVIKAICLSLILAASDTTAVTLTWAIALL  336

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN++DV+++ Q E+D  VG  R V++SD  NL YLQ V+KE +RLYP  PL  P ESI+D
Sbjct  337   LNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAPLLVPHESIED  396

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWITFGF  709
             C ++GYH+P GTQL VN WK+ RDP +W EP +F PERFLT+     L  Q F +I FG 
Sbjct  397   CNISGYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKGQNFEFIPFGS  456

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRR CP  ++A ++   ILA LL GFDFATPS  PVDM E   +T  KA P++ LLTPRL
Sbjct  457   GRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRL  516

Query  528   PAASYN  511
              A+ Y+
Sbjct  517   SASLYD  522



>ref|XP_007134139.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
 gb|ESW06133.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
Length=530

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/486 (41%), Positives = 294/486 (60%), Gaps = 12/486 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GHL          +  + MA+K GP+F +++G    +VV+S E  K+  TTND+
Sbjct  48    GALPFIGHLHLLNARIPYFRTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLTTNDR  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN   G  +GYNNA       G +WR++RKM V+E+LS+ +LEK KH+  +E   
Sbjct  108   VFASRPNTTGGRLMGYNNAIFGLAPYGNYWREIRKMAVLEILSSYRLEKLKHVRDTETFS  167

Query  1590  SVKQLYGSVTKNREV----EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              VK LY S++  + V    EV +   + +   NI+ +++A KR+     +  DN+ A  L
Sbjct  168   LVKDLYSSMSSPKNVKGSTEVAISNLLEHTTFNIIVRMIAGKRFGGDTVNQEDNE-AWKL  226

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             R++ +D   L G F  ADA P     W D +G +  MK+ +  TD +LQ W++EH+R   
Sbjct  227   RKSIRDSTYLFGVFVVADAIP--SLSWFDFQGYVSFMKRTAKQTDLILQKWMEEHLRDRV  284

Query  1242  LPAGEDPDFFDIMMKVVD-QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                  + DF D+M+   + QE I G  Y ++T+IKATAM ++   + +T   + W +++L
Sbjct  285   RDGKCERDFMDVMISTFEEQEEICG--YKKETVIKATAMLLILTGSGSTAMTLTWALSLL  342

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LNH  V+K   +E+DT VG+ERWV++SD  NL YL A++KE +RLYP  PL   RE ++D
Sbjct  343   LNHPKVLKVALQELDTHVGKERWVEESDIKNLNYLHAIIKETLRLYPPAPLTGIREVMED  402

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGF  709
             C + GYH+PKGT+L +N+W L RDP++W  P +F+PERFL+     D +++ F  I F F
Sbjct  403   CSLVGYHVPKGTRLLINLWNLQRDPEVWANPNEFQPERFLSSHRDIDFMSQDFELIPFSF  462

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCP  A+ L++ H  LARLLQGF      G  VDM+EG GV +PK +P++ +L PRL
Sbjct  463   GRRSCPGMAFGLQVTHLTLARLLQGFHICLKDGAEVDMTEGLGVALPKEQPLRVMLQPRL  522

Query  528   PAASYN  511
             P   Y 
Sbjct  523   PLELYQ  528



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   404 bits (1038),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/526 (40%), Positives = 324/526 (62%), Gaps = 13/526 (2%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD   + +     L+ L  L+ SL ++        PEP G  P++GH     ++    + 
Sbjct  1     MDFSSQTITGLSTLLFLFVLWRSLARKSKSKNINVPEPTGAWPLIGHFHLLARQEPACRI  60

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             L  +ADK GP++ +R+G+ RI+V S  E VK+ FTTND+  A R +I AG Y+GYNNA  
Sbjct  61    LGDIADKTGPLYSLRLGINRIMVASGWEVVKECFTTNDRIFATRASIAAGKYIGYNNAIF  120

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVK---QLYGSVTKNREVEVD  1537
             A    G +WR VRK+  ++LLS+ +LEK KH+ +SE++  +K    LY     +   +V 
Sbjct  121   ALAPYGQYWRDVRKLATLKLLSSNRLEKLKHVRLSEVDTFLKDLHNLYVESADSNHAKVI  180

Query  1536  MEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPF  1357
             +      +  NI  +++  K+++ S  +G +N +    ++A ++ + L+G F  +DA P+
Sbjct  181   INTLFERLTFNISLRMIVGKQFSSST-YGEENSEPWRYKKAIEEAVYLSGTFVMSDAIPW  239

Query  1356  RIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGEDPDFFDIMMKVVDQ  1186
                 W+D +G I AMK+ +   DAV++ W++EH+++    +   GE+ DF D+M+  +D+
Sbjct  240   --LEWIDHQGHISAMKRTAKELDAVIETWLEEHIKKRSSDECHKGEN-DFMDVMLSDLDE  296

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
             + +    ++RDT+IKATAM +    + +T   + W +++LLN+  V+K  QEE+D  VGR
Sbjct  297   DAVM-SGHSRDTVIKATAMILTLTGSGSTAVTLTWALSLLLNNPGVLKAAQEELDIHVGR  355

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
             E+WV +SD +NL YLQA+VKE +RLYP  PL   RE+ +DC + GY +PKGT+L +NIW+
Sbjct  356   EKWVQESDIENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPKGTRLIINIWQ  415

Query  825   LHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             L RDP++W +P +F+PERFL T S  D   + F +I F  GRRSCPA  + L++ H  LA
Sbjct  416   LQRDPRVWKDPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLA  475

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
             R+LQGFD  T  G+PVDM+EG G+ +PK  PV+ ++ PRL    Y 
Sbjct  476   RVLQGFDLTTIGGLPVDMTEGLGIALPKVNPVEVIIKPRLGLELYQ  521



>gb|KHG29587.1| Cytochrome P450 protein [Gossypium arboreum]
Length=521

 Score =   404 bits (1037),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/513 (41%), Positives = 323/513 (63%), Gaps = 12/513 (2%)
 Frame = -2

Query  2037  ISGVLIILPFLYL-SLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMADKI  1861
             +  + I+L  LY+ S R  KN  K   PEP G LP++GHL     +  + K LATMADK 
Sbjct  7     LQSIAILLLSLYIFSRRAPKNSKKSCIPEPSGSLPLIGHLHLLGGKEPICKKLATMADKH  66

Query  1860  GPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAF  1684
             GP++ +++G  R+LVVSS E  KD FT ND+ LA R +I AG ++GYNNA +A    G +
Sbjct  67    GPLYSLKLGTHRVLVVSSWEIAKDCFTDNDRTLATRASIAAGRHMGYNNAVMALAPYGEY  126

Query  1683  WRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEEWIGYVNLN  1504
             WR +RK+  VELLS+ +LEK KHI  SEM+  +K+LYG +++N   +V + E +  +  N
Sbjct  127   WRNIRKIATVELLSSHRLEKLKHIRFSEMDSFIKELYG-LSRN-GAKVTINEALERLTFN  184

Query  1503  IMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGL  1324
             I  +++  KR++   ++   N +     +A K  + L+G F  ADA P+    WLD++G 
Sbjct  185   INLRLLVGKRFS-GCDYEEVNSEPWRYGKAIKRALHLSGVFVLADALPY--LEWLDIQGH  241

Query  1323  IRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG-EDPDFFDIMMKVVDQE-FIAGQNYTRDT  1150
             +R+MKK +   D+V+  W++EH+++     G  + DF D+M+  + ++  I+G N  RD 
Sbjct  242   VRSMKKTAKELDSVISVWLEEHLKKKKANQGTSENDFMDVMLNHLPEDTVISGHN--RDN  299

Query  1149  IIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNL  970
             I+KAT + +     E+T   + W++++LLNH  ++   Q+E+D  VG++RWV++SD  NL
Sbjct  300   IVKATTLILSLTGGESTSVTITWVLSLLLNHPKILMAAQQELDLHVGKQRWVEESDIKNL  359

Query  969   VYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPE  790
              YLQA+VKE +RLYP  P+   RE+ +DC +AGY + KGT+L VN+WKL RDP++W   +
Sbjct  360   KYLQAIVKETLRLYPPGPITGIREATKDCRIAGYDVSKGTRLIVNLWKLQRDPRVWENAD  419

Query  789   KFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPS  613
             +F+PERF+T  V  D   + F ++ F  GRRSCP   + L++ H ++A+L+QGFD  T  
Sbjct  420   EFRPERFMTTHVDFDVRGQNFEYMPFSSGRRSCPGITFGLQVVHLMVAKLIQGFDIKTAE  479

Query  612   GMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             G  VDM EG G+ +PK  P+  +L PRL    Y
Sbjct  480   GTAVDMEEGLGLALPKLNPIDVVLRPRLRTEFY  512



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   404 bits (1037),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 206/485 (42%), Positives = 298/485 (61%), Gaps = 14/485 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQF-KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  +AD+ GP   +R+G     VVSS E  KD FT ND
Sbjct  39    GAWPIIGHLHLLVGKEQLLYRTLGRLADRYGPTMSLRLGSSEAFVVSSFEVAKDCFTVND  98

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  99    KALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSVSEIS  158

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSV---EHGADNQDA  1432
             + VK LY    KN     V VD+  W+  + LN++ +++A KRY   V   E   D ++ 
Sbjct  159   MGVKDLYSLWVKNGGSEPVMVDLRRWLDNMTLNMIVRMVAGKRYFGGVVGSESSEDTEEG  218

Query  1431  VVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR  1252
                + A      L G F+ +DAFP     W D +G  + MK+     D +L+ WID H +
Sbjct  219   RQCKTAISKFFHLIGIFTVSDAFP--SLRWFDFQGHEKEMKQTGSELDVILEKWIDNHRQ  276

Query  1251  RGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
                +   E  D DF  +M+ + +Q  ++   Y  +  IK+T +A++   +ETT S + W 
Sbjct  277   ERKVSGTEEIDSDFIHVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLTWA  336

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +A+LLN+K+++K+ Q+EID  VGR+R V+ SD +NLVYLQAVVKE +RLYP  PL  PRE
Sbjct  337   IALLLNNKEMLKKAQDEIDLHVGRDRNVEVSDINNLVYLQAVVKETLRLYPAGPLLGPRE  396

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGW  724
             +++DC VAGY++ +GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  
Sbjct  397   AMEDCTVAGYNVTRGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNFEL  456

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDM+E PG+T+PKA P++ L
Sbjct  457   MPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVL  516

Query  543   LTPRL  529
             ++PRL
Sbjct  517   ISPRL  521



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   403 bits (1036),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 220/524 (42%), Positives = 321/524 (61%), Gaps = 23/524 (4%)
 Frame = -2

Query  2037  ISGVLIILPFLYL----SLRkqknktkkpppepPGGLPILGHLFQF--KKETHLVKALAT  1876
             ++GV   L F YL     + +  +  K+  PE  G  P LGHL      K  H+V  L  
Sbjct  12    MAGVFAFLIFCYLLFTRVINRTGSGMKRKAPEASGARPFLGHLHLLGGSKPAHVV--LGD  69

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             +AD  GP+F IR+G+   LVVS+ E  K+ FTTNDKA A RP   A   LGYN A   F+
Sbjct  70    LADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAELLGYNYAMFGFS  129

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG------SVTKNREVEVD  1537
               G +WR++RK+V +E+LS  +LEK KHI  SE+  S+K+LY       S + + +V V+
Sbjct  130   PYGPYWRQIRKIVTLEVLSNHRLEKLKHIRESEVRTSIKELYKLGVEGVSNSSSGKVLVE  189

Query  1536  MEEWIGYVNLNIMSKIMAKKRYNYS-VEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFP  1360
             M+ W   +N+N++ K++  KRY+ +   HG D  D    R+A +D   LTG F+  D+ P
Sbjct  190   MKRWFWTLNINMVFKMVVGKRYSEAETSHGKDENDRR--RKALRDFFELTGTFTVGDSLP  247

Query  1359  FRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKVVDQE  1183
             F    WLD+ G  +AMKK +   D +L+ W++EH  +R    A  + DF  +M+ +++ +
Sbjct  248   F--LRWLDLGGHEKAMKKTAKELDHILEEWLEEHKQKRNSGNAESEHDFMGMMLSLLN-D  304

Query  1182  FIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRE  1003
                  +Y  DTI KAT ++++  A++TT+  + W +++LLN+++ +K+ QEE+D  VGR+
Sbjct  305   AAELPSYDADTINKATCLSLILAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRD  364

Query  1002  RWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKL  823
             + V++SD   LVYLQA++KE +RLYP  PL  P ES++DC V+GYHIP GT+L +N++K+
Sbjct  365   KLVEESDIKKLVYLQAIIKETLRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKI  424

Query  822   HRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILAR  646
             HRDP  W +P +F+PERFLT     D   + F  I FG GRR CP  + AL++    LA 
Sbjct  425   HRDPHAWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLAN  484

Query  645   LLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LLQGF+  TP   PVDM E  G+T  K  P++ L+TPRLPA  Y
Sbjct  485   LLQGFELGTPLDEPVDMGEAIGITNLKVSPLEVLITPRLPAVCY  528



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   403 bits (1036),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 305/485 (63%), Gaps = 15/485 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  GP   +++G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE+ 
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIT  156

Query  1593  LSVKQLYGSVTKN---REVEVDMEEWIGYVNLNIMSKIMAKKRY---NYSVEHGADNQDA  1432
             + VK LY    KN   + V VD++ W+  + LN++ +++A KRY     SV    D ++A
Sbjct  157   MGVKDLYSLWFKNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRYFGGGGSVS-SEDTEEA  215

Query  1431  VVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR  1252
             +  ++A      L G F+ +DAFP     + D++G  + MK+     D +L+ WI+ H +
Sbjct  216   MQCKKAIAKFFHLIGIFTVSDAFP--TLSFFDLQGHEKEMKQTGSELDVILERWIENHRQ  273

Query  1251  RGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
             +      +  D DF D+MM + +Q  ++   Y  +T IK+T +A++   ++T+ S + W 
Sbjct  274   QRKFSGTKENDSDFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSASTLTWA  333

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLN+K+++K+ Q+EID  VGR+R V+DSD +NLVYLQA++KE +RLYP  PL  PRE
Sbjct  334   ISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPRE  393

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGW  724
             +++DC VAGY++P GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  
Sbjct  394   AMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNFEL  453

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FG GRRSCP S+ A+++ H  LAR L  FD  T   MPVDMSE PG+T+PKA P++ L
Sbjct  454   MPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKATPLEVL  513

Query  543   LTPRL  529
             ++PR+
Sbjct  514   ISPRI  518



>ref|XP_010028535.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   403 bits (1036),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 299/485 (62%), Gaps = 9/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+ GHL        L + LA MAD+ GP F IR+G+ R+LVVS+ E  K+ FT+ND+
Sbjct  44    GAWPLFGHLHLLGPNKLLHRILAVMADQYGPAFSIRLGILRVLVVSNWEVAKECFTSNDR  103

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
                 RP   +   +GY++A L F   G +WR +RK+ VVELLS  +L+ +KH+  +E NL
Sbjct  104   VFPTRPRSLSIKLMGYDHAMLGFAPYGPYWRGMRKLAVVELLSNHRLDSFKHVRDAETNL  163

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              VK LY     N E  V V+ME+  G+V +NI  +++A KRY     +  D +++   R+
Sbjct  164   FVKGLYEKWLSNGENPVTVEMEKDFGHVAMNITVRMVAGKRYLSGNGNEGDEEESSRCRK  223

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDM-EGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             A  D   L GEF  +DA PF    WLD+ +G +  MK+ +   D VL  W++EH +R  +
Sbjct  224   ALGDFSHLVGEFMVSDAIPF--LGWLDIVKGRVAEMKRTAKELDWVLGRWVEEHRKRRAV  281

Query  1239  PAGED--PDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                ED   DF   M+   + E         DTI+KAT ++M+    +T V  + W +++L
Sbjct  282   AKVEDDEQDFIHFMLSATELEEGKYSVQEADTIVKATCLSMILGGNDTIVLTLTWALSLL  341

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+   ++R Q+E+D +VG+ R V++SD  NL YLQAVVKE +R+YPV+PL   RE+++D
Sbjct  342   LNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVVKETLRIYPVLPLSLQREAMED  401

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGF  709
             C VAG+H+P GT+L VN+WKL RDP++W    +F+PERFLT+ V  D   + F +I FG 
Sbjct  402   CIVAGFHVPAGTRLMVNLWKLQRDPRVWSHASEFQPERFLTDHVHVDVRGQSFEYIPFGT  461

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRR CP  ++ L++   ILARLL  F     SG  VDMSE P +TMP+A P++A+LTPRL
Sbjct  462   GRRMCPGVSFGLQVVQLILARLLHAFKLERVSGSEVDMSESPALTMPRATPLEAVLTPRL  521

Query  528   PAASY  514
             PA  Y
Sbjct  522   PATCY  526



>ref|XP_007017404.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14629.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 211/483 (44%), Positives = 306/483 (63%), Gaps = 16/483 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL           AL  +A+K GP+F IR+GL   +VVSS E  K++FTT D 
Sbjct  45    GRWPLIGHLHVLAGSQLPYLALGDLANKYGPIFTIRIGLHPAVVVSSSELAKEIFTTYDV  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A++ RP +  G YLGYN A   F+  GA+WR++RK+   ELLS  +LE  KHI  SE+  
Sbjct  105   AVSSRPKLTVGNYLGYNCANFGFSPYGAYWREMRKITASELLSNRRLELLKHIKASEVES  164

Query  1590  SVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             SVK+LY   TK ++    V V+M++W G +NLN++ +++A KR+ +     +D  +A   
Sbjct  165   SVKELYKLWTKTKDESGHVLVEMKQWFGELNLNVILRMIAGKRF-FGAGVASDENEARRC  223

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--  1249
             R+A ++   L G F   DA PF    WLD+ G  +AMKK +   D++++ W++EH+R+  
Sbjct  224   RKAMREFFRLAGLFVVRDAVPF--LGWLDLGGHEKAMKKNAKELDSIMEEWLEEHLRKKD  281

Query  1248  --GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               G++  GE  DF D+++ V+D   + G  Y  +T+ KATAM +L    +TT   + W +
Sbjct  282   TVGEIAKGEQ-DFIDVLLSVLDGVDLEG--YDVNTVTKATAMTLLVGGTDTTTVTITWAL  338

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLNH+  +++ QEE+D ++GRER V+++D D LVYLQA+VKE +RLYP  PL   RE 
Sbjct  339   ALLLNHRHALEKAQEELDIQIGRERLVNEADIDKLVYLQAIVKESLRLYPAGPLSGAREF  398

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
              +DC + GYH+PKGT+L VN+WK+  DP+ W +P +FKPERF+T  +  D   + F  I 
Sbjct  399   TEDCTIGGYHVPKGTRLIVNLWKIQTDPQFWFDPLEFKPERFITSHLDVDVKGQHFELIP  458

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRR CP   + L+M H +LARLL  FD  TPS  PVDM+  PG+T  KA P++ L+ 
Sbjct  459   FGAGRRLCPGINFGLQMTHLVLARLLHAFDIWTPSNEPVDMTGSPGLTNIKATPLEVLVK  518

Query  537   PRL  529
             PRL
Sbjct  519   PRL  521



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 301/483 (62%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MA++ GP   +R+G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSNEAFVVSSFEVAKECFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWR++RK+  VELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAVV  1426
             + VK LY    K    E   VD++ W+  + LN++ +++A KRY         D ++A  
Sbjct  157   MGVKDLYSLWVKKGGSEPIIVDLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQ  216

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG  1246
              ++A      L G F+ +DAFP     W D++G  + MKK     D +L+ WI+ H ++ 
Sbjct  217   CQKAITKFFHLIGIFTMSDAFP--TLGWFDLQGHEKEMKKTGSELDVILERWIENHRQQR  274

Query  1245  DLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
              +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +A++   ++TT S + W +A
Sbjct  275   KVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIA  334

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+KD++K+ Q+EID +VG +R V+DSD +NLVYLQA++KE +RLYP  PL  PRE++
Sbjct  335   LLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAM  394

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWIT  718
             +DC VAGYH+  GT+L VN+WK+ RDPK+W EP +F+PERFLT      D   + F  I 
Sbjct  395   EDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIP  454

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP S+ A+++ H  LAR L  FD  T   + VDMSE PG+T+PKA P++ +++
Sbjct  455   FGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMIS  514

Query  537   PRL  529
             PRL
Sbjct  515   PRL  517



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 224/522 (43%), Positives = 325/522 (62%), Gaps = 18/522 (3%)
 Frame = -2

Query  2052  IRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATM  1873
             I  + + G+L +    YL +R+ +   ++  PE  G  PI+GHL            L TM
Sbjct  15    ITTIGVLGILFL--SYYLLVRRSRAGKRRIAPEAAGAWPIIGHLHLLGGSQLPHVTLGTM  72

Query  1872  ADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT  1693
             ADK GP+F IR+G+ R LVVSS E  K+ FTTND A++GRP + A  +LGYN A  AF+ 
Sbjct  73    ADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSP  132

Query  1692  -GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG--SVTKNR--EVEVDMEE  1528
               A+WR+VRK+V  ELLS  +LE  K +  SE+  S+K+LY   +  KN    V V+M++
Sbjct  133   YDAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIKELYKLWAEKKNELGHVLVEMKQ  192

Query  1527  WIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIF  1348
             W G +++N++ +++  KRY + V  G + ++A   ++A ++   L G F   D  P    
Sbjct  193   WFGDLSMNVILRMVVGKRY-FGVGAGGEEEEARRCQKAIREFFRLLGLFVVKDGIPS--L  249

Query  1347  HWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP---DFFDIMMKVVDQEFI  1177
              WLD+ G  +AMKK +   D++ Q W++EH RR D   GED    DF D+++ V+D +  
Sbjct  250   GWLDLGGHEKAMKKTAKEIDSIAQEWLEEHRRRKDW--GEDNGMHDFMDVLLSVLDGK--  305

Query  1176  AGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERW  997
             A   Y  DTI KAT+MA++    +T    + W ++++LN+++ +K+ +EE+DT VG+ER 
Sbjct  306   ALPEYDADTINKATSMALISGGTDTMTVTLTWALSLILNNRETLKKAKEELDTHVGKERL  365

Query  996   VDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHR  817
             V+ SD   LVYLQA+VKE +RL P  PL  PR+  +DC + GYH+PKGT+L +N+ KLHR
Sbjct  366   VNASDISKLVYLQAIVKETLRLRPPGPLSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLHR  425

Query  816   DPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLL  640
             DP +W +PE+F+PERFLT     D   + F  + FG GRRSCP   +AL+M H  LA  L
Sbjct  426   DPSVWLDPEEFQPERFLTTHRDVDARGQHFQLLPFGAGRRSCPGITFALQMLHLALASFL  485

Query  639   QGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              GF+ +TPS  PVDMSE PG+T  K+ P++ L+ PRLP  SY
Sbjct  486   HGFEVSTPSNAPVDMSEIPGLTNIKSTPLEILIAPRLPYNSY  527



>gb|KDP38423.1| hypothetical protein JCGZ_04348 [Jatropha curcas]
Length=561

 Score =   404 bits (1038),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 213/489 (44%), Positives = 301/489 (62%), Gaps = 17/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ + L  MADK GP F IR+G     VV+S E  K+ FT ND
Sbjct  79    GAWPIIGHLHLLGGADKLLHQTLGLMADKYGPAFNIRIGSHCAFVVASSELAKECFTIND  138

Query  1770  KALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K +A RP   A  ++ YN+A   F    + WR++RK+V++ELLS  +LE  KH+  SE+N
Sbjct  139   KDVASRPTTAATKHMCYNHAVFGFAPHSSHWREMRKIVMLELLSNRRLEMVKHVQNSEVN  198

Query  1593  LSVKQLYGSVTKNR--EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             L +K+LY    +N    V V++++W   + LN++ +++A KRY  S    +D+  A   +
Sbjct  199   LGIKKLYHLWAENNCLPVLVELKQWFEDLTLNVIVRVVAGKRYTGS----SDDDGARRCQ  254

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
              A      L G F  +DA PF    WLD+EG  RAMKK +   DAVL+GW+ EH ++   
Sbjct  255   NAISKFFHLMGIFVVSDALPF--LQWLDLEGHQRAMKKTAKDLDAVLEGWLTEHRQKRVS  312

Query  1248  --GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               G+     + DF D+M+ + ++  ++G  Y  DT IK+T +A++  A++TT + + W +
Sbjct  313   VLGEAKTEGEQDFIDVMLSLEEKGHLSGFIYDADTSIKSTCLALIAGASDTTTTTLTWAI  372

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++LLN+K  +K+ +EE+D  VG ER VD+SD  +LVY+QA++KE +RLYPV PL  PRE 
Sbjct  373   SLLLNNKSALKKAREELDLHVGPERQVDESDLKSLVYIQAIIKETLRLYPVAPL-IPREF  431

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWIT  718
              +DC +AGYH+P GT+L VN WK+ RDP+ W  P  F+PERFLT     D   +    I 
Sbjct  432   TKDCTIAGYHVPAGTRLLVNAWKIQRDPRYWTNPSAFQPERFLTSHANVDVRGQHHELIP  491

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP +A+AL   H  LAR L  FD AT    PVDM+E PG T+PKA P+  LL+
Sbjct  492   FGSGRRSCPGAAFALHALHLTLARFLHAFDLATTMDKPVDMTETPGTTLPKATPLDVLLS  551

Query  537   PRLPAASYN  511
             PRLPA  Y+
Sbjct  552   PRLPAELYS  560



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   402 bits (1032),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/487 (42%), Positives = 298/487 (61%), Gaps = 15/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL      + + + L  MAD+ GPVF +R+G  R LVVSS EA+K+  T ND+
Sbjct  41    GAWPLIGHLHLLDGLSPVARTLGAMADRHGPVFSLRLGSHRGLVVSSWEAIKECLTANDR  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP+I    YLGY  A+      G +WR VRKMV V+LL+   L+ + H+  +E++ 
Sbjct  101   VFATRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMVTVDLLTARHLDDFSHVRTAEVDG  160

Query  1590  SVKQLY----GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              VK L+    G      ++ V +   I  +  NI+ +++  KR+++S     D+      
Sbjct  161   FVKDLHSMCGGGNGGESKMVVALSGRIELLTFNIILRMLVGKRFSFS---KGDDDKNWRF  217

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RG  1246
             ++A K V+ L G F  +DA P     WLD+ G I++MK+     D VL+ W+ E ++ R 
Sbjct  218   QEAIKKVLYLGGVFVFSDAIP--SLEWLDIGGYIKSMKQTFKQVDNVLEDWVQERIQTRK  275

Query  1245  DLPAGEDPDFFDIMMKVVDQ-EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                A  D DF D+M+  +D+ E +AG  YTR+T+IKAT + ++   +E+T   ++W +++
Sbjct  276   QKDAQTDSDFMDVMLSTIDKNEMMAG--YTRETVIKATILMLIMTGSESTSETIIWAISL  333

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+   MK  Q+EID  +GR+R+V +SD +NL YLQA+ KE +RLYP  PL  PRE+++
Sbjct  334   LLNNPHTMKTAQDEIDNNIGRDRFVQESDINNLTYLQAIFKETLRLYPPGPLSGPREALE  393

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWITFG  712
             DC + GYH+P+GT+L +N+WKLHRDP IW  P++F+PERFL E        Q F +I F 
Sbjct  394   DCHIGGYHVPRGTRLVLNLWKLHRDPNIWFNPDEFRPERFLNEKSQMNFKGQYFEFIPFS  453

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP   + L++ H  LARLLQ FDF+ P+G  VDM EG G+ +PK KP+  +LTPR
Sbjct  454   SGRRMCPGMTFGLQVIHLTLARLLQSFDFSMPNGETVDMGEGLGIALPKLKPLDVVLTPR  513

Query  531   LPAASYN  511
             LP   Y 
Sbjct  514   LPKKLYQ  520



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   402 bits (1032),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 302/483 (63%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MA++ GP   +R+G     VVSS E  K+ FT ND
Sbjct  37    GSWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAVV  1426
             + VK LY    K   +  V V+++ W+  + LN++ +++A KRY         D ++A  
Sbjct  157   MGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQ  216

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG  1246
              ++A      L G F+ +DAFP     W D++G  + MKK     D +L+ WI+ H ++ 
Sbjct  217   CQKAITKFFHLIGIFTMSDAFP--TLGWFDLQGHEKEMKKTGSELDVILERWIENHRQQR  274

Query  1245  DLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
              +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +A++   ++TT S + W +A
Sbjct  275   KVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIA  334

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+KD++K+ Q+EID +VG +R V+DSD +NLVYLQA++KE +RLYP  PL  PRE++
Sbjct  335   LLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAM  394

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWIT  718
             +DC VAGYH+  GT+L VN+WK+ RDPK+W EP +F+PERFLT      D   + F  I 
Sbjct  395   EDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIP  454

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP S+ A+++ H  LAR L  FD  T   + VDMSE PG+T+PKA P++ +++
Sbjct  455   FGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMIS  514

Query  537   PRL  529
             PRL
Sbjct  515   PRL  517



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   402 bits (1032),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 299/484 (62%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  G    +++G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + VK LY    KN   E   VD++ W+  + LN++ +++A KRY      E   D ++A 
Sbjct  157   MGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGAGSESSEDTEEAS  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A      L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H + 
Sbjct  217   QCKRAISKFFHLIGIFTVSDAFP--SLRWFDLQGHEKEMKQTGSELDVILERWIENHRQE  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               +   +  D DF D+M+ + +Q  ++   Y   T IK+T +A++   ++TT S + W +
Sbjct  275   RKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGGSDTTASTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K  Q+EID  VGR+R V+DSD +NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAGY++  GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFITGEAKEFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDMSE PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATPLEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   401 bits (1031),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 302/483 (63%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MA++ GP   +R+G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAVV  1426
             + VK LY    K   +  V V+++ W+  + LN++ +++A KRY         D ++A  
Sbjct  157   MGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQ  216

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG  1246
              ++A      L G F+ +DAFP     W D++G  + MKK     D +L+ WI+ H ++ 
Sbjct  217   CQKAITKFFHLIGIFTMSDAFP--TLGWFDLQGHEKEMKKTGSELDVILERWIENHRQQR  274

Query  1245  DLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
              +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +A++   ++TT S + W +A
Sbjct  275   KVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIA  334

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+KD++K+ Q+EID +VG +R V+DSD +NLVYLQA++KE +RLYP  PL  PRE++
Sbjct  335   LLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAM  394

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWIT  718
             +DC +AGYH+  GT+L VN+WK+ RDPK+W EP +F+PERFLT      D   + F  I 
Sbjct  395   EDCTIAGYHVSCGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIP  454

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             FG GRRSCP S+ A+++ H  LAR L  FD  T   + VDMSE PG+T+PKA P++ +++
Sbjct  455   FGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMIS  514

Query  537   PRL  529
             PRL
Sbjct  515   PRL  517



>emb|CDP03915.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   399 bits (1026),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 284/423 (67%), Gaps = 10/423 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL Q      L +    +ADK GPVF IR+G+ R LVVS+ EAVK+ FTTNDK
Sbjct  46    GAWPVIGHLLQLNSHDTLARTFGALADKYGPVFSIRLGMTRALVVSNWEAVKECFTTNDK  105

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA RP+  AGVYLGYNNAA  F   G FWR++RK+V++++LS  +LE  +H+ +SE+  
Sbjct  106   VLASRPDSNAGVYLGYNNAAFGFAPYGHFWRQMRKLVLLQVLSNRRLETLRHVRVSEIQT  165

Query  1590  SVKQLYGSVTK--NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             S ++L+  + +  N   +V + EW+  + LNI+ + +A KRY+ S     +  DA   ++
Sbjct  166   STRELFSVINREENAPAKVVISEWVEQLTLNIIVRTVAGKRYSDS--EAGNRIDAQYFKK  223

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV--RRGD  1243
               K+ M +TG+   +D  PF    WLD  G I++MK++    DA++Q WIDEHV  RR  
Sbjct  224   VVKEYMYVTGQLDLSDVIPFPPLRWLDPLGHIKSMKRLFKELDAIMQIWIDEHVEKRRTK  283

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
               +G++  F D+++ V++ +F  GQ   R+T+IKAT   ++   ++TT  ++ W++++L+
Sbjct  284   SISGDEQSFIDVLLSVIEDDFALGQ--PRETLIKATINNLILAGSDTTSVHLTWLLSLLV  341

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N++ VM++ QEEID+ VG+ERWV++SD  NLVYLQA+VKE +RLYP  PL  P  + +DC
Sbjct  342   NNRQVMEQAQEEIDSSVGKERWVNESDIKNLVYLQAIVKEALRLYPPGPLSVPHLAREDC  401

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             EV+GYH+PKGT+++VN+WKLHRDP+IW EP+KF PERF+T     D   + F +  FG G
Sbjct  402   EVSGYHVPKGTRVFVNVWKLHRDPRIWSEPDKFCPERFMTSHAEVDVSGQHFEFTPFGSG  461

Query  705   RRS  697
             RRS
Sbjct  462   RRS  464



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   401 bits (1031),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 304/484 (63%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     + HL+ + L  MAD  GP   +R+G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLLGGKEHLLYRTLGKMADHYGPAMSLRLGSSEAFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + VK LY    K    E   VD++ W+  + LN++ +++A KRY      +   D ++A+
Sbjct  157   MGVKDLYSLWVKKGGTEPVMVDLKSWLEDMTLNMIVRMVAGKRYFGGGGSQSSEDTEEAM  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A      L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H ++
Sbjct  217   QCKKAIAKFFHLIGIFTVSDAFP--RLGWFDLQGHEKEMKQTGSELDVILERWIENHRQQ  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +A++   ++T+ S + W +
Sbjct  275   RQVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSASTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++LLN+K+++K+ Q+EID  VG ++ V+DSD +NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   SLLLNNKEMLKKAQDEIDLHVGTDKNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAGY++P GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCRVAGYNVPCGTRLIVNVWKIQRDPKVYTEPNEFRPERFITGEAKEFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR L  F+  T   +PVDMSE PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARFLHSFEAKTVLDLPVDMSESPGLTIPKATPLEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/516 (41%), Positives = 317/516 (61%), Gaps = 14/516 (3%)
 Frame = -2

Query  2028  VLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFK-KETHLVKALATMADKIGPV  1852
             +L ++ FLY   + + + +KK  PEP G  PI+GHL      E  L + L  MAD  GP 
Sbjct  9     LLGVVIFLYFLFKNKNSTSKKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMADNYGPA  68

Query  1851  FIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRK  1675
             F IR+G  R  VVSS E  K+ FT NDKALA RP   A  ++GY  A   F     FWR+
Sbjct  69    FSIRLGSRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSTFWRE  128

Query  1674  VRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKN----REVEVDMEEWIGYVNL  1507
             +RK+ + ELLS  +L+  KH+ +SE+ + +++LY     N    R + V+++ W   + L
Sbjct  129   MRKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGYRPILVELKHWFEDLTL  188

Query  1506  NIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEG  1327
             N++ +++A KRY +      D+ +A   ++A      L G F  +DAFP  I  W D++G
Sbjct  189   NVIVRMVAGKRY-FGAGASCDDDEARRCQKAINQFFHLIGIFVPSDAFP--ILGWFDIQG  245

Query  1326  LIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP---DFFDIMMKVVDQEFIAGQNYTR  1156
               +AMK+ +   D++L+ W+ EH  +  L  G++    DF D+M+ + ++  ++   Y  
Sbjct  246   HEKAMKRTAKELDSILESWLQEHREKRRLSEGKNEGAQDFIDVMLSLQEEGRLSNFQYDA  305

Query  1155  DTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTD  976
             DT IK+T +A++   ++TT   + W +++LLN+ +++++ QEEID  VG++R VD+SD  
Sbjct  306   DTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQ  365

Query  975   NLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPE  796
             NL Y+QA++KE +RLYP  PL  PRE++ +CEV GY I  GT+L VN+WK+ RDP+IW +
Sbjct  366   NLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWED  425

Query  795   PEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFAT  619
             P+ FKP+RFL + S  D   + F  I FG GRRSCP  + AL++ H  LAR LQ F+F+ 
Sbjct  426   PDSFKPDRFLMSNSNVDVKGQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSK  485

Query  618   PSG-MPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             P G   +D++E PG+T+PKA P+  L+TPRL A  Y
Sbjct  486   PVGDQLIDLTESPGLTIPKATPLDVLITPRLNANLY  521



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/486 (42%), Positives = 295/486 (61%), Gaps = 14/486 (3%)
 Frame = -2

Query  1944  GLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
              LP +GHL          +  + MA+K GP+F +++G    +VV+S E  K+  T ND+ 
Sbjct  47    ALPFIGHLHLLNARIPYFRTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLTKNDRV  106

Query  1764  LAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
              A RPN  AG  LGYN+A       G +WR++RKM V+E+ S+ +LEK KH+  SE    
Sbjct  107   FASRPNTSAGRILGYNHAVFGLAPYGNYWREIRKMAVLEIFSSYRLEKLKHVRDSETLSL  166

Query  1587  VKQLYGSVTKNREV----EVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             VK+LY S++  + V    EV M   + ++  NI+ +++A KR+     +  DN+ A  LR
Sbjct  167   VKELYSSISSIKNVKGSTEVAMSNLLEHMTFNIIVRMIAGKRFGGDTVNEEDNE-AWKLR  225

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGD  1243
             +A KD   L G F  ADA P     W D +G +  MK+ +   D +LQ W++EHV+ RGD
Sbjct  226   KAIKDATYLCGIFVVADAIP--SLSWFDFQGHLSFMKRTAKKLDFILQKWLEEHVKTRGD  283

Query  1242  -LPAGEDPDFFDIMMKVVD-QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              +  G + DF D+M+   + QE   G  Y R+ +IKAT++ ++   + +T   + W +++
Sbjct  284   NMNGGCERDFMDVMLSSFEGQEDFCG--YNREIVIKATSVLLVLTGSGSTAITLTWALSL  341

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLNH  V+K  Q+E+D  VG+ERWV +SD  NL YL A++KE +RLYP  PL   RE+++
Sbjct  342   LLNHPRVLKAAQQELDNSVGKERWVQESDIKNLNYLHAIIKETLRLYPPAPLTGIREAME  401

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGYH+PKG +L +N+W+L RDP++W  P +F PERFLT     D +++ F  I F 
Sbjct  402   DCCVAGYHVPKGARLLINLWELQRDPEVWSNPNEFNPERFLTTHRDIDFMSQNFELIPFS  461

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
             FGRRSCP   + L++ H  LARL+QGFD +T  G  VDM+EG GV +PK   ++  L PR
Sbjct  462   FGRRSCPGVTFGLQVLHLTLARLIQGFDMSTKDGAEVDMTEGLGVALPKENELQLTLAPR  521

Query  531   LPAASY  514
             LP   Y
Sbjct  522   LPLMLY  527



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   400 bits (1029),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 204/487 (42%), Positives = 304/487 (62%), Gaps = 19/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  GP   +R+G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKECFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F   GAFWR++RK+  +ELLS  +L+  KH+ +SE+ 
Sbjct  97    KALASRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVRVSEIA  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY-----NYSVEHGADNQ  1438
             + VK LY    K    E   VD++ W+  ++LN+M +++A KRY     + S E   D +
Sbjct  157   MGVKDLYSLWVKKGGAEPVMVDLQSWLEDISLNMMVRMVAGKRYFGGGGSLSSE---DTE  213

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
             +A   R+   +   L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H
Sbjct  214   EARQCRKGVANFFHLVGIFTVSDAFP--KLGWFDLQGHEKEMKQTGRELDVILERWIENH  271

Query  1257  VRRGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              ++  +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +AM+    ET+ + + 
Sbjct  272   RQQRKVSGTKHNDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGGTETSPATLT  331

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++LLN+K+++K+ QEEID  VGR+R V+DSD +NLVYLQA++KE +RLYP  PL   
Sbjct  332   WAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGH  391

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQF  730
             RE+++DC VAGY++P GT++ VN+WK+ RDPK++ EP++F+PERF+T      D   + F
Sbjct  392   REAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFITGEAKEFDVRGQNF  451

Query  729   GWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVK  550
               + FG GRRSCP ++ A+++ H  LAR L  F+  T   MPVDMSE PG+T+PK  P++
Sbjct  452   ELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESPGLTIPKGTPLE  511

Query  549   ALLTPRL  529
              L++PRL
Sbjct  512   VLISPRL  518



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   400 bits (1028),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 212/487 (44%), Positives = 299/487 (61%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL  F  +    + L  +ADK GP+F ++MGL R LVVS+ E  K+ FT NDK
Sbjct  48    GAWPLIGHLHLFGGQEPTHRLLGDVADKYGPIFTMKMGLNRALVVSNWEIAKECFTINDK  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN  A+A +  G +WR+ RKM  +ELLS  +L+K KH+  SE+  
Sbjct  108   PFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKLKHVRESEVKA  167

Query  1590  SVKQLYGSV--TKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             S+K L+ +   + + +V V+M+ WI  + L+I+ +I+A KRY         +QD+   ++
Sbjct  168   SIKGLFENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYT--------SQDSSDFQE  219

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDL  1240
                +   L G+F  +DA PF    WLD+ G  + MKK +   D V QGW+DEH  +RG  
Sbjct  220   HATNFFDLCGKFVVSDALPF--LRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKSKRGSS  277

Query  1239  PAGEDPDFFDIMMKVVD---QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                 D DF  +M+ + D   ++   G +   DT+IKA  ++++  A++TT   + W +A+
Sbjct  278   EVKGDEDFMYVMLSLFDDKAKQLPDGDD--TDTVIKAICLSLILAASDTTAVTLTWAIAL  335

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++DV+K+ Q E+D +VG  R V++SD  NL YLQ ++KE +RLYP  PL  P ESI+
Sbjct  336   LLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHESIE  395

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWITFG  712
             DC + GYH+P GTQL VN WK+ RDP +W EP KF PERFL +     L  Q F +I FG
Sbjct  396   DCTIRGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKGQNFEFIPFG  455

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++A ++   ILA LL GFDFATPS  PVDM E   +T  KA P++ LLTPR
Sbjct  456   SGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPR  515

Query  531   LPAASYN  511
             L A+ Y+
Sbjct  516   LSASLYD  522



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   400 bits (1027),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 300/484 (62%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  G    +++G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + VK LY    KN   E   VD++ W+  + LN++ +++A KRY      E   D ++A 
Sbjct  157   MGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGTGSETSEDTEEAR  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               + A      L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H ++
Sbjct  217   QCKIAISKFFHLIGIFTVSDAFP--ALRWFDLQGHEKEMKQTGSELDVILEKWIENHRQQ  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               +   +  D DF D+M+ + +Q  ++   Y  +T IK+T +A++   ++TT S + W +
Sbjct  275   RKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K+ Q+EID  VGR+R V+DSD  NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAGY++  GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVTGEAKEFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDMSE PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATPLEVLM  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>ref|XP_010028533.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW55288.1| hypothetical protein EUGRSUZ_I01215 [Eucalyptus grandis]
Length=524

 Score =   400 bits (1027),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 298/485 (61%), Gaps = 11/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+ GHL        L + LA MA++ GP F IR+G+ ++LVVS+ E  K+ FT+ND+
Sbjct  44    GAWPLFGHLHLLGPNKLLHRILAAMANQYGPAFSIRLGIHQVLVVSNWEVAKECFTSNDR  103

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
                 RP   +   +GY++A   F   G +WR +RK+ VVELLS  +L+  KH+  +E NL
Sbjct  104   VFPTRPRSLSVKLMGYDHAMFGFAPYGPYWRGMRKLAVVELLSNHRLDLLKHVRDAETNL  163

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              VK LY     N E  V V+ME+  G+V +NI  +++A KRY    E   D +++   R+
Sbjct  164   FVKGLYEKWLSNGENPVTVEMEKNFGHVAMNITVRMVAGKRYLSGNE--GDEEESSRCRK  221

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             A  D   L GEF  +DA PF    WLD + G +  MK+ +   D VL  W++EH +R  +
Sbjct  222   ALGDFFHLVGEFMVSDAIPF--LGWLDVLRGRVAEMKRTAKELDWVLGRWVEEHRKRRAV  279

Query  1239  PAGED--PDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                ED   DF   M+   + E         DTI+KAT ++++    +TTV  + W +++L
Sbjct  280   AKVEDDEQDFIHFMLSATELEEGKYSVQEADTIVKATCLSVILGGNDTTVLTLTWALSLL  339

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+   ++R Q+E+D +VG+ R V++SD  NL YLQAVVKE +RLYPV+PL   RE+++D
Sbjct  340   LNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVVKETLRLYPVLPLSVQREAMED  399

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGF  709
             C VAG+H+P GT+L VN+WKL RDP++W    +F+PERFLT+ V  D   + F +I FG 
Sbjct  400   CIVAGFHVPAGTRLMVNLWKLQRDPRVWSRASEFQPERFLTDHVHVDVRGQSFEYIPFGT  459

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRR CP  ++ L++   ILARLL  F     SG  VDMSE PG+TMP+A P++A+LTPRL
Sbjct  460   GRRMCPGVSFGLQVVQLILARLLHAFKLERVSGAEVDMSESPGLTMPRATPLEAVLTPRL  519

Query  528   PAASY  514
             PA  Y
Sbjct  520   PATCY  524



>gb|KDP38422.1| hypothetical protein JCGZ_04347 [Jatropha curcas]
Length=523

 Score =   400 bits (1027),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 207/487 (43%), Positives = 302/487 (62%), Gaps = 15/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             GGLP++GHL        L+ + L TM DK GPVF IR+G  R LVV+S+E+ K+ FT ND
Sbjct  43    GGLPVIGHLHLLGGADKLLHQTLGTMVDKYGPVFNIRIGSRRALVVASVESAKECFTLND  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K LA RP   A  ++ YN+A   F      WR++RK+V++ELLS   LE  K +  +E++
Sbjct  103   KILASRPTTAATKHMCYNHAVFGFAPFSPHWREMRKIVMLELLSNRSLEMIKQVQHTELD  162

Query  1593  LSVKQLYGSVTKNREVEV--DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             L +++LYG   KN  + +  ++  W   + LN++ +++A K+Y  S    +++ ++   R
Sbjct  163   LGIRKLYGLWAKNSCLPLLFELNRWFDDLTLNVIVRVVAGKQYAGS----SNDDESKRCR  218

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +A  +   L G F ++DA PF    WLD++G ++AMKK ++  D +L GW+++H +R   
Sbjct  219   KAISEFYHLMGIFVASDALPF--LWWLDLKGHVKAMKKTAEDLDVILSGWLNKHRQRRIS  276

Query  1239  PAGE---DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
               GE   + DF D+M+ + ++  ++G  Y  DT IK+T +A++  A +T  + + W M++
Sbjct  277   VPGEVKSEKDFIDMMLSLEEKGRMSGFQYDADTSIKSTCLALIAGAGDTITTTLTWAMSL  336

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ QEE+D  VG ER V +SD  NLVYLQA+VKE +RLYPV PL  PRE ++
Sbjct  337   LLNNQPSLKKAQEELDLHVGIERQVVESDIKNLVYLQAIVKETLRLYPVAPL-IPREFME  395

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC +AGY +P GT+L VN+ K+ RDPK W  P  F+PERFL      D     F  I FG
Sbjct  396   DCSIAGYRVPAGTRLLVNVGKIQRDPKFWTNPLAFQPERFLENHTNIDVRGHHFELIPFG  455

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP +++AL   H  LARLL  FD  T    PVDM+E PG   PKA P++ LL+PR
Sbjct  456   SGRRSCPGASFALHTLHLTLARLLHMFDLRTSMDKPVDMTETPGTHTPKATPLEVLLSPR  515

Query  531   LPAASYN  511
             LP   Y 
Sbjct  516   LPEKLYT  522



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   400 bits (1027),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 299/486 (62%), Gaps = 18/486 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +    + L  MADK GP+F ++MGL R LVVS+ E  K+ FT NDK
Sbjct  48    GAWPVIGHLHLLGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNWEIAKECFTINDK  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN  A+A +  G +WR+ RKM  +ELLS  +L+K KH+  SE+  
Sbjct  108   PFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKLKHVRESEVKA  167

Query  1590  SVKQLYGSV--TKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             S+K L+ +   + + +V V+M+ WI  + L+I+ +I+A KRY         +QD+   ++
Sbjct  168   SIKGLFENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYT--------SQDSSDFQE  219

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDL  1240
                D   L G+F  +DA PF    WLD+ G  + MKK +   D V QGW+DEH  +RG  
Sbjct  220   HATDFFDLFGKFVVSDALPF--LRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKSKRGSS  277

Query  1239  PAGEDPDFFDIMMKVVDQEF--IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                 D DF  +M+ + D +   + G + T DT+IKA  ++++  A++TT   + W +A+L
Sbjct  278   EVKGDEDFMYVMLSLFDDKTKQLPGGDDT-DTVIKAICLSLILAASDTTAVTLTWAIALL  336

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN++DV+++ Q E+D  VG  R V++SD  NL +LQ V+KE +RLYP  PL  P ESI+D
Sbjct  337   LNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAPLLLPHESIED  396

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ-FGWITFGF  709
             C ++GYH+P GTQL VN WK+ RDP +W EP KF PERFLT+     L  Q F +I FG 
Sbjct  397   CTISGYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKGQNFEFIPFGS  456

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRR CP  ++A ++   ILA LL GFDFATPS   VDM E   +T  KA P++ LLTPRL
Sbjct  457   GRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKATPLEVLLTPRL  516

Query  528   PAASYN  511
              A+ Y+
Sbjct  517   SASLYD  522



>ref|XP_010248151.1| PREDICTED: cytochrome P450 82C4-like, partial [Nelumbo nucifera]
Length=464

 Score =   397 bits (1020),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 293/469 (62%), Gaps = 22/469 (5%)
 Frame = -2

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP FI+R+G+ R+LVV+S E  K+ FT NDKA + RP+  A   LGYN A   F 
Sbjct  1     MADKHGPAFIVRLGVHRLLVVNSWEVAKECFTINDKAFSNRPSTVAIRLLGYNRAMFGFA  60

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY----------GSVTKNR-  1552
               G++WR++RK+  ++LLS  +LE  KHI  SE+++S++ LY           S+ + R 
Sbjct  61    PYGSYWREIRKIATLQLLSNNRLEMLKHIQASEIDMSIRHLYELWVNKTTATASLDQGRP  120

Query  1551  -EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSS  1375
              +V V+M++W G + LNI+++++A KR     + G    DA+  ++A +D   L G F  
Sbjct  121   NQVLVEMKQWFGNLTLNIITRMVAGKRVAGVTDEG---DDALRCQKAIRDFFHLMGLFIL  177

Query  1374  ADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-GDLPAGEDPDFFDIMMK  1198
              DA PF    WLD++G  RAM++ +   D  L+ W+ EH  R     A ++ DF DIM+ 
Sbjct  178   PDAIPF--LGWLDLQGYKRAMRRTAKELDCFLEVWLQEHKHRILSSDAIDEKDFMDIMLS  235

Query  1197  VVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDT  1018
             +++   +   N    TIIK+T + ++    +TT   + W +++LLN++  MK+ QEE+D 
Sbjct  236   ILEDSKLPDHNL--GTIIKSTCLNLILGGNDTTAVTLTWCISLLLNNRHAMKKAQEELDI  293

Query  1017  KVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYV  838
             +VGRER V++SD +NL YLQA++K   RLYP  PL  P+ + +DC VAG+++P GT+L  
Sbjct  294   QVGRERIVEESDIENLKYLQAIIKXTFRLYPAAPLSAPQITTEDCTVAGFYVPSGTRLVT  353

Query  837   NIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAH  661
             NIWK+ RDP +W +P  F PERFLT     D   + F  ITFG GRRSCP    AL++ +
Sbjct  354   NIWKIQRDPAVWMDPSNFNPERFLTRHTNLDVWGQHFELITFGLGRRSCPGINLALRVVN  413

Query  660   FILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
               L RLLQGF+FATPS  PVDM+E  G+T  KA P++ LLTPR P+  Y
Sbjct  414   LTLXRLLQGFEFATPSDAPVDMTEKAGLTNLKATPLQILLTPRFPSKFY  462



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 300/484 (62%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     K+  L + L  MAD  GP   +R+G     VVSS E  KD FTTND
Sbjct  37    GAWPIIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDCFTTND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    +FWR++RK+  VELLS  +L+  KH+ +SE+ 
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRVSEIA  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAVV  1426
             + V+ LY    K   +  V VD++ W+  + LN++ +++A KRY         D  +A  
Sbjct  157   MGVQDLYSLWVKKGGSEPVMVDLKTWLEDMTLNMIVRMVAGKRYFGCGSVSSEDTDEARQ  216

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRR  1249
              ++A      L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H  +R
Sbjct  217   CKKAIAKFFHLIGIFTVSDAFP--TLTWFDLQGHEKKMKRTGSELDVILERWIENHKQQR  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
              D    E  D DF D+M+ + +Q  ++   Y  DT IK+T +A++   ++TT S + W +
Sbjct  275   NDSGTKENNDSDFIDVMLSLAEQGKLSHLQYDADTSIKSTCLALILGGSDTTASTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K+ Q+EID +VG +R V+DSD +NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             +++C VAGY++ +G +L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  I
Sbjct  395   LENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGKNFELI  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ AL++ H  LAR L  F+  T   +PVDMSE PG+T+PKA P + L+
Sbjct  455   PFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSESPGLTIPKATPFEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 297/484 (61%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  G    +++G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + VK LY    KN   E   VD++ W+  + LN++ +++A KRY      E   D ++A 
Sbjct  157   MGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGAGSESSEDTEEAS  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A      L G F+ +DAFP     W D++G  + MK+     D +L+ WI+ H + 
Sbjct  217   QCKRAISKFFHLIGIFTVSDAFP--ALRWFDLQGHEKEMKQTGSELDVILERWIENHRQE  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               +   +  D DF D+M+ +  Q  ++   Y   T IK+T +A++   ++TT S + W +
Sbjct  275   RKVSGTKENDSDFIDVMLSLAKQGKLSHLQYDATTSIKSTCLALILGGSDTTASTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K  Q+EID  VGR+R V+DSD  NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAGY++  GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYVEPNEFRPERFITGEAKEFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDMSE PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATPLEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 307/490 (63%), Gaps = 25/490 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL Q   + H+ + LA MADK GPVF IR+G+  +LVV++ E+VK+ FTTNDK
Sbjct  42    GAWPVIGHLLQMNPKIHVAETLAAMADKNGPVFSIRLGMLPVLVVNNWESVKECFTTNDK  101

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP      YL Y+ AA      G +WR VRKMV+ ELLST +LEK K + ISE+  
Sbjct  102   TFASRPPSSFAKYLCYDYAAFGIAPYGPYWRDVRKMVLRELLSTQRLEKLKQVRISEVQT  161

Query  1590  SVKQLYGSVTK-NRE-------VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQD  1435
             S+K+++ ++++ N+          VD+ +    + LNI+ + +A  RY  S       +D
Sbjct  162   SIKEIFLNISEVNKHGNEIKAPARVDLGDVFEKLTLNIVLRKIAGGRYTDS--DVGKERD  219

Query  1434  AVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
             A   R+  K+          +D  PFR   WLD +G I++MK+++   D  +Q W+DEH 
Sbjct  220   AE-FRRVLKEFEAFARILVVSDIIPFRFLKWLDPQGNIKSMKRLAKELDKYMQIWVDEHK  278

Query  1254  --RRGDLPAGEDP-DFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
               R  +   G+D  DF D+++  +  E I G  ++++ +IK+T + ++     TT   + 
Sbjct  279   EGRMKNSGDGDDELDFIDVLLSTIKDESICG--FSKEVVIKSTILVLIVAGTSTTSRALS  336

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W++++LLNH+ V+++ QEEID+ VG+ERWV++SD  NLVYLQA+VKE MRL+P  P+  P
Sbjct  337   WVISLLLNHRHVLQKAQEEIDSFVGKERWVEESDIKNLVYLQAIVKETMRLHPPAPVPMP  396

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT----ESVPDGLAR  736
             R++ +DC VAGY IPKGTQLYVN+WK+ RDP+IWPEPEKF PERFL+     +  D  ++
Sbjct  397   RQADEDCNVAGYFIPKGTQLYVNVWKIQRDPRIWPEPEKFFPERFLSGDHAGAQLDFSSQ  456

Query  735   QFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKP  556
              F    FG GRR CP  ++AL++ H  LARLLQ FD +  S +PVD +   G    KA P
Sbjct  457   NFELNPFGNGRRICPGMSFALQVMHLTLARLLQAFDISRVSDLPVDTAGYEG----KAPP  512

Query  555   VKALLTPRLP  526
             ++AL+ PRLP
Sbjct  513   LEALMMPRLP  522



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   399 bits (1024),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 202/484 (42%), Positives = 301/484 (62%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  G    +++G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + V  LY    K   +  V VD++ W+  + LN++ +++A KRY      E   D ++A 
Sbjct  157   MGVNYLYSLWVKKGGSEPVMVDLKSWLDDMTLNMVVRMVAGKRYFGGAGSESSKDTEEAR  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH--V  1255
               ++A      L G F+ +DAFP     W D++G  + MK+     D +L+ W++ H   
Sbjct  217   QCKKAIAKFFHLIGIFTVSDAFP--TLGWFDLQGHEKEMKQTGIELDVILERWVENHRQQ  274

Query  1254  RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
             R+   P   D DF D+M+ + +Q  ++   Y  +  IK+T +A++   +ETT S + W +
Sbjct  275   RKVSGPKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K+ Q+EID  VG ER V+DSD +NLVY+QA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKKAQDEIDLHVGTERNVEDSDIENLVYVQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAG+++ +GT+L VN+WK+ RDP+++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCTVAGHNVSRGTRLIVNVWKIQRDPRVYMEPNEFRPERFVTGEAKKFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR+LQ FD  T S M VDMSE PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARILQSFDVKTVSDMAVDMSESPGLTIPKATPLEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>ref|XP_010069622.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Eucalyptus 
grandis]
Length=478

 Score =   397 bits (1019),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 203/474 (43%), Positives = 300/474 (63%), Gaps = 22/474 (5%)
 Frame = -2

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP+F IR+G+    ++SS EAV+  FTT+DK LA RP    G++ GY  A   F 
Sbjct  1     MADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFA  60

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKN-------REVEV  1540
               G  WR++RK+ ++ELLST +L+  KH+  SE++  VK L+     N           V
Sbjct  61    EYGDLWREMRKITMLELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVV  120

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGA---DNQDAVVLRQAFKDVMTLTGEFSS  1375
              + + +  + LNI+ +++A KRY    S   G+   D+++A  LR+  K+ M ++G  + 
Sbjct  121   VISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTDDDEEASHLRKVIKEFMYISGFPTV  180

Query  1374  ADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV------RRGDLPAGEDPDFF  1213
             ++  PF    W D  G ++ MK+V+   D ++  W++EH       +RG++      DF 
Sbjct  181   SELVPFT--GWTDCVGTVKTMKRVAREMDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFI  238

Query  1212  DIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQ  1033
             D+M+ V+ ++ +A   ++ +T+IKAT + ++   ++TT  N+ W++++LLNHK V+KR Q
Sbjct  239   DVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQ  298

Query  1032  EEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKG  853
             EEID KVG+++WV DSD  +L YLQA+VKE +RLYP  PL  P E+  DC V GY IPKG
Sbjct  299   EEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKG  358

Query  852   TQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYA  676
             T+++VN+WKLHRDP++W +PEKF PERFLT  S  D   + F +I FG GRR CP +A+A
Sbjct  359   TRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFA  418

Query  675   LKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             L+  H  LARLLQGFD A  S   VDM+EG G+ +PKA P++ +L PRLP+  Y
Sbjct  419   LRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  472



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   398 bits (1023),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 225/524 (43%), Positives = 316/524 (60%), Gaps = 23/524 (4%)
 Frame = -2

Query  2037  ISGVLIILPFLYLS----LRkqknktkkpppepPGGLPILGHLFQF--KKETHLVKALAT  1876
             ++GV   L F YL     + +  +  K+  PE  G  P LGHL      K  H+V  L  
Sbjct  12    MAGVFAFLIFCYLLFTRLINRTGSGMKRKAPEVSGARPFLGHLHLLGGSKPAHVV--LGD  69

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             +AD  GP+F IR+G+   LVVS+ E  K+ FTTNDKA A RP   A   LGYN A   F+
Sbjct  70    LADTNGPIFTIRLGMHPTLVVSNWEIAKECFTTNDKAFANRPRTIAAELLGYNYAMFGFS  129

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG------SVTKNREVEVD  1537
               G +WR++RK+  +E+LS  +LEK KHI  SE+  S+K+LY       S + + +V V+
Sbjct  130   PYGPYWRQIRKIATLEVLSNHRLEKLKHIRESEVRTSIKELYELGVEGVSNSSSGKVLVE  189

Query  1536  MEEWIGYVNLNIMSKIMAKKRYNYS-VEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFP  1360
             M+ W   +N+N++ K++  KRY+ +   HG D  D    R+A +D   LTG F+  D+ P
Sbjct  190   MKRWFWTLNINMVFKMVVGKRYSEAETSHGKDENDGH--RKALRDFFELTGTFTVGDSLP  247

Query  1359  FRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKVVDQE  1183
             F    WLD+ G  +AMKK +   D +L+ W++EH  +R    A  + DF  +M+ +++ +
Sbjct  248   F--LRWLDLGGHEKAMKKTAKELDHILEEWLEEHKQKRNSGNAESEHDFMGMMLSLLN-D  304

Query  1182  FIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRE  1003
                  +Y  DTIIKAT +A++    +TT   + W +++LLNH DV+++ Q E+DT VGRE
Sbjct  305   AAELPSYNADTIIKATCLAIILGGTDTTTVTITWALSLLLNHHDVLEKAQHELDTYVGRE  364

Query  1002  RWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKL  823
             R V +SD  NLVYLQA++KE  RLYP  PL    ES++DC  AGY IP GT+L VN+ KL
Sbjct  365   RPVQESDVKNLVYLQAIIKETTRLYPAAPLSVMHESVEDCTTAGYFIPAGTRLLVNLSKL  424

Query  822   HRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILAR  646
              RDPK W  P++F+PERFLT     D   + +  + FG GRR CP  ++AL++  F LA 
Sbjct  425   QRDPKAWSNPDEFRPERFLTTHKHFDVRGQNYELVPFGSGRRVCPGISFALQVLQFSLAS  484

Query  645   LLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LLQ F+  TPS  PVDM EG G+T  KA P++ +LTPRLP   Y
Sbjct  485   LLQAFEITTPSDEPVDMGEGAGLTNLKATPLEVILTPRLPPHLY  528



>emb|CAN65652.1| hypothetical protein VITISV_016780 [Vitis vinifera]
Length=473

 Score =   396 bits (1018),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 281/480 (59%), Gaps = 51/480 (11%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL     +  + + L  MADK+GPVF+IR+G+ R LVVS+ EA K+ FTTNDK
Sbjct  43    GAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDK  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPN  A   LGYN AA AF   G +WR++RK  ++E+LST +L             
Sbjct  103   IFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKXSMLEILSTRRL-------------  149

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
                                           + +++A KRY  +V HG +   + +   A 
Sbjct  150   ------------------------------VLRMVAGKRYFNNVVHGGEEARSAI--AAI  177

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG  1231
             K ++ L G   ++D  PF    W+D++G + +MK V+   D++++ W+ EH  R +  A 
Sbjct  178   KKLLLLVGASVASDVIPF--LEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEAS  235

Query  1230  EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKD  1051
                DF DIM+  +  + + G  Y+R+TIIKAT + M+   ++TT     W+++ LLN+K 
Sbjct  236   SSQDFIDIMLTKLKDDSLFG--YSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKH  293

Query  1050  VMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAG  871
             VMK  QEE+D KVGR+RWV+ SD  NLVY++A+VKE +RLY   PL  P E+++DC V G
Sbjct  294   VMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGG  353

Query  870   YHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSC  694
             YHI KGT+L VN WKLHRDP +W  PE+F+PERFLT     D   + F  I FG GRRSC
Sbjct  354   YHISKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSC  413

Query  693   PASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             P     L+M H  +ARLLQGFD   PS  PVDM+EG  V + K  P++ +LTPRLPA  Y
Sbjct  414   PGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLPAELY  473



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   397 bits (1021),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 216/524 (41%), Positives = 328/524 (63%), Gaps = 19/524 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYL-SLRkqknktkkpppepPGGLPILGHLFQFKKETHLVK  1888
             MD    + +I+ +L+   FLY+ S +  KN  K   PEP G LP++GHL     +  + K
Sbjct  1     MDLYTYIPSIASLLL---FLYIFSRKAPKNSKKNCIPEPTGSLPLIGHLHLLGGKEPICK  57

Query  1887  ALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAA  1708
              LATMADK GP++ +++G  RILVVSS E  KD FT ND+ LA R NI AG Y+GY+NA 
Sbjct  58    NLATMADKHGPLYSLKLGTHRILVVSSWEIAKDCFTNNDRTLATRANIVAGRYMGYDNAI  117

Query  1707  LAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDME  1531
              +    G +WR +RKM  VELLS+ +LEK KHI  SEM+  +K+LYG +++N + +V + 
Sbjct  118   FSLAPYGEYWRNIRKMATVELLSSHRLEKLKHIRFSEMDSFIKELYG-LSRNGD-KVTIS  175

Query  1530  EWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRI  1351
             E +  +  NI  +++  KR++ + ++G  + +     +A K  + L G F   DA     
Sbjct  176   EALERLTFNINLRMLFGKRFSGN-DYGEVDSEPWRFMKAIKRALYLFGIFVLPDAL----  230

Query  1350  FHWL---DMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG-EDPDFFDIMMKVVDQE  1183
               WL   D++G +R+MK+ +   D+++  W++EH+++     G  + DF D+M+  + ++
Sbjct  231   -QWLERFDIQGHVRSMKENAKELDSIINVWLEEHLKKKRENQGASESDFMDVMLTHLRED  289

Query  1182  FIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRE  1003
              +    +TRDTI+KAT + +     E+T   + W++++LLNH +V+   QEEID  VG++
Sbjct  290   TVI-SGHTRDTIVKATTLVLSLTGGESTSVTITWVLSLLLNHPNVLITAQEEIDHHVGKQ  348

Query  1002  RWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKL  823
             RWV++SD  NL YLQA+VKE +RLYP  P+   RE++QDC +AGY +PKGT+L VNIWKL
Sbjct  349   RWVEESDIKNLKYLQAIVKETLRLYPPGPITGIREAMQDCCIAGYDVPKGTRLIVNIWKL  408

Query  822   HRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILAR  646
             HRDP++W    +F PERF+T  V  D   + F ++ F  GRRSCP   + L++ H  +++
Sbjct  409   HRDPRVWENANEFHPERFMTTHVDFDVKGQNFEYMPFSSGRRSCPGMTFGLQVVHLTVSK  468

Query  645   LLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             L+QGFD     G  VDM EG G+ +PK  P++ +L+PRL    Y
Sbjct  469   LIQGFDIRVAEGTAVDMEEGLGLALPKLNPLEVVLSPRLGTEFY  512



>ref|XP_010934114.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=527

 Score =   397 bits (1021),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 299/485 (62%), Gaps = 8/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+LGHL       ++ +AL  +AD  GPVF +R+G    LVV + EA K+ FT +DK
Sbjct  45    GAWPVLGHLPLLGSHNNIGRALKALADASGPVFSLRLGASPALVVGTREAAKECFTVHDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             ALAGRP   A   + YNNA + F++ G +WR+VRK++ +ELLS  +L    H+  SE++ 
Sbjct  105   ALAGRPRSTASKLMCYNNAMVGFSSYGPYWREVRKILTIELLSHARLGSLAHVRASEVDA  164

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKR-YNYSVEHGADNQDAVVLR  1420
               K LYG   +  E    V++ +W   +  N++ K++A KR + Y       + ++    
Sbjct  165   FAKTLYGLCRRGDEGPARVEISKWFQELTFNVVVKMVAGKRCFVYGAVDDGGSSESRRFI  224

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGD  1243
              A + +M L   F  +D  PF    W+D  G  +AMK+ +   D ++ GW+ EH  RR +
Sbjct  225   GAIQRMMELLRAFVISDVVPF--LKWMDFGGYEKAMKRNAAVMDCIIGGWLREHRERRME  282

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
                    DF D+M+ ++++E     ++  DT+IKA ++A++    +TT   M W +A++L
Sbjct  283   GRGDGKQDFMDVMLAIMEKEGELLSDHDPDTVIKANSLALIIGGTDTTSVTMTWALALML  342

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             NH  V+++ QEE++  VGR R V++SD + LVYLQA+VKE +RLYP  P+  P ++++DC
Sbjct  343   NHPHVLRKAQEELEAHVGRARNVNESDVEKLVYLQAIVKETLRLYPPGPILLPHQAMEDC  402

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGL-ARQFGWITFGFG  706
             +VAG+ +P GTQ+ VN W + RDP++WPEP  F+PERFLT     G+  RQ   + FG G
Sbjct  403   QVAGFDVPAGTQVLVNAWAIQRDPQVWPEPSAFRPERFLTSHGDVGVRGRQLELLPFGSG  462

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR+CP +++AL++ H  LAR++ GFD  TP+G PVDM+EG G T+PKA P++ L+TPRL 
Sbjct  463   RRACPGASFALQVVHLTLARIIHGFDLETPTGEPVDMTEGKGATLPKATPLEVLVTPRLA  522

Query  525   AASYN  511
                Y 
Sbjct  523   PVLYQ  527



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   397 bits (1020),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 205/487 (42%), Positives = 299/487 (61%), Gaps = 20/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL   +      +    MADK GP+FIIRMG    L+VS+ E  K+  TT+DK
Sbjct  50    GAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECLTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN +   F+  G++WR+ RK+  + LLS  +LEK KH+   E+  
Sbjct  110   VFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVREYEVKT  169

Query  1590  SVKQLYGSVTKNREVE----VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +K+LY    KN+       V+M++W G    N++ +++  K        G ++ D+   
Sbjct  170   CLKELYELWHKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGK--------GCNSVDSEEW  221

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++       ++G+F  +DA PF    WLD+ G  R+MKK++   D V QGW++EH R+ D
Sbjct  222   KELLTRFFEMSGKFVVSDALPF--MRWLDIGGDERSMKKIAKELDVVAQGWLEEHKRKRD  279

Query  1242  LPA-GEDPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                  ++ DF  +M+ ++ D E   G++   DTI KA  +A++  AA+TT   + W+M++
Sbjct  280   SQEIKKEEDFMYVMLSILGDTEQYLGRDV--DTINKAICLALILGAADTTTVTLTWVMSL  337

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLNH+D++ + Q E+D +VG +R V++SD  NLVYLQA++KE MRLYP  PL  P ESI+
Sbjct  338   LLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHESIE  397

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             +C V GYH+P  TQL++N WK+ RDP +W EP KF+PERFLT     D   + F  + F 
Sbjct  398   ECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKGQNFELLPFS  457

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++  F LA LLQGF+FATPS  PVDM EG G+TM K++P + L+TPR
Sbjct  458   SGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLVTPR  517

Query  531   LPAASYN  511
             L AA Y+
Sbjct  518   LSAAVYS  524



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   397 bits (1020),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 207/484 (43%), Positives = 293/484 (61%), Gaps = 15/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL  F       + L  MA+K GP+F ++MG+ R LVVS+ E  K+ FTTNDK
Sbjct  48    GAWPMIGHLHLFGGPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDK  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             ALA RP   A   LGYN  A   +  G++WR+ RK+  VELLS  +LEK KH+  SE+  
Sbjct  108   ALASRPRRMAMEILGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVRESEVTA  167

Query  1590  SVKQLYGSVTKNR--EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             S+K L+     +   +V V+M+ W+     +I+ +I+  KRY         +Q+   L +
Sbjct  168   SIKGLFKDCQNSATGKVSVEMKHWLEGTTFDIIIRIIEGKRYT--------SQEGTDLHE  219

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDL  1240
                   TL G+F  +DA PF    WLD+ G  + MKK +   D +LQ W+DEH ++RG  
Sbjct  220   HAASFFTLFGKFVVSDALPF--LRWLDIGGNEKLMKKTAKEFDIILQQWLDEHKIKRGSS  277

Query  1239  PAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
                 D DF  +M+ ++        +   DT+IKA  + ++  AA+TT   + W +++LLN
Sbjct  278   EVEGDEDFIYVMLSLLYDNAKQLPDSDADTVIKALCLTVILGAADTTSVTLTWAISLLLN  337

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             ++D +K+ Q+E++  VG  R V++SD  NLVYLQA++KE MRLYP  PL  P +S++DC 
Sbjct  338   NRDALKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAAPLLLPHQSMEDCT  397

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             ++GYH+P GTQL+VN WK+H DPK+W EP KF PERFLT     D   + F  I FG GR
Sbjct  398   ISGYHVPAGTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKDIDLRGQNFELIPFGSGR  457

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             R CP  ++A ++   ILA LL GFD ATP   PVDM E   +T+ +A P+K LLTPRL A
Sbjct  458   RICPGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRATPLKVLLTPRLSA  517

Query  522   ASYN  511
             + Y+
Sbjct  518   SLYD  521



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 203/492 (41%), Positives = 310/492 (63%), Gaps = 21/492 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  P++GHL   +  + +H+V     MADK GP+F I+MG+   LV S+ E  K+ FTTN
Sbjct  43    GAWPLIGHLHLLRGPQPSHIV--FGNMADKYGPIFTIKMGVHPTLVASNWEMAKECFTTN  100

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DKA A RPNI A   LGY  +  AF+  G +WR++RK+  +ELLS  +L+ + H+  SE+
Sbjct  101   DKAFANRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRESEV  160

Query  1596  NLSVKQLYG------SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNY-SVEHGADNQ  1438
               ++K+LY       +   N +V V+M+ W G + LNI+ +I+  K   Y + + G ++ 
Sbjct  161   GTALKELYKLWEKNKTTNSNNKVLVEMKRWFGDITLNIILRIIVGKFIGYETADEGKESN  220

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
             +    +QA +D   L+G F +ADA PF    WLD+ G  + MK  ++  D V+  W++EH
Sbjct  221   EG--WKQALRDFFHLSGRFIAADAVPF--LRWLDIGGHEKTMKHTANKLDIVVTEWLNEH  276

Query  1257  VRR---GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNM  1087
               +   G +  GE+ DF D+++ ++D E  A  +   DTI KAT +A+   A++TT   +
Sbjct  277   KEKKASGCVKKGEE-DFMDLILDIMDDEAEATLSRDSDTINKATCLALTLAASDTTSVTL  335

Query  1086  VWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGF  907
             +W +++L+N+ DV+K+ Q+E+D +VGRER V +SD +NL++L+A+VKE +RLYP  PL  
Sbjct  336   IWALSLLVNNPDVLKKAQDELDVQVGRERQVHESDVNNLIFLKAIVKETLRLYPAGPLSV  395

Query  906   PRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQF  730
             P ES++DC VAGYHIP GT+L  N+ K+HRDP++W  P +++ ERFLT     D   + F
Sbjct  396   PHESMKDCTVAGYHIPAGTRLVTNLSKIHRDPRVWSNPSEYQQERFLTSHQDFDVRGKTF  455

Query  729   GWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVK  550
              +I FG GRR CP  ++AL++ H  LA LL GF+F TP+G P+DM+E  G+T  +A P++
Sbjct  456   EFIPFGSGRRMCPGVSFALQVLHITLATLLHGFNFGTPTGEPLDMTENFGLTNLRATPLE  515

Query  549   ALLTPRLPAASY  514
               + PRL    Y
Sbjct  516   VAINPRLGPHLY  527



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/485 (40%), Positives = 297/485 (61%), Gaps = 8/485 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+LGHL       ++ ++L  +AD +GPVF +R+G    LVVS+ EA K+ FT NDK
Sbjct  45    GAWPVLGHLHLLGSHNNIGRSLKAVADAVGPVFALRLGAHPALVVSTWEAAKECFTANDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             ALAGRP   A   + YNNA + F+  G++WR+VR+++ +ELLS  +L    H+  SE+  
Sbjct  105   ALAGRPPSTASKLMCYNNAMVGFSPYGSYWRQVRRILTLELLSHARLASLAHVRASEVGA  164

Query  1590  SVKQLYGSVTK--NREVEVDMEEWIGYVNLNIMSKIMAKKR-YNYSVEHGADNQDAVVLR  1420
               K L+G   K       V+M +W   +  N++ +++A KR +         +++A    
Sbjct  165   FAKSLFGVCRKVEGGAARVEMNKWFQELTFNVVVRMVAGKRCFGCGAVDDGGSREARRFT  224

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
              A   +M L G F  +D  PF    W+D+ G  RAM++ +   D ++ GW+ EH  R   
Sbjct  225   GAMHRMMELLGAFVVSDVVPF--LRWMDLGGYERAMRRTAAEMDGIIGGWLREHRERRSE  282

Query  1239  PAGE-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
               GE   DF D+M+  +++E     ++  DT+IKA ++A++    +TT   M W++A+LL
Sbjct  283   GRGEGKEDFMDVMLSTIEKEGELFSDHDPDTVIKANSLALIIGGTDTTSVTMTWVLALLL  342

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             NH +V+++ +EE+D++VG+ER VD+SD + LVYLQA+VKE +RLYP  P+  P +++++C
Sbjct  343   NHPNVLRKAREELDSRVGKERNVDESDVEKLVYLQAIVKETLRLYPPGPVLIPHQAMEEC  402

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             +V G+ +P GT++ VN W +  DP++WP+P  F+PERFLT     D   R F  + FG G
Sbjct  403   QVRGFDVPAGTRVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRGRHFELLPFGSG  462

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR+CP +++AL++ H  LAR++ GF   TP G PVDM+EG G T+PKA P+  L+ PRL 
Sbjct  463   RRACPGASFALQVLHLTLARVIHGFHMRTPGGGPVDMTEGKGATLPKATPLHVLVAPRLS  522

Query  525   AASYN  511
                Y 
Sbjct  523   PELYQ  527



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/491 (43%), Positives = 303/491 (62%), Gaps = 17/491 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          K L +MA+K GP+F I+MG+ R LVVS+ E  K+ FTT+DK
Sbjct  50    GAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A +GRP   A   L Y+ A + F+  G +WR+VRK+  VELLS  +LEK K +  SE+  
Sbjct  110   AFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRA  169

Query  1590  SVKQLY---------GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
              +K+LY          S +K+  V V+M+ W G + LNI+ + +  K   Y + +  D +
Sbjct  170   FLKELYKLWDENRCSASKSKSSLVLVEMKRWFGDLTLNIVLRTIVGKTVGY-ISNVEDEE  228

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
                  ++  KD    TG FS +DA PF  F  LD+ G   AMKK +   D V++ W+ EH
Sbjct  229   SVEGWKKGLKDFFHWTGVFSVSDALPFLRF--LDLGGHGEAMKKTAKELDLVVEDWLQEH  286

Query  1257  VRR--GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              R+    +  G++ DF D+M+ V D +  A Q    DT IKAT++A++  A+ TT   ++
Sbjct  287   KRKRAAGIVKGKE-DFMDLMLDVFDNDAEAVQGGDSDTTIKATSLALILAASNTTAVTLI  345

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++L+N+ +V+K+ Q E+DT VG+ER V++SD  NLVYL+AV+KE +RLYP  PL  P
Sbjct  346   WALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLVP  405

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
              E+I+DC + GYH+P+GT+L +N+ K+HRD ++W  P +F PERFLT     D   + F 
Sbjct  406   HEAIEDCTIDGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFE  465

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
             +  FG GRR CP  ++AL +    LA LL GFDFATPSG PVDM E  G+T  +A P++ 
Sbjct  466   FFPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEV  525

Query  546   LLTPRLPAASY  514
             LL+PRLP+  Y
Sbjct  526   LLSPRLPSRLY  536



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 303/492 (62%), Gaps = 20/492 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI GHL      T     LA MADK GP+F IR+G+   LV+SS E  K+ FTTND 
Sbjct  41    GAWPIFGHLPLLGGSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDL  100

Query  1767  ALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              L  RP +    ++GYN A   F  +G FWR++RK+  +ELLS  +LE  +HI +SE+  
Sbjct  101   VLNSRPKLAVVDHIGYNCAMFGFAPSGPFWREMRKITTLELLSNRRLELLRHIRVSEVTT  160

Query  1590  SVKQLYG--SVTKNRE------VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQD  1435
              +++L+   S  + RE      V V++++W G + LN++ +++A KRY+ + +   +  +
Sbjct  161   FLQELFKTWSTAEKRESNNSDGVLVELKQWFGDMTLNVILRMVAGKRYSVAADED-EKTE  219

Query  1434  AVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
             A  ++ A K+     G F   DA P+    WLD+ G  +AMK+++   DA++ GW++EH 
Sbjct  220   ARRVQSALKEFFYYVGLFVVGDAVPY--LRWLDLGGHEKAMKRIAKELDAIVGGWVEEHK  277

Query  1254  RR---GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
             RR   GD  A  +PDF D M+ V+D   + G  +  DT+ KAT++ M+   ++TT+  ++
Sbjct  278   RRRARGD--AKGEPDFIDAMLSVLDGADLGG--FDADTVNKATSLNMIAGGSDTTMVTLI  333

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++LLN+  V+K  Q E+DT++GR+R V +SD   LVY+QA+VKE +RLYP  PL  P
Sbjct  334   WAISLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPAAPLSGP  393

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
             RE  +DC + GYH+ KGT+L  N+WK+  DP+IWP+P +FKPERFLT     D     F 
Sbjct  394   REFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHRDVDVKGLHFE  453

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
              I FG GRR+CP  A+AL+M  F LA  +  FD + PS  P+DM+E  G+T  KA P++ 
Sbjct  454   LIPFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPSNSPIDMTESFGLTNIKATPLQV  513

Query  546   LLTPRLPAASYN  511
             L+ PRLP+  Y 
Sbjct  514   LIKPRLPSQLYG  525



>gb|KDP38424.1| hypothetical protein JCGZ_04349 [Jatropha curcas]
Length=526

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 216/532 (41%), Positives = 324/532 (61%), Gaps = 21/532 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppep---PGGLPILGHLFQFKKETHL  1894
             MD  + ++ I G  I L FL  SL  +   T+    +     G  PI+GHL     +  L
Sbjct  1     MDLNLHLIVIVG-FISLIFLCFSLATRVRITRSNCRQAPEPAGAWPIIGHLHLLGGDDQL  59

Query  1893  V-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYN  1717
             + + L  MADK GP + IR+G   + V SS E  ++ FT  D+A A RP+  A  ++ YN
Sbjct  60    LHQKLGMMADKYGPAYSIRLGNRPVFVASSSEVAEECFTIYDRAFASRPSTSATKHMCYN  119

Query  1716  NAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVE-  1543
             +A   F     +WR++RK+VV+ELLS  +LE  K++  SE++  + +LYG   KN  +  
Sbjct  120   DAVFGFAPYSTYWREMRKIVVLELLSNRRLEIVKNVQASEVDKGINKLYGLWAKNTCLPL  179

Query  1542  -VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADA  1366
              V + +W   + LN++  ++A KR+      G+D+ +A   ++   +   L G F  +DA
Sbjct  180   LVKINQWFDDLTLNVIVGMVAGKRF----AGGSDDGEAGWCQKTISEFFHLMGVFVISDA  235

Query  1365  FPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR------RGDLPAGEDPDFFDIM  1204
              PF    WLD++G  +AMK  +   DA+L+GW+DEH R       G+  A  + DF D+M
Sbjct  236   VPF--LWWLDLQGHEKAMKNTAKYFDAILEGWVDEHRRTRAASGSGEFKAEGEQDFIDVM  293

Query  1203  MKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEI  1024
             + + ++  ++   Y  +TIIK+T +A++  AA+TT + + W +++L+NH+  +K+ Q+E+
Sbjct  294   LTLEEEGQLSNFPYDSNTIIKSTILAVIAAAADTTATMLTWAISLLMNHRWALKKAQQEL  353

Query  1023  DTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQL  844
             D  VG ER VD SD   L++LQA+VKE +R+YPV PL  PRE+++DC +AGYH+  GT+L
Sbjct  354   DFHVGVERQVDGSDLKKLIFLQAIVKETLRVYPVAPLSGPREALEDCTIAGYHVKAGTRL  413

Query  843   YVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKM  667
              VN+WK+ RDPK+W  P  F+PERFLT  V  D   + F  + FG GRR+CP +++AL  
Sbjct  414   LVNVWKIQRDPKLWTNPLSFQPERFLTSHVNVDVRGQNFELLPFGSGRRACPGTSFALHA  473

Query  666   AHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASYN  511
              HF LARLL  FD ATP   PVDM+EG G+T+PKA PV+ LL+PRLP   Y+
Sbjct  474   LHFTLARLLHSFDLATPMDQPVDMTEGTGITLPKANPVEVLLSPRLPGKLYS  525



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/483 (41%), Positives = 312/483 (65%), Gaps = 10/483 (2%)
 Frame = -2

Query  1944  GLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
              LP++GHL     +T L +  A++ADK GP+F I +G    LV+ + EA+K+ FTTNDK 
Sbjct  44    ALPLIGHLHLLGAKTPLARIFASLADKYGPIFQIHLGAYPALVICNQEAIKECFTTNDKV  103

Query  1764  LAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
             LA RP    GV+L YN A   F   G++W K+RK+ ++ELLS  +LE  + ++ SE++  
Sbjct  104   LASRPKSSHGVHLSYNFAGFGFAPYGSYWIKLRKLTMLELLSARRLEFLRPVYESEIDTL  163

Query  1587  VKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFK  1408
             ++ L+  +    +V+V + EW+  +  N+++K++A KRY +S     D+ +A  + +  K
Sbjct  164   IRDLWMYLGGKSDVKVTISEWLERLTFNMITKMIAGKRY-FSYLQDVDDVEAHGIVKLIK  222

Query  1407  DVMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEHVRRGDLP--  1237
             + M ++GEF  +D  P  +  WL + G +++ MK+++   D ++ GW++EH++   L   
Sbjct  223   EFMHISGEFVLSDLIP--LLGWLGVHGTVLKNMKRIAKDLDTLVGGWVEEHMKSDTLTNK  280

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
             + E  DF D+M+ V++ + ++G  +TRDTIIKA  M ++   ++TT + M W +AML+ +
Sbjct  281   SWEKHDFIDVMLSVIEDDSVSG--HTRDTIIKANVMNLMLAGSDTTSTTMTWTLAMLMKN  338

Query  1056  KDVMKRIQEEIDTKVGRERW-VDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
                +KR QEEID +VGRER  V+  D  +L+YLQA+VKE +RLYP  P+  P E+ +DC 
Sbjct  339   PHALKRAQEEIDHQVGRERRRVEARDIKDLIYLQAIVKETLRLYPPGPVLVPHEAREDCN  398

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRR  700
             + GYH+PKGT+++ N+WKLHRDP +W EPEKF PERF++E+        F ++ FG GRR
Sbjct  399   IQGYHVPKGTRVFANVWKLHRDPSLWSEPEKFSPERFISENGELDEVHHFEYLPFGSGRR  458

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             +CP S +A ++    L+RLLQGFD   P   PVD+ EG G+T+PK  P++ +L+PRLP+ 
Sbjct  459   ACPGSTFATQVCLLTLSRLLQGFDLHVPMDEPVDLEEGLGITLPKMNPLQIVLSPRLPSE  518

Query  519   SYN  511
              Y 
Sbjct  519   FYQ  521



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   396 bits (1017),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 219/521 (42%), Positives = 314/521 (60%), Gaps = 20/521 (4%)
 Frame = -2

Query  2040  AISGVLIILP-FLYLSL----RkqknktkkpppepPGGLPILGHLFQFKKETHLVKALAT  1876
             AIS ++I L  FL +S     R  K K  +  PE  G  P++GHL   +      + L  
Sbjct  15    AISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGN  74

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP+F +++G+ + LVVS+ E  K+ FTTNDKA AGRP   A   LGYN   + F 
Sbjct  75    MADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFA  134

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSV----TKNREVEVDME  1531
               G +WR+ RK+  +ELLS  +LEK KH+  SE+  S+++LY +     +  + V V+M 
Sbjct  135   PYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMI  194

Query  1530  EWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRI  1351
              W+    L+I+ +I+A KRY    +   D Q      Q       L+G+F  +DA PF  
Sbjct  195   HWLEGTVLDIILRIIAGKRYTSQSQEVNDWQ------QQITKFTALSGQFVVSDALPF--  246

Query  1350  FHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKVVDQEFIA  1174
               WLD+ G  R M K +   D +LQ W+DEH ++R    A  D DF  +++ ++D     
Sbjct  247   LRWLDIGGYERLMSKTAKYFDIILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQ  306

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
               +   D +IKA  + ++  AA+T+V  + W +A+L+N++DV+K+ Q+E+D +VG ER V
Sbjct  307   LPDRDADAVIKAICVTLIVAAADTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPV  366

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             ++SD  NLVYLQA++KE MRLYP  PL  P E I++C V GYH+P GTQL+VN WK+ RD
Sbjct  367   NESDARNLVYLQAIIKETMRLYPAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRD  426

Query  813   PKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQ  637
             P +W EP +F+PERFLT     D   + F  I FG GRR CPA ++ L++   +LA L+ 
Sbjct  427   PCVWEEPCQFQPERFLTRHKDIDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVH  486

Query  636   GFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             GFDF TPS  PVDM E  G+T+ KA P++ L++PRL A+ Y
Sbjct  487   GFDFTTPSDEPVDMGEAMGLTIAKATPLEVLVSPRLSASLY  527



>emb|CAN64501.1| hypothetical protein VITISV_020341 [Vitis vinifera]
Length=462

 Score =   393 bits (1010),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 215/523 (41%), Positives = 298/523 (57%), Gaps = 67/523 (13%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppep---PGGLPILGHLFQFKKETHL  1894
             MD     +AI+G+++ L   Y   R +    K     P    G  P +GHL     +  +
Sbjct  1     MDLPSHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLHGKVPV  60

Query  1893  VKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLG--Y  1720
              + L  MADK+GPVF+IR+G+ R LVVS+ EA K+ FTTNDK  A RPN+     LG  Y
Sbjct  61    FRTLGAMADKVGPVFVIRLGMYRXLVVSNXEAAKECFTTNDKXFASRPNL---YILGKDY  117

Query  1719  NNAALAFTTGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEV  1540
             N           W   +K+V+                                       
Sbjct  118   N-----------WVNPKKVVI---------------------------------------  127

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFP  1360
                EW  ++N N++ +++A KRY  +V HG +   +       K ++ L G F ++D  P
Sbjct  128   --SEWFEHLNFNVVLRMVAGKRYFNNVVHGGEEAGSAT--AVIKKLVPLAGAFVASDVIP  183

Query  1359  FRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMMKVVDQEF  1180
             F    W+D++G + +MK+V+   D+VL+ W++EH  R +  A    DF DIM+  +    
Sbjct  184   F--LEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNSEASSRQDFIDIMLTKLKDAS  241

Query  1179  IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRER  1000
             + G  Y+R+TIIKAT M ++   ++TT     W+++ LLN++ VMK  QEE+D KVGR+R
Sbjct  242   LFG--YSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVMKHAQEELDLKVGRDR  299

Query  999   WVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLH  820
             WV+ SD  NLVYL+A+VKE +RLYP VPL  P E+++DC V GYHIPKGT+L VN WKLH
Sbjct  300   WVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPKGTRLLVNAWKLH  359

Query  819   RDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARL  643
             RDP +W  PE+F+PERFLT  +  D L + F  I FG GRRSCP    AL+M H  +A+L
Sbjct  360   RDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINMALQMLHLTIAQL  419

Query  642   LQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             LQGFD ATPS  PVDM+E   +TMPK  P++ +LTPRLPA  Y
Sbjct  420   LQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLPAELY  462



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   395 bits (1016),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 211/491 (43%), Positives = 304/491 (62%), Gaps = 17/491 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          K L +MA+K GP+F I+MG+ R LVVS+ E  K+ FTT+DK
Sbjct  50    GAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A +GRP   A   L Y+ A L F+  G +WR+VRK+  VELLS  +LEK K +  SE+  
Sbjct  110   AFSGRPRTLASELLTYDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRA  169

Query  1590  SVKQLY-------GSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
              +K+LY       GS +K++   V V+M+ W G + LNI+ + +  K   Y + +  D +
Sbjct  170   FLKELYKLWDENRGSASKSKSNLVLVEMKRWFGDLTLNIVLRTIVGKTVGY-ITNVEDEE  228

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
                  ++  KD    T  FS +DA PF  F  LD+ G   AMKK +   D V++ W+ EH
Sbjct  229   SVEGWKKGLKDFFHWTRVFSVSDALPFLRF--LDLGGHGEAMKKTAKELDLVVEDWLKEH  286

Query  1257  VRR--GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              R+    +  G++ DF D+M+ V D +  A Q    DT IKAT++A++  A++TT   ++
Sbjct  287   KRKRAAGIVKGKE-DFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAASDTTAVTLI  345

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++L+N+ +V+K+ Q E+DT VG+ER V++SD  NLVYL+AV+KE +RLYP  PL  P
Sbjct  346   WALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAAPLSLP  405

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
              E+I+DC + GYH+P+GT+L VN+ K+HRD ++W  P +F PERFLT     D   + F 
Sbjct  406   HEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFE  465

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
             +  FG GRR CP  ++AL +    LA LL GFDFATPSG PVDM E  G+T  +A P++ 
Sbjct  466   FSPFGSGRRMCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEV  525

Query  546   LLTPRLPAASY  514
             LL+PRL +  Y
Sbjct  526   LLSPRLSSRLY  536



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   395 bits (1014),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 207/491 (42%), Positives = 301/491 (61%), Gaps = 17/491 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          K L +MA+K GP+F I+MG+ R LVVS  E  K+ FTT+DK
Sbjct  50    GAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETAKECFTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A +GRP   A   L Y+ A + F+  G +WR+VRK+  VELLS  +LEK K I  SE+  
Sbjct  110   AFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDIRESEVRT  169

Query  1590  SVKQLY---------GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
              +K+LY          S +K+  V V+M+ W G + LNI+ + +  K   Y + +  D +
Sbjct  170   FLKELYKLWDKNRGGASKSKSNMVLVEMKRWFGDLTLNIVLRTIVGKTVGY-ITNVEDEE  228

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
              A   ++  KD    T  FS +DA PF     LD+ G + AMKK +   D V++ W++EH
Sbjct  229   SAKGWKKGLKDFFHWTAVFSVSDALPF--LRLLDLGGHVEAMKKTAKELDLVVEDWLEEH  286

Query  1257  VRR--GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              R+    +  G++ DF D+M+ V D +  A Q    DTI KAT++A++  A++TT   ++
Sbjct  287   KRKRAAGIVKGKE-DFMDLMLDVFDNDAEAVQGGDSDTINKATSLALILAASDTTAVTLI  345

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++L+N+ +V+K+ Q E+DT VG+ER V++SD  NLV+L+AV++E +RLYP  PL  P
Sbjct  346   WALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVFLKAVIRETLRLYPAAPLLLP  405

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
              E+ +DC + GYH+P+GT+L V++ K+HRD ++W  P +F PERFLT     D   + F 
Sbjct  406   HEATEDCTIDGYHVPRGTRLLVDVSKIHRDERVWSNPNEFDPERFLTTHRGFDARGKNFE  465

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
             +  FG GRR CP  ++AL      LA LL GFDFATPSG PVDM E  G+T  +A P++ 
Sbjct  466   FFPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEV  525

Query  546   LLTPRLPAASY  514
             LL PRLP+  Y
Sbjct  526   LLCPRLPSGLY  536



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   403 bits (1036),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 306/490 (62%), Gaps = 19/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQF--KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  P LGHL      K  H+V  L  +AD  GP+F IR+G+   LVVS+ E  K+ FTTN
Sbjct  316   GARPFLGHLHLLGGSKPAHVV--LGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTN  373

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DKA A RP   A   LGYN A   F+  G +WR++RK+V +E+LS  +LEK KHI  SE+
Sbjct  374   DKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRESEV  433

Query  1596  NLSVKQLYG------SVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYS-VEHGADNQ  1438
               S+K+LY       S + + +V V+M+ W   +N+N++ K++  KRY+ +   HG D  
Sbjct  434   RTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSEAETSHGKDEN  493

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
             D    R+A +D   LTG F+  D+ PF    WLD+ G  +AMKK +   D +L+ W++EH
Sbjct  494   DR--RRKALRDFFELTGTFTVGDSLPF--LRWLDLGGHEKAMKKTAKELDHILEEWLEEH  549

Query  1257  -VRRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
               +R    A  + DF  +M+ +++ +     +Y  DTI KAT ++++  A++TT+  + W
Sbjct  550   KQKRNSGNAESEHDFMGMMLSLLN-DAAELPSYDADTINKATCLSLILAASDTTMVTLTW  608

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLN+++ +K+ QEE+D  VGR++ V++SD   LVYLQA++KE +RLYP  PL  P 
Sbjct  609   ALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAPLSVPH  668

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGW  724
             ES++DC V+GYHIP GT+L +N++K+HRDP  W +P +F+PERFLT     D   + F  
Sbjct  669   ESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDVRGQNFEL  728

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             I FG GRR CP  + AL++    LA LLQGF+  TP   PVDM E  G+T  K  P++ L
Sbjct  729   IPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVSPLEVL  788

Query  543   LTPRLPAASY  514
             +TPRLPA  Y
Sbjct  789   ITPRLPAVCY  798


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P LGHL            L  +AD  GP+F IR+G+   LVVS+ E  K+ FTTN K
Sbjct  10    GARPFLGHLQLLGGSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKECFTTNHK  69

Query  1767  ALAGRPNICAGVYLGYNNAAL  1705
             A   RP   A   LGYN A +
Sbjct  70    AFVNRPRTLAAELLGYNYAMM  90


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -2

Query  1938  PILGHLFQFK--KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
             P++GHL      +  H+V  L  MA+K G +F I+MG+ R LVV++ E  K+  TTNDKA
Sbjct  193   PVIGHLHLLGGPQPPHIV--LGDMAEKYGSIFTIKMGVYRALVVNNWETAKECLTTNDKA  250

Query  1764  LAGRPNICAGVYLGYNNAALAFT  1696
              A RP   A  +L + +  + FT
Sbjct  251   FASRPKTLAMEFLSFEHTMVGFT  273


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = -2

Query  1530  EWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRI  1351
             E +GY   N    ++ K+       HG D+ D    R A ++ + LTG F+  D+ PF  
Sbjct  81    ELLGY---NYAMMVIGKRYSEVEASHGKDDNDRC--RNAVRNFLELTGTFTVGDSLPF--  133

Query  1350  FHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               WLD+ G  +AMKK +   D +L+ W++EH ++
Sbjct  134   LRWLDLGGHEKAMKKTAKELDQILEKWLEEHKQK  167



>ref|XP_010547840.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=527

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 205/487 (42%), Positives = 301/487 (62%), Gaps = 10/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     + +L+ + L  +AD  GP F +R+G  + LVVSS E  K+  T ND
Sbjct  42    GSWPIIGHLHLLGGKNNLLYRTLGALADDYGPAFGLRLGSRKALVVSSWEVAKECLTAND  101

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K  A RPN      +GYN A   F    +++R++RK+V  ELLS  +++  +H+ ISE+ 
Sbjct  102   KTFASRPNTVGAKLMGYNYALFGFAPYDSYFREMRKIVTFELLSNRRIQMLRHVRISEIE  161

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             + +K +Y   +K   +  V VD+++W+  +NLN++ K++A KRY++      +  +A   
Sbjct  162   MGIKDIYSLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYSFGDATADEADEARRC  221

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
              +A      L G F  ADAFPF      D++G  + MKK +   D +L+GW+ EH RR  
Sbjct  222   PKATARFFQLMGLFVIADAFPF--LGRFDLQGYEKEMKKTAAEIDGILEGWLQEHERRRA  279

Query  1242  LPAGE-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                 E D DF D+M+ + DQ  ++   +   T IK+T +AM+   ++T V  ++W  A+L
Sbjct  280   SGESEGDSDFIDVMLSLADQGKLSDLKHDERTCIKSTCLAMILGGSDTLVGTLIWAFALL  339

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
              N+++++K+ QEEID  VG++R V DSD +NLVYLQA+ KE +R+YP  PL  PRE+ +D
Sbjct  340   ANNREILKKAQEEIDFHVGKDRKVVDSDIENLVYLQAITKETLRMYPAAPLLGPREATED  399

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLAR--QFGWITFG  712
             C VAGYH+  GT+L VN+WK+HRDP+ WP PE+F+PERFLT    +   R   F  + FG
Sbjct  400   CTVAGYHVTAGTRLMVNVWKIHRDPRFWPNPEEFRPERFLTGPASEYSVRGQSFELLPFG  459

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  + AL+M H +LAR+L  FD  T SG+ VDM E PG+T+PK KP++ LL+PR
Sbjct  460   SGRRSCPGISLALQMLHLLLARVLHSFDLTTVSGLDVDMGESPGLTIPKTKPLEVLLSPR  519

Query  531   LPAASYN  511
             L    Y 
Sbjct  520   LKKELYE  526



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 306/490 (62%), Gaps = 21/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKAL-ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL       +L   L  TMADK GPVF IR+GL R +VVSS E  K+ FTT+D
Sbjct  43    GAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHD  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
              ALA RP + A  YLGYN A    +  GA+WR+VRK+  +ELLS  +LE  K++ ISE+ 
Sbjct  103   LALASRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVE  162

Query  1593  LSVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAV  1429
               +K+LY    K +     V VDM++W G+++LN++ K++  KRY  Y+ E  +  ++A 
Sbjct  163   TCMKELYELWAKKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAE--SKEKEAQ  220

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A ++   L G F  +DA PF    WLD+ G ++AMKK +   D + Q W++EH RR
Sbjct  221   QFQKAIREFFRLMGLFVVSDAIPF--LGWLDVGGHVKAMKKTAKELDGITQEWLEEHRRR  278

Query  1248  GDLPAGE---DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
              D  +GE   D DF D+M+ ++        +Y  DTI KAT++ M+   A+TT   + W 
Sbjct  279   KD--SGEADGDQDFMDVMLSILGGRDTT--DYDADTINKATSLVMIGGGADTTSGTLTWA  334

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLN+  ++++ QEE+D  VG+ER V++ D   LVYLQA+VKE +RL P+ PL  PR+
Sbjct  335   VSLLLNNPHILRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLSGPRQ  394

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWI  721
              IQD  + GYHI KGT+L +N+ K+ RDP++W  P +F+P+RFLT     D   + F   
Sbjct  395   FIQDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELT  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRR CP   +AL++ H  LA  L  F  +TPS  PVDMSEG G+T  K+ P++ L+
Sbjct  455   PFGGGRRICPGIVFALQVLHLTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTPLEVLI  514

Query  540   TPRLPAASYN  511
             +PRL  ASY+
Sbjct  515   SPRL--ASYD  522



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   393 bits (1010),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 216/490 (44%), Positives = 311/490 (63%), Gaps = 21/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKAL-ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL       +L   L  TMADK GPVF IR+GL R +VV+S E  K+ FTT+D
Sbjct  43    GAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKECFTTHD  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
              ALA RP + A  YLGYN A  AF+  GA+WR+VRK+  +ELLS  +LE  K++ ISE+ 
Sbjct  103   LALASRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVE  162

Query  1593  LSVKQLYG--SVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAV  1429
               +K+LY   +  KN    V VDM+EW G++ LN++  ++A KRY  Y+ E  +  ++A 
Sbjct  163   TCMKELYKLWAEKKNEAGVVLVDMKEWFGHLTLNVILMMVAGKRYFGYTGE--SKEKEAQ  220

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               R+A ++   L G F  +DA PF  F WLD+ G ++AMKK +   D + Q W++EH +R
Sbjct  221   QCRKAIREFFRLWGLFVVSDAIPF--FGWLDVGGHLKAMKKTAKELDGIAQEWLEEHRQR  278

Query  1248  GDLPAGE---DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
              D  +GE   + DF D+ + ++    I   +Y  DTI KATA+ ++    +TT + + W+
Sbjct  279   KD--SGEADGNQDFMDVTLSILGGRDIT--DYDADTINKATALILIGGGTDTTSATLTWV  334

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLN+ DV+++ QEE+D  VG+ER V++ D   LVYLQA+VKE +R+ P  PL  PR+
Sbjct  335   ISLLLNNPDVLRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRINPTAPLSGPRQ  394

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWI  721
              IQD  + GYHI KGT+L +N+ K+ RDP++W  P +F+P+RFLT     D   +QF   
Sbjct  395   FIQDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKQFELT  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRR CP + +AL++ H  LA  L  F  +TPS  PVDMSE  G+T  K+ P++ L+
Sbjct  455   PFGGGRRICPGAVFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLI  514

Query  540   TPRLPAASYN  511
             +PRL  ASY+
Sbjct  515   SPRL--ASYD  522



>ref|XP_008343493.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=532

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 300/489 (61%), Gaps = 20/489 (4%)
 Frame = -2

Query  1938  PILGHLFQFKKET---HLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             PI+GHL      T   HL+     +ADK GP+F I+ G+ R +VVSS E  KD F TNDK
Sbjct  50    PIIGHLHLLSSSTEPAHLL--FGNLADKYGPIFTIKFGMKRAIVVSSSEIAKDCFKTNDK  107

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   AG  LGYN A L F+  G ++R++RK+  +E+LS +++ K KHI   E+  
Sbjct  108   VFASRPKSIAGEVLGYNYAFLPFSPYGEYFRQIRKIATLEVLSQSRIGKLKHIREFEVKA  167

Query  1590  SVKQLYGSVTKNRE------VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAV  1429
             S+K++Y   T N +      V V+M+EW+ + N NI+ +++  K +  + +    +Q   
Sbjct  168   SMKEMYRRWTVNNKSSGSTKVLVEMKEWLAFTNENIIFRMIVGKSFLEATD-SKYSQGRY  226

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
             + R+ F + + L+G F  +D+ PF    WLD+ G  +AMKK++   + V +GW++EH  +
Sbjct  227   LARKTFLEFLRLSGTFVISDSIPF--LRWLDLGGHEKAMKKIAKALEVVFKGWLEEHKHK  284

Query  1248  GDLPAG---EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
               +  G   ++ DF D+M+ ++D   +   +Y  DTI  AT++ +L   AETT   M W 
Sbjct  285   RKILGGLISDELDFMDVMLSILDNNEVT-TSYDADTINIATSLTLLLGGAETTTVTMSWA  343

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +A+L+NH + +K++QEE+D  VG++R V +SD D LV+LQAV+KE MRL+P  PL  P  
Sbjct  344   LALLVNHPETLKKVQEELDENVGKDRQVKESDADKLVFLQAVIKESMRLHPAGPLAIPHL  403

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWI  721
             S  +C V  YH+P GT+L VNI K+HRDPK+W EP +FKPERFLT     D   R F  +
Sbjct  404   STDECMVGDYHVPSGTRLLVNISKIHRDPKVWSEPNEFKPERFLTTHKGLDVKGRDFELL  463

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRR CPA + ALK+  F LA LL GF+  TP+  P+D+SE  G+T   +  ++ LL
Sbjct  464   PFGSGRRMCPAISLALKITEFALASLLHGFEIETPTDDPIDLSETAGLTNNMSALLEVLL  523

Query  540   TPRLPAASY  514
             TPRLPA  Y
Sbjct  524   TPRLPAELY  532



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/535 (39%), Positives = 311/535 (58%), Gaps = 19/535 (4%)
 Frame = -2

Query  2091  LQTRSIHTAMDALIRVVAISGVLIILPFLYL----SLRkqknktkkpppepPGGLPILGH  1924
             +Q    HT+  A     AI+G+  ++ FL       LRK++    +PPP   G  PI GH
Sbjct  1     MQLLQYHTSPKA-----AIAGLFALVTFLSFLITRILRKKRTTGDQPPPSAAGAWPITGH  55

Query  1923  LFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNI  1744
             L            L  MADK GP+F I++G  + +VVS  E  K+ FTTNDKA   RP  
Sbjct  56    LHLLGGPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKY  115

Query  1743  CAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGS  1567
              A   LGYN A L F+  G +WR VRK+  +ELLS   LEK +H+  + +  S+K+ Y  
Sbjct  116   LAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVREAVVRASIKEAYER  175

Query  1566  VTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTG  1387
                     ++M+ W   +  N++ K++  K+ + +     D       R A K    L+G
Sbjct  176   SNAQGNTPIEMKSWFHALTFNVIFKMVGGKQSDGTTASEEDKDQNDRCRIALKSFFVLSG  235

Query  1386  EFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGE-DPDFFD  1210
             +F ++D  P+    W D+ G ++AMK+ +   D V++GW+DEH R+      E D DF D
Sbjct  236   QFVASDVLPY--LRWFDVGGYVKAMKRTAKELDDVVEGWLDEHKRKRACGEAEGDRDFMD  293

Query  1209  IMMKVVDQEFIAGQ--NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRI  1036
             +M+ ++     A +  +Y  DTI KAT +A++    +TT   + W +++LLN++ V+K+ 
Sbjct  294   VMLSILG---TADELPSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKKA  350

Query  1035  QEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPK  856
             Q+E+D+++GRER V +SD  NLVYLQA++KE +RLYP  PL  P ES++DC + GY +P 
Sbjct  351   QQELDSQIGRERQVTESDVKNLVYLQAIIKETLRLYPAAPLSVPHESVEDCTIGGYRVPA  410

Query  855   GTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAY  679
             GT+L +NI KLH++P +WP P +F+PERFLT     D   + F ++ FG GRR CPA ++
Sbjct  411   GTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHKDLDVRGQNFEYLPFGSGRRMCPAVSF  470

Query  678   ALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             AL+  H +LA +L  F+  T S  PVDM+ G GVT P+  P++ +LTPRLP   Y
Sbjct  471   ALQALHIVLATVLHSFEIETASDGPVDMTAGMGVTSPRVTPLEVILTPRLPLHLY  525



>ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52484.1| cytochrome P450, putative [Ricinus communis]
Length=526

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 205/486 (42%), Positives = 300/486 (62%), Gaps = 15/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL        L+ K L  MADK GP F IR+G  R  V++S E  K+  TTND
Sbjct  43    GAWPIIGHLRVLGGADKLLHKTLGLMADKYGPAFNIRIGSHRAFVIASKELAKECLTTND  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KA+A RP   A   + YN+A   F    + WR++RK+V+ ELLS  +LE  K++  SE++
Sbjct  103   KAVASRPTTAATERMCYNHAVFGFAPYSSHWREMRKIVMFELLSNRRLEMVKNVQASEVD  162

Query  1593  LSVKQLYGSVTKNR--EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             + +++LY     N    V V++++W   V  N++ +++A KRY  S    +D+ +A + +
Sbjct  163   IGLRKLYNLWADNGCLPVLVELKQWFQDVTFNVIVRMVAGKRYAGS----SDDYEARLCQ  218

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             +A      L G F  +DA PF    WLD+EG  +AMK+ +   D VL GW++EH++R   
Sbjct  219   KAISQFYHLMGIFVVSDALPF--LWWLDLEGHKKAMKETAKDLDTVLAGWLEEHLQRRVP  276

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G++      DF D+M+ + ++  ++G  Y  D  IKAT +A++  A+ TT + ++W +++
Sbjct  277   GEVKTEVQQDFIDVMLSLEEKGNLSGFLYDADISIKATCLALIAGASGTTTTTLIWAISL  336

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ QEE+D  +G ER VD+SD  NLVYLQA++KE +RLYPV PL  PRE ++
Sbjct  337   LLNNQAALKKAQEELDQHIGTERQVDESDLKNLVYLQAIIKETLRLYPVAPL-IPREFME  395

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC + GYH+  GT+L +N+WK+HRDP+ W  P  F+P RFLT     D   + F  I FG
Sbjct  396   DCTIGGYHVAAGTRLLINVWKIHRDPRFWTNPLAFEPGRFLTSHADIDVRGQHFELIPFG  455

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP + + L   H  LAR L  FD ATP   P+DMSE PG  +PKA P++ L++PR
Sbjct  456   SGRRSCPGAPFGLHALHLALARFLHAFDLATPMDQPIDMSEMPGTHVPKATPLEVLVSPR  515

Query  531   LPAASY  514
             LPA  Y
Sbjct  516   LPAKLY  521



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 210/491 (43%), Positives = 303/491 (62%), Gaps = 17/491 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          K L  MA+K GP+F I+MG+ R LVVS+ E  K+ FTT+DK
Sbjct  50    GAWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A +GRP   A   L Y+ A + F+  G +WR+VRK+  VELLS  +LEK K +  SE+  
Sbjct  110   AFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRA  169

Query  1590  SVKQLY-------GSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
              +K+LY       GS +K++     V+M+ W G + LNI+ + +  K   Y + +  D +
Sbjct  170   FLKELYKLWDENRGSASKSKSNLALVEMKRWFGDLTLNIVLRTIVGKTVGY-ITNVEDEE  228

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
                  ++  KD    TG FS +DA PF  F  LD+ G   AMKK +   D V++ W+ EH
Sbjct  229   SVEGWKKGLKDFFHWTGVFSVSDALPFLRF--LDLGGHGEAMKKTAKELDLVVEDWLKEH  286

Query  1257  VRR--GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              R+    +  G++ DF D+M+ V D +  A Q    DT IKAT++A++  A++TT   ++
Sbjct  287   KRKRAAGIVKGKE-DFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAASDTTAVTLI  345

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++L+N+ +V+K+ Q E+DT VG+ER V++SD  NLVYL+AV+KE +RLYP  PL  P
Sbjct  346   WALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLVP  405

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
              E+I+DC + GYH+P+GT+L VN+ K+HRD ++W  P +F PERFLT     D   + F 
Sbjct  406   HEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFE  465

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
             +  FG GRR CP  ++AL +    LA LL G DFATPSG PVDM E  G+T  +A P++ 
Sbjct  466   FFPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSGLTNLRATPLEV  525

Query  546   LLTPRLPAASY  514
             LL+PRLP+  Y
Sbjct  526   LLSPRLPSRLY  536



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/535 (39%), Positives = 311/535 (58%), Gaps = 19/535 (4%)
 Frame = -2

Query  2091  LQTRSIHTAMDALIRVVAISGVLIILPFLYL----SLRkqknktkkpppepPGGLPILGH  1924
             +Q    HT+  A     AI+G+  ++ FL       LRK++    +PPP   G  PI GH
Sbjct  1     MQLLQYHTSPKA-----AIAGLFALVTFLSFLITRILRKKRTTGDQPPPSAAGAWPITGH  55

Query  1923  LFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNI  1744
             L            L  MADK GP+F I++G  + +VVS  E  K+ FTTNDKA   RP  
Sbjct  56    LHLLGGPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKY  115

Query  1743  CAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGS  1567
              A   LGYN A L F+  G +WR VRK+  +ELLS   LEK +H+  + +  S+K+ Y  
Sbjct  116   LAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVREAVVRASIKEAYER  175

Query  1566  VTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTG  1387
                     ++M+ W   +  N++ K++  K+ + +     D       R A K    L+G
Sbjct  176   SNAQGNTPIEMKSWFHALTFNVIFKMVGGKQSDGTTASEEDKDQNDRCRIALKSFFVLSG  235

Query  1386  EFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGE-DPDFFD  1210
             +F ++D  P+    W D+ G ++AMK+ +   D V++GW+DEH R+      E D DF D
Sbjct  236   QFVASDVLPY--LRWFDVGGYVKAMKRTAKELDDVVEGWLDEHKRKRACGEAEGDRDFMD  293

Query  1209  IMMKVVDQEFIAGQ--NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRI  1036
             +M+ ++     A +  +Y  DTI KAT +A++    +TT   + W +++LLN++ V+K+ 
Sbjct  294   VMLSILG---TADELPSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKKA  350

Query  1035  QEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPK  856
             Q+E+D+++GRER V +SD  NLVYLQA++KE +RLYP  PL  P ES++DC + GY +P 
Sbjct  351   QQELDSQIGRERQVTESDVKNLVYLQAIIKETLRLYPAAPLSVPHESVEDCTIGGYRVPA  410

Query  855   GTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAY  679
             GT+L +NI KLH++P +WP P +F+PERFLT     D   + F ++ FG GRR CPA ++
Sbjct  411   GTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHKDLDVRGQNFEYLPFGSGRRMCPAVSF  470

Query  678   ALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             AL+  H +LA +L  F+  T S  PVDM+ G GVT P+  P++ +LTPRLP   Y
Sbjct  471   ALQALHIVLATVLHSFEIETASDGPVDMTAGMGVTSPRVTPLEVILTPRLPLHLY  525



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   393 bits (1010),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 201/486 (41%), Positives = 299/486 (62%), Gaps = 20/486 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL        L + L +MADK GP+F I++G+ R LVVSS E  K+  TTNDK
Sbjct  57    GAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDK  116

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN +   F+  G++W + RK+  +ELLS  +LEK +H+   E+  
Sbjct  117   IFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLRHVRDYEVKT  176

Query  1590  SVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K+LY    K++      V+M+ W      N++ +++  K        G ++ D+    
Sbjct  177   CLKELYELWDKSKSTNKMLVEMKRWFADTIRNVILRMIVGK--------GCNSVDSEEWM  228

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             +     + ++G+F  +DA PF    WLD+ G  R+MKK +   D V+QGW +EH R+ D 
Sbjct  229   ELLTRFLEMSGKFVVSDALPF--LRWLDIGGDERSMKKTAKELDIVVQGWFEEHKRKRDS  286

Query  1239  P--AGEDPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                 GE+ DF  +M  ++ D E  +G++   DTI KA  + ++    +TT   + W++++
Sbjct  287   REVKGEELDFMSVMPSILGDTEQYSGRDV--DTINKAVCLGLIIAGLDTTTVTLTWVISL  344

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLNH+D++ ++Q E+D +VG +R V++SD  NLVYLQA +KE MRLYP VPL  P E+I+
Sbjct  345   LLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIE  404

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             +C V GYH+P  TQL +N+WKL RDP++W EP KF+PERFLT+    D   +    + FG
Sbjct  405   ECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLELLPFG  464

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++  F +A LLQGFDFATPS  P+DM EG G+TM K++P++ L+ PR
Sbjct  465   SGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPR  524

Query  531   LPAASY  514
             L A+ Y
Sbjct  525   LSASLY  530



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   393 bits (1009),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 218/521 (42%), Positives = 313/521 (60%), Gaps = 20/521 (4%)
 Frame = -2

Query  2040  AISGVLIILP-FLYLSL----RkqknktkkpppepPGGLPILGHLFQFKKETHLVKALAT  1876
             AIS ++I L  FL +S     R  K K  +  PE  G  P++GHL   +      + L  
Sbjct  15    AISALVIFLSIFLLISRNGQKRTLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGN  74

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP+F +++G+ + LVVS+ E  K+ FTTNDKA AGRP   A   LGYN   + F 
Sbjct  75    MADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFA  134

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSV----TKNREVEVDME  1531
               G +WR+ RK+  +ELLS  +LEK KH+  SE+  S+++LY +     +  + V V+M 
Sbjct  135   PYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMI  194

Query  1530  EWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRI  1351
              W+    L+I+ +I+A KRY    +   D Q      Q       L+G+F  +DA PF  
Sbjct  195   HWLEGTVLDIILRIIAGKRYTSQSQEVNDWQ------QQITKFTALSGQFVVSDALPF--  246

Query  1350  FHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKVVDQEFIA  1174
               WLD+ G  R M K +   D +LQ W+DEH ++R    A  D DF  +++ ++D     
Sbjct  247   LRWLDIGGYERLMSKTAKYFDIILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQ  306

Query  1173  GQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWV  994
               +   D +IKA  + ++  AA+T+V  + W +A+L+N++DV+K+ Q+E+D +VG ER V
Sbjct  307   LPDRDADAVIKAICVTLIVAAADTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPV  366

Query  993   DDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRD  814
             ++SD  NLVYLQA++KE MRLYP  PL  P E I++C V GYH+P GTQL+VN WK+ RD
Sbjct  367   NESDARNLVYLQAIIKETMRLYPAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRD  426

Query  813   PKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQ  637
             P +W EP +F+PERFLT     D   + F  I FG GRR CPA ++ L++   +LA L+ 
Sbjct  427   PCVWEEPCQFQPERFLTRHKDIDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVH  486

Query  636   GFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             GFDF TPS  PVDM E  G+T+ KA P++ L++PR  A+ Y
Sbjct  487   GFDFTTPSDEPVDMGEAMGLTIAKATPLEVLVSPRHSASLY  527



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   393 bits (1009),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 304/490 (62%), Gaps = 21/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKAL-ATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL       +L   L  TMADK GPVF IR+G  R +VVSS E  K+ FTT+D
Sbjct  43    GAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKECFTTHD  102

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
              ALA RP + A  YLGYN A  AF+  GA+WR+VRK+  +ELLS  +LE  K++ ISE+ 
Sbjct  103   LALASRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVE  162

Query  1593  LSVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRY-NYSVEHGADNQDAV  1429
               +K+LY    + +     V VDM++W G+++LN++ K++  KRY  Y+ E  +  ++A 
Sbjct  163   TCMKELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAE--SKEKEAQ  220

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A ++   L G F  +DA PF    WLD+ G ++AMKK +   D + Q W++EH RR
Sbjct  221   QCQKAIREFFRLLGLFVVSDALPF--LGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRR  278

Query  1248  GDLPAGE---DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWI  1078
              D  +GE   D DF D+M+ ++      G  Y  D I KAT++ ++    +TT   + W 
Sbjct  279   KD--SGEADGDQDFMDVMLSILGATDPNG--YDADXINKATSLILIAGGTDTTSXTLTWA  334

Query  1077  MAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRE  898
             +++LLN+  V+++ QEE+DT VG+ER V++ D   LVYLQA+VKE +RLYP  PL   R+
Sbjct  335   ISLLLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQ  394

Query  897   SIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWI  721
              IQD  + GYHIPKGT+L +N+ K+ RDP++W  P  F+P RFLT     D   + F   
Sbjct  395   FIQDSVLGGYHIPKGTRLLLNLTKIQRDPRVWLNPTXFQPSRFLTTYKDVDVKGKHFVLT  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRR CP +A+AL++    LA  L  F  +TPS  P+DMSE  G+T  K+ P++ L+
Sbjct  455   PFGGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLI  514

Query  540   TPRLPAASYN  511
             +PRL  ASYN
Sbjct  515   SPRL--ASYN  522



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 289/483 (60%), Gaps = 20/483 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT-ND  1771
             G  P +GHL        + + L  MADK GP+F +++G    +VVS+ E VKD FT  ND
Sbjct  48    GAWPFIGHLHLLSGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEMVKDCFTAKND  107

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K  A RPN+    YLGYN A  A    G +WR +RKMV +ELL+ ++LEK KH+  SE+N
Sbjct  108   KIFASRPNMAISKYLGYNGAIFALAPYGPYWRNIRKMVTLELLTNSRLEKLKHVRTSEVN  167

Query  1593  LSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
               +K+LY   + N   +V++  W   +  NI+ +++A KR+  S E        +  +++
Sbjct  168   SCIKELY---SNNCPGQVNLSSWFENITCNIIIRMLAGKRFTGSAEE-------MNFKES  217

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-GDLP  1237
              K  + L G F  +D+ P+  F W+D+ G I+AMK      D+V   W+ +H+   GD  
Sbjct  218   IKKALYLGGTFVFSDSIPW--FEWMDIGGHIKAMKDTYKEVDSVFDSWLKQHINSIGD--  273

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
              GE  DF DIM+  + +E      Y RD IIKAT + ++  A+E+T   ++W +++LLN+
Sbjct  274   -GEQSDFIDIMLSTLPEETNMESGYNRDAIIKATTLILIMTASESTAETLIWALSLLLNN  332

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
                +K  Q+E+D  +GR +WV++SD  NL YLQA+VKE +RLYP  PL  PRE+++DC V
Sbjct  333   THSLKLAQDELDEHIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLAGPREALEDCYV  392

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPER-FLTESVPDGL-ARQFGWITFGFGR  703
               YHI KGT+L VN+WKL RD +IW +P +FKPER FL E        + F +I F  GR
Sbjct  393   DKYHIKKGTRLIVNLWKLQRDSRIWKDPNEFKPERWFLKEHTNINFRGQNFEYIPFSSGR  452

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             R CP   +  ++ H  LA+LL GF+ +     PVD+SEG G+ +PK KP++ LL+PRL  
Sbjct  453   RMCPGLTFGSQVVHLTLAKLLHGFNVSMLKEEPVDLSEGLGIALPKVKPLQPLLSPRLAV  512

Query  522   ASY  514
               Y
Sbjct  513   ELY  515



>ref|XP_010526010.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Tarenaya hassleriana]
Length=524

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 199/487 (41%), Positives = 299/487 (61%), Gaps = 10/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PILGHL     + +L+ + L  +AD+ GP F +++G  + LVVSS +  K+  T ND
Sbjct  39    GSWPILGHLHLLGGKNNLLYRTLGALADEYGPAFGLQLGSQKALVVSSWDVAKECLTVND  98

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             +  A RP      ++GYN A   F    +++R +RK+V  ELLS  +++K  H+ ISE+ 
Sbjct  99    RTFASRPKTVGAKHMGYNYALFGFAPYDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIE  158

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             + +K +Y   +K   +  V VD+++W+  +NLN++ K++A KRY +      +  +A   
Sbjct  159   MGIKDIYNLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYAFGDATADEADEARRC  218

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
              +A      L G F  +DA PF      D++G  + MKK +   D +L+GW+ EH RR  
Sbjct  219   PKATARFFQLMGLFVLSDALPF--LGRFDLQGHEKEMKKNAAEIDGILEGWLQEHERRRA  276

Query  1242  LPAGE-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
             L   + D DF D+M+   +Q  ++   +   T IKAT +AM+   ++T V  +VW  A+L
Sbjct  277   LGETDGDSDFIDVMLSQKEQGKLSNLKHDERTAIKATCLAMILGGSDTLVGTLVWAFALL  336

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
              N+++++K+ +EEID  VG++R V+DSD + LVYLQA+ KE +RLYP  PL  PRE+ +D
Sbjct  337   ANNREILKKAREEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATED  396

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLAR--QFGWITFG  712
             C VAGYH+  GT+L VN+WK+HRDPKIWP P++F PERFL     +   R   +  + FG
Sbjct  397   CTVAGYHVTAGTRLMVNVWKVHRDPKIWPNPDEFIPERFLEGKASEYSVRGQSYELLPFG  456

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  + A+++ H +LAR L  FD +T SGM VDM E PG+T+PK KP++ LL+PR
Sbjct  457   SGRRSCPGISLAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPR  516

Query  531   LPAASYN  511
             L    Y+
Sbjct  517   LKKELYD  523



>gb|ABK28662.1| unknown [Arabidopsis thaliana]
Length=524

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 202/491 (41%), Positives = 306/491 (62%), Gaps = 18/491 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD+ GP   +R+G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GY+ A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY----NYSVEHGADNQD  1435
             + ++ LY    K   +  V VD++ W+  ++LN+M +++A KRY    + S E   D ++
Sbjct  157   MVMQDLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPE---DAEE  213

Query  1434  AVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
             A   R+   +   L G F+ +DAFP     W D +G  + MK+     D +L+ WI+ H 
Sbjct  214   ARQCRKGVANFFHLVGIFTVSDAFP--KLGWFDFQGHEKEMKQTGRELDVILERWIENHR  271

Query  1254  RRGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
             ++  +   +  D DF D+M+ + +Q   +   +   T IK+T +A++   +ET+ S + W
Sbjct  272   QQRKVSGTKHNDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSPSTLTW  331

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLN+KD++K+ Q+EID  VGR+R V+DSD +NLVY+QA++KE +RLYP  PL   R
Sbjct  332   AISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLLGHR  391

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFG  727
             E+I+DC VAGY++ +GT++ VN+WK+ RDP+++ EP +F+PERF+T      D   + F 
Sbjct  392   EAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVRGQNFE  451

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
              + FG GRRSCP S+ A+++ H  LAR LQ FD  T   MPVDM+E PG+T+PKA P++ 
Sbjct  452   LMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEI  511

Query  546   LLTPRLPAASY  514
             L++PRL    Y
Sbjct  512   LISPRLKEGLY  522



>ref|NP_194925.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
 sp|O49394.2|C82C2_ARATH RecName: Full=Cytochrome P450 82C2 [Arabidopsis thaliana]
 emb|CAA16592.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79915.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85984.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
Length=523

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 202/491 (41%), Positives = 306/491 (62%), Gaps = 18/491 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD+ GP   +R+G     VVSS E  KD FT ND
Sbjct  37    GAWPIIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GY+ A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRY----NYSVEHGADNQD  1435
             + ++ LY    K   +  V VD++ W+  ++LN+M +++A KRY    + S E   D ++
Sbjct  157   MVMQDLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPE---DAEE  213

Query  1434  AVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV  1255
             A   R+   +   L G F+ +DAFP     W D +G  + MK+     D +L+ WI+ H 
Sbjct  214   ARQCRKGVANFFHLVGIFTVSDAFP--KLGWFDFQGHEKEMKQTGRELDVILERWIENHR  271

Query  1254  RRGDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVW  1081
             ++  +   +  D DF D+M+ + +Q   +   +   T IK+T +A++   +ET+ S + W
Sbjct  272   QQRKVSGTKHNDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSPSTLTW  331

Query  1080  IMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPR  901
              +++LLN+KD++K+ Q+EID  VGR+R V+DSD +NLVY+QA++KE +RLYP  PL   R
Sbjct  332   AISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLLGHR  391

Query  900   ESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFG  727
             E+I+DC VAGY++ +GT++ VN+WK+ RDP+++ EP +F+PERF+T      D   + F 
Sbjct  392   EAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVRGQNFE  451

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
              + FG GRRSCP S+ A+++ H  LAR LQ FD  T   MPVDM+E PG+T+PKA P++ 
Sbjct  452   LMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEI  511

Query  546   LLTPRLPAASY  514
             L++PRL    Y
Sbjct  512   LISPRLKEGLY  522



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   392 bits (1007),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 212/532 (40%), Positives = 316/532 (59%), Gaps = 22/532 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFK-KETHLVK  1888
             MD    +  I GVLI   FLY   + +   T K  PEP G  PI+GHL      E  L +
Sbjct  1     MDTSTYLPLIIGVLI---FLYFIFKNKNYSTSKQVPEPAGAWPIIGHLHLLGGTEQLLYR  57

Query  1887  ALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAA  1708
              L  MAD  GP F +R+G  R  VVSS E  K+ FT NDKALA RP   A  ++GY  A 
Sbjct  58    TLGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAV  117

Query  1707  LAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKN---REVEV  1540
               F     FWR++RK+ + ELLS  +L+  K++ +SE+++ +++LY     N   R + V
Sbjct  118   FGFAPYSPFWREMRKIAMFELLSNRRLDALKYVQVSEVDIGIQELYKLWVDNNSDRPILV  177

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQD-AVVLRQAFKDVMTLTGEFSSADAF  1363
             +++ W   + LN++ +++A KRY +      DN D A   ++A      L G F  +DAF
Sbjct  178   ELKRWFEDLTLNVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDAF  236

Query  1362  PFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP--------DFFDI  1207
             P  I  W D+ G  +AMKK +   D +L+GW+ EH  +    + E          DF D+
Sbjct  237   P--ILGWFDINGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEVKSTTDSAVQDFIDV  294

Query  1206  MMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEE  1027
             M+ + ++  ++   Y  DT IK+T +A++   ++TT   + W +++LLN+  ++ + QEE
Sbjct  295   MLSLEEEGRLSNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILTKAQEE  354

Query  1026  IDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQ  847
             ID  VG+ R +D+SD +NL+Y+QA++KE +RLYP  PL  PRE++ +CE++GY I  GT+
Sbjct  355   IDLHVGKNRQIDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTR  414

Query  846   LYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKM  667
             L VN+WK+ RDP+IW +P+ F P+RFL  +V D   + F  I FG GRRSCP ++ AL++
Sbjct  415   LIVNVWKIQRDPRIWEDPDCFNPDRFLMSNV-DVKGKDFELIPFGSGRRSCPGASLALQV  473

Query  666   AHFILARLLQGFDFATP-SGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              H  LAR+L  F+F  P  G P+D++E PG+T+PKA P+  L+ PRL A  Y
Sbjct  474   LHLTLARILHAFEFTKPIDGQPIDLTESPGLTIPKATPLDVLIAPRLSANLY  525



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   407 bits (1046),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 305/483 (63%), Gaps = 10/483 (2%)
 Frame = -2

Query  1944  GLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
              LP +GHL     +T L +  A+ ADK GP+F I +G    LV+S+ E++K+ FTTNDK 
Sbjct  575   ALPFIGHLHLLGNQTPLARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKI  634

Query  1764  LAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
             LA RP    G+YLGYN A   F   G ++ K+RK+ ++ELLS+ ++E  +H++ SE++  
Sbjct  635   LASRPKSSHGIYLGYNYAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTL  694

Query  1587  VKQLYGSVTKNREVE--VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
             V  L+  V  N +V   V + +W+  +  NI++K+++ KRY +      D+ +A  + + 
Sbjct  695   VNDLWLYVKDNNKVTKAVVISKWLEKLTFNIITKMISGKRY-FEYLQDVDDVEAHGIVKL  753

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEG-LIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
              K+ M ++GEF  +D  P  I  W   EG ++++MK+V    D V+  W+DEHV++ D  
Sbjct  754   IKEFMHISGEFVPSDLIP--IIGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDG  811

Query  1236  AGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNH  1057
               E  DF D+M+ V++ +  +G +  RDTIIKA  M ++   ++TT + M WI+A+LLN+
Sbjct  812   VNEKHDFIDVMLSVIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNN  869

Query  1056  KDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEV  877
              + +KR QEEI+  +G++R V+ SD  NLVYLQA++KE +RLYP  PL  P E+ +DC +
Sbjct  870   TNALKRAQEEINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYI  929

Query  876   AGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGL-ARQFGWITFGFGRR  700
              GY++PKGT+++ N+WKLHRDP IW E EKF PERF+ E   +      F ++ FG GRR
Sbjct  930   QGYNVPKGTRVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRR  989

Query  699   SCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAA  520
             +CP S +A ++    LARL+ GFD   P G  VDM EG G+T+PK  P+  +LTPRL   
Sbjct  990   ACPGSMFATQVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYE  1049

Query  519   SYN  511
              YN
Sbjct  1050  LYN  1052


 Score =   403 bits (1036),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/487 (43%), Positives = 297/487 (61%), Gaps = 15/487 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP +GHL     +    +  +TMA+K G +F +R+G  + LVVSS E  ++  TTNDK
Sbjct  28    GSLPFIGHLHLLSTQVPYFRTFSTMAEKYGSIFSLRLGCHKTLVVSSREIARECLTTNDK  87

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RPNI AG YLGYNNA LA    G +WR +RK+  +ELLS+ +LEK  H+  SE+  
Sbjct  88    VFASRPNISAGRYLGYNNAILALAPYGNYWRDMRKISTLELLSSHRLEKLMHVRDSEIFS  147

Query  1590  SVKQLYGSVTKNRE---VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              VK LY  +  N     +EV + +++ ++  NI+ +++A KR+     +  D++ A  LR
Sbjct  148   LVKDLYTFLKNNNSNGLIEVPISKFLDHMTFNIIVRMIAGKRFRGETIYQEDSE-AWRLR  206

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH---VRR  1249
              A KD   L+G F   DA PF    W D +G +  MK+     D +L  W+ EH   +  
Sbjct  207   NAIKDTTYLSGVFVVGDAIPF--LSWFDFQGHVGFMKRTFKEMDFILDKWMREHYTKINE  264

Query  1248  GDLPAGEDPDFFDIMMKVVD-QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
             G     E+ DF D+++ + D  + I G  + R+ +IKAT M ++  A+ +T   + W ++
Sbjct  265   GQHGKYEN-DFMDVLISMFDGYDEICG--HKREIVIKATTMILILTASGSTAITLTWALS  321

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+  V+K+ Q+E+D  +G+ +WV +S+  NL YLQA++KE +RLYP  PL   RESI
Sbjct  322   LLLNNPRVLKQAQQELDNNIGKHKWVQESNIKNLKYLQAIIKETLRLYPPAPLTGLRESI  381

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
              DC VAGYH+PKGT+L +NIWKL RDP IWP P +F+PERFLT +   D     FG++ F
Sbjct  382   DDCHVAGYHVPKGTRLLINIWKLQRDPHIWPNPNEFQPERFLTSNGQIDSQHYDFGFVPF  441

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
              +GRRSC  S + L++ H  LARL+QGFD  T  G  VDMSEG G+ +PK  P+  +L P
Sbjct  442   SYGRRSCVGSTFGLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGLALPKENPLSLMLQP  501

Query  534   RLPAASY  514
             RLP   Y
Sbjct  502   RLPLDLY  508



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   392 bits (1006),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 295/483 (61%), Gaps = 12/483 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP++GHL    K     K  A MAD  GP+F +R+GL   L+VS+ E  ++ FTTNDK
Sbjct  47    GALPLIGHLHLLAKNEPAHKTFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDK  106

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP + A   LGY+ A    +  G  WR VRK+ ++ELLS  +LEK +HI +SE+  
Sbjct  107   IFASRPKLVASKLLGYDYAMFGLSPYGPHWRHVRKLAMLELLSNYRLEKLQHIRVSEVQT  166

Query  1590  SVKQLYGSVTKNRE-VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
             S+K LY    KN++   V+M+ W G + LN +S+I+  K+++ +V+  A N +    R+A
Sbjct  167   SMKNLYELCLKNKKNALVEMKTWFGDITLNTISRIVVGKKFSTAVD--ASNNENEEYRKA  224

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPA  1234
              +D     G F  +D+FPF    WLD+ G  +AMKK +   D V   WI +H        
Sbjct  225   LRDFFEWFGVFVPSDSFPF--LKWLDLGGHEKAMKKTAKVLDEVFDKWIQDHKNNLGEVK  282

Query  1233  GEDPDFFDIMMKVVDQEFIAGQ--NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              E+ DF D+M+  V  +   GQ   Y   T+ KAT ++++   ++TT   M+W +++LLN
Sbjct  283   MEEHDFMDVMLSNVRDD---GQLSKYDAHTVTKATCLSLILAGSDTTTVTMIWALSLLLN  339

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +++V+KR Q E+D +VGR+R V +SD  NL+YLQA+VKE +RLYP  P+  P ES+ DC 
Sbjct  340   NQEVLKRAQLELDERVGRQRQVKESDVKNLLYLQAIVKETLRLYPAAPILVPHESVDDCV  399

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGR  703
             VAGYHIP GT+L VN+ KL RDP+IW +P +F+PERFLT +   D   +    I FG GR
Sbjct  400   VAGYHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSAKDFDVRGQNPRLIPFGSGR  459

Query  702   RSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPA  523
             R CP  ++AL++ H  LA LL GF+ + PS   +DM E  G+T  +  P++ +LTPRLP 
Sbjct  460   RMCPGISFALQVMHLALANLLHGFEISRPSKEFLDMEESAGMTSIRKNPLEVVLTPRLPP  519

Query  522   ASY  514
               Y
Sbjct  520   HVY  522



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/484 (41%), Positives = 289/484 (60%), Gaps = 22/484 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFT-TND  1771
             G  P +GHL        + + L  MADK GP+F +++G    +VVS+ E VKD FT  ND
Sbjct  41    GAWPFIGHLHLLNGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEIVKDCFTANND  100

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K  + RPN+    YLGYN A  A    G +WR +RKMV VELL+ ++LEK KH+  SE+N
Sbjct  101   KIFSSRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVTVELLTHSRLEKLKHVRTSEVN  160

Query  1593  LSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
               +K+LY     N   +V++  W   +  NI+ +++A KR+    E        +  +++
Sbjct  161   CCIKELYS----NCPSQVNLSSWFENITCNIIVRMLAGKRFTGCAEE-------MNFKES  209

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-GDLP  1237
              K  + L G F  +DA P+    W+D+ G I+AMK+     D+V   W+ +H+   GD  
Sbjct  210   IKKALYLGGAFVFSDAIPW--LEWMDIGGHIKAMKETYKEVDSVFDSWLKQHINSIGD--  265

Query  1236  AGEDPDFFDIMMKVVDQEF-IAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLN  1060
              GE  DF DIM+  + +E  +    Y R  IIKAT + ++  A+E+T   ++W +++L+N
Sbjct  266   -GEQSDFIDIMLSTLPEETNMESAAYNRHAIIKATTLILIMTASESTAETLIWALSLLMN  324

Query  1059  HKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCE  880
             +   +K  Q E+D ++GR +WV++SD  NL YLQA+VKE +RLYP  PL  PRE+I+DC 
Sbjct  325   NTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLAGPREAIEDCY  384

Query  879   VAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPER-FLTESVPDGL-ARQFGWITFGFG  706
             +  YHI KGT+L VN+WKL RD +IW +P +FKPER FL E        + F +I F  G
Sbjct  385   IGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHTNINFRGQHFEYIPFSSG  444

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR CP   +A ++ H  LA+LL GF+ + P   PVD+SEG G+ +PK KP++ LL+PRL 
Sbjct  445   RRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGIALPKVKPLQPLLSPRLA  504

Query  525   AASY  514
                Y
Sbjct  505   VELY  508



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   391 bits (1005),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 296/484 (61%), Gaps = 13/484 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PI+GHL     KE  L + L  MAD  G    +++G     VVSS E  K+ FT ND
Sbjct  37    GAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVND  96

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             KALA RP   A  ++GYN A   F    AFWR++RK+  +ELLS  +L+  KH+ +SE++
Sbjct  97    KALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEIS  156

Query  1593  LSVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQDAV  1429
             + VK LY    KN   E   VD++ W   +  N++ +++A KRY      E   D  +A 
Sbjct  157   MGVKDLYSLWVKNGGSEPVIVDLKRWSEDMTQNVIVRMVAGKRYLGGAVSESSEDAAEAR  216

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR  1249
               ++A      L G F+ +DAFP     W D +G  + MK+     D +L+ W + H + 
Sbjct  217   QCKRAISKFFHLIGIFTVSDAFP--ALRWFDFQGHEKEMKQTGSELDVILERWTENHRQE  274

Query  1248  GDLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
               +   +  D DF D+M+ + +Q  ++   Y  +T IK+T ++++   ++TT S + W +
Sbjct  275   RKVSGTKENDSDFIDVMLSLEEQGKLSHLQYDANTSIKSTCLSLILGGSDTTSSTLTWAI  334

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             A+LLN+K+++K+ Q+EID  VGR+R V+DSD +NLVYLQA++KE +RLYP  PL  PRE+
Sbjct  335   ALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGPREA  394

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP--DGLARQFGWI  721
             ++DC VAGY++  GT+L VN+WK+ RDPK++ EP +F+PERF+T      D   + F  +
Sbjct  395   MEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNFELM  454

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              FG GRRSCP S+ A+++ H  LAR L  F+  T   MPVDM+E PG+T+PKA P++ L+
Sbjct  455   PFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLI  514

Query  540   TPRL  529
             +PRL
Sbjct  515   SPRL  518



>ref|XP_009780811.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=708

 Score =   397 bits (1021),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/490 (41%), Positives = 295/490 (60%), Gaps = 16/490 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL          + L  MADK GP+F +++G    LVVSS E VKD FTTNDK
Sbjct  222   GAWPFIGHLHLLSDPVPACRTLGLMADKYGPIFQLQLGTHPALVVSSWEMVKDCFTTNDK  281

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP +    Y  YN+A  A    G +WR++RKMV +EL + ++LEK KH+  SE++ 
Sbjct  282   IFASRPKMTLSKYF-YNDAVFALAPYGPYWREIRKMVTLELFTNSRLEKLKHVRASEVDC  340

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K+LY     N     +V++  W  ++  NI+ +++A KR++ SV   +  ++ +  ++
Sbjct  341   CIKELYSFCNNNNNFPTQVNLSSWFEHITCNIIIRMLAGKRFSSSVNEQSGTKE-MQFKE  399

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV-RRGDL  1240
             + K  + L G F  +D  P     W+D+ G I+AMK+  +  D+V   W+ EH+ +R D 
Sbjct  400   SIKKALFLGGTFVVSDVIP--SLEWMDIGGHIKAMKQTFNEVDSVFDIWLKEHIQKRKDC  457

Query  1239  P---AGED--PDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIM  1075
                  G+D   DF D+M+  + +E +    Y RD IIKAT + ++  A+E+T   ++W +
Sbjct  458   ENSNTGDDHQSDFIDVMLSTLPEETMVS-GYDRDAIIKATTLILIMTASESTAETLIWTL  516

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++L+N + ++K  Q+E+D  VGR RWV++SD  NL YLQA+VKE +RLYP  PL  PRE+
Sbjct  517   SLLMNDRRILKIAQDELDEHVGRNRWVEESDMKNLKYLQAIVKETLRLYPPGPLAGPREA  576

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPER-FLTESVPDGLARQ-FGWI  721
             I+DC V  YHI KGT+L VN+WKL RD  IW  P +F+PER FL E +      Q F +I
Sbjct  577   IEDCYVGKYHIRKGTRLIVNLWKLQRDSSIWENPNEFQPERWFLKEHMNINFRGQSFEYI  636

Query  720   TFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALL  541
              F  GRR CP   +  ++ H  LARLL GF+ + P   PVD+SEG G+ +PK KP++ LL
Sbjct  637   PFSSGRRMCPGLTFGTQVVHLTLARLLHGFNISMPREEPVDLSEGLGIALPKMKPLQPLL  696

Query  540   TPRLPAASYN  511
             TPRLP   Y 
Sbjct  697   TPRLPMELYQ  706



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   390 bits (1003),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 214/493 (43%), Positives = 297/493 (60%), Gaps = 28/493 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL            LA+MADK GP+F I+ G+ R L+VS+ +  K   T ND+
Sbjct  22    GAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDR  81

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   +   + YN A       G +WR VRK+ ++ELLS  +LE  KH+  SE+  
Sbjct  82    AFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQA  141

Query  1590  SVKQLYGSVTKNR-----EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             SV  LY    ++      +V VDM+ W G + LN++ +++  KRY        D QD   
Sbjct  142   SVTHLYKRCMESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKG  194

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-  1249
              R+A +    L G F  +DAFP  I  WLD++G  + MKK +   D V+QGW++EH RR 
Sbjct  195   -REALRSYFDLAGRFIVSDAFP--ILRWLDLDGYEKMMKKTAHELDRVVQGWLNEHKRRR  251

Query  1248  ------GDLPAGEDPDFFDIMMKVVDQ-EFIAGQNYTRDTIIKATAMAMLQDAAETTVSN  1090
                   GD     D DF D+M+ +VD  E + G  Y  DT IKAT MA++   ++TT  +
Sbjct  252   SANKRRGD-NKDSDQDFMDVMLSIVDAAEELPG--YDADTFIKATCMALVLAGSDTTSVS  308

Query  1089  MVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLG  910
             + W +++LLNH++V+K+ Q E+DT++GRER V++SD  NLVY+QA++KE MRLYP  PLG
Sbjct  309   LTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLG  368

Query  909   FPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQ  733
              P ES++DC V GYHIPKGT+L +N WK+HRD  IW +P +F+PERFLT     D   + 
Sbjct  369   VPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQN  428

Query  732   FGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             F  I FG GRR CP    A+++    LA LL GFD  T +  PVDM+E  G+T  KA P+
Sbjct  429   FELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPL  488

Query  552   KALLTPRLPAASY  514
             + L+TPRLP  +Y
Sbjct  489   EVLVTPRLPEHAY  501



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 218/522 (42%), Positives = 316/522 (61%), Gaps = 20/522 (4%)
 Frame = -2

Query  2043  VAISGVLIILPFLYL-----SLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALA  1879
             VAIS ++I L   +L       R +KNK  +  P   G  P++GHL   +      + L 
Sbjct  14    VAISALVIFLSIFHLISRNGQKRIRKNKQSQQAPVAGGAWPLIGHLHLLRGPEPAHRVLG  73

Query  1878  TMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF  1699
              +ADK G +F +++G+ + LVVS+ E  K+ FTTNDKA A RP   A   +GYN + + F
Sbjct  74    NLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKRMAVELMGYNFSVIGF  133

Query  1698  TT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSV----TKNREVEVDM  1534
                G +WR+ RK+V +ELLS  +LEK KH+  SE+  S+++LY +     +  + V V+M
Sbjct  134   APYGKYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEM  193

Query  1533  EEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFR  1354
               W+    L+I+ +I+A KR+    E   D Q      Q    +  L G+F  +DA PF 
Sbjct  194   IHWLEGTALDIILRIIAGKRHTSQSEEANDWQ------QQITKIAALFGQFVVSDALPF-  246

Query  1353  IFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKVVDQEFI  1177
                 LD+ G  R M K +   D +LQ W+DEH ++R       D DF  +++ ++D    
Sbjct  247   -LRRLDIGGYERLMSKTAKYFDIILQEWLDEHKMKRVSGEVKGDEDFIYVLLSLLDDNAE  305

Query  1176  AGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERW  997
                +   DT+IKA  ++++    +TTV  + W +A+LLN+ +V+K+ ++EID +VG ER 
Sbjct  306   QLPDRDADTVIKAICLSLIVAGTQTTVVTLTWAIALLLNNPEVLKKARDEIDIQVGTERP  365

Query  996   VDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHR  817
             V++SDT NLVYLQA++KE MRLYP  PL  P ESI++C V GYH+P GTQL+VN WK+ R
Sbjct  366   VNESDTRNLVYLQAIIKETMRLYPAGPLLLPHESIEECIVNGYHVPAGTQLFVNAWKIQR  425

Query  816   DPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLL  640
             DP +W EP +F+PERFLT     D   + F  I FG GRR CPA +Y L++   +LA L+
Sbjct  426   DPCVWEEPCQFQPERFLTRHKDIDVGGQDFELIPFGSGRRMCPAVSYGLQVMPLMLASLV  485

Query  639   QGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             +GFDF TPSG PVDM E  G+++ KA P++ LL+PRL A+SY
Sbjct  486   RGFDFTTPSGEPVDMGESMGLSIAKATPLEVLLSPRLSASSY  527



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   392 bits (1006),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/501 (43%), Positives = 298/501 (59%), Gaps = 30/501 (6%)
 Frame = -2

Query  1947  GGLPILGHL---FQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  P++GH+    +  +  H++  L  MADK GP+F I +G  + L+VSS E  K  FTT
Sbjct  41    GSWPVIGHIPVIGRGPQPPHVI--LGNMADKYGPIFTINLGQHKALIVSSWEMAKQCFTT  98

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             NDK  A RP   AG  LGYN +   F+  G +WR VRK+  VELLS  +LE  +H+  SE
Sbjct  99    NDKVFATRPKHLAGKLLGYNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLRHVRESE  158

Query  1599  MNLSVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRY--NYSVEHGADNQ  1438
             +N   K LY    +N      V V+M  W   V LNIM +++  KR+    +VE   +N+
Sbjct  159   VNACTKDLYDKWERNGGESDWVLVEMNRWFADVTLNIMYRVVVGKRFLGAATVEEKEENE  218

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
                  R+A +D + L+ EF  +D  PF    WLD  G+ +AMK  +   D  LQGW++EH
Sbjct  219   RC---RKALRDFLRLSSEFVVSDKIPF--LKWLDFGGIGKAMKATAKDLDVALQGWLEEH  273

Query  1257  VR----RGDLPAG---EDPDFFDIMMKVVDQEFIAGQNYTR--DTIIKATAMAMLQDAAE  1105
              +    R +L +G   ++ DF D M+ V+      G   T   DT IKAT +A +    +
Sbjct  274   KQKRNSRSELNSGNVKDERDFMDTMLSVLGDVSAEGFPSTTIADTTIKATCLAAILGGTD  333

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
              T + + W++++LLN+++ +K+ QEE+D +VGRER V +SD  NLVYLQA+VKE +RLYP
Sbjct  334   PTTAVLTWVLSLLLNNREALKKAQEELDNQVGRERQVKESDVKNLVYLQAIVKETLRLYP  393

Query  924   VVPLGFPRESIQDCEVA---GYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESV  754
               PL  P E I+DC V     YH+  GT+L VNIWK+HR+P +W +P +F+PERFLT   
Sbjct  394   PSPLSIPHECIEDCNVGNGTNYHVKTGTRLLVNIWKIHRNPNVWLDPFRFQPERFLTTHK  453

Query  753   P-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGV  577
               D   + F +I FG GRR CP  +  L++    LA+LL GF+ ATPS  PVDM+E  GV
Sbjct  454   DFDVRGQNFEFIPFGSGRRMCPGVSLGLQVVQLTLAQLLHGFEIATPSDEPVDMTESTGV  513

Query  576   TMPKAKPVKALLTPRLPAASY  514
             T  KA P++ LLTPRLPA  Y
Sbjct  514   TNMKATPLEVLLTPRLPAKLY  534



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/493 (43%), Positives = 297/493 (60%), Gaps = 28/493 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL            LA+MADK GP+F I+ G+ R L+VS+ +  K   T ND+
Sbjct  52    GAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDR  111

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   +   + YN A       G +WR VRK+ ++ELLS  +LE  KH+  SE+  
Sbjct  112   AFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQA  171

Query  1590  SVKQLYGSVTKNR-----EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             SV  LY    ++      +V VDM+ W G + LN++ +++  KRY        D QD   
Sbjct  172   SVTHLYKRCMESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKG  224

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR-  1249
              R+A +    L G F  +DAFP  I  WLD++G  + MKK +   D V+QGW++EH RR 
Sbjct  225   -REALRSYFDLAGRFIVSDAFP--ILRWLDLDGYEKMMKKTAHELDRVVQGWLNEHKRRR  281

Query  1248  ------GDLPAGEDPDFFDIMMKVVDQ-EFIAGQNYTRDTIIKATAMAMLQDAAETTVSN  1090
                   GD     D DF D+M+ +VD  E + G  Y  DT IKAT MA++   ++TT  +
Sbjct  282   SANKRRGD-NKDSDQDFMDVMLSIVDAAEELPG--YDADTFIKATCMALVLAGSDTTSVS  338

Query  1089  MVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLG  910
             + W +++LLNH++V+K+ Q E+DT++GRER V++SD  NLVY+QA++KE MRLYP  PLG
Sbjct  339   LTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLG  398

Query  909   FPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQ  733
              P ES++DC V GYHIPKGT+L +N WK+HRD  IW +P +F+PERFLT     D   + 
Sbjct  399   VPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQN  458

Query  732   FGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             F  I FG GRR CP    A+++    LA LL GFD  T +  PVDM+E  G+T  KA P+
Sbjct  459   FELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPL  518

Query  552   KALLTPRLPAASY  514
             + L+TPRLP  +Y
Sbjct  519   EVLVTPRLPEHAY  531



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 218/533 (41%), Positives = 310/533 (58%), Gaps = 30/533 (6%)
 Frame = -2

Query  2040  AISGVLIILPFLY-----LSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALAT  1876
             A++ +L ++ FLY     +S     NK K+ PPE  G  P++GHL    +   L + L  
Sbjct  10    AVAAILTLIIFLYTLLLFVSRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFP-LHRVLGD  68

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP+F IRMG+ R LVVS+ E  K+  TT+D+  A RP       LG+N +   F+
Sbjct  69    MADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFS  128

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY-----------GSVTKNR  1552
               G  WR++RK+  +ELLS  +LEK KH+   E+   +K+LY                N+
Sbjct  129   PYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYEFWERTNNYKSSDHNNNK  188

Query  1551  EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSA  1372
             +V V+M +W   V LN + ++   +R N S     D       ++        +G+F  +
Sbjct  189   KVLVEMNKWFEDVTLNTILRVTVGQRCNSSSSQ-EDTDHEGAWKEELTKFFAFSGKFVVS  247

Query  1371  DAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGE-DPDFFDIM  1204
             D+ PF    W D+ G  RAMKK +   D + QGW+DEH R+   G +   E   DF D+M
Sbjct  248   DSLPF--LRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMDVM  305

Query  1203  MKVV--DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQE  1030
             + ++  D + + G +   DTI KAT +A++  A++T+   + WI+++LLNH+DV+K+ Q 
Sbjct  306   LSILRDDAQQLPGDDA--DTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQN  363

Query  1029  EIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGT  850
             E+D  +G+ R V++ D  NLVYLQA++KE MRLYP  PL  P  S +DC V  Y +P GT
Sbjct  364   ELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGT  423

Query  849   QLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYAL  673
              LYVN+WK+HRDP++WPEP KFKPERFLT     D   + F  + F  GRR CP  ++A+
Sbjct  424   VLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAI  483

Query  672   KMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              + H  LA LL GFDF TP   PVDMSEG  +T+ K  PVK L+TPRL A+ Y
Sbjct  484   PVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>gb|KEH18124.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=458

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/460 (42%), Positives = 294/460 (64%), Gaps = 11/460 (2%)
 Frame = -2

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MA+K G +F +R+G  + LVV+S E  K+  T NDK  A RPN+ AG YLGYNNA LA  
Sbjct  1     MAEKYGSIFSLRLGCNQTLVVNSREIAKECLTKNDKVFASRPNVAAGRYLGYNNAILALA  60

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTK-NREVEVDMEEWI  1522
               G +WR +RK+  +ELLS+ +LEK KH+   E+   VK LY  V K N  +EV + +++
Sbjct  61    PYGDYWRYMRKISTLELLSSHRLEKLKHVRDFEIYSLVKNLYTFVKKTNGSIEVPISKFL  120

Query  1521  GYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
              ++  NI+ K++A KR++    +  D++ A  LR A KD   L G F  ADA P     W
Sbjct  121   DHMTFNIIVKMIAGKRFSGETINQEDSE-AWRLRNAIKDTTYLCGVFVMADAIP--SLSW  177

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGEDPDFFDIMMKVVDQE-FIAGQ  1168
             +D +G +  MK+ +   D +L  W+ EH + R ++ +G++ DF D+++ + +++  I G 
Sbjct  178   IDFQGHVGFMKRTAKEMDFILDKWLSEHYKKRDEVQSGKEDDFMDVLISMFEEDDEICG-  236

Query  1167  NYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDD  988
              + R+T+IKAT + ++  A+ +T   + W +++L+NH  V+K+ +EE+DT +G+++WV +
Sbjct  237   -HKRETVIKATTLILILTASGSTSITLGWALSLLINHPKVLKQAKEELDTNIGKDKWVQE  295

Query  987   SDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPK  808
             SD  NL YLQA++KE +RLYP  PL   RE+  DC VAGY + KGT+L++N+WKL RDP 
Sbjct  296   SDIKNLKYLQAIIKETLRLYPPAPLTGIREATDDCHVAGYKVTKGTRLFINLWKLQRDPL  355

Query  807   IWPEPEKFKPERFLT--ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             +W  P KF+PERF    + + +   ++FG++ F +GRRSC  + + +++ H  LARL+QG
Sbjct  356   VWSNPNKFQPERFFNIHDQIDNFQNQEFGYLPFSYGRRSCAGATFGMQVLHLTLARLIQG  415

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             FD  T  G PVDM EG G+ +PK  P+  +L PRLP   Y
Sbjct  416   FDINTKDGGPVDMIEGVGLALPKENPLDVMLQPRLPLELY  455



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   390 bits (1002),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/499 (42%), Positives = 298/499 (60%), Gaps = 28/499 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQF--KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  PI+GHL      K  HLV  L  MA++ GP+F + +G+ + L+VSS E  K+ FTTN
Sbjct  25    GAWPIIGHLHLLGGSKPPHLV--LGKMAERYGPIFTVNIGVQKALIVSSSEIAKECFTTN  82

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTTGAFW-RKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DK  A RP   A   + YN A   F+  + + R+VRK+V++E+LS ++LE  KH+  SE+
Sbjct  83    DKVFASRPKFMAAEIMAYNYALFPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRESEV  142

Query  1596  NLSVKQLY-------GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
               S+K +Y        S T + +  V+M EW   +N NI+ +++  KR+  +    +   
Sbjct  143   KASMKGIYERCVTNGKSSTSSNKALVEMREWFLDINENIVIRMIVGKRFREATSSNSKGS  202

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
             +  + ++ + D + L+G F  +DA P+    WLD+ G  RAMKKV+   D V  GW++EH
Sbjct  203   NYYLKKETYMDFLRLSGTFVLSDAIPW--LRWLDLGGHERAMKKVAKELDLVFNGWLEEH  260

Query  1257  VRR----GDLPAGEDP-DFFDIMMKVVDQEFIAGQN-----YTRDTIIKATAMAMLQDAA  1108
              +R    G +  G+D  DF D+M+ ++D   + G N     Y  DT+ KAT+MA++    
Sbjct  261   KQRRKISGQVKGGDDQLDFMDVMLSILD---VDGANEITSDYDADTVNKATSMALIVAGV  317

Query  1107  ETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLY  928
             E     M W +A+LLN+++ +K+ QEE+D  +G++R V +SD  NLVYLQA++KE MRLY
Sbjct  318   EAPAVQMTWALALLLNNREALKKAQEELDQIIGKDRQVKESDIKNLVYLQAIIKESMRLY  377

Query  927   PVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-  751
             P  PL  P ES +DC V  YH+P GT+L VN+ KLHRDP++W +P +F+PERFLT     
Sbjct  378   PAGPLSLPHESTEDCMVGDYHVPAGTRLLVNLSKLHRDPRVWSDPNEFRPERFLTTHKSF  437

Query  750   DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTM  571
             D     F  I FG GRR CP  + ALK+    LA LL GF+  TP+   VDM E  GVT 
Sbjct  438   DVKGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIGTPTDETVDMGETVGVTN  497

Query  570   PKAKPVKALLTPRLPAASY  514
              KA P++ L TPRLPA  Y
Sbjct  498   NKATPLEVLFTPRLPAQLY  516



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   390 bits (1003),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 218/533 (41%), Positives = 310/533 (58%), Gaps = 30/533 (6%)
 Frame = -2

Query  2040  AISGVLIILPFLY-----LSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALAT  1876
             A++ +L ++ FLY     +S     NK K+ PPE  G  P++GHL    +   L + L  
Sbjct  10    AVAAILTLIIFLYTLLLFVSRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFP-LHRVLGD  68

Query  1875  MADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFT  1696
             MADK GP+F IRMG+ R LVVS+ E  K+  TT+D+  A RP       LG+N +   F+
Sbjct  69    MADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFS  128

Query  1695  T-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLY-----------GSVTKNR  1552
               G  WR++RK+  +ELLS  +LEK KH+   E+   +K+LY                N+
Sbjct  129   PYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNNNK  188

Query  1551  EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSA  1372
             +V V+M +W   V LN + ++   +R N S     D       ++        +G+F  +
Sbjct  189   KVLVEMNKWFEDVTLNAILRVTVGQRCNSSSSQ-EDTDHEGAWKEELTKFFAFSGKFVVS  247

Query  1371  DAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR---GDLPAGE-DPDFFDIM  1204
             D+ PF    W D+ G  RAMKK +   D + QGW+DEH R+   G +   E   DF D+M
Sbjct  248   DSLPF--LRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMDVM  305

Query  1203  MKVV--DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQE  1030
             + ++  D + + G +   DTI KAT +A++  A++T+   + WI+++LLNH+DV+K+ Q 
Sbjct  306   LSILRDDAQQLPGDD--ADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQN  363

Query  1029  EIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGT  850
             E+D  +G+ R V++ D  NLVYLQA++KE MRLYP  PL  P  S +DC V  Y +P GT
Sbjct  364   ELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGT  423

Query  849   QLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYAL  673
              LYVN+WK+HRDP++WPEP KFKPERFLT     D   + F  + F  GRR CP  ++A+
Sbjct  424   VLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAI  483

Query  672   KMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              + H  LA LL GFDF TP   PVDMSEG  +T+ K  PVK L+TPRL A+ Y
Sbjct  484   PVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>gb|KCW58033.1| hypothetical protein EUGRSUZ_H00761 [Eucalyptus grandis]
Length=537

 Score =   390 bits (1003),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 211/498 (42%), Positives = 305/498 (61%), Gaps = 24/498 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL   + ET L K LA MAD  GP+       P  L   +       FTT+DK
Sbjct  38    GAWPTIGHLHLLRGETPLAKTLAAMADAQGPIPHWPRPWPPWLTRKA--RCSGSFTTHDK  95

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA R    AGV+LGY NAA AF   G FWR++RK+ ++ELLS  +L+  KH+  SE++ 
Sbjct  96    ELASRTKSKAGVHLGYGNAAFAFAEYGDFWREMRKITMLELLSIRRLDNLKHVQASEIDT  155

Query  1590  SVKQLYGSVTKN-------REVEVDMEEWIGYVNLNIMSKIMAKKRYN--YSVEHGA---  1447
              VK L+     N           V + + +  + LNI+ +++A KRY    S   G+   
Sbjct  156   FVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTD  215

Query  1446  DNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWI  1267
             D+++A  LR+  K+ M ++G  + ++  PF    W D  G ++ MK+V+   D ++  W+
Sbjct  216   DDEEASHLRKVIKEFMYISGFPTVSELVPFT--GWTDCVGTVKTMKRVAREMDEIVGKWV  273

Query  1266  DEHV------RRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAE  1105
             +EH       +RG++      DF D+M+ V+ ++ +A   ++ +T+IKAT + ++   ++
Sbjct  274   EEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSD  333

Query  1104  TTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYP  925
             TT  N+ W++++LLNHK V+KR QEEID KVG+++WV DSD  +L YLQA+VKE +RLYP
Sbjct  334   TTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYP  393

Query  924   VVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPD  748
               PL  P E+  DC V GY IPKGT+++VN+WKLHRDP++W +PEKF PERFLT  S  D
Sbjct  394   PGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVD  453

Query  747   GLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMP  568
                + F +I FG GRR CP +A+AL+  H  LARLLQGFD A  S   VDM+EG G+ +P
Sbjct  454   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLP  513

Query  567   KAKPVKALLTPRLPAASY  514
             KA P++ +L PRLP+  Y
Sbjct  514   KATPLRVVLNPRLPSMLY  531



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   390 bits (1002),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 205/489 (42%), Positives = 301/489 (62%), Gaps = 16/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +  L + L  MADK GP+F +R+GL + LVVSS E  K+ +TT+DK
Sbjct  45    GRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSWEVAKECYTTSDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   +GY++ +  F   G +WR VRK+ +VELLS  +LE  KH+  SE+ +
Sbjct  105   VFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEMHKHVQDSEVKI  164

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K+LYG    N++    V+M+E  G + LN++ + +A KRY  +   G + +     ++
Sbjct  165   LIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRYFGTHACGDEPKRX---KK  221

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             AF+D + L G F  +D  PF    WLD M+G    MK+V+   D VL  W++EH R+  L
Sbjct  222   AFEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYVLGSWVEEH-RQNRL  278

Query  1239  PA---GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              A   G + DF   M+ V+D    +G++   DTIIK T   ++    +TT   + W +++
Sbjct  279   SANDNGAEQDFIHAMLSVIDDGQFSGRD--PDTIIKGTCSNLILAGNDTTSITLTWALSL  336

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ Q E++  VG+ R VD SD  NLVYLQA+VKE +RLYP  PL  P E+++
Sbjct  337   LLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAME  396

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAG+HI  GT+L VN+WKLHRDP++W +P +F+PERFLT+    D   + +  + FG
Sbjct  397   DCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFG  456

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++ H  LARLL GF+    +  PVDM+E PG+T PKA P++  + PR
Sbjct  457   SGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPR  516

Query  531   LPAASYN*E  505
             LP   Y+ E
Sbjct  517   LPFELYSYE  525



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   388 bits (997),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 296/487 (61%), Gaps = 32/487 (7%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL        L + L +MADK GP+F I++G+ R LVVSS E  K+  TTNDK
Sbjct  11    GAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDK  70

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN +    +  G++WR+ RK+  +ELLS  +LEK +H+   E+  
Sbjct  71    IFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKLRHVRDYEVKT  130

Query  1590  SVKQLYGSVTKNREVE---VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
              +K+LY    K++      V+M+ W      N++ +++  K  N                
Sbjct  131   CLKELYELWDKSKSTNKMLVEMKRWFEDTICNVILRMIVGKGCN----------------  174

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
                  V  ++G+F  +DA PF    WLD+ G  R+MKK +   D V+QG ++EH R+ D 
Sbjct  175   ----SVDKMSGKFVVSDALPF--LRWLDIGGDERSMKKTAKELDIVVQGCLEEHKRKRDS  228

Query  1239  P--AGEDPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                 GE+ DF  +M+ ++ D E  +G++   DTI KA  + ++    +TT   + W++++
Sbjct  229   REMKGEELDFMSVMLSILGDTEKYSGRDV--DTINKAVCLGLIIAGLDTTTVTLTWVISL  286

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLNH+D++ ++Q E+D +VG +R V++SD  NLVYLQA +KE MRLYP VPL  P E+I+
Sbjct  287   LLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIE  346

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             +C V GYH+P GTQL +N+WKL RDP++W EP KF+PERFLT+    D   +    + FG
Sbjct  347   ECTVNGYHVPAGTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLELLPFG  406

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++  F +A LLQGFDFATPS  P+DM EG G+TM K++P++ L+ PR
Sbjct  407   SGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPR  466

Query  531   LPAASYN  511
             L A+ Y 
Sbjct  467   LSASLYG  473



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   390 bits (1001),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 207/489 (42%), Positives = 302/489 (62%), Gaps = 16/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL     +    + L  MADK GP+F I +GL + LVVSS E  K+ +TTNDK
Sbjct  45    GRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECYTTNDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   +GY++A L F   G +WR VRK+ +VELLS  +LE  KH+  SE+  
Sbjct  105   VFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQDSEVEF  164

Query  1590  SVKQLYGSVTKNREVE--VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K+LYG   +N++    V+M+E  G + +N+M + +A KRY  +  H  D++     ++
Sbjct  165   LIKELYGQWARNKDSPALVEMKERFGNLVMNVMVRAIAGKRYFGT--HACDDEPKRG-KK  221

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             A  D M L G F  +DA PF    WLD ++G    MKK++   D +L  W++EH R+  L
Sbjct  222   ALDDFMLLVGLFMVSDAIPF--LGWLDTVKGYTTDMKKIAKELDYLLGRWVEEH-RQQRL  278

Query  1239  PAGEDP---DFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              A  +    DF  +M+ V+D    +G++   DT+IKAT + ++    +TT   + W +++
Sbjct  279   SANNNRAEVDFLHVMLSVIDDGQFSGRD--PDTVIKATCLNLILAGYDTTSITLTWALSL  336

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ Q E++  VG+ R VD SD  NLVYLQA+VKE +RLYP  PL  P E+++
Sbjct  337   LLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSVPHEAME  396

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAG+HI  GT+L VN+WKLHRDP++W +P +F+PERFLT     D   + +  + FG
Sbjct  397   DCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVRGKNYELLPFG  456

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++ H  LARLL GF+    +  PVDM+EGPG++ PKA P++  + PR
Sbjct  457   SGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPLEVTIVPR  516

Query  531   LPAASYN*E  505
             LP   Y+ E
Sbjct  517   LPFELYSYE  525



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   389 bits (999),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 208/499 (42%), Positives = 299/499 (60%), Gaps = 28/499 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQF--KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTN  1774
             G  PI+GHL      K  HLV  L  MA++ GP+F + +G+ + L+VSS E  K+ FTTN
Sbjct  25    GARPIIGHLHLLGGSKPPHLV--LGKMAERYGPIFTVNIGVHKALIVSSSEIAKECFTTN  82

Query  1773  DKALAGRPNICAGVYLGYNNAALAFTTGAFW-RKVRKMVVVELLSTTKLEKWKHIWISEM  1597
             DK  A RP   A   + YN A L F+  + + R+VRK+V++E+LS ++LE  KH+  SE+
Sbjct  83    DKVFASRPKFMAAEIMAYNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRESEV  142

Query  1596  NLSVKQLY-------GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
               S+K +Y        S T + +  V+M EW   +N NI+ +++  KR+  +    +   
Sbjct  143   KASMKGIYERCVTNGKSSTGSNKALVEMREWFLDINENIVFRMIVGKRFGEATSSNSKGS  202

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
             +  + ++ + D + L+G F  +DA P+    WLD+ G  RAMKKV+   D V  GW++EH
Sbjct  203   NYYLKKETYMDFLRLSGTFVLSDAIPW--LRWLDLGGHERAMKKVAKELDLVFNGWLEEH  260

Query  1257  VRR----GDLPAGEDP-DFFDIMMKVVDQEFIAGQN-----YTRDTIIKATAMAMLQDAA  1108
              ++    G +   +D  DF D+M+ ++D   + G N     Y  DT+ KAT+MA++    
Sbjct  261   KQKRKISGQVKGDDDQLDFMDVMLSILD---VDGANEITTDYDADTVNKATSMALIVAGV  317

Query  1107  ETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLY  928
             E     M W +A+LLN+++ +K+ QEE+D  +G+ R V +SD  NLVYLQA++KE  RLY
Sbjct  318   EAPAVQMTWALALLLNNREALKKAQEELDQIIGKGRQVKESDIKNLVYLQAIIKESTRLY  377

Query  927   PVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-  751
             P  PL  P ES +DC V  YH+P GT+L+VN+ KLHRDP++W EP +F+PERFLT     
Sbjct  378   PAGPLSLPHESTEDCMVGDYHVPAGTRLFVNLSKLHRDPRVWSEPNEFRPERFLTTHKSF  437

Query  750   DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTM  571
             D     F  I FG GRR CP  + ALK+    LA LL GF+ ATP+  PVDM E  G+T 
Sbjct  438   DVKGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIATPTDEPVDMVETVGLTN  497

Query  570   PKAKPVKALLTPRLPAASY  514
              KA P++ L TPRLPA  Y
Sbjct  498   NKATPLEVLFTPRLPAQLY  516



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 220/535 (41%), Positives = 321/535 (60%), Gaps = 22/535 (4%)
 Frame = -2

Query  2064  MDALIRVV--AISGVLIILPFLYL----SLRkqknktkkpppepPGGLPILGHLFQFKKE  1903
             M+ L+R +  +++G L IL FLYL    S   ++N ++  PPE  G  PI+GHL      
Sbjct  1     MEFLLRHIDTSVAGFLAILLFLYLVQKRSSSFRRNDSRISPPEAAGRWPIIGHLHLLGGS  60

Query  1902  THLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLG  1723
                   LA +ADK GP+F IR+G  R LVVSS E  K+ FT ND A A RPN+ A  +LG
Sbjct  61    QLPHITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKECFTINDLASASRPNLLAAKHLG  120

Query  1722  YNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVT-----  1561
             Y  A       G FWR++RK+  V+LLS  +LE  KHI ISE+   VK+LY   T     
Sbjct  121   YKYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVKELYEHWTTKWND  180

Query  1560  --KNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTG  1387
                + +  V+M++    + LN++ +++A KRY+     G D ++A ++++  K+ +   G
Sbjct  181   NDHSGQASVEMKQRFSDLTLNVILRMVAGKRYSIDANDGGDVKEARLVQKEIKEFLKHLG  240

Query  1386  EFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDLPAGE--DPDF  1216
              F   DA P+    WLD+ G  +AMKK +   D ++  W++EH + R ++   E  + DF
Sbjct  241   LFVPGDAIPY--LGWLDLGGCEKAMKKTAKALDGIVGEWLEEHKQNRAEMNNEEKKEQDF  298

Query  1215  FDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRI  1036
              D+M+ V+      G  +  DTIIKAT + M+   ++TT   + W +++LLN+  V+K+ 
Sbjct  299   MDVMLSVLHGSDFGG--FDADTIIKATILNMIAGGSDTTALTLTWAVSLLLNNHHVLKKA  356

Query  1035  QEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPK  856
             QEE++  VG+ R V++SD   L Y+ A+VKE +RLYPV PL  PR  ++DC + GYH+ K
Sbjct  357   QEELENNVGKNRTVNESDIGKLTYIFAIVKETLRLYPVAPLSAPRVFLEDCTIGGYHVAK  416

Query  855   GTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAY  679
             GT+L  NIWK+  DP +WP+P +FKPERFLT +   D   + F  I FG GRR+CP +++
Sbjct  417   GTRLITNIWKIQTDPILWPDPFEFKPERFLTTNKDVDVRGQHFELIPFGSGRRACPGTSF  476

Query  678   ALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             AL+M  F LA  LQ FD +TP    VDM+E  G+T  KA P++ L+TPRLPA  Y
Sbjct  477   ALQMVQFTLASFLQAFDISTPLNALVDMTESFGLTNTKATPLEVLITPRLPAELY  531



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   388 bits (996),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/486 (40%), Positives = 297/486 (61%), Gaps = 14/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL   + +  L      MADK GPVF++ +G+ R LVV+S EA K+   TNDK
Sbjct  15    GSWPIIGHLHLLRSQKPLAHLFGEMADKYGPVFMLHLGMRRTLVVNSWEAAKECLATNDK  74

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   AG +LGYN A + F   G++WR VRK+++VELLS  +LE  KH+   EM+ 
Sbjct  75    VFATRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARLETLKHVRSMEMDT  134

Query  1590  SVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +++LY    +N  R V+V+M+ W+G +  NI+ +++A KRY  S   G  + +A   R+
Sbjct  135   CIRELYELWLRNNRRPVKVEMKRWLGGLAYNIVVRVVAGKRYFGS---GTGSDEAWRFRK  191

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRR--GD  1243
             A   +  L   F ++D FP     W+D  G   AMK  +   D+++ G ++EH +R    
Sbjct  192   AISRLFGLLDAFVASDMFP--CLKWMDWRGHESAMKNTAQEVDSIMAGLLEEHRQRRLSG  249

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
                G   DF D+M+ +V+    +G +   D +IKAT++A++    +TT +++ W +A+L+
Sbjct  250   KATGGPQDFMDVMLSIVEDAEFSGMDV--DAVIKATSLALIMGGTDTTTTSLAWTLALLV  307

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
              +  V+K+ Q+EID  VG++R V++SD  NL+YLQA+VKE +RLYP   L    E++ DC
Sbjct  308   KNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVLRLYPAAKLLVQHEAMADC  367

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT--ESVPDGLARQFGWITFGF  709
              + GY +  GT+L+VN+WKL RDP +W EP +F+PERFL+   +  D   + F  I FG 
Sbjct  368   RIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAPHAGVDVRGQHFELIPFGS  427

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRRSCP  ++AL++ H  LARL+QGF+  TP G P +M++  G+  P   P++ LL+PRL
Sbjct  428   GRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDLGLPYPNTTPLEVLLSPRL  487

Query  528   PAASYN  511
                 Y 
Sbjct  488   ADMLYE  493



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   390 bits (1002),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 213/518 (41%), Positives = 317/518 (61%), Gaps = 16/518 (3%)
 Frame = -2

Query  2025  LIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMADKIGPVFI  1846
             L++   L+LS R + +  KKP PEP G  P++GHL     +      L  +A+K GP+F+
Sbjct  42    LLVYSLLWLSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFM  101

Query  1845  IRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVR  1669
             I++G+ R L+VS+ E  K+ FTTNDK  + R    A   LGYN A   F+  G +WR++R
Sbjct  102   IKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIR  161

Query  1668  KMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVE----VDMEEWIGYVNLNI  1501
             K+  +E+LS  +LE  KH+  SE+  S+K+LY    K+ +      V+M+E    V LN+
Sbjct  162   KIATLEVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSDGSGKALVEMKERFNAVTLNV  221

Query  1500  MSKIMAKKRY----NYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDM  1333
              ++++  KR          H   +++    R+A +    LTG F+ ADA PF    WLD+
Sbjct  222   ATRMVVGKRLFVGGTGKTNHQEIDEENDRCRKAIRKFSELTGGFAIADAVPF--LRWLDL  279

Query  1332  EGLIRAMKKVSDGTDAVLQGWIDEH----VRRGDLPAGEDPDFFDIMMKVVDQEFIAGQN  1165
             +G  ++M + +   D +L+GW+ +H    +   D    ++ DF D+M+ V+ +      +
Sbjct  280   DGCEKSMGRTAKELDQILEGWLKDHKQKRISSDDQVIKDENDFMDVMISVLTEADEEIPS  339

Query  1164  YTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDS  985
             +  DTI KAT +A++    +TT+  + W + ++LNH DV+K++Q+E+DT +GRER V++S
Sbjct  340   FDADTITKATCLALILGGTDTTMVTLTWALTLVLNHGDVLKKVQDELDTHIGRERQVNES  399

Query  984   DTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKI  805
             DT  LVYLQAVVKE +RLYP  PL  P ESI+DC +AGYH+P GT+L+VNI K+ RDP +
Sbjct  400   DTKKLVYLQAVVKETLRLYPATPLSVPHESIEDCTIAGYHVPAGTRLFVNIPKIQRDPNV  459

Query  804   WPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFD  628
             W +P +F+PERFLT     D   + F  I FG GRR CP  ++AL++    LA LL GF+
Sbjct  460   WEKPNEFRPERFLTTHKDIDVRGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFE  519

Query  627   FATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             FATP   P+DMSEG G+T  KA P++ LLTPRL A  +
Sbjct  520   FATPGDEPLDMSEGVGLTNLKATPLQVLLTPRLHAPLF  557



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 208/491 (42%), Positives = 299/491 (61%), Gaps = 17/491 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          K L +MA+K GP+F I+MG+ R LVVS+ E  K+ FTT+DK
Sbjct  50    GAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A +GRP   A   L Y+ A + F+  G +WR+VRK+  VELLS  +LEK K +  SE+  
Sbjct  110   AFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRA  169

Query  1590  SVKQLY---------GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQ  1438
              +K+LY          S +K   V V+ME W G + LNI+ + +  K   Y + +  D +
Sbjct  170   FLKELYKLWDDNRGGASKSKGSMVLVEMERWFGDLTLNIVLRTIVGKTVGY-ITNVEDEE  228

Query  1437  DAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH  1258
                  ++  KD    TG F  +DA PF  F  LD+ G   AMKK +   D V++ W++EH
Sbjct  229   SVKGWKKGLKDFFHWTGVFPVSDALPFLRF--LDLGGHGEAMKKTAKELDLVVEDWLEEH  286

Query  1257  VRR--GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMV  1084
              R+    +  G++ DF D+M+ V D +  A Q    DTI KAT++ ++  A++TT   ++
Sbjct  287   KRKRAAGIVKGKE-DFMDLMLDVFDNDAEAVQGGDSDTINKATSLTLILAASDTTAVTLI  345

Query  1083  WIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFP  904
             W +++L+N+ + +K+ Q E+DT V +ER V++SD  NLVYL+AV+KE +RLYP  PL  P
Sbjct  346   WALSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLKAVLKETLRLYPPGPLLIP  405

Query  903   RESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFG  727
              E+I+DC + GYH+P+GT+L VN+ K+HRD ++W  P +F PERFLT     D   + F 
Sbjct  406   HEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFE  465

Query  726   WITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKA  547
             ++ FG GRR CP  ++AL      LA LL GFDFATPSG PVDM E  G+T  +A P++ 
Sbjct  466   FLPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHENSGLTNLRATPLEV  525

Query  546   LLTPRLPAASY  514
             LL PRLP+  Y
Sbjct  526   LLCPRLPSRLY  536



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   387 bits (995),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 214/493 (43%), Positives = 295/493 (60%), Gaps = 28/493 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL            LA+MADK GP+F I+ G+ R L+VS  +  K   T ND+
Sbjct  7     GAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDR  66

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   +   + YN A       G +WR+VRK+ ++ELLS  +LE  KH+  SE+  
Sbjct  67    AFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHSEVQA  126

Query  1590  SVKQLYGSVTKN-----REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             SV  LY    ++     ++V VDM+ W G + LN++ +++  KRY        D QD   
Sbjct  127   SVTHLYKRCMESYTGAPKKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKG  179

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV---  1255
              R+A +    L G F  +DAFP  I   LD++G  R MKK +   D V+QGW++EH    
Sbjct  180   -REALRSYFDLAGRFIVSDAFP--ILRRLDLDGYERMMKKTAQELDRVVQGWLNEHKSRR  236

Query  1254  ----RRGDLPAGEDPDFFDIMMKVVDQ-EFIAGQNYTRDTIIKATAMAMLQDAAETTVSN  1090
                 RRGD     D DF D+M+ +VD  E I G  Y  DT IKAT MA++   ++TT   
Sbjct  237   SANKRRGD-NKDSDRDFMDVMLSIVDAAEEIPG--YDADTFIKATCMALILAGSDTTSVT  293

Query  1089  MVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLG  910
             + W +++LLNH++V+K+ Q E+DT++GRER V++SD  NLVY+QA++KE MRLYP  PLG
Sbjct  294   LTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLG  353

Query  909   FPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQ  733
              P ES++DC V GYHIPKGT+L  N WK+HRD  IW +P +F+PERFLT     D   + 
Sbjct  354   VPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQN  413

Query  732   FGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             F  I FG GRR CP    A+++    LA LL GFD  T +  PVDM++  G+T  KA P+
Sbjct  414   FELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNLKATPL  473

Query  552   KALLTPRLPAASY  514
             + L+TPRLP  +Y
Sbjct  474   EVLVTPRLPEHAY  486



>ref|XP_011030924.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=521

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 217/526 (41%), Positives = 314/526 (60%), Gaps = 15/526 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             MD L  +  I    I+L   YL LR+ K+   K  PE  G  PI+GHL            
Sbjct  1     MDILPYLSTIIPTAIVLFSCYL-LRRSKSSKTKLAPEAGGAWPIIGHLPLLAGSELPHLR  59

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             L  +ADK GP+F IR+G+   LVVSS E  K++FT ND  ++ R  + A   LGYN A+ 
Sbjct  60    LGDLADKYGPIFTIRIGMYPALVVSSWELAKELFTINDAIVSSRSKLTASKILGYNFASF  119

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYG---SVTKNREVE--  1543
              F+  G FWR +RK+V  ELLS  +LE  KH+  SE+ +SVK+LY    S  KN E +  
Sbjct  120   GFSPYGEFWRGIRKIVASELLSNRRLELLKHVRASEVEVSVKELYKLWYSKDKNEESQIL  179

Query  1542  VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAF  1363
             V+M++WI  +NLN+M +++A KRY Y      +  +A   ++A ++   LTG F   DA 
Sbjct  180   VNMKQWIADMNLNLMLRMIAGKRY-YDAGIVTEENEARRCQRAMREFFHLTGLFVLRDAV  238

Query  1362  PFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL--PAGEDPDFFDIMMKVVD  1189
             PF    WLD  G  +AMK+ ++  D +   W++EH R+ D    A ++ DF D+M+  +D
Sbjct  239   PF--LGWLDWGGYEKAMKRNAEELDNIFAEWLEEHRRKRDSGESANKEQDFMDVMLYALD  296

Query  1188  QEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVG  1009
                +AG  Y  DT+ KAT+++++    +T    ++W +++LLN+   +K  QEE+D  VG
Sbjct  297   GINLAG--YDADTVRKATSLSLIIGGTDTITVTIIWALSLLLNNTVALKNAQEELDVHVG  354

Query  1008  RERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIW  829
             +ER V++SD + L YLQA VKE +RLYP  PLG  RE   DC + GYH+P GT+L +NI 
Sbjct  355   KERLVNESDIEKLTYLQACVKEALRLYPAGPLGGFREFTADCTIGGYHVPAGTRLLLNIH  414

Query  828   KLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFIL  652
             K+ RDP++WP P +FKPER L +    D   + F  I FG GRR+CP +   L+M+H +L
Sbjct  415   KIQRDPRVWPNPTEFKPERLLGSHEAVDVKGQHFELIPFGAGRRACPGATLGLRMSHLVL  474

Query  651   ARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             A +LQ F+ + PS  P+DM+   G+T   A P++ L+ PRLPA+ Y
Sbjct  475   ASILQAFEISPPSNAPIDMTGTAGLTCSPATPLQVLVKPRLPASVY  520



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   392 bits (1006),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 302/489 (62%), Gaps = 16/489 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +  L + L  MADK GP+F +R+GL + LVVSS E  K+ +TT+DK
Sbjct  128   GRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSWEVAKECYTTSDK  187

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   +GY++ +  F   G +WR VRK+ +VELLS  +LE  KH+  SE+ +
Sbjct  188   VFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEMHKHVQDSEVKI  247

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K+LYG    N++    V+M+E  G + LN++ + +A KRY  +   G + + A   ++
Sbjct  248   LIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRYFGTHACGDEPKRA---KK  304

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             AF+D + L G F  +D  PF    WLD M+G    MK+V+   D VL  W++EH R+  L
Sbjct  305   AFEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYVLGSWVEEH-RQNRL  361

Query  1239  PA---GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              A   G + DF   M+ V+D    +G++   DTIIK T   ++    +TT   + W +++
Sbjct  362   SANDNGAEQDFIHAMLSVIDDGQFSGRD--PDTIIKGTCSNLILAGNDTTSITLTWALSL  419

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ Q E++  VG+ R VD SD  NLVYLQA+VKE +RLYP  PL  P E+++
Sbjct  420   LLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAME  479

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAG+HI  GT+L VN+WKLHRDP++W +P +F+PERFLT+    D   + +  + FG
Sbjct  480   DCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFG  539

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++ H  LARLL GF+    +  PVDM+E PG+T PKA P++  + PR
Sbjct  540   SGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPR  599

Query  531   LPAASYN*E  505
             LP   Y+ E
Sbjct  600   LPFELYSYE  608



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   389 bits (999),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 219/537 (41%), Positives = 322/537 (60%), Gaps = 24/537 (4%)
 Frame = -2

Query  2064  MDALIRVV--AISGVLIILPFLY----LSLRkqknktkkpppepPGGLPILGHLFQFKKE  1903
             M+ L+R +  A++G L +L FLY     S R ++N ++K PPE  G  PI+GHL      
Sbjct  1     MEFLLRHIYTAVAGFLAMLLFLYSVQKRSSRLRRNDSRKSPPEAAGRWPIIGHLHLLGGS  60

Query  1902  THLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLG  1723
                   LA +ADK GP+F +R+G    LVVSS E  K+ FT ND ALA RPN+ A  ++G
Sbjct  61    QLPHITLANLADKCGPIFTVRIGSHPGLVVSSSEMAKECFTINDLALASRPNLLAAKHMG  120

Query  1722  YNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVT-----  1561
             YN A       G FWR++RK+  V+LLS  +LE  KHI ISE+   VK+LY   T     
Sbjct  121   YNYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVKELYEHWTTKWND  180

Query  1560  ---KNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLT  1390
                 + +  V+M++    ++LN++ +++A KRY+     G D ++A ++++  K+   L 
Sbjct  181   NDHHSGQASVEMKQRFLDLSLNVILRMVAGKRYSVDANDGGDVKEARLVQKEIKEFFKLL  240

Query  1389  GEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGDL---PAGEDP  1222
             G F   DA P+    WLD+ G  +AMKK +   D ++  W++EH + R ++      E  
Sbjct  241   GLFVPGDAIPY--LGWLDLGGCEKAMKKTAKALDGIVGEWLEEHKQNRAEMNNDEKKEQD  298

Query  1221  DFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMK  1042
             DF D+M+ V+      G  +  DTIIKAT + M+   ++T  + + W +++LLN+  V+K
Sbjct  299   DFMDVMLSVLHGSDFGG--FDADTIIKATILNMIAGGSDTIPATLTWAVSLLLNNHHVLK  356

Query  1041  RIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHI  862
             + QEE++  VG+ R V +SD   L Y+ A+VKE +RLYPV PL  P   ++DC + GYH+
Sbjct  357   KAQEELENNVGKNRVVSESDIGKLTYIFAIVKETLRLYPVAPLSVPHVFLKDCTIGGYHV  416

Query  861   PKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPAS  685
              KGT+L  NIWK+  +P +WP+P +FKPERFLT +   D   + F  I FG GRR+CP +
Sbjct  417   AKGTRLITNIWKIQTNPILWPDPFEFKPERFLTTNKDVDIRGQHFELIPFGSGRRACPGT  476

Query  684   AYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             ++AL+M  F LA  LQ FD +TP   PVDM+E  G+T  KA P++ L+TPRLPA  Y
Sbjct  477   SFALQMVQFTLASFLQAFDISTPLNAPVDMTESFGLTNTKATPLEVLITPRLPAELY  533



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/487 (41%), Positives = 295/487 (61%), Gaps = 21/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P+ GHL          + L  MADK GP+F I+MG+ R LVVS+ E  K+  TT+DK
Sbjct  50    GAWPVTGHLHLLGGPEPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMAKECLTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A    GYN +   F+  G++WR+ RK+  VELLS  +LEK KH+   E+  
Sbjct  110   VFASRPKTLAMEIFGYNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLKHVRDYEVKT  169

Query  1590  SVKQLYGSVTKNREVE----VDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +K+LY    KN+       V+++ W      N++ +++  K        G ++ D    
Sbjct  170   CLKELYELWDKNKSTNEMLLVELKRWFADTIRNVVLRMIVGK--------GCNSVDGEEW  221

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
              +       ++G+F  +DA PF    WLD+ G  R+MK +++  D +LQGW+++H R+ +
Sbjct  222   MELLTRSFEMSGKFVVSDALPF--LRWLDIGGDERSMKNIAEELDNLLQGWLEKHKRKRN  279

Query  1242  LP--AGEDPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   E+ DF  +M+ ++ D+E  +G++   DT+ KAT + ++  A +TT   + W+++
Sbjct  280   SQEIKEEELDFMSVMLLILGDKEQYSGRDV--DTVNKATCLGLILAATDTTAVTLTWVIS  337

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLNH+D++ + Q E+D +VG +R V++SD  NLVYLQA++KE MRLYP VPL  P ES+
Sbjct  338   LLLNHRDILNKAQNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHESM  397

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
             ++C V GYHIP GTQL++N WKL RDP++W EP KF P+RFLT     D   + F  + F
Sbjct  398   EECIVNGYHIPAGTQLFINAWKLQRDPRVWEEPYKFHPKRFLTRHKDIDVKGQNFELLPF  457

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
               GRR CP  ++AL++  F LA LL GFDFATPS  PVDM EG G+TM K+ P+  L+ P
Sbjct  458   SSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLVVLVAP  517

Query  534   RLPAASY  514
             RL A+ Y
Sbjct  518   RLSASLY  524



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   390 bits (1003),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/486 (42%), Positives = 300/486 (62%), Gaps = 16/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +  L + L  MADK GP+F +R+GL + LVVSS E  K+ +TT+DK
Sbjct  113   GRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSWEVAKECYTTSDK  172

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   +GY++ +  F   G +WR VRK+ +VELLS  +LE  KH+  SE+ +
Sbjct  173   VFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLEMHKHVQDSEVKI  232

Query  1590  SVKQLYGSVTKNRE--VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K+LYG    N++    V+M+E  G + LN++ + +A KRY  +   G + + A   ++
Sbjct  233   LIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRYFGTHACGDEPKRA---KK  289

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             AF+D + L G F  +D  PF    WLD M+G    MK+V+   D VL  W++EH R+  L
Sbjct  290   AFEDFIILLGLFMVSDVIPF--LGWLDTMKGFTAEMKRVAKEVDYVLGSWVEEH-RQNRL  346

Query  1239  PA---GEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
              A   G + DF   M+ V+D    +G++   DTIIK T   ++    +TT   + W +++
Sbjct  347   SANDNGAEQDFIHAMLSVIDDGQFSGRD--PDTIIKGTCSNLILAGNDTTSITLTWALSL  404

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++  +K+ Q E++  VG+ R VD SD  NLVYLQA+VKE +RLYP  PL  P E+++
Sbjct  405   LLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAME  464

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAG+HI  GT+L VN+WKLHRDP++W +P +F+PERFLT+    D   + +  + FG
Sbjct  465   DCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFG  524

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++ H  LARLL GF+    +  PVDM+E PG+T PKA P++  + PR
Sbjct  525   SGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPR  584

Query  531   LPAASY  514
             LP   Y
Sbjct  585   LPFELY  590



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   387 bits (995),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 202/485 (42%), Positives = 300/485 (62%), Gaps = 14/485 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVK-ALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  P LGHL      T L   +L  +ADK GP+F IR+G+ R +VVSS E +K++FTTND
Sbjct  38    GAWPFLGHLNIISGHTGLPHVSLGNLADKHGPIFGIRIGVHRAVVVSSSEVIKELFTTND  97

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
              A++ RP++ AG +L Y+ A L F++ G +WR++RK+V +EL S  ++E  +++ +SE  
Sbjct  98    AAVSSRPSVKAGKHLAYDYAMLGFSSYGTYWRQMRKLVSLELFSARRVELQRNVRVSETA  157

Query  1593  LSVKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
               + +LY +  + R+    V V+M+E  G +++N++ K++A KR++     G D ++A  
Sbjct  158   HFINELYSAWEERRDGSSRVSVEMKELFGELSMNVILKMVAGKRFS----GGDDAEEARR  213

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG  1246
              R+  ++   L G F  +DAFP+    WLD+ G  R MK+ ++  D ++  W+ EH R+ 
Sbjct  214   CRRVMREFFHLAGLFVLSDAFPY--LGWLDLGGHERRMKRTAEEMDELVGEWLAEHRRKE  271

Query  1245  DLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
                 G+  DF D+M+  V       + Y  DTIIKAT   ++    +TT    +W +A+L
Sbjct  272   YSGEGKAQDFMDVMLSEVKGANFECE-YDVDTIIKATCGTLIAGGTDTTAVVFIWALALL  330

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
             LN+  V+++ Q E+DT VG++R V++SD +NLVYLQA+ KE +RLYP  PLG  R   QD
Sbjct  331   LNNPHVLQKAQHELDTHVGKQRRVNESDLNNLVYLQAITKETLRLYPPGPLGGTRRLTQD  390

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGF  709
             C V GYHIPK T L VN+WKLHRDP++W +P +F+PERFL  E   D   + F  I F  
Sbjct  391   CHVGGYHIPKETWLIVNLWKLHRDPRVWSDPSEFRPERFLNGEKSMDVKGQDFELIPFSA  450

Query  708   GRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             GRR CP + + L+M H +LA LLQ FD +  S   +DMSE  G+T  KA P+  L+ PRL
Sbjct  451   GRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLIAPRL  510

Query  528   PAASY  514
             P + Y
Sbjct  511   PPSLY  515



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   388 bits (996),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 214/493 (43%), Positives = 295/493 (60%), Gaps = 28/493 (6%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL            LA+MADK GP+F I+ G+ R L+VS  +  K   T ND+
Sbjct  52    GAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDR  111

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   +   + YN A       G +WR+VRK+ ++ELLS  +LE  KH+  SE+  
Sbjct  112   AFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHSEVQA  171

Query  1590  SVKQLYGSVTKN-----REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             SV  LY    ++     ++V VDM+ W G + LN++ +++  KRY        D QD   
Sbjct  172   SVTHLYKRCMESYTGAPKKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKG  224

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV---  1255
              R+A +    L G F  +DAFP  I   LD++G  R MKK +   D V+QGW++EH    
Sbjct  225   -REALRSYFDLAGRFIVSDAFP--ILRRLDLDGYERMMKKTAQELDRVVQGWLNEHKSRR  281

Query  1254  ----RRGDLPAGEDPDFFDIMMKVVDQ-EFIAGQNYTRDTIIKATAMAMLQDAAETTVSN  1090
                 RRGD     D DF D+M+ +VD  E I G  Y  DT IKAT MA++   ++TT   
Sbjct  282   SANKRRGD-NKDSDRDFMDVMLSIVDAAEEIPG--YDADTFIKATCMALILAGSDTTSVT  338

Query  1089  MVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLG  910
             + W +++LLNH++V+K+ Q E+DT++GRER V++SD  NLVY+QA++KE MRLYP  PLG
Sbjct  339   LTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLG  398

Query  909   FPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQ  733
              P ES++DC V GYHIPKGT+L  N WK+HRD  IW +P +F+PERFLT     D   + 
Sbjct  399   VPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQN  458

Query  732   FGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPV  553
             F  I FG GRR CP    A+++    LA LL GFD  T +  PVDM++  G+T  KA P+
Sbjct  459   FELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNLKATPL  518

Query  552   KALLTPRLPAASY  514
             + L+TPRLP  +Y
Sbjct  519   EVLVTPRLPEHAY  531



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   387 bits (995),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 214/528 (41%), Positives = 312/528 (59%), Gaps = 20/528 (4%)
 Frame = -2

Query  2064  MDALIRVVAISGVLIILPFLYLSLRkqknktkkppp--epPGGLPILGHLFQF--KKETH  1897
             MD  + VV ++   I+L  L+      K ++       E  G  PI+GHL      +  H
Sbjct  1     MDLFLIVVTLATSFILLFILHKQFYSVKKQSSSSRKVPEAGGAWPIIGHLHLLGGSESDH  60

Query  1896  LV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGY  1720
             L  K L  +ADK GP+F +++G+ +++VVS  +  K+ FTTND ALAGRP   A   +GY
Sbjct  61    LPHKMLGRLADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEIIGY  120

Query  1719  NNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR---  1552
              +A     + G +WR+ RK+  +EL S  ++E  KHI   E+   +K++Y +  KN    
Sbjct  121   KHAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSGIKEIYNNWEKNNLNG  180

Query  1551  EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSA  1372
              V+++M+EWIG + +N M KI+  K    + + G +        +A +    L G F  A
Sbjct  181   VVKMEMKEWIGDLFMNTMGKILFGKGRRSNEDEGINKA-----HKAIRRFFELLGVFVVA  235

Query  1371  DAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMMKV  1195
             D  P+    WLD+ G  +AMK+VS   D+V++ W+ EH  +RG + +GE+ DF D+M+ V
Sbjct  236   DFLPY--LRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHKTKRGIIKSGEEEDFMDVMLSV  293

Query  1194  VDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTK  1015
              +   + G +   DT IKAT MA+L    +TT+  + WI+++LLN+   +++ Q+E+D  
Sbjct  294   CEDRDLPGVD--ADTAIKATCMALLSAGTDTTMVTLTWILSLLLNNYQSLQKAQDELDAH  351

Query  1014  VGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVN  835
             VG+ RWV +SD  NLVY QA+VKE +RLYP  PL  P ES++DC ++GY IPKGT+L VN
Sbjct  352   VGKNRWVQESDIKNLVYFQAIVKEALRLYPAGPLSLPHESMEDCTISGYDIPKGTRLLVN  411

Query  834   IWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITFGFGRRSCPASAYALKMAHF  658
             IWK+ RDP IWP P +FKPERFL T    D     F  + FG GRR CP  + AL++  F
Sbjct  412   IWKIQRDPNIWPNPHEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPF  471

Query  657   ILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             ++A LLQGFD       P+DMSE  G+T+ KA P++ LL PRL    Y
Sbjct  472   VIAMLLQGFDMKRLLDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  519



>ref|XP_008235427.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   388 bits (996),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 203/487 (42%), Positives = 293/487 (60%), Gaps = 12/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P +GHL   + +  +   L  MAD  GP+F +++G  ++LV+S+ E VK+  TTND+
Sbjct  51    GAWPFIGHLPLLRGKDPVAITLGAMADDHGPLFSLKLGQHQVLVLSAWETVKECLTTNDR  110

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP++  G YLGY+NAA A    G +WR VRK+  +ELLST ++E   H+  SE++L
Sbjct  111   VFATRPSMAGGKYLGYDNAAFAIAPYGPYWRHVRKLATLELLSTKRVEMLSHVRTSEVDL  170

Query  1590  SVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              VK L    TKN  R   V + E I ++  NI  +++A KR+  + ++   N DA    +
Sbjct  171   FVKNLLSLCTKNGSRTTPVHLSELIEFLTFNINVRLIAGKRFT-AEQYNEKNSDAWRFEK  229

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLD-MEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL  1240
             A KD + L G F  +DA P+    WLD + G + +MK+     D VL  W++EH +R   
Sbjct  230   AVKDALYLLGVFVWSDAMPW--LEWLDILFGHVGSMKRCFKELDCVLGKWLEEHRQRSRP  287

Query  1239  PAGED---PDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                 D    D  D+MM    +E      ++RD +IKATA+ ++    E+T   + W +++
Sbjct  288   QCKIDRVESDLMDVMMSSFQEEDDVIFGHSRDDVIKATALVLILTGTESTSVTLTWALSL  347

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+   +K +Q+E+D  VGR+RWV +SD  NL YLQA++KE +R+YP  PL   RE+ +
Sbjct  348   LLNNPTTLKAVQQELDIHVGRDRWVQESDLPNLKYLQAILKETLRIYPPGPLAGLREATE  407

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLARQ--FGWITF  715
             DC +AGYH+PKGT++ VNIWKL RD +IW  P +F+PERF+T         Q  F +I F
Sbjct  408   DCHLAGYHVPKGTRVLVNIWKLQRDARIWANPGEFQPERFMTTRADVEFKDQNNFEYIPF  467

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRRSCP     L++   ILARL+QGFD +      VDM EG G+ +PKA P++ALL+P
Sbjct  468   GSGRRSCPGMVLGLQVVQLILARLVQGFDISRVGEEAVDMREGLGLALPKANPLEALLSP  527

Query  534   RLPAASY  514
             RLP   Y
Sbjct  528   RLPLHLY  534



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   387 bits (994),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 194/479 (41%), Positives = 297/479 (62%), Gaps = 10/479 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL     +  + K L  +ADK GP++ +R+G   IL+VSS E VKD FTTND+
Sbjct  43    GAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDR  102

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
              LA R  I AG  +GY+NA  A    G +WR +RK+   ELLS+ +LE  KH+  SE++ 
Sbjct  103   ILATRAKIVAGKLMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLELLKHVRYSEVDT  162

Query  1590  SVKQLYGSVTKN--REVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
              +K LY   ++N     +V + + I  +  NI  K++A KR++ + ++     +A  + +
Sbjct  163   FIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFS-AKDYEEQGSEAWRINR  221

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLP  1237
             A K+   L G F   DA P+    W+D +G + +MK  +   D V+  W+ E ++     
Sbjct  222   AIKEATHLFGVFILGDAIPW--LEWIDFQGHVGSMKSTAKEIDDVIGNWLKERLQNKLQG  279

Query  1236  AGEDP--DFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
              G +   D  D+++  + ++ + G  +TRDT++KATA+ ++   +E+T   ++W M++LL
Sbjct  280   EGHNGKGDLIDVLLSKLQEDAVMG-GHTRDTVVKATALILILTGSESTYLGIIWTMSLLL  338

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             NH   +K+ QEE+D  VGR+RWV++SD   L YL+A+VKE +R+YP  P+   RE+++DC
Sbjct  339   NHPKELKKAQEELDVHVGRDRWVNESDMKKLKYLRAIVKETLRIYPPGPVTGIREAMEDC  398

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
             E+ GYH+PKGT+L VNIWKLHRDP++W  P +F+PERFLT     D   + F ++ F FG
Sbjct  399   EIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYVPFSFG  458

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRL  529
             RRSCP     L++    LAR+LQGFD AT  G PVDM  G G+ +PK+ P++ ++ PRL
Sbjct  459   RRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVDMQIGLGLALPKSNPLEVIIKPRL  517



>ref|XP_006346673.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=518

 Score =   387 bits (993),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 203/488 (42%), Positives = 297/488 (61%), Gaps = 18/488 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT-ND  1771
             G LP +GHL+    +  + + L  M DK GP+F +++G    LVVSS E VKD FT  ND
Sbjct  38    GALPFIGHLYLLSGDLPVCRILGLMTDKYGPIFQLQLGSHPALVVSSWEMVKDCFTAGND  97

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K  A RP++    YLGYN A  A    G +WR +RKMV VELL+ ++LEK KH+  SE+N
Sbjct  98    KIFASRPSMALSKYLGYNGAIFALAPYGQYWRDIRKMVTVELLTNSRLEKLKHVRTSEVN  157

Query  1593  LSVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQA  1414
              S+K LY + + N   EV++  W   +  NI+ +++  KR+    E   +       +++
Sbjct  158   CSIKDLYSNCSSNNNSEVNLSSWFENITFNIIIRMLVGKRFTGCFEAEMN------FKES  211

Query  1413  FKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHV-RRGDL-  1240
              K V+ L G F  +DA P     W+D+ G I++MK+     D+VL  W+ +H+ +R D  
Sbjct  212   IKKVLYLGGTFVFSDAIP--SIEWMDIGGHIKSMKQTYKEVDSVLDSWLKQHIEKRKDCD  269

Query  1239  --PAGED-PDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                +G D  DFFD+M+  + +E +    Y R+ IIKATA+ ++  A+E+T   ++W ++M
Sbjct  270   SNSSGSDQSDFFDVMLSTLPEETME-SGYDRNAIIKATALILIMTASESTAETLIWALSM  328

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             L+N    +K  Q+E++  VGR RWV++SD  NL YLQA+VKE +RLYP  PL  PRE+I+
Sbjct  329   LINGTRSLKLAQDELEEHVGRNRWVEESDIKNLPYLQAIVKETLRLYPPGPLAGPREAIE  388

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPER-FLTE-SVPDGLARQFGWITF  715
             DC V  YHI KGT+L VN+WKL RD +IW +P +FKPER FL E S  +   + F +I F
Sbjct  389   DCYVGNYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLKEHSEFNFRGQNFEYIPF  448

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
               GRR CP   +  ++ H  LA+LL GF+ +T    P+D+SEG G+ +PK KP++  ++P
Sbjct  449   SSGRRMCPGLTFGSQVVHLTLAKLLHGFNISTTREEPIDLSEGLGIALPKVKPLQPFVSP  508

Query  534   RLPAASYN  511
             RL    Y 
Sbjct  509   RLAVELYQ  516



>ref|XP_010526011.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Tarenaya hassleriana]
Length=524

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 197/487 (40%), Positives = 297/487 (61%), Gaps = 10/487 (2%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  PILGHL     + +L+ + L  +AD+ GP F +++G  + LVVSS +  K+  T ND
Sbjct  39    GSWPILGHLHLLGGKNNLLYRTLGALADEYGPAFGLQLGSQKALVVSSWDVAKECLTVND  98

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             +  A RP      ++GYN A   F    +++R +RK+V  ELLS  +++K  H+ ISE+ 
Sbjct  99    RTFASRPKTVGAKHMGYNYALFGFAPYDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIE  158

Query  1593  LSVKQLYGSVTK---NREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             + +K +Y   +K   +  V VD+++W+  +NLN++ K++A KRY +      +  +A   
Sbjct  159   MGIKDIYNLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYAFGDATADEADEARRC  218

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
              +A      L G F  +DA PF      D++G  + MKK +   D +L+GW+ EH RR  
Sbjct  219   PKATARFFQLMGLFVLSDALPF--LGRFDLQGHEKEMKKNAAEIDGILEGWLQEHERRRA  276

Query  1242  LPAGE-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAML  1066
             L   + D DF D+M+   +Q  ++   +   T IKAT +AM+   ++T V  +VW  A+L
Sbjct  277   LGKTDGDSDFIDVMLSQKEQGKLSNLKHDERTAIKATCLAMILGGSDTLVGTLVWAFALL  336

Query  1065  LNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQD  886
              N+++++K+ +EEID  VG++R V+DSD + LVYLQA+ KE +RLYP  PL  PRE+ +D
Sbjct  337   ANNREILKKAREEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATED  396

Query  885   CEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGLAR--QFGWITFG  712
             C VAGY +  GT+L VN+WK+HRDPKIW  P++F PERFL     +   R   +  + FG
Sbjct  397   CTVAGYQVTAGTRLMVNVWKVHRDPKIWSNPDEFIPERFLEGKASEYSVRGQSYELLPFG  456

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  + A+++ H +LAR L  FD +T SGM VDM E PG+T+PK KP++ LL+PR
Sbjct  457   SGRRSCPGISLAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPR  516

Query  531   LPAASYN  511
             L    Y+
Sbjct  517   LKKELYD  523



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   387 bits (993),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/487 (42%), Positives = 293/487 (60%), Gaps = 18/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFK-KETHLV--KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTT  1777
             G  PI+GHL      ET  +  K +  MADK GP+F +++G+ +++VVS  +  K+ FTT
Sbjct  61    GAWPIIGHLHLLSGSETEQLPHKIMGRMADKYGPIFGMKLGVHQVVVVSDPKLAKECFTT  120

Query  1776  NDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISE  1600
             ND ALAGRP   A   +GY +A  A +  G +WR+ RK+  +EL S  ++E  KHI   E
Sbjct  121   NDLALAGRPKSMASEIVGYKHAMFALSAYGPYWRETRKIATIELFSARRIEMLKHIREFE  180

Query  1599  MNLSVKQLYGSVTKNR---EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAV  1429
             +   +K++Y    KN     V+++M+EWIG + +N M KI+  K    + + G +     
Sbjct  181   VKSGIKEIYSDWGKNNLNGVVKMEMKEWIGDLVMNTMGKILFGKGRRSNEDEGINKA---  237

Query  1428  VLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VR  1252
                +A +    L G F  AD  P+    WLD+ G  +AMK+VS   D+V++ W+ EH  +
Sbjct  238   --HKAIRRFFELLGAFVVADFLPY--LRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHKTK  293

Query  1251  RGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
             RG + +GE+ DF D+M+ + +   + G  +  DT IKA  M +L    +TT+  + W + 
Sbjct  294   RGIIKSGEEEDFMDVMLSICEDRDLPG--FDADTAIKANCMGLLSAGTDTTIVTLTWALC  351

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+ + +K+ Q+E+D  VG  RWV +SD  NLVYLQA+VKE +RLYP  PL  P ES+
Sbjct  352   LLLNNYEALKKAQDELDAHVGNNRWVQESDIKNLVYLQAIVKEVLRLYPAGPLSVPHESM  411

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFL-TESVPDGLARQFGWITF  715
             +DC + GY IPKGT+L VN+WK+  DP IWP P +FKPERFL T    D     F  + F
Sbjct  412   EDCVIGGYDIPKGTRLLVNLWKIQHDPNIWPNPHEFKPERFLSTHKDVDVKGNHFELMPF  471

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
             G GRR CP  + AL++  F++A LLQGFD   PS   +DMSE  G+T+ KA P++ LL P
Sbjct  472   GSGRRMCPGISLALQVVPFVIAVLLQGFDMKRPSDEAIDMSESFGLTVLKASPLQVLLAP  531

Query  534   RLPAASY  514
             RL +  Y
Sbjct  532   RLASVLY  538



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 280/481 (58%), Gaps = 6/481 (1%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI GHL            L  MADK GP+F I++G  R +VVS  E  K+ FTTNDK
Sbjct  51    GAWPITGHLHLLGGPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDK  110

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A   RP   A   LGYN A   F+  G +WR VRK+  +ELLS   LE  +H+  + +  
Sbjct  111   AFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREAVVRA  170

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
             S K+ Y          ++M+ W   +  N++ K++  K+Y+ +     D       R A 
Sbjct  171   STKEAYERSNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQNDRCRIAL  230

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG  1231
             K    L G+F ++D  PF  F WLD+ G ++AMK+ +   D V+ GW+DEH R+      
Sbjct  231   KSFFELGGQFVASDVLPF--FRWLDIGGYVKAMKRTAKELDDVVGGWLDEHKRKRACGEA  288

Query  1230  E-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHK  1054
             E D DF D+M+ ++    +   +Y  DTI KAT +A++    +TT   + W +++LLN++
Sbjct  289   EGDRDFMDVMLSILGTADVL-PSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNNR  347

Query  1053  DVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVA  874
              V+K+ Q+E+D+++GRER V +SD  N VY+QA++KE +RLYP  PL  P ES++DC + 
Sbjct  348   HVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTIG  407

Query  873   GYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGL-ARQFGWITFGFGRRS  697
              Y +P GT+L +NI KLH +P +WP P +F+PERFLT     G+  + F ++ FG GRR 
Sbjct  408   SYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDLGVWGQNFEYLPFGSGRRM  467

Query  696   CPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAAS  517
             CP  ++AL++ H +LA LL  F+  T S  P DM  G G+T PK  P++ +LTPRLP   
Sbjct  468   CPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVLTPRLPPHL  527

Query  516   Y  514
             Y
Sbjct  528   Y  528



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/520 (40%), Positives = 310/520 (60%), Gaps = 14/520 (3%)
 Frame = -2

Query  2052  IRVVAISGVLIILPFLY----LSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA  1885
             +    ++G+  +L FLY    +S R      KK PPEP G  P++GHL            
Sbjct  8     LSATVVTGIFSLLLFLYTLFNISTRVVGAHRKKLPPEPAGHWPVIGHLHLLSATEPAHIT  67

Query  1884  LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAAL  1705
             LA +AD  GP+F +++G+ + LVVSS E  K+ FTTND+  A RP + A   LGYN   L
Sbjct  68    LAKLADTYGPIFTLKLGMSKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLGYNYNML  127

Query  1704  AFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEVDMEE  1528
               +  G +WR +RK+  +ELL+  +L +++HI   E+  S+K+LY S  +N++  V+M  
Sbjct  128   GLSPYGPYWRHIRKLATLELLTNRRLHQFQHIREFEVQTSIKKLYESCIRNKKALVEMNT  187

Query  1527  WIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIF  1348
             W G + LN + +I+  K+++ +++  AD  +  V R A ++     G F  +D+FPF   
Sbjct  188   WFGDITLNTIFRIVVGKKFSIAMDGSADRNE--VYRTALREFFEWFGVFVPSDSFPF--L  243

Query  1347  HWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDPDFFDIMM-KVVDQEFIAG  1171
              W D+ G  +AMKK +   D V   W+ EH +R      E+ DF D+++  V D E    
Sbjct  244   KWFDLGGHEKAMKKTAKILDEVFDKWLQEHRQRRKFEESEN-DFMDVLLSNVKDAEQFP-  301

Query  1170  QNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVD  991
              NY  DT+IK++ + ++    +TT   M+W +++LLN+++ +KR Q E+D ++GR + V 
Sbjct  302   -NYDADTVIKSSCLGLILAGFDTTTVTMIWALSLLLNNEEALKRAQLELDEQIGRHKQVK  360

Query  990   DSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDP  811
             +SD  NL YL+A+VKE +RLYP  PLG P ES +DC++AGYHIP GT+L VNI KL RDP
Sbjct  361   ESDIVNLKYLRAIVKETLRLYPAGPLGVPHESTEDCKIAGYHIPAGTRLMVNIQKLQRDP  420

Query  810   KIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             + W +P +F+PERFLT E   D   +    I FG GRR CPA ++AL++ H  LA  L G
Sbjct  421   REWKDPCEFRPERFLTSEKDFDVGGKNPKLIPFGTGRRMCPAVSFALQIMHLTLANFLHG  480

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             F+   PS   +DM E  G+T  K +P++ +++PRLP   Y
Sbjct  481   FEIERPSQDLIDMEESAGMTSIKKEPLRVIISPRLPPQLY  520



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/486 (41%), Positives = 293/486 (60%), Gaps = 14/486 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI+GHL          K L  MADK GP+F IR+G+   LVVS+ +  K+ FTTNDK
Sbjct  30    GAWPIIGHLHLLGGSELRHKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKECFTTNDK  89

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A A RP   A   LGY+         G +W ++RK+ + ELLS  +LE  KH+  SE++ 
Sbjct  90    AFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKITMSELLSNRRLELLKHVRDSEIDA  149

Query  1590  SVKQLYGSVTKNRE-----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             S++ LY  V KN +     V VDM++W G + LN++ +++A KRY+ S+    D  +A  
Sbjct  150   SIQDLY-KVWKNHDKAKGPVLVDMKQWFGDLTLNVILRMIAGKRYSGSMS-SCDETEART  207

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-R  1249
              ++  +D   L G F   DA P+    W D++G  + MK  +   D+V Q W++EH R R
Sbjct  208   CQKGMRDFFRLLGLFIIEDALPY--LSWFDLQGYKKEMKNTAKELDSVFQRWLEEHNRMR  265

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                    + DF D++M +++   I+   Y  DTIIK+T ++++    +TT+  + WI+++
Sbjct  266   QTGELNREQDFMDVLMSILEDTRIS--EYDNDTIIKSTCLSIVTGGGDTTMVTLTWILSL  323

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+K  +K+ Q+E+D+ VG++R V++SD  NLVYLQA+ KE +RLYP  PL  PR +  
Sbjct  324   LLNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQAITKEALRLYPAGPLSGPRVADA  383

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC VAGYH+P GT+L VN +K+ RDP +W EP +F+PERFLT  V  D     +  I FG
Sbjct  384   DCTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPERFLTSHVNMDVKGLHYELIPFG  443

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRRSCP  ++ L++   +LAR L  FD  T   MPVDM+E  G+T  KA P++ ++TPR
Sbjct  444   AGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVDMTETAGLTNAKATPLEVVITPR  503

Query  531   LPAASY  514
             L    Y
Sbjct  504   LHPEIY  509



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 280/481 (58%), Gaps = 6/481 (1%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  PI GHL            L  MADK GP+F I++G  R +VVS  E  K+ FTTNDK
Sbjct  46    GAWPITGHLHLLGGPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDK  105

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
             A   RP   A   LGYN A   F+  G +WR VRK+  +ELLS   LE  +H+  + +  
Sbjct  106   AFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREAVVRA  165

Query  1590  SVKQLYGSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAF  1411
             S K+ Y          ++M+ W   +  N++ K++  K+Y+ +     D       R A 
Sbjct  166   STKEAYERSNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQNDRCRIAL  225

Query  1410  KDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAG  1231
             K    L G+F ++D  PF  F WLD+ G ++AMK+ +   D V+ GW+DEH R+      
Sbjct  226   KSFFELGGQFVASDVLPF--FRWLDIGGYVKAMKRTAKELDDVVGGWLDEHKRKRACGEA  283

Query  1230  E-DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHK  1054
             E D DF D+M+ ++    +   +Y  DTI KAT +A++    +TT   + W +++LLN++
Sbjct  284   EGDRDFMDVMLSILGTADVL-PSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNNR  342

Query  1053  DVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVA  874
              V+K+ Q+E+D+++GRER V +SD  N VY+QA++KE +RLYP  PL  P ES++DC + 
Sbjct  343   HVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTIG  402

Query  873   GYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVPDGL-ARQFGWITFGFGRRS  697
              Y +P GT+L +NI KLH +P +WP P +F+PERFLT     G+  + F ++ FG GRR 
Sbjct  403   SYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDLGVWGQNFEYLPFGSGRRM  462

Query  696   CPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAAS  517
             CP  ++AL++ H +LA LL  F+  T S  P DM  G G+T PK  P++ +LTPRLP   
Sbjct  463   CPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVLTPRLPPHL  522

Query  516   Y  514
             Y
Sbjct  523   Y  523



>gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum]
Length=534

 Score =   386 bits (991),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 211/496 (43%), Positives = 302/496 (61%), Gaps = 26/496 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKET-----HLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVF  1783
             G  P++GHL            H+   L  +ADK GP+F IR+G+ R++VVSS E +K++F
Sbjct  42    GAWPVIGHLRIMSGHPSAGIPHV--NLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELF  99

Query  1782  TTNDKALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWI  1606
             TTND A++ RP++ AG +L Y+NA L F + GA+WR++RK+V +ELLS  +LE   H+ +
Sbjct  100   TTNDVAVSSRPSVKAGKHLAYDNAMLGFASYGAYWRQLRKIVSLELLSNRRLELQSHVSM  159

Query  1605  SEMNLSVKQLY---------GSVTKNRE-VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVE  1456
             SE    VK+LY         GS T+  E V VDM+ W+G +N+N++ +++A KR+     
Sbjct  160   SETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFG----  215

Query  1455  HGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQ  1276
              G + ++    R+   D   L G F  ADA P+    WLD+ G  + MKK +   D V+ 
Sbjct  216   SGDNAEETKRCRRVMGDFFYLAGFFVPADALPY--LGWLDLGGHEKRMKKAAKELDEVVG  273

Query  1275  GWIDEHVRRGDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTV  1096
              W+ EH  R     G+  DF D+M+ VV    +  + +  DTIIKAT   ++    +TT 
Sbjct  274   EWLAEHREREFSGEGKAQDFMDVMISVVKGADLQCE-FDVDTIIKATCGTLIAGGTDTTA  332

Query  1095  SNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVP  916
                VW +++LLNH  V+K+ Q+E+D  VG++R V +SD +NL+YLQA+VKE +RLYP  P
Sbjct  333   VVFVWALSLLLNHSHVLKKAQQELDKHVGKDRRVKESDLNNLIYLQAIVKETLRLYPPGP  392

Query  915   LGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLT-ESVPDGLA  739
             L   R   +DC V GY+IPK T L VN+WKL RDP++W +P +F+PERFL  +   D   
Sbjct  393   LAGTRRFTEDCVVGGYYIPKDTWLIVNLWKLQRDPRVWSDPLEFRPERFLAGDKTFDVKG  452

Query  738   RQFGWITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAK  559
             + F  I FG GRR CP  ++ L+M H +LA LLQ FD +T S   VDMSE  G+T  KA 
Sbjct  453   QDFELIPFGAGRRICPGLSFGLQMLHLVLASLLQAFDMSTVSDEAVDMSESAGLTNMKAT  512

Query  558   PVKALLTPRLPAASYN  511
             P+  ++TPRLP   YN
Sbjct  513   PLDVVVTPRLPPRLYN  528



>ref|XP_010040235.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW45364.1| hypothetical protein EUGRSUZ_L00957 [Eucalyptus grandis]
Length=531

 Score =   385 bits (990),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/490 (40%), Positives = 307/490 (63%), Gaps = 20/490 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL    K  H  +  A+MAD+ GP+F +R+GL  ++VV+S E  K+ +T +D 
Sbjct  47    GAWPVIGHLPMLAKSQHPHRTFASMADEYGPIFTVRVGLFPVVVVNSSEVAKECWTKHDL  106

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKH-IWISEMN  1594
             ALA RP + A   +GYNNA   F+  G +WR+VRK+  +ELLS  ++E   + I  S  +
Sbjct  107   ALASRPRLLATEVMGYNNAFFGFSPYGQYWREVRKLANMELLSNRRIESLVNPIVASVTD  166

Query  1593  LSVKQLYGSVTKNR----EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVV  1426
             +++K+L+   T+ +     + +D+++W   + LNI+ +++A K Y YS     D ++   
Sbjct  167   VAIKELHKLWTEKKNESGHILIDLKQWFASLCLNIVIQVVAGKGY-YSGIATVDEEEERR  225

Query  1425  LRQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRG  1246
                A ++ +   G F+ ADA PF     LD+ G  + M+ ++   D++L GW++EH R  
Sbjct  226   CHHALREFLHYLGVFTVADALPF--LRRLDLGGHEKTMRGIAKDLDSILSGWLEEHKRNS  283

Query  1245  DLPAGE--DPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
             +  + +    DF D+M+  ++ + + G  Y  DTIIKAT +AM+    +TT+  + W ++
Sbjct  284   ESSSEKRGHRDFMDVMLSTINDKEMGG--YDADTIIKATCLAMISGGTDTTMGTLTWAVS  341

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLN+  ++K+ QEE+DT++G++R+V++SD  NL Y+ A+VKE +RL+P  PLG P ESI
Sbjct  342   LLLNNLHILKKTQEELDTQIGKQRYVNESDVANLGYVFAIVKETLRLHPPGPLGVPHESI  401

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTE----SVPDGLARQFGW  724
             QDCE+ G+++PKGT+   NIWK+  DP+ WPEP +FKPERFL+      V D   R F +
Sbjct  402   QDCEINGHYVPKGTRFMFNIWKIQNDPRTWPEPMEFKPERFLSSHKDVEVKD---RNFEF  458

Query  723   ITFGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKAL  544
             + FG GRR CP  ++ L+  H +LAR L  F+ +T   +PVDMSE  G+T+ KA P+K +
Sbjct  459   LPFGGGRRICPGMSFGLQFVHSMLARFLHAFEISTLDNLPVDMSETFGITIEKATPLKVM  518

Query  543   LTPRLPAASY  514
             LTPRLP   Y
Sbjct  519   LTPRLPDEVY  528



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 206/520 (40%), Positives = 306/520 (59%), Gaps = 18/520 (3%)
 Frame = -2

Query  2046  VVAISGVLIILPFLYL-SLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKALATMA  1870
             ++A++  +  L F Y+  L     K  K  PE  G  PI+GHL          K    MA
Sbjct  5     LIALTLAISFLSFFYVRKLFFSAKKQSKNVPEAAGAWPIIGHLHLLNGPQMPHKIFGQMA  64

Query  1869  DKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAF-TT  1693
             +K GP+F +++G+  +++VS  +  K+ FTTNDKA A RP   A   LGYN A       
Sbjct  65    EKYGPIFRLKLGVNDVVIVSDHKIAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPY  124

Query  1692  GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNR---EVEVDMEEWI  1522
             G +WR++RK+V  E LS  ++E  KH+   E+  +VK+ Y    KN     V+++M+EW 
Sbjct  125   GPYWREIRKIVTTEFLSARRIEMLKHVREFEVKSAVKETYEYWLKNNLNGAVKIEMKEWF  184

Query  1521  GYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
             G + +N M K++   +Y      G ++++     +A + ++ L G F  AD  P+    W
Sbjct  185   GNLIMNTMVKLLFGVQYT-----GNEDEERSKAHKAIQRLLELLGAFVVADFLPY--LRW  237

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDL---PAGEDPDFFDIMMKVVDQEFIAG  1171
             LD+ G  + MK  +   D +++ W+ EH R+  L     G++ DF D+M+ + + + + G
Sbjct  238   LDIGGHEKIMKSTAKEIDFIVEDWLAEHRRKRKLRGNNCGDEEDFMDVMLSICEDKNLHG  297

Query  1170  QNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGRERWVD  991
               +  D IIKAT MA+     +TT+  ++WI+++LLN+ + +K+ Q+E+DT +G+ RWV 
Sbjct  298   --FDTDAIIKATCMALQTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQ  355

Query  990   DSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWKLHRDP  811
             +SD  NLVYLQA+VKE  RLYP  PL  P ESI+DC V+GY IPKGT+L VN+WKL  DP
Sbjct  356   ESDIKNLVYLQAIVKESFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDP  415

Query  810   KIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMAHFILARLLQG  634
             +IWP P +FKPERFLT     D     F  I FG GRR CP  + AL++  ++++ LLQG
Sbjct  416   EIWPNPHEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQG  475

Query  633   FDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             FD   PS   +DMSE  G+T+ KA P++  LTPRL +  Y
Sbjct  476   FDIKRPSDEAIDMSESFGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 217/530 (41%), Positives = 320/530 (60%), Gaps = 18/530 (3%)
 Frame = -2

Query  2064  MDALIRVVAISGVL--IILPFLYLSLR--kqknktkkpppepPGGLPILGHLFQFKKETH  1897
             MD+L    +I+  L  II+   YLS R     +K K  PPE  G  PILGHL      T 
Sbjct  1     MDSLPYANSITAGLFTIIIVSYYLSRRWRAANHKGKLSPPEAKGAWPILGHLPLLGGSTP  60

Query  1896  LVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYN  1717
                 L  MADK GP++ IR+G+   LV+SS E  K+ FTTND ++  RP +    ++GYN
Sbjct  61    PHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVNSRPKMAVVDHIGYN  120

Query  1716  NAALAFT-TGAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGS-VTKNRE--  1549
              A   F  +G +WR++RK+  +ELLS  ++E  KHI +SE+   +K+L+ +  T+ +E  
Sbjct  121   YAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRVSEVTTFLKELHKTWSTRQKEGS  180

Query  1548  ---VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFS  1378
                V V++++W G + LN++ +++A KRY+ + +   + ++A+ ++ A ++     G F 
Sbjct  181   NDGVVVELKQWFGDMTLNVIVRMVAGKRYSVAADED-EKKEALRVQNALREFFNFVGMFL  239

Query  1377  SADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEH-VRRGDLPAGEDPDFFDIMM  1201
               DA P+    WLD+ G  +AMKK +   DA++  W++EH  RR    A  + DF D M+
Sbjct  240   VGDAVPY--LRWLDLGGHEKAMKKTAKDLDAMVGEWVEEHKQRRAKGGAKGEQDFIDAML  297

Query  1200  KVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEID  1021
              V+D   + G  +  DTI KAT++ M+   ++TT+  + W +++L+N+  V+KR   E+D
Sbjct  298   SVLDGADLGG--FDADTINKATSLNMIAGGSDTTMVTLTWAISLLVNNPHVLKRALNELD  355

Query  1020  TKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLY  841
             TK+GR+R V + D  NLVY+QA+VKE +RLYP  PL  PRE  +DC +AG HI KGT+L 
Sbjct  356   TKIGRQRVVSEEDISNLVYIQAIVKETLRLYPAAPLSGPREFTEDCTIAGCHIRKGTRLI  415

Query  840   VNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFGRRSCPASAYALKMA  664
             +N+WKL  DPKIWP+P +FKPERFLT     D     F  I FG GRR+CP  A+AL+M 
Sbjct  416   MNLWKLQTDPKIWPDPLEFKPERFLTTHKDVDVKGHHFELIPFGSGRRACPGLAFALQMV  475

Query  663   HFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              F LA  L  F+ + PS  P+DM+E  G+T  K  P+K L+ PRL    Y
Sbjct  476   QFTLASFLHAFEISNPSSAPIDMTESFGLTNMKVTPLKVLIKPRLSFEFY  525



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   385 bits (989),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 198/483 (41%), Positives = 302/483 (63%), Gaps = 14/483 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLV-KALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTND  1771
             G  P +GHL        L+ + L  MADK G  F+I +G+ R LV+SS E  K+ FTTND
Sbjct  45    GAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHRALVISSWEVTKECFTTND  104

Query  1770  KALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMN  1594
             K  + RP   A   +GY++A + F   G++WR+VRK+  V+LLS  +LE  KH+  +E+ 
Sbjct  105   KLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQLLSNHRLELLKHVRDTEVK  164

Query  1593  LSVKQLYGSVTKNR-EVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQ  1417
             + +K+L+    KN   V V+M+E    + +NI+ +++A KRY Y  E  AD+Q++   ++
Sbjct  165   VFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIVRMIAGKRY-YRSETNADDQESKRFQK  223

Query  1416  AFKDVMTLTGEFSSADAFPFRIFHWLDM-EGLIRAMKKVSDGTDAVLQGWIDEHVRR---  1249
             A  D + L G F ++D  PF    WLD+ +G    MK+ +   D V    + EH  +   
Sbjct  224   ALGDFLYLLGLFLASDNIPF--LGWLDIVKGYTGQMKRTAKELDDVFGRLVQEHRHKRLN  281

Query  1248  GDLPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
             G +   E+ DF D+M+ V+D    + ++   DT+IKAT ++++    +TTV+ + W +++
Sbjct  282   GSINKDEE-DFIDVMLSVMDDGKTSPEDA--DTVIKATCLSLISGGNDTTVTTITWALSL  338

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN++ V+K+ Q+E+D  VG+ R V++SD  NL+YLQA+VKE +RL P +PL  PRE+++
Sbjct  339   LLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKETLRLCPPLPLSAPREAME  398

Query  888   DCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFG  712
             DC + G+HIP GT+L VN+WK+HRDP IW  P +F P+RFL E+   D   + F ++ FG
Sbjct  399   DCTIDGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDRFLNENAKLDVNGQDFEFLPFG  458

Query  711   FGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPR  532
              GRR CP  ++AL++ H  LARLL  F   T S   VDMS  PG+T+PKA P++  LTPR
Sbjct  459   SGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGITVPKATPLEVTLTPR  518

Query  531   LPA  523
             +P+
Sbjct  519   VPS  521



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   385 bits (988),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 202/484 (42%), Positives = 303/484 (63%), Gaps = 21/484 (4%)
 Frame = -2

Query  1938  PILGHLFQF--KKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKA  1765
             P++GHL      +  H+V  L  MA+K GP+F I+MG+ R LVV++ E  K+  TTNDKA
Sbjct  51    PVIGHLHLLGGPQPAHIV--LGDMAEKYGPIFTIKMGVYRALVVNNWETAKECLTTNDKA  108

Query  1764  LAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLS  1588
              A RP   A   L Y++A   F   G +WR++RK+  +ELLS+ +L++ KH+  SE+  S
Sbjct  109   FASRPKTLAMELLSYDHAMFGFAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQSEIKTS  168

Query  1587  VKQLYGSVTKNRE----VEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLR  1420
             +K+LY   ++N++    V V+M+ W   V LN++ +++  KR    +     + +    +
Sbjct  169   LKELYQHWSENKDSSDKVLVEMKAWFRDVTLNVILRMIVGKR----IPSSDSDAEGERWK  224

Query  1419  QAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVR-RGD  1243
              A +D   L+G+F  +DA PF    WLD+ G  R MKKV+   D V +GW+ +H R +  
Sbjct  225   DALRDFFDLSGKFVISDALPF--LKWLDIGGDERFMKKVTKELDEVAEGWLQDHKRMKAS  282

Query  1242  LPAGEDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLL  1063
                  D DF D+M  ++      G+ +  DTI KAT +AM+  A++TT+  + W +++LL
Sbjct  283   GNQESDQDFMDVMFSILSD---VGK-HDADTINKATCLAMILAASDTTMVTLTWALSLLL  338

Query  1062  NHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDC  883
             N++  +K+ QEE+D  VGR++ V++SD   LVYL+A++KE +RLYP  PL  P ES++DC
Sbjct  339   NNRGALKKAQEELDIHVGRDKLVEESDIKKLVYLRAILKETLRLYPAGPLSLPHESMEDC  398

Query  882   EVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITFGFG  706
              V+GYHIP GT+L +N++K+HRDP++W +P +F+PERFLT     D   + F  I FG G
Sbjct  399   IVSGYHIPAGTRLLINVYKIHRDPRVWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSG  458

Query  705   RRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLP  526
             RR CP  ++AL++    LA LLQGF+  TP   PVDMSE  G+T  KA P++ L+TPRLP
Sbjct  459   RRMCPGVSFALQVLELTLANLLQGFELGTPLDEPVDMSEAMGLTNLKASPLEVLITPRLP  518

Query  525   AASY  514
             A  Y
Sbjct  519   AVCY  522



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   385 bits (988),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/488 (40%), Positives = 295/488 (60%), Gaps = 23/488 (5%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          + L  MADK GP+F I+MG+ R LVVS+ E  K+  TT+DK
Sbjct  50    GAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN +   F+  G++WR+ RK+  +ELLS  +LEK K +   E+  
Sbjct  110   VFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKT  169

Query  1590  SVKQLY----GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +K+LY     + + N+ + V+M+ W+     N++ +++  K        G ++ D+   
Sbjct  170   CLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRMIVGK--------GCNSMDSEEW  221

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++       ++G+F  +DA PF    WLD+ G  R+MKK++   D V+QGW++EH  + D
Sbjct  222   KELLTRFFEMSGKFVVSDALPF--LRWLDIGGDERSMKKIAKELDVVVQGWLEEHKMKRD  279

Query  1242  LPA--GEDPDFFDIMMKVVDQEFIAGQNYTRD--TIIKATAMAMLQDAAETTVSNMVWIM  1075
                   E+ DF  +M+ ++       Q Y RD  TI KA  + ++  A +TT   + WI+
Sbjct  280   SQEMNQEEEDFMYVMLSILGD---TDQYYGRDVDTINKAICLGLILAATDTTAVTLTWII  336

Query  1074  AMLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRES  895
             ++LLNH D++ + + E+D +VG +R V++SD  NLVYLQA++KE MRLYP  PL  P ES
Sbjct  337   SLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHES  396

Query  894   IQDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESV-PDGLARQFGWIT  718
             I++C V+GY++P GTQL++N+WKL RDP +W EP KF+PERFLT     D   + F  + 
Sbjct  397   IEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLP  456

Query  717   FGFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLT  538
             F  GRR CP  ++AL++  F LA LL GFD ATPS  P+DM EG G+T+ K+ P++ L+ 
Sbjct  457   FSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVA  516

Query  537   PRLPAASY  514
             PRL A+ Y
Sbjct  517   PRLSASLY  524



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   385 bits (988),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 198/488 (41%), Positives = 306/488 (63%), Gaps = 15/488 (3%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G LP++GH+     +    K L  MADK GPVF IR+G  R+LV++S E  K+ FT +DK
Sbjct  45    GALPVIGHMHLLGGQQLTHKTLGAMADKYGPVFSIRLGSHRVLVLNSWEMAKECFTVHDK  104

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               + RP+I A  +LGY+ A   F   G++WR++RK+  +ELLS+ +++  KHI  SE+  
Sbjct  105   VFSTRPSIAASKHLGYDFAMFGFAPYGSYWREMRKIATIELLSSHRIDMLKHIRASEVKT  164

Query  1590  SVKQLYGS----VTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
             ++++LY S     +   EV VDM++W G +  NI  +++  +RY +      +  DA   
Sbjct  165   AIRELYKSWLSKGSAETEVFVDMKQWFGDLTHNIALRMVGGRRY-FGPNADCEEADARRC  223

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++  +D + L G F  +DA PF    WLD +G  ++MK+ +   D++++ W++EH ++  
Sbjct  224   QKVMRDFVYLFGVFVLSDAIPF--LGWLDFQGYEKSMKRTAKQLDSLVERWLEEHKQKRL  281

Query  1242  LPAG--EDPDFFDIMMKVVDQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAM  1069
                G  E+ DF D+M+ +++   I G  +  DTI KAT + ++   ++TT+  + W +++
Sbjct  282   SGGGVIEEQDFMDVMLNILEDGKITG--FDADTINKATCLNLILAGSDTTMVTLTWALSL  339

Query  1068  LLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQ  889
             LLN+  V+KR Q+E+D  VG++R +++SD  NLVYLQ++VKE +RLYP  P+   R +++
Sbjct  340   LLNNPRVLKRAQDELDMHVGKDRPLEESDISNLVYLQSIVKETLRLYPPSPIIGLRAALE  399

Query  888   DCEVA-GYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESVP-DGLARQFGWITF  715
             DC ++ GYHIP GT+L VN WK+ RD ++WP+P  F+PERFLT     D   + F  I F
Sbjct  400   DCTLSTGYHIPSGTRLMVNAWKIQRDERVWPDPHDFQPERFLTSHKDMDFRGQTFELIPF  459

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMP-VDMSEGPGVTMPKAKPVKALLT  538
             G GRRSCP ++ ALKM HFIL R L  FD A PS +  VDM+E  G+T  KA P++ L+T
Sbjct  460   GSGRRSCPGTSLALKMVHFILGRFLHSFDVAKPSKLEDVDMTESAGLTNLKATPLEVLVT  519

Query  537   PRLPAASY  514
             PRL +  Y
Sbjct  520   PRLNSQLY  527



>gb|AJD25201.1| cytochrome P450 CYP82D71 [Salvia miltiorrhiza]
Length=516

 Score =   384 bits (986),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 219/525 (42%), Positives = 306/525 (58%), Gaps = 33/525 (6%)
 Frame = -2

Query  2046  VVAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLVKA------  1885
             VV  +   I L F YL   +  + T + PPE  G  P LGHL       HL+        
Sbjct  7     VVYGAAAFISLLFYYLIRLRSADPTLRAPPEAGGAWPFLGHL-------HLISGGPSSGL  59

Query  1884  ----LATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYN  1717
                 L  +ADK GP+F IR+G+ R  VVSS E  K  FT ND A++ RP++ AG +LGY 
Sbjct  60    PHVNLGALADKHGPIFTIRIGVHRAAVVSSWELAKQAFTANDAAVSSRPSVKAGKHLGYG  119

Query  1716  NAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKNREVEV  1540
              A L F   GA WR++RK+   EL S  +LE+ + + ++E  + V +L+    + R   V
Sbjct  120   YAMLGFAEHGAHWRQLRKLASAELFSARRLEQQRRVRVAETLIFVGELHALWQRERGAAV  179

Query  1539  DMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVLRQAFKDVMTLTGEFSSADAFP  1360
             D++E +G +NLN+M +++A K            ++A   R+  +D   + G F  +DAFP
Sbjct  180   DVKERLGELNLNVMLRLVAGKELR-------GGEEARRCRRVMRDFFHMAGLFVPSDAFP  232

Query  1359  FRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP--DFFDIMMKVVDQ  1186
             +    WLD+ G  R MK+ ++  D ++  W+ EH R+    +GED   DF D+M+ VV  
Sbjct  233   Y--LEWLDIGGHERRMKRAAEEMDEIVGEWLAEHRRKE--YSGEDKAQDFMDVMLSVVKG  288

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
             E   G  Y  DTIIKAT   ++    +TT    +W +A+LLN++ V+++ QEE+D  VG+
Sbjct  289   EDF-GSEYDVDTIIKATCGTLIAGGTDTTSVVFIWAIALLLNNRRVLEKAQEELDKHVGK  347

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
             ER V++SD  NLVYLQA+VKE +RLYP  PLG  R   QDC + GY+IPKGT L VN+WK
Sbjct  348   ERRVEESDIANLVYLQAIVKETLRLYPPGPLGGARRVTQDCSIGGYNIPKGTWLIVNLWK  407

Query  825   LHRDPKIWPEPEKFKPERFLT-ESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILA  649
             LHRDP++W +P +F+PERFL  ES  D   + F  I FG GRR CP   + ++M H +LA
Sbjct  408   LHRDPRVWQDPSEFRPERFLNGESNADVKGQDFELIPFGAGRRICPGINFGVQMLHLVLA  467

Query  648   RLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
              LLQ FD  T S   VDMSE  G+T  KA P+  ++ PRLP   Y
Sbjct  468   SLLQAFDLNTVSDEGVDMSESAGLTNIKATPLDVVIAPRLPPNLY  512



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 206/525 (39%), Positives = 314/525 (60%), Gaps = 21/525 (4%)
 Frame = -2

Query  2043  VAISGVLIILPFLYLSLRkqknktkkpppepPGGLPILGHLFQFKKETHLV-KALATMAD  1867
             + + GVLI L F++   + +   T K  PEP G  PI+GHL        L+ + L  MAD
Sbjct  7     IPLIGVLIFLYFIFK--KNKNCSTSKQAPEPAGAWPIIGHLPLLGGTDQLLYRTLGAMAD  64

Query  1866  KIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDKALAGRPNICAGVYLGYNNAALAFTT-G  1690
               GP F +R+G  R  VVSS E  K+ FT NDKALA RP   A  ++GY  A   F    
Sbjct  65    NYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYS  124

Query  1689  AFWRKVRKMVVVELLSTTKLEKWKHIWISEMNLSVKQLYGSVTKN---REVEVDMEEWIG  1519
              FWR++RK+ + ELLS  +L+  K++ +SE+++ ++ LY     N   R + V+++ W  
Sbjct  125   PFWREMRKIAMFELLSNRRLDTLKYVQVSEVDMGIQALYKLWVDNNSDRPILVELKRWFE  184

Query  1518  YVNLNIMSKIMAKKRYNYSVEHGADNQD-AVVLRQAFKDVMTLTGEFSSADAFPFRIFHW  1342
              + LN++ +++A KRY +      DN D A   ++A      L G F  +DAFP  I  +
Sbjct  185   DLTLNVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDAFP--ILGF  241

Query  1341  LDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGDLPAGEDP--------DFFDIMMKVVDQ  1186
             LD+ G  +AMKK +   D +L+GW+ EH  +    + E          DF D+M+ + ++
Sbjct  242   LDINGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEAKSTTDSAVQDFIDVMLSLEEE  301

Query  1185  EFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMAMLLNHKDVMKRIQEEIDTKVGR  1006
               ++   Y  DT IK+T +A++   ++TT   + W +++LLN+  ++++ QEEID  +G+
Sbjct  302   GRLSNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILRKAQEEIDNHIGK  361

Query  1005  ERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESIQDCEVAGYHIPKGTQLYVNIWK  826
              R +D+SD +NL+Y+QA++KE +RLYP  PL  PRE++ +CE++GY I  GT+L VN+WK
Sbjct  362   NRQIDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWK  421

Query  825   LHRDPKIWPEPEKFKPERFLTESVPDGLARQFGWITFGFGRRSCPASAYALKMAHFILAR  646
             + RDP+IW  P  F P+RFLT +V D   + F  I FG GRRSCP ++ AL++ H  LAR
Sbjct  422   IQRDPRIWENPNCFNPDRFLTSNV-DVKGKDFELIPFGSGRRSCPGASLALQVLHLTLAR  480

Query  645   LLQGFDFATP-SGMPVDMSEGPGVTMPKAKPVKALLTPRLPAASY  514
             +L  F+F  P    P+D++E PG+T+PKA P+  L+ PRL A  Y
Sbjct  481   ILHAFEFTKPIDDQPIDLTESPGLTIPKATPLDVLVAPRLSANLY  525



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   384 bits (986),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/487 (40%), Positives = 296/487 (61%), Gaps = 21/487 (4%)
 Frame = -2

Query  1947  GGLPILGHLFQFKKETHLVKALATMADKIGPVFIIRMGLPRILVVSSLEAVKDVFTTNDK  1768
             G  P++GHL          + L  MADK GP+F I+MG+ R LVVS+ E  K+  TT+DK
Sbjct  50    GAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDK  109

Query  1767  ALAGRPNICAGVYLGYNNAALAFTT-GAFWRKVRKMVVVELLSTTKLEKWKHIWISEMNL  1591
               A RP   A   LGYN +   F+  G++WR+ RK+  +ELLS  +LEK K +   E+  
Sbjct  110   VFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKT  169

Query  1590  SVKQLY----GSVTKNREVEVDMEEWIGYVNLNIMSKIMAKKRYNYSVEHGADNQDAVVL  1423
              +K+LY     + + N+ + V+M+ W+     N++ +I+  K        G ++ D+   
Sbjct  170   CLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRIIVGK--------GCNSMDSEEW  221

Query  1422  RQAFKDVMTLTGEFSSADAFPFRIFHWLDMEGLIRAMKKVSDGTDAVLQGWIDEHVRRGD  1243
             ++       ++G+F  +DA PF    WLD+ G  R+MKK++   D V+QGW++EH  + D
Sbjct  222   KELLTRFFEMSGKFVVSDALPF--LRWLDIGGDERSMKKIAKELDVVVQGWLEEHKMKRD  279

Query  1242  LPA--GEDPDFFDIMMKVV-DQEFIAGQNYTRDTIIKATAMAMLQDAAETTVSNMVWIMA  1072
                   E+ DF  +M+ ++ D E   G++   DTI KA  + ++  A +TT   + WI++
Sbjct  280   SQEMNQEEEDFMYVMLSILGDTEQYYGRDV--DTINKAICLGLILAATDTTAVTLTWIIS  337

Query  1071  MLLNHKDVMKRIQEEIDTKVGRERWVDDSDTDNLVYLQAVVKECMRLYPVVPLGFPRESI  892
             +LLNH D++ + + E+D +VG +R V++SD   LVYLQA++KE MRLYP  PL  P ESI
Sbjct  338   LLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEAMRLYPAAPLLIPHESI  397

Query  891   QDCEVAGYHIPKGTQLYVNIWKLHRDPKIWPEPEKFKPERFLTESV-PDGLARQFGWITF  715
             ++C V+GY++P GTQL++N+WKL RDP +W EP KF+PERFLT     D   + F  + F
Sbjct  398   EECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPF  457

Query  714   GFGRRSCPASAYALKMAHFILARLLQGFDFATPSGMPVDMSEGPGVTMPKAKPVKALLTP  535
               GRR CP  ++AL++  F LA LL GFD ATPS  P+DM EG G+T+ K+ P++ L+ P
Sbjct  458   SSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVAP  517

Query  534   RLPAASY  514
             RL A+ Y
Sbjct  518   RLSASLY  524



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6749630335086