BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25266_g1_i1 len=1175 path=[1001:0-252 1254:253-277 4187:278-362
480:363-511 4418:512-533 4440:534-610 913:611-697 1000:698-739
4644:740-830 4735:831-918 5890:919-938 4841:939-1174]

Length=1175
                                                                      Score     E

ref|XP_011090743.1|  PREDICTED: sugar transport protein 8-like          457   2e-154   
ref|XP_006356033.1|  PREDICTED: sugar transport protein 8-like          453   5e-153   
ref|XP_011090744.1|  PREDICTED: sugar transport protein 8-like          453   6e-153   
ref|XP_011090740.1|  PREDICTED: sugar transport protein 8-like          453   9e-153   
ref|XP_011090741.1|  PREDICTED: sugar transport protein 8-like          451   7e-152   
dbj|BAO96219.1|  sugar transporter 7                                    448   1e-151   
ref|XP_004234230.1|  PREDICTED: sugar transport protein 8-like          449   1e-151   
ref|XP_009794717.1|  PREDICTED: sugar transport protein 8-like          448   7e-151   
gb|EYU41506.1|  hypothetical protein MIMGU_mgv1a005012mg                448   1e-150   
ref|XP_009614744.1|  PREDICTED: sugar transport protein 8-like          447   2e-150   
ref|XP_006356676.1|  PREDICTED: sugar transport protein 8-like          446   3e-150   
gb|EYU41507.1|  hypothetical protein MIMGU_mgv1a005011mg                443   6e-149   
ref|XP_009621209.1|  PREDICTED: sugar transport protein 8-like          439   1e-147   
ref|XP_009795520.1|  PREDICTED: sugar transport protein 8-like          439   3e-147   
ref|XP_004228841.2|  PREDICTED: sugar transport protein 8-like          430   6e-144   
ref|XP_010256217.1|  PREDICTED: sugar transport protein 6-like          428   1e-142   
gb|EPS64536.1|  hypothetical protein M569_10244                         425   6e-142   
ref|XP_002517214.1|  sugar transporter, putative                        425   2e-141   Ricinus communis
ref|XP_006378398.1|  hypothetical protein POPTR_0010s10030g             422   1e-140   
gb|KHG00927.1|  Sugar transport 8 -like protein                         422   1e-140   
ref|XP_011021554.1|  PREDICTED: sugar transport protein 8               422   1e-140   
emb|CDO99034.1|  unnamed protein product                                426   1e-139   
ref|XP_006419890.1|  hypothetical protein CICLE_v10006537mg             417   5e-139   
gb|EYU41505.1|  hypothetical protein MIMGU_mgv1a004927mg                417   8e-139   
ref|XP_006356032.1|  PREDICTED: sugar transport protein 8-like          416   3e-138   
ref|XP_004234231.1|  PREDICTED: sugar transport protein 8-like          414   1e-137   
ref|XP_006837022.1|  hypothetical protein AMTR_s02390p00006900          407   2e-137   
ref|XP_010666755.1|  PREDICTED: sugar transport protein 8-like          413   6e-137   
ref|XP_002530190.1|  sugar transporter, putative                        409   2e-135   Ricinus communis
ref|XP_010026975.1|  PREDICTED: sugar transport protein 8-like          408   5e-135   
ref|XP_010026977.1|  PREDICTED: sugar transport protein 8-like          406   2e-134   
ref|XP_010551756.1|  PREDICTED: sugar transport protein 8-like          406   2e-134   
ref|XP_007034706.1|  Major facilitator superfamily protein              403   3e-133   
gb|ADP37143.1|  putative hexose transporter                             394   4e-132   
gb|KDP40152.1|  hypothetical protein JCGZ_02150                         400   6e-132   
gb|KCW84229.1|  hypothetical protein EUGRSUZ_B01091                     399   7e-132   
ref|XP_010454979.1|  PREDICTED: sugar transport protein 8               399   1e-131   
ref|XP_008777629.1|  PREDICTED: sugar transport protein 13-like         399   1e-131   
ref|XP_007034707.1|  Major facilitator superfamily protein              399   2e-131   
ref|XP_006419889.1|  hypothetical protein CICLE_v10004752mg             399   2e-131   
ref|XP_010045842.1|  PREDICTED: sugar transport protein 8-like          398   3e-131   
ref|XP_010935205.1|  PREDICTED: sugar transport protein 8-like          397   9e-131   
ref|XP_006290071.1|  hypothetical protein CARUB_v10003709mg             397   1e-130   
ref|XP_010655156.1|  PREDICTED: sugar transport protein 8-like          397   1e-130   
ref|XP_002268130.1|  PREDICTED: sugar transport protein 8               394   9e-130   Vitis vinifera
emb|CBI17742.3|  unnamed protein product                                394   2e-129   
ref|XP_002268567.2|  PREDICTED: sugar transport protein 8               394   2e-129   Vitis vinifera
emb|CAN79503.1|  hypothetical protein VITISV_029241                     394   2e-129   Vitis vinifera
ref|XP_011090062.1|  PREDICTED: sugar transport protein 8-like          394   2e-129   
ref|XP_002268177.1|  PREDICTED: sugar transport protein 8               394   2e-129   Vitis vinifera
gb|ADP37141.1|  putative hexose transporter                             394   2e-129   
ref|XP_009609771.1|  PREDICTED: sugar transport protein 6-like          388   3e-129   
emb|CDY52634.1|  BnaC07g49600D                                          392   5e-129   
gb|ADP37140.1|  putative hexose transporter                             392   7e-129   
emb|CDY49992.1|  BnaC03g34490D                                          391   2e-128   
ref|XP_010524814.1|  PREDICTED: sugar transport protein 6-like          391   2e-128   
emb|CBI26224.3|  unnamed protein product                                390   3e-128   
emb|CDX74116.1|  BnaA03g29310D                                          390   3e-128   
ref|XP_002268611.2|  PREDICTED: sugar transport protein 8-like          390   5e-128   Vitis vinifera
ref|XP_002277946.2|  PREDICTED: sugar transport protein 8-like          389   8e-128   Vitis vinifera
ref|XP_009134865.1|  PREDICTED: sugar transport protein 6-like          389   2e-127   
ref|XP_002311613.2|  sugar transporter family protein                   388   5e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010256218.1|  PREDICTED: sugar transport protein 8-like          387   9e-127   
ref|XP_011026212.1|  PREDICTED: sugar transport protein 8-like          387   9e-127   
ref|XP_009151134.1|  PREDICTED: sugar transport protein 8               386   1e-126   
emb|CDX88227.1|  BnaA06g28180D                                          386   1e-126   
ref|XP_006408005.1|  hypothetical protein EUTSA_v10020542mg             387   1e-126   
emb|CAG27608.1|  monosaccharide transporter                             386   3e-126   Populus tremula x Populus tremuloides
ref|XP_009417165.1|  PREDICTED: sugar transport protein 8-like          385   4e-126   
emb|CDY18836.1|  BnaAnng03010D                                          384   2e-125   
ref|XP_009129619.1|  PREDICTED: sugar transport protein 6               383   3e-125   
ref|XP_011080689.1|  PREDICTED: sugar transport protein 8-like          382   4e-125   
emb|CDY05216.1|  BnaC05g45870D                                          382   6e-125   
ref|XP_011080684.1|  PREDICTED: sugar transport protein 8-like          382   7e-125   
ref|XP_009758106.1|  PREDICTED: sugar transport protein 8-like          382   7e-125   
ref|XP_011035196.1|  PREDICTED: sugar transport protein 8-like          381   2e-124   
gb|KFK38009.1|  hypothetical protein AALP_AA3G058600                    380   3e-124   
ref|XP_002884547.1|  hypothetical protein ARALYDRAFT_317457             380   5e-124   
ref|XP_002298323.2|  hypothetical protein POPTR_0001s25600g             380   6e-124   Populus trichocarpa [western balsam poplar]
ref|XP_009124947.1|  PREDICTED: sugar transport protein 6-like          379   8e-124   
ref|XP_002461666.1|  hypothetical protein SORBIDRAFT_02g006150          379   1e-123   Sorghum bicolor [broomcorn]
ref|XP_009364224.1|  PREDICTED: sugar transport protein 13-like         378   2e-123   
ref|NP_187247.1|  sugar transport protein 6                             378   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394871.1|  hypothetical protein EUTSA_v10005607mg             375   2e-122   
ref|XP_010026974.1|  PREDICTED: sugar transport protein 8-like          375   3e-122   
emb|CBI17743.3|  unnamed protein product                                391   3e-122   
ref|XP_002311614.2|  hypothetical protein POPTR_0008s15020g             375   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_008390875.1|  PREDICTED: sugar transport protein 13-like         375   4e-122   
ref|XP_009366952.1|  PREDICTED: sugar transport protein 13-like         373   3e-121   
ref|XP_009366956.1|  PREDICTED: sugar transport protein 13-like         373   3e-121   
ref|XP_008652769.1|  PREDICTED: sugar transport protein 13 isofor...    369   3e-121   
ref|XP_008380300.1|  PREDICTED: sugar transport protein 13-like         372   4e-121   
gb|EMT20071.1|  Sugar transport protein 13                              372   5e-121   
ref|XP_010667424.1|  PREDICTED: sugar transport protein 13              371   3e-120   
ref|NP_197997.1|  sugar transport protein 8                             370   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434418.1|  PREDICTED: sugar transport protein 6               370   3e-120   
ref|XP_009366951.1|  PREDICTED: sugar transport protein 13-like         370   4e-120   
ref|XP_008348363.1|  PREDICTED: sugar transport protein 13-like         370   4e-120   
gb|KDP46531.1|  hypothetical protein JCGZ_08503                         370   4e-120   
ref|XP_004292942.1|  PREDICTED: sugar transport protein 13-like         370   4e-120   
ref|XP_009366953.1|  PREDICTED: sugar transport protein 13-like         369   6e-120   
ref|XP_009383001.1|  PREDICTED: sugar transport protein 8-like          369   7e-120   
ref|XP_009366955.1|  PREDICTED: sugar transport protein 13-like         369   7e-120   
ref|XP_007223243.1|  hypothetical protein PRUPE_ppa004420mg             369   7e-120   
ref|XP_008222843.1|  PREDICTED: sugar transport protein 13-like         369   8e-120   
ref|XP_008380301.1|  PREDICTED: sugar transport protein 13-like         369   1e-119   
ref|XP_002872209.1|  hypothetical protein ARALYDRAFT_351641             369   1e-119   
ref|XP_004955790.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    368   2e-119   
ref|XP_004985175.1|  PREDICTED: sugar transport protein 13-like         368   2e-119   
ref|XP_004162276.1|  PREDICTED: sugar transport protein 13-like         364   3e-119   
ref|XP_008652761.1|  PREDICTED: sugar transport protein 13 isofor...    367   6e-119   
ref|XP_008390869.1|  PREDICTED: sugar transport protein 13-like         367   8e-119   
tpg|DAA44110.1|  TPA: hypothetical protein ZEAMMB73_406835              367   1e-118   
ref|XP_004298157.1|  PREDICTED: sugar transport protein 13-like         366   1e-118   
gb|EMS63665.1|  Sugar transport protein 13                              365   3e-118   
ref|XP_008380303.1|  PREDICTED: sugar transport protein 13-like         365   4e-118   
ref|XP_002465636.1|  hypothetical protein SORBIDRAFT_01g042690          365   4e-118   Sorghum bicolor [broomcorn]
gb|KEH27346.1|  sugar porter (SP) family MFS transporter                363   5e-118   
ref|XP_008438691.1|  PREDICTED: sugar transport protein 13-like         365   6e-118   
ref|XP_009366904.1|  PREDICTED: sugar transport protein 13-like         364   7e-118   
gb|KCW85471.1|  hypothetical protein EUGRSUZ_B02275                     363   8e-118   
ref|XP_010046383.1|  PREDICTED: sugar transport protein 6-like          363   1e-117   
ref|XP_009366920.1|  PREDICTED: sugar transport protein 13-like         363   1e-117   
gb|EYU45974.1|  hypothetical protein MIMGU_mgv1a004836mg                363   1e-117   
ref|XP_003558480.1|  PREDICTED: sugar transport protein 13-like         363   2e-117   
ref|XP_004134452.1|  PREDICTED: sugar transport protein 13-like         363   2e-117   
ref|XP_006649643.1|  PREDICTED: sugar transport protein 13-like         363   2e-117   
ref|XP_003610701.1|  Hexose transporter                                 363   3e-117   
ref|XP_003592418.1|  Hexose transporter                                 362   3e-117   
emb|CDO99036.1|  unnamed protein product                                363   3e-117   
ref|XP_004511353.1|  PREDICTED: sugar transport protein 13-like         363   3e-117   
ref|NP_001049396.1|  Os03g0218400                                       362   4e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40155.1|  hypothetical protein JCGZ_02153                         362   5e-117   
ref|XP_004296902.1|  PREDICTED: sugar transport protein 13-like         362   6e-117   
gb|EEE58602.1|  hypothetical protein OsJ_09938                          362   8e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KHN35184.1|  Sugar transport protein 13                              362   8e-117   
ref|XP_003539275.1|  PREDICTED: sugar transport protein 13-like         362   1e-116   
gb|EEC74774.1|  hypothetical protein OsI_10546                          362   1e-116   Oryza sativa Indica Group [Indian rice]
gb|AAQ24871.1|  monosaccharide transporter 4                            361   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008380302.1|  PREDICTED: sugar transport protein 13-like         360   2e-116   
ref|XP_003517581.1|  PREDICTED: sugar transport protein 13              361   2e-116   
ref|XP_010108003.1|  Sugar transport protein 13                         360   2e-116   
ref|XP_003536538.1|  PREDICTED: sugar transport protein 13-like i...    360   3e-116   
ref|XP_004496749.1|  PREDICTED: sugar transport protein 13-like         360   3e-116   
ref|XP_009394723.1|  PREDICTED: sugar transport protein 13-like         360   4e-116   
ref|XP_004296901.1|  PREDICTED: sugar transport protein 13-like         359   4e-116   
ref|XP_007157147.1|  hypothetical protein PHAVU_002G046800g             359   7e-116   
ref|XP_002517216.1|  sugar transporter, putative                        359   8e-116   Ricinus communis
ref|XP_008438688.1|  PREDICTED: sugar transport protein 13-like         358   9e-116   
ref|XP_008222844.1|  PREDICTED: sugar transport protein 13-like         358   1e-115   
ref|XP_003592419.1|  Hexose transporter                                 360   1e-115   
gb|AES62670.2|  sugar porter (SP) family MFS transporter                358   1e-115   
ref|XP_008222938.1|  PREDICTED: sugar transport protein 13-like         358   1e-115   
ref|XP_010277661.1|  PREDICTED: sugar transport protein 13-like         359   1e-115   
ref|XP_009411272.1|  PREDICTED: sugar transport protein 13-like         358   1e-115   
ref|XP_008801700.1|  PREDICTED: sugar transport protein 13              358   2e-115   
ref|XP_007223245.1|  hypothetical protein PRUPE_ppa004424mg             357   3e-115   
ref|XP_007221814.1|  hypothetical protein PRUPE_ppa004132mg             358   3e-115   
ref|NP_198006.1|  sugar transport protein 13                            358   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223242.1|  hypothetical protein PRUPE_ppa004417mg             357   3e-115   
ref|XP_010108002.1|  Sugar transport protein 13                         358   4e-115   
ref|XP_009594387.1|  PREDICTED: sugar transport protein 13              351   4e-115   
ref|XP_010454987.1|  PREDICTED: sugar transport protein 13 isofor...    358   4e-115   
dbj|BAO45901.1|  hexose transporter                                     357   7e-115   
ref|XP_010421503.1|  PREDICTED: sugar transport protein 13-like         357   8e-115   
ref|XP_009364267.1|  PREDICTED: sugar transport protein 13-like         356   8e-115   
ref|XP_007223259.1|  hypothetical protein PRUPE_ppa004439mg             356   9e-115   
ref|XP_006359910.1|  PREDICTED: sugar transport protein 13-like         357   9e-115   
gb|ABR16571.1|  unknown                                                 357   1e-114   Picea sitchensis
gb|KDO74663.1|  hypothetical protein CISIN_1g009833mg                   355   1e-114   
ref|XP_008390874.1|  PREDICTED: sugar transport protein 13-like         356   1e-114   
ref|XP_010645729.1|  PREDICTED: sugar transport protein 8               355   1e-114   
ref|XP_003557399.1|  PREDICTED: sugar transport protein 8-like          356   1e-114   
ref|XP_004296900.1|  PREDICTED: sugar transport protein 13-like         356   1e-114   
ref|XP_011090738.1|  PREDICTED: sugar transport protein 13              356   1e-114   
ref|XP_009366919.1|  PREDICTED: sugar transport protein 13-like         356   2e-114   
ref|XP_009366906.1|  PREDICTED: sugar transport protein 13-like         356   2e-114   
ref|XP_009364266.1|  PREDICTED: sugar transport protein 13-like         355   2e-114   
ref|XP_004298160.1|  PREDICTED: sugar transport protein 13-like         355   2e-114   
ref|XP_008222925.1|  PREDICTED: sugar transport protein 13-like         355   2e-114   
ref|XP_009364223.1|  PREDICTED: sugar transport protein 13-like         355   3e-114   
ref|XP_010905220.1|  PREDICTED: sugar transport protein 13              355   4e-114   
ref|XP_004298158.1|  PREDICTED: sugar transport protein 13-like         354   5e-114   
ref|XP_004167176.1|  PREDICTED: sugar transport protein 13-like         355   7e-114   
gb|KFK26411.1|  hypothetical protein AALP_AA8G245100                    355   7e-114   
ref|XP_006419892.1|  hypothetical protein CICLE_v10004729mg             354   8e-114   
ref|XP_006287497.1|  hypothetical protein CARUB_v10000707mg             354   8e-114   
ref|XP_010255992.1|  PREDICTED: sugar transport protein 13              353   1e-113   
ref|XP_007034709.1|  Major facilitator superfamily protein              353   1e-113   
ref|XP_006394875.1|  hypothetical protein EUTSA_v10003980mg             353   2e-113   
ref|XP_010493897.1|  PREDICTED: sugar transport protein 13-like         353   2e-113   
ref|XP_007143232.1|  hypothetical protein PHAVU_007G055200g             352   3e-113   
ref|NP_001268207.1|  hexose transporter                                 353   4e-113   
ref|XP_009763608.1|  PREDICTED: sugar transport protein 13              352   4e-113   
ref|XP_004298159.1|  PREDICTED: sugar transport protein 13-like         352   5e-113   
ref|XP_008438690.1|  PREDICTED: sugar transport protein 13-like         352   5e-113   
gb|KCW60804.1|  hypothetical protein EUGRSUZ_H03539                     350   7e-113   
emb|CAN61766.1|  hypothetical protein VITISV_025413                     352   7e-113   Vitis vinifera
ref|XP_008449560.1|  PREDICTED: sugar transport protein 13              352   8e-113   
ref|XP_004168644.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    351   1e-112   
ref|XP_004134451.1|  PREDICTED: sugar transport protein 13-like         351   1e-112   
ref|XP_010489690.1|  PREDICTED: sugar transport protein 8-like          360   1e-112   
ref|XP_007226274.1|  hypothetical protein PRUPE_ppa020009mg             350   1e-112   
emb|CDX87052.1|  BnaC09g03670D                                          351   1e-112   
ref|NP_001234785.1|  hexose transporter protein                         350   3e-112   
gb|ADP37145.1|  putative hexose transporter                             341   4e-112   
emb|CDY19773.1|  BnaA09g04260D                                          350   4e-112   
ref|XP_010546806.1|  PREDICTED: sugar transport protein 13              350   4e-112   
ref|XP_010024355.1|  PREDICTED: sugar transport protein 13-like         350   4e-112   
ref|XP_010533292.1|  PREDICTED: sugar transport protein 8-like          349   4e-112   
ref|XP_004296903.1|  PREDICTED: sugar transport protein 13-like         350   5e-112   
ref|XP_009111698.1|  PREDICTED: sugar transport protein 13              350   5e-112   
ref|XP_010035273.1|  PREDICTED: sugar transport protein 13-like         349   5e-112   
ref|XP_008222842.1|  PREDICTED: sugar transport protein 13-like         348   1e-111   
ref|XP_008222939.1|  PREDICTED: sugar transport protein 13-like         348   1e-111   
dbj|BAO96217.1|  sugar transporter 2                                    348   1e-111   
emb|CAB52689.1|  hexose transporter                                     348   1e-111   Solanum lycopersicum
ref|XP_003592420.1|  Hexose transporter                                 348   1e-111   
ref|XP_007224819.1|  hypothetical protein PRUPE_ppa023527mg             347   2e-111   
ref|XP_008222924.1|  PREDICTED: sugar transport protein 13-like         346   8e-111   
gb|EYU41503.1|  hypothetical protein MIMGU_mgv1a004471mg                346   1e-110   
ref|XP_002525597.1|  sugar transporter, putative                        345   2e-110   Ricinus communis
ref|XP_006838270.1|  hypothetical protein AMTR_s00103p00075300          345   4e-110   
ref|XP_001768225.1|  predicted protein                                  344   6e-110   
ref|XP_007143231.1|  hypothetical protein PHAVU_007G055100g             343   7e-110   
ref|XP_006289688.1|  hypothetical protein CARUB_v10003245mg             343   1e-109   
ref|XP_006841839.1|  hypothetical protein AMTR_s00003p00270500          340   1e-109   
ref|XP_001753303.1|  predicted protein                                  343   1e-109   
ref|XP_010421502.1|  PREDICTED: sugar transport protein 13-like         343   2e-109   
ref|XP_002874309.1|  hypothetical protein ARALYDRAFT_489474             342   2e-109   
gb|ADJ68005.1|  putative hexose transporter                             342   3e-109   
gb|EEC68623.1|  hypothetical protein OsI_37004                          334   5e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_004496753.1|  PREDICTED: sugar transport protein 13-like         341   6e-109   
dbj|BAJ92881.1|  predicted protein                                      335   9e-109   
ref|XP_008222904.1|  PREDICTED: sugar transport protein 13-like         342   1e-108   
ref|XP_010942230.1|  PREDICTED: sugar carrier protein C-like            340   2e-108   
ref|XP_002889642.1|  sugar transport protein 2                          339   2e-108   
ref|NP_001059153.1|  Os07g0206600                                       339   3e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412437.1|  PREDICTED: sugar carrier protein C-like            339   3e-108   
ref|XP_001785042.1|  predicted protein                                  339   6e-108   
emb|CDY67102.1|  BnaA06g39540D                                          337   1e-107   
ref|XP_009151136.1|  PREDICTED: sugar transport protein 13-like         337   1e-107   
ref|XP_004168645.1|  PREDICTED: sugar transport protein 13-like         338   1e-107   
ref|XP_002961014.1|  hypothetical protein SELMODRAFT_437470             337   3e-107   
ref|XP_002312523.1|  hypothetical protein POPTR_0008s15050g             337   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010454983.1|  PREDICTED: sugar transport protein 13-like         337   3e-107   
ref|XP_011032149.1|  PREDICTED: sugar transport protein 8               337   3e-107   
gb|KGN56998.1|  hypothetical protein Csa_3G148800                       337   4e-107   
ref|XP_004134450.1|  PREDICTED: sugar transport protein 13-like         336   7e-107   
ref|XP_003575949.1|  PREDICTED: sugar transport protein 13-like         336   7e-107   
ref|XP_002525598.1|  sugar transporter, putative                        335   9e-107   Ricinus communis
ref|XP_011026237.1|  PREDICTED: sugar transport protein 13-like         336   9e-107   
gb|EPS73973.1|  hypothetical protein M569_00781                         335   1e-106   
ref|XP_002966995.1|  hypothetical protein SELMODRAFT_144534             335   1e-106   
ref|XP_002461309.1|  hypothetical protein SORBIDRAFT_02g000650          330   1e-106   Sorghum bicolor [broomcorn]
ref|XP_002313392.1|  hypothetical protein POPTR_0009s04750g             335   1e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010487356.1|  PREDICTED: sugar transport protein 2-like          335   2e-106   
gb|EYU39411.1|  hypothetical protein MIMGU_mgv1a004703mg                335   2e-106   
ref|XP_010533293.1|  PREDICTED: sugar transport protein 8-like          334   2e-106   
ref|XP_010532699.1|  PREDICTED: sugar transport protein 8-like          334   2e-106   
tpg|DAA59969.1|  TPA: sugar transport protein 8                         334   3e-106   
ref|XP_010645730.1|  PREDICTED: sugar transport protein 13-like         325   3e-106   
emb|CDX86492.1|  BnaC08g02110D                                          333   4e-106   
ref|NP_001151401.1|  sugar transport protein 8                          333   7e-106   Zea mays [maize]
ref|XP_006307319.1|  hypothetical protein CARUB_v10008940mg             332   1e-105   
ref|XP_009110953.1|  PREDICTED: sugar transport protein 2               332   1e-105   
emb|CDY15608.1|  BnaA08g28920D                                          332   1e-105   
ref|XP_002981389.1|  hypothetical protein SELMODRAFT_154400             333   1e-105   
ref|XP_002969912.1|  hypothetical protein SELMODRAFT_170916             333   2e-105   
dbj|BAK00566.1|  predicted protein                                      333   2e-105   
ref|XP_008797565.1|  PREDICTED: sugar carrier protein C-like            330   3e-105   
ref|XP_001753236.1|  predicted protein                                  332   4e-105   
ref|XP_010905564.1|  PREDICTED: sugar carrier protein C-like            332   5e-105   
ref|XP_010475490.1|  PREDICTED: sugar transport protein 2               331   5e-105   
emb|CDX80558.1|  BnaC07g28860D                                          331   7e-105   
ref|XP_009416065.1|  PREDICTED: sugar carrier protein C-like            331   7e-105   
gb|KDP46530.1|  hypothetical protein JCGZ_08502                         331   7e-105   
ref|XP_008465176.1|  PREDICTED: sugar transport protein 13-like         330   9e-105   
gb|KDO66800.1|  hypothetical protein CISIN_1g035548mg                   330   1e-104   
ref|XP_006425019.1|  hypothetical protein CICLE_v10030046mg             330   1e-104   
emb|CAG27607.1|  monosaccharide transporter                             330   2e-104   
ref|XP_009402797.1|  PREDICTED: sugar carrier protein C-like            329   3e-104   
ref|NP_172214.5|  sugar transport protein 2                             328   4e-104   
ref|XP_009385289.1|  PREDICTED: sugar carrier protein C-like            328   6e-104   
ref|XP_009418748.1|  PREDICTED: sugar carrier protein C-like            328   7e-104   
ref|XP_010457905.1|  PREDICTED: sugar transport protein 2-like          327   9e-104   
ref|XP_004134449.1|  PREDICTED: sugar transport protein 13-like         328   1e-103   
ref|XP_010687752.1|  PREDICTED: sugar transport protein 7               328   1e-103   
ref|XP_011021553.1|  PREDICTED: sugar transport protein 13-like         328   1e-103   
ref|NP_001105681.1|  monosaccharide transporter1                        328   1e-103   
ref|XP_006606047.1|  PREDICTED: sugar transport protein 13-like         327   1e-103   
gb|ACN34678.1|  unknown                                                 327   2e-103   
ref|XP_010521924.1|  PREDICTED: sugar transport protein 2               326   2e-103   
ref|XP_010904882.1|  PREDICTED: sugar carrier protein C-like            327   2e-103   
ref|XP_008812644.1|  PREDICTED: sugar carrier protein C-like            327   2e-103   
ref|XP_004955304.1|  PREDICTED: sugar carrier protein C-like isof...    326   2e-103   
gb|EMS50819.1|  Sugar transport protein 13                              329   3e-103   
dbj|BAC81184.1|  putative glucose transport protein STP1                322   4e-103   
ref|XP_004955303.1|  PREDICTED: sugar carrier protein C-like isof...    326   5e-103   
ref|XP_009385295.1|  PREDICTED: sugar carrier protein C-like            326   5e-103   
ref|XP_004141211.1|  PREDICTED: sugar transport protein 13-like         326   5e-103   
ref|XP_002314709.1|  hypothetical protein POPTR_0010s10010g             326   7e-103   
ref|XP_009388857.1|  PREDICTED: sugar carrier protein C-like            325   1e-102   
gb|KHN02703.1|  Sugar transport protein 13                              325   1e-102   
ref|XP_009118968.1|  PREDICTED: sugar transport protein 2               325   1e-102   
ref|XP_010936607.1|  PREDICTED: sugar carrier protein C-like            325   1e-102   
ref|XP_004170121.1|  PREDICTED: sugar transport protein 13-like         325   1e-102   
ref|XP_008800390.1|  PREDICTED: sugar carrier protein C-like            325   1e-102   
ref|XP_010268857.1|  PREDICTED: sugar carrier protein C-like            325   1e-102   
gb|EAY75161.1|  hypothetical protein OsI_03053                          318   1e-102   
ref|XP_004140149.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    325   2e-102   
emb|CBI25604.3|  unnamed protein product                                325   2e-102   
emb|CAN83402.1|  hypothetical protein VITISV_009589                     324   3e-102   
ref|XP_006417812.1|  hypothetical protein EUTSA_v10007449mg             323   4e-102   
ref|XP_008670623.1|  PREDICTED: sugar transport protein 1-like          323   4e-102   
ref|XP_011033480.1|  PREDICTED: sugar carrier protein A-like            323   5e-102   
ref|NP_001267837.1|  hexose transporter 7                               323   6e-102   
gb|AAT09977.1|  putative hexose transporter                             323   7e-102   
ref|XP_010461877.1|  PREDICTED: sugar transport protein 9               323   1e-101   
emb|CDY10269.1|  BnaC05g05120D                                          322   1e-101   
ref|XP_008238715.1|  PREDICTED: sugar carrier protein C-like            323   1e-101   
ref|XP_008675375.1|  PREDICTED: sugar transport protein 1-like          322   1e-101   
emb|CDY07098.1|  BnaCnng01130D                                          322   1e-101   
emb|CAB07812.1|  monosaccharid transport protein                        322   2e-101   
ref|XP_008439910.1|  PREDICTED: sugar carrier protein C-like            322   2e-101   
ref|XP_002458021.1|  hypothetical protein SORBIDRAFT_03g025600          322   2e-101   
ref|XP_010905889.1|  PREDICTED: sugar carrier protein C-like            322   2e-101   
ref|XP_010500594.1|  PREDICTED: sugar transport protein 9-like          322   3e-101   
ref|XP_002994657.1|  hypothetical protein SELMODRAFT_187905             321   3e-101   
dbj|BAJ89694.1|  predicted protein                                      322   3e-101   
ref|XP_006847824.1|  hypothetical protein AMTR_s00029p00047980          318   4e-101   
ref|XP_002325158.2|  hypothetical protein POPTR_0018s12130g             321   4e-101   
ref|XP_008651124.1|  PREDICTED: uncharacterized protein LOC100274...    320   4e-101   
emb|CDY22024.1|  BnaA09g00530D                                          321   4e-101   
ref|NP_001058704.1|  Os07g0106200                                       321   5e-101   
ref|XP_002960063.1|  hypothetical protein SELMODRAFT_402035             321   5e-101   
gb|EEC70918.1|  hypothetical protein OsI_02481                          320   6e-101   
ref|XP_006396402.1|  hypothetical protein EUTSA_v10028576mg             321   6e-101   
tpg|DAA61441.1|  TPA: sugar carrier protein A                           320   7e-101   
ref|XP_002891565.1|  monosaccharide transporter                         320   7e-101   
ref|XP_006287526.1|  hypothetical protein CARUB_v10000732mg             320   8e-101   
ref|NP_175449.1|  sugar transporter 9                                   320   9e-101   
ref|XP_009398213.1|  PREDICTED: sugar carrier protein C-like isof...    320   1e-100   
ref|NP_001043369.1|  Os01g0567500                                       320   1e-100   
ref|XP_010479485.1|  PREDICTED: sugar transport protein 9-like          320   1e-100   
ref|XP_009398212.1|  PREDICTED: sugar carrier protein C-like isof...    321   1e-100   
ref|XP_009412674.1|  PREDICTED: sugar carrier protein C-like            320   1e-100   
ref|XP_011017956.1|  PREDICTED: sugar carrier protein A-like            320   1e-100   
ref|XP_004504960.1|  PREDICTED: sugar transport protein 1-like          320   1e-100   
ref|XP_004168788.1|  PREDICTED: sugar carrier protein C-like            320   1e-100   
ref|XP_009124552.1|  PREDICTED: sugar transport protein 9-like is...    320   1e-100   
ref|XP_002279859.2|  PREDICTED: sugar transport protein 12              319   1e-100   
gb|KGN49184.1|  hypothetical protein Csa_6G516920                       320   1e-100   
emb|CDY29325.1|  BnaA05g15920D                                          320   2e-100   
ref|NP_001141959.1|  uncharacterized protein LOC100274108               320   2e-100   
gb|AHC98497.1|  putative hexose transporter                             320   2e-100   
emb|CDX90958.1|  BnaA03g26380D                                          319   2e-100   
gb|ACG38482.1|  sugar carrier protein A                                 320   2e-100   
gb|KDP25512.1|  hypothetical protein JCGZ_20668                         320   2e-100   
ref|XP_009124551.1|  PREDICTED: sugar transport protein 9-like is...    320   2e-100   
ref|XP_004134731.1|  PREDICTED: sugar carrier protein C-like            320   2e-100   
ref|NP_192114.1|  sugar transport protein 7                             319   2e-100   
ref|XP_010429078.1|  PREDICTED: sugar transport protein 7-like          319   3e-100   
gb|ADP37133.1|  putative hexose transporter                             319   4e-100   
emb|CDY53930.1|  BnaCnng25770D                                          319   4e-100   
ref|XP_009776302.1|  PREDICTED: sugar carrier protein A-like            317   4e-100   
ref|XP_009134451.1|  PREDICTED: sugar transport protein 7               318   4e-100   
ref|XP_009111324.1|  PREDICTED: sugar transport protein 7               318   4e-100   
ref|XP_010456090.1|  PREDICTED: sugar transport protein 7-like          318   4e-100   
ref|XP_009389223.1|  PREDICTED: sugar transport protein 10-like         319   5e-100   
ref|XP_010422647.1|  PREDICTED: sugar transport protein 7               318   5e-100   
ref|XP_007016173.1|  Sugar transporter 2, putative                      318   5e-100   
ref|XP_008439371.1|  PREDICTED: sugar transport protein 13-like         318   5e-100   
ref|XP_009147845.1|  PREDICTED: sugar transport protein 9               318   6e-100   
gb|KFK35926.1|  hypothetical protein AALP_AA4G054500                    318   7e-100   
ref|XP_002973114.1|  hypothetical protein SELMODRAFT_267610             317   9e-100   
ref|XP_010522016.1|  PREDICTED: sugar transport protein 11-like         318   9e-100   
ref|XP_010253802.1|  PREDICTED: sugar transport protein 4               318   9e-100   
ref|XP_010521842.1|  PREDICTED: sugar transport protein 11-like         318   1e-99    
ref|XP_009124549.1|  PREDICTED: sugar transport protein 9-like is...    320   2e-99    
ref|XP_003557694.1|  PREDICTED: LOW QUALITY PROTEIN: sugar carrie...    317   2e-99    
gb|EMS66971.1|  Sugar carrier protein C                                 317   2e-99    
ref|XP_009623349.1|  PREDICTED: sugar carrier protein A                 317   2e-99    
ref|XP_009771478.1|  PREDICTED: sugar carrier protein A                 317   2e-99    
ref|XP_011002247.1|  PREDICTED: sugar transport protein 10-like         317   2e-99    
gb|KFK39319.1|  hypothetical protein AALP_AA3G229200                    317   2e-99    
ref|XP_010521988.1|  PREDICTED: sugar transport protein 11-like         317   2e-99    
ref|XP_006453688.1|  hypothetical protein CICLE_v10008037mg             316   3e-99    
ref|XP_002872859.1|  hypothetical protein ARALYDRAFT_327595             316   3e-99    
ref|XP_002976741.1|  hypothetical protein SELMODRAFT_105612             316   3e-99    
ref|XP_010522006.1|  PREDICTED: sugar transport protein 11-like i...    316   3e-99    
gb|EMT31642.1|  Sugar carrier protein C                                 317   3e-99    
ref|XP_002308382.1|  Sugar carrier protein A                            316   4e-99    
ref|XP_006644257.1|  PREDICTED: sugar carrier protein C-like            316   5e-99    
gb|ABK24644.1|  unknown                                                 316   5e-99    
ref|XP_010521999.1|  PREDICTED: sugar transport protein 11-like i...    316   5e-99    
gb|KFK30778.1|  hexose transporter                                      315   7e-99    
emb|CDP20258.1|  unnamed protein product                                315   7e-99    
emb|CDP10521.1|  unnamed protein product                                315   7e-99    
ref|NP_188628.1|  sugar transport protein 10                            315   7e-99    
gb|KDO59360.1|  hypothetical protein CISIN_1g010375mg                   313   9e-99    
gb|KDO59361.1|  hypothetical protein CISIN_1g010375mg                   313   9e-99    
ref|XP_010468035.1|  PREDICTED: sugar transport protein 6-like          319   9e-99    
ref|NP_001234855.1|  hexose transporter 3                               315   9e-99    
ref|XP_010106347.1|  Sugar transport protein 7                          315   1e-98    
ref|XP_002310647.2|  hypothetical protein POPTR_0007s07640g             315   1e-98    
ref|XP_008246194.1|  PREDICTED: sugar transport protein 13-like         307   1e-98    
ref|XP_010489959.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    315   1e-98    
ref|XP_006393163.1|  hypothetical protein EUTSA_v10011372mg             315   2e-98    
ref|XP_003608257.1|  Sugar transport protein                            314   2e-98    
gb|KFK43063.1|  hypothetical protein AALP_AA1G073500                    314   2e-98    
gb|AAB06594.1|  sugar transporter                                       314   2e-98    
ref|XP_004146734.1|  PREDICTED: sugar transport protein 7-like          313   3e-98    
ref|XP_004968998.1|  PREDICTED: sugar transport protein 1-like          313   3e-98    
ref|XP_010508245.1|  PREDICTED: sugar transport protein 10-like         313   3e-98    
ref|XP_003530990.1|  PREDICTED: sugar carrier protein C-like isof...    313   4e-98    
ref|XP_006366202.1|  PREDICTED: sugar carrier protein A-like            313   4e-98    
emb|CDO99641.1|  unnamed protein product                                313   4e-98    
ref|XP_007013711.1|  Sugar transporter protein 7 isoform 1              313   4e-98    
ref|XP_009124547.1|  PREDICTED: sugar transport protein 9-like is...    321   4e-98    
ref|XP_008443895.1|  PREDICTED: sugar transport protein 7               313   4e-98    
gb|KHN00100.1|  Sugar carrier protein C                                 312   5e-98    
ref|XP_009124545.1|  PREDICTED: sugar transport protein 9-like is...    321   5e-98    
ref|XP_009124548.1|  PREDICTED: sugar transport protein 9-like is...    320   5e-98    
ref|XP_009124546.1|  PREDICTED: sugar transport protein 9-like is...    320   6e-98    
ref|XP_006658204.1|  PREDICTED: sugar carrier protein C-like            313   6e-98    
gb|KHG17738.1|  Sugar transport 7 -like protein                         313   7e-98    
gb|KDO59359.1|  hypothetical protein CISIN_1g010375mg                   313   7e-98    
ref|XP_004982025.1|  PREDICTED: sugar transport protein 7-like          313   7e-98    
ref|XP_006473953.1|  PREDICTED: sugar carrier protein A-like            313   7e-98    
ref|XP_004956822.1|  PREDICTED: sugar transport protein 7-like          313   7e-98    
gb|EYU35574.1|  hypothetical protein MIMGU_mgv1a008149mg                308   7e-98    
ref|XP_002984075.1|  hypothetical protein SELMODRAFT_119504             313   8e-98    
ref|XP_006651548.1|  PREDICTED: sugar carrier protein C-like            313   8e-98    
ref|XP_007143235.1|  hypothetical protein PHAVU_007G055500g             311   8e-98    
ref|XP_002520406.1|  sugar transporter, putative                        312   8e-98    
ref|XP_002306376.1|  hypothetical protein POPTR_0005s09290g             312   1e-97    
ref|XP_010688661.1|  PREDICTED: sugar transport protein 10-like         312   1e-97    
ref|XP_010547707.1|  PREDICTED: sugar transport protein 11-like         312   1e-97    
ref|XP_006406437.1|  hypothetical protein EUTSA_v10022032mg             312   1e-97    
dbj|BAJ94378.1|  predicted protein                                      312   1e-97    
gb|KDP42049.1|  hypothetical protein JCGZ_03538                         310   1e-97    
emb|CDM87201.1|  unnamed protein product                                306   2e-97    
gb|KHN07680.1|  Sugar carrier protein C                                 312   2e-97    
gb|KEH16381.1|  sugar porter (SP) family MFS transporter                311   2e-97    
gb|KEH16382.1|  sugar porter (SP) family MFS transporter                311   2e-97    
ref|XP_010533083.1|  PREDICTED: sugar transport protein 7               312   2e-97    
gb|AFO84096.1|  hexose transport protein                                311   2e-97    
ref|XP_009111361.1|  PREDICTED: sugar transport protein 10-like         311   2e-97    
ref|XP_009111369.1|  PREDICTED: sugar transport protein 10-like         311   2e-97    
ref|XP_007043258.1|  Major facilitator superfamily protein              311   2e-97    
ref|XP_010244794.1|  PREDICTED: sugar transport protein 7-like          311   3e-97    
ref|XP_009136370.1|  PREDICTED: sugar transport protein 11              311   3e-97    
ref|XP_010434176.1|  PREDICTED: sugar transport protein 12-like         310   3e-97    
emb|CDX91815.1|  BnaC03g31170D                                          320   3e-97    
ref|XP_004170560.1|  PREDICTED: sugar transport protein 10-like         311   4e-97    
ref|XP_006306003.1|  hypothetical protein CARUB_v10011283mg             311   4e-97    
emb|CAA47324.1|  monosaccharid transporter                              311   4e-97    
ref|XP_009397582.1|  PREDICTED: sugar transport protein 10-like         312   5e-97    
gb|EMS67764.1|  Sugar carrier protein C                                 310   5e-97    
ref|XP_002960062.1|  hypothetical protein SELMODRAFT_402034             311   5e-97    
ref|XP_008336926.1|  PREDICTED: sugar transport protein 7 isoform X2    310   6e-97    
dbj|BAK07271.1|  predicted protein                                      310   6e-97    
dbj|BAO96218.1|  sugar transporter 3                                    310   6e-97    
gb|EPS67473.1|  monosaccharide transporter 2                            310   8e-97    
ref|XP_009111963.1|  PREDICTED: sugar transport protein 10-like         309   8e-97    
ref|XP_004146580.1|  PREDICTED: sugar carrier protein C-like            310   8e-97    
emb|CDY45759.1|  BnaC02g42230D                                          310   8e-97    
ref|XP_008342326.1|  PREDICTED: sugar transport protein 1-like          310   8e-97    
ref|XP_010676976.1|  PREDICTED: sugar transport protein 1-like          310   9e-97    
ref|XP_004296074.1|  PREDICTED: sugar transport protein 10-like         310   9e-97    
ref|XP_008441947.1|  PREDICTED: sugar carrier protein C-like            310   1e-96    
ref|XP_009111375.1|  PREDICTED: sugar transport protein 10-like         310   1e-96    
ref|XP_009366131.1|  PREDICTED: sugar transport protein 7-like is...    308   1e-96    
ref|XP_009348656.1|  PREDICTED: sugar carrier protein C-like            310   1e-96    
ref|XP_008222991.1|  PREDICTED: sugar carrier protein C-like            310   1e-96    
ref|NP_001234849.1|  hexose transporter 1                               310   1e-96    
ref|XP_007208848.1|  hypothetical protein PRUPE_ppa025599mg             309   1e-96    
ref|XP_009761332.1|  PREDICTED: sugar transport protein 12-like         310   1e-96    
ref|XP_004234261.1|  PREDICTED: sugar carrier protein C-like            310   1e-96    
ref|XP_008441746.1|  PREDICTED: sugar transport protein 10-like         309   1e-96    
ref|XP_002452988.1|  hypothetical protein SORBIDRAFT_04g036140          310   2e-96    
gb|KDP25511.1|  hypothetical protein JCGZ_20667                         309   2e-96    
ref|XP_008242891.1|  PREDICTED: sugar transport protein 7               309   2e-96    
ref|XP_006343267.1|  PREDICTED: sugar carrier protein C-like            309   2e-96    
ref|XP_009111387.1|  PREDICTED: sugar transport protein 10              309   2e-96    
ref|XP_008336925.1|  PREDICTED: sugar transport protein 7 isoform X1    311   2e-96    
ref|XP_006300082.1|  hypothetical protein CARUB_v10016310mg             309   2e-96    
ref|XP_009603909.1|  PREDICTED: sugar carrier protein C-like            309   2e-96    
emb|CDY33434.1|  BnaC01g32910D                                          308   2e-96    
ref|XP_008793638.1|  PREDICTED: sugar carrier protein C-like            308   2e-96    
ref|XP_007224158.1|  hypothetical protein PRUPE_ppa016440mg             302   2e-96    
emb|CDY33432.1|  BnaC01g32930D                                          308   3e-96    
ref|XP_009341808.1|  PREDICTED: sugar transport protein 7-like is...    307   3e-96    
ref|NP_001050592.1|  Os03g0594400                                       309   3e-96    
ref|XP_003566793.2|  PREDICTED: sugar transport protein 1-like          308   3e-96    
ref|NP_001237936.1|  monosaccharide transporter                         308   3e-96    
ref|XP_006347143.1|  PREDICTED: sugar carrier protein C-like            308   3e-96    
ref|XP_010112199.1|  Sugar transport protein 7                          308   3e-96    
ref|XP_009614842.1|  PREDICTED: sugar transport protein 12-like         308   4e-96    



>ref|XP_011090743.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=498

 Score =   457 bits (1176),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/300 (73%), Positives = 265/300 (88%), Gaps = 0/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP V+L +GSL+I+ETP SLVERGK  EG+AAL+++RGV+NV+AEF+ IV GC+
Sbjct  196   SLGLAAVPGVILFIGSLIITETPPSLVERGKEMEGRAALQKIRGVDNVDAEFQQIVTGCE  255

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK+PFKKL KKSG P L IS ++QVFQQFTGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  256   QAKQVKQPFKKLFKKSGFPALFISTIIQVFQQFTGINAIMFYAPVLFQTLGFKSDASLLS  315

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV ATFVSIY VDK GRRKLLLQ  +QM ISQ+A+G IL T+LK TGSLDK L
Sbjct  316   AVITGLVNVGATFVSIYAVDKVGRRKLLLQASVQMFISQVAIGAILVTHLKATGSLDKVL  375

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+CTFIIAQAFLS
Sbjct  376   AAVVVVLVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMICTFIIAQAFLS  435

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A+IFFFFSAWI+ MGLFV F +PETKG+P++L+ E+VWKQHPVW+KFF+ D + 
Sbjct  436   MLCHMRAYIFFFFSAWILVMGLFVLFLLPETKGIPIELVEERVWKQHPVWKKFFKDDAKE  495



>ref|XP_006356033.1| PREDICTED: sugar transport protein 8-like [Solanum tuberosum]
Length=485

 Score =   453 bits (1166),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 214/294 (73%), Positives = 254/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GS VI++TP+SL+ERGK E+GKAALK++RGV +VE E++ IVA C+
Sbjct  192   SLGFAAVPAIVLLVGSFVITDTPSSLIERGKDEQGKAALKKIRGVNDVEVEYQEIVAACE  251

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K +  P L+IS+LLQ+FQQFTGINAIMFYAPVLFQTMGFK +GSLLS
Sbjct  252   QAKLVKHPFRNLAKAASIPPLVISILLQIFQQFTGINAIMFYAPVLFQTMGFKTDGSLLS  311

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+G IL TNL+ TG+LD+ L
Sbjct  312   SVITGLVNVGSTFVSIYLVDKIGRRKLLLQACCQMLISQLAIGAILVTNLEETGTLDRKL  371

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +T+VV L+C YVM+FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T +IAQAFL+
Sbjct  372   ATIVVFLVCTYVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTSLIAQAFLT  431

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             M+C MQA+IFFFFS WIV MGLFV FF+PETKGVP+D MVE+VW QHPVW+K F
Sbjct  432   MLCTMQAYIFFFFSGWIVVMGLFVIFFLPETKGVPIDSMVERVWMQHPVWKKLF  485



>ref|XP_011090744.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=497

 Score =   453 bits (1166),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 263/300 (88%), Gaps = 0/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSLVI+ETP SLVE GK  E +AAL+++RGV+NV+AEF+ IV GC+
Sbjct  195   SLGLAAVPGFILFIGSLVITETPPSLVEMGKEMEARAALQKIRGVDNVDAEFQQIVTGCE  254

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK+PFKKL KKSG P L IS ++QVFQQFTGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  255   QAKQVKRPFKKLFKKSGFPALFISTIIQVFQQFTGINAIMFYAPVLFQTLGFKSDASLLS  314

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV ATFVSIY VDK GRRKLLLQ  IQM ISQ+A+G IL T+LK TGSLDK L
Sbjct  315   AVITGLVNVGATFVSIYAVDKVGRRKLLLQASIQMFISQVAIGAILVTHLKATGSLDKVL  374

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+CTFIIAQAFLS
Sbjct  375   AAVVVVLVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMICTFIIAQAFLS  434

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A+IFFFFSAWI+ MGLFV FF+PETKGVP++L+ E+VWKQHPVW+KFF+ D + 
Sbjct  435   MLCHMRAYIFFFFSAWILVMGLFVVFFLPETKGVPIELVEERVWKQHPVWKKFFKDDAKE  494



>ref|XP_011090740.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=497

 Score =   453 bits (1165),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 263/300 (88%), Gaps = 0/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSLVI+ETP SLVE GK  E +AAL+++RGV+NV+AEF+ IV GC+
Sbjct  195   SLGLAAVPGFILFIGSLVITETPPSLVEMGKEMEARAALQKIRGVDNVDAEFQQIVTGCE  254

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK+PFKKL KKSG P L IS ++QVFQQFTGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  255   QAKQVKRPFKKLFKKSGFPALFISTIIQVFQQFTGINAIMFYAPVLFQTLGFKSDASLLS  314

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV ATFVSIY VDK GRRKLLLQ  IQM ISQ+A+G IL T+LK TGSLDK L
Sbjct  315   AVITGLVNVGATFVSIYAVDKLGRRKLLLQASIQMFISQVAIGAILVTHLKATGSLDKVL  374

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+CTFIIAQAFLS
Sbjct  375   AAVVVVLVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMICTFIIAQAFLS  434

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A+IFFFFSAWI+ MGLFV FF+PETKGVP++L+ E+VWKQHPVW+KFF+ D + 
Sbjct  435   MLCHMRAYIFFFFSAWILVMGLFVVFFLPETKGVPIELVEERVWKQHPVWKKFFKDDAKE  494



>ref|XP_011090741.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=497

 Score =   451 bits (1159),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 220/300 (73%), Positives = 262/300 (87%), Gaps = 0/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSLVI+ETP SLVE GK  E +AAL+++RGV+NV+AEF+ IV GC+
Sbjct  195   SLGLAAVPGFILFIGSLVITETPPSLVEMGKEMEARAALQKIRGVDNVDAEFQQIVTGCE  254

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK+PFKKL KKSG P L IS ++QVFQQFTGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  255   QAKQVKRPFKKLFKKSGFPALFISTIIQVFQQFTGINAIMFYAPVLFQTLGFKSDASLLS  314

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV ATFVSIY VDK GRRKLLLQ  IQM ISQ+A+G IL T+LK TGSLDK L
Sbjct  315   AVITGLVNVGATFVSIYAVDKLGRRKLLLQASIQMFISQVAIGAILVTHLKATGSLDKVL  374

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+CTFIIAQAFLS
Sbjct  375   AAVVVVLVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMICTFIIAQAFLS  434

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A+IFFFFSAWI+ MGLFV F +PETKGVP++L+ E+VWKQHPVW+KFF+ D + 
Sbjct  435   MLCHMRAYIFFFFSAWILVMGLFVVFLLPETKGVPIELVEERVWKQHPVWKKFFKDDAKE  494



>dbj|BAO96219.1| sugar transporter 7, partial [Solanum lycopersicum]
Length=452

 Score =   448 bits (1153),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/294 (72%), Positives = 254/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVPA++L +GS VI++TP+SL+ERGK E+GK  LK++RGV +VE E++ IVA C+
Sbjct  159   SLGLAAVPAIVLFVGSFVITDTPSSLIERGKDEQGKTVLKKIRGVNDVEVEYQEIVAACE  218

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+ VK PF+ L K +  P L+I++LLQ+FQQFTGINAIMFYAPVLFQTMGFK+ GSLLS
Sbjct  219   QARLVKYPFRSLAKAASIPPLVIAILLQIFQQFTGINAIMFYAPVLFQTMGFKSEGSLLS  278

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+G IL TNL+ TG+L+K L
Sbjct  279   SVITGLVNVGSTFVSIYLVDKVGRRKLLLQACCQMLISQLAIGAILVTNLEETGTLNKKL  338

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+C YVM+FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T +IAQAFL+
Sbjct  339   AAIVVLLVCTYVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTSLIAQAFLT  398

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             M+C MQA+IFFFFSAWIV MGLFV FF+PETKGVP+D MVE+VW QHPVW+K F
Sbjct  399   MLCTMQAYIFFFFSAWIVVMGLFVIFFLPETKGVPIDSMVERVWMQHPVWKKLF  452



>ref|XP_004234230.1| PREDICTED: sugar transport protein 8-like [Solanum lycopersicum]
Length=487

 Score =   449 bits (1156),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 254/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVPA++L +GS VI++TP+SL+ERGK E+GK  LK++RGV +VE E++ IVA C+
Sbjct  194   SLGLAAVPAIVLFVGSFVITDTPSSLIERGKDEQGKTVLKKIRGVNDVEVEYQEIVAACE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K +  P L+I++LLQ+FQQFTGINAIMFYAPVLFQTMGFK+ GSLLS
Sbjct  254   QAKLVKYPFRNLAKAASIPPLVIAILLQIFQQFTGINAIMFYAPVLFQTMGFKSEGSLLS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+G IL TNL+ TG+L+K L
Sbjct  314   SVITGLVNVGSTFVSIYLVDKVGRRKLLLQACCQMLISQLAIGAILVTNLEETGTLNKKL  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+C YVM+FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T +IAQAFL+
Sbjct  374   AAIVVLLVCTYVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTSLIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             M+C MQA+IFFFFSAWIV MGLFV FF+PETKGVP+D MVE+VW QHPVW+K F
Sbjct  434   MLCTMQAYIFFFFSAWIVVMGLFVIFFLPETKGVPIDSMVERVWMQHPVWKKLF  487



>ref|XP_009794717.1| PREDICTED: sugar transport protein 8-like [Nicotiana sylvestris]
Length=487

 Score =   448 bits (1152),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 252/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GS VI++TP SL+ERGK  +GKAALK++RGV +VE+E++ IVA C+
Sbjct  194   SLGFAAVPAMVLLIGSFVITDTPTSLIERGKEVQGKAALKKIRGVSDVESEYQEIVAACE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L K +  P L+I++LLQ+FQQFTGINAIMFYAPVLFQTMGFK +GSLLS
Sbjct  254   QAKQVKHPFRNLAKTASIPPLLIAILLQIFQQFTGINAIMFYAPVLFQTMGFKTDGSLLS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+G ILATNL+ TG+LDK L
Sbjct  314   SVITGLVNVGSTFVSIYLVDKVGRRKLLLQACCQMLISQVAIGAILATNLRETGTLDKKL  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV L+C YVM+FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T +IAQAFL+
Sbjct  374   AAVVVFLVCTYVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTSLIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             M+C MQA+IFFFFS WIV MGLFV F +PETKG+P+D MVE VW +HPVW+K F
Sbjct  434   MLCTMQAYIFFFFSGWIVVMGLFVIFLLPETKGIPIDSMVESVWMKHPVWKKLF  487



>gb|EYU41506.1| hypothetical protein MIMGU_mgv1a005012mg [Erythranthe guttata]
Length=500

 Score =   448 bits (1152),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 262/305 (86%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSL+I+ETP+SLVERGK +EG+ ALK++RGV+ V+AEF+ IVA C+
Sbjct  196   SLGLAAVPGCVLLVGSLIITETPSSLVERGKEDEGRKALKKIRGVDEVDAEFQQIVAACE  255

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
               +QVKKPFKKL K+SG P L ++ ++QVFQQ TGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  256   QGRQVKKPFKKLFKRSGIPALFVANIIQVFQQLTGINAIMFYAPVLFQTLGFKSDASLLS  315

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV ATFVSIY VDK GRRKLLLQ  +QM ISQ+A+G IL T+L  TG+L K L
Sbjct  316   SVITGLVNVGATFVSIYLVDKVGRRKLLLQASVQMFISQVAIGAILLTHLSATGTLHKGL  375

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+ TFIIAQAFLS
Sbjct  376   AALVVILVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMIFTFIIAQAFLS  435

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDV-R  279
             MMC M+A+IFFFFSAWI+AMGLFV F +PETKG+P++L+ E+VWKQHPVW+KF+  D  +
Sbjct  436   MMCHMRAYIFFFFSAWILAMGLFVVFLLPETKGIPIELIEERVWKQHPVWKKFYDDDEGK  495

Query  278   SYEMA  264
               EMA
Sbjct  496   RDEMA  500



>ref|XP_009614744.1| PREDICTED: sugar transport protein 8-like [Nicotiana tomentosiformis]
Length=487

 Score =   447 bits (1149),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 210/294 (71%), Positives = 252/294 (86%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GS VI++TP SL+ERGK  +GKAALK++RGV  VE+E++ IVA C+
Sbjct  194   SLGFAAVPAMVLLIGSFVITDTPTSLIERGKEVQGKAALKKIRGVSEVESEYQEIVASCE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L K +  P L+I++LLQ+FQQFTGINAIMFYAPVLFQTMGFK +GSLLS
Sbjct  254   QAKQVKHPFRNLAKAASIPPLVIAILLQIFQQFTGINAIMFYAPVLFQTMGFKTDGSLLS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TF+SIY VDK GRRKLLLQ C QM+ISQ+A+G IL TNL+ TG+LD+TL
Sbjct  314   SVITGLVNVGSTFISIYLVDKVGRRKLLLQACCQMLISQIAIGAILVTNLRETGTLDRTL  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C YVM+FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T +IAQAFL+
Sbjct  374   AAVVVLLVCTYVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTSLIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             M+C MQA+IFFFFS WIV MGLFV F +PETKG+P+D MVE VW +HPVW+K F
Sbjct  434   MLCTMQAYIFFFFSGWIVVMGLFVIFLLPETKGIPIDSMVESVWMKHPVWKKLF  487



>ref|XP_006356676.1| PREDICTED: sugar transport protein 8-like [Solanum tuberosum]
Length=489

 Score =   446 bits (1147),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 258/297 (87%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVPA+ML +G  VI++TPASL+ERGK E+GKAALK++RGV++VE EF+ IVA C+
Sbjct  194   SLGLAAVPALMLLVGCFVITDTPASLIERGKDEQGKAALKKVRGVDDVEVEFKEIVAACE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K +  P L+I+V LQ+FQQFTGINAIMFYAPVLFQTMGFK++G+LLS
Sbjct  254   QAKAVKHPFRNLMKSASVPPLVIAVFLQIFQQFTGINAIMFYAPVLFQTMGFKSDGALLS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+GIIL+ +LK TG+LD+TL
Sbjct  314   AVITGLVNVGSTFVSIYAVDKVGRRKLLLQACCQMLISQLAIGIILSFSLKETGTLDRTL  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +T+VVIL+C YVM+FAWSWGPL WLIPSE FP+ETRTAGFAFAVSTNML T IIAQAFL+
Sbjct  374   ATIVVILVCTYVMSFAWSWGPLGWLIPSETFPMETRTAGFAFAVSTNMLFTSIIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C MQA IFFFFS WIV MGLFV F VPETKGVP+D MV+ VWK HPVW++ F+++
Sbjct  434   MLCKMQANIFFFFSGWIVVMGLFVVFLVPETKGVPIDGMVD-VWKSHPVWKRCFKNE  489



>gb|EYU41507.1| hypothetical protein MIMGU_mgv1a005011mg [Erythranthe guttata]
Length=500

 Score =   443 bits (1140),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 209/297 (70%), Positives = 256/297 (86%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSL+I+ETP+SL+ERGK +EGK ALK++RGV+ V+AEF  IVA C+
Sbjct  196   SLGLAAVPGCVLLVGSLIITETPSSLIERGKEDEGKKALKKIRGVDEVDAEFRQIVAACE  255

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
               +QVKKPFKKL K+SG P L ++ ++QVFQQ TGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  256   QGRQVKKPFKKLFKRSGIPALFVANIIQVFQQLTGINAIMFYAPVLFQTLGFKSDASLLS  315

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV ATFVSIY VDK GRRKLLLQ  +QM ISQ+A+G IL T+L  TG+L K L
Sbjct  316   SVITGLVNVGATFVSIYLVDKVGRRKLLLQASVQMFISQVAIGAILLTHLSATGTLHKGL  375

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C +VM+FAWSWGP+ WLIPSEIFP+ETRTAGFAFAVSTNM+ TFIIAQAFLS
Sbjct  376   AALVVILVCTFVMSFAWSWGPMGWLIPSEIFPIETRTAGFAFAVSTNMIFTFIIAQAFLS  435

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             MMC M+A+IFFFFSAWI+ MGLFV F +PETKG+P++L+ E+VWKQHPVW+KF+  +
Sbjct  436   MMCHMRAYIFFFFSAWILVMGLFVVFLLPETKGIPIELIEERVWKQHPVWKKFYDDE  492



>ref|XP_009621209.1| PREDICTED: sugar transport protein 8-like [Nicotiana tomentosiformis]
Length=490

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 248/284 (87%), Gaps = 0/284 (0%)
 Frame = -1

Query  1136  LGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQVKKPFKKLT  957
             +G  VI++TPASL+ERGK ++GKAALK++RGVE+VE E++ IVA C+ AKQVK PF+ L 
Sbjct  207   IGCFVITDTPASLIERGKEDQGKAALKKIRGVEDVEVEYKEIVAACEQAKQVKHPFRNLV  266

Query  956   KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGLVNVLATF  777
             K +  P L+I++ LQ+FQQFTGINAIMFYAPVLFQTMGFK++G+LLS++ITGLVNV ATF
Sbjct  267   KAASVPPLVIAIFLQIFQQFTGINAIMFYAPVLFQTMGFKSDGALLSAVITGLVNVGATF  326

Query  776   VSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTLSTVVVILICLYVM  597
             VSIY VDK GRRKLLLQ C QM+ISQ+A+G IL+ NLK TG+LD+TL+ +VV+L+C YVM
Sbjct  327   VSIYAVDKLGRRKLLLQACCQMLISQLAIGGILSVNLKETGTLDRTLAAIVVVLVCTYVM  386

Query  596   AFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGMQAFIFFFF  417
             +FAWSWGPL WLIPSE FP+ETRTAGFAFAVSTNML T +IAQAFL+M+C MQA+IFFFF
Sbjct  387   SFAWSWGPLGWLIPSETFPMETRTAGFAFAVSTNMLFTSLIAQAFLTMLCKMQAYIFFFF  446

Query  416   SAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SAWIV MGLFV F +PETKGVP+D MVE VWK+HPVW+K F+++
Sbjct  447   SAWIVVMGLFVIFLLPETKGVPIDSMVEDVWKKHPVWKKLFKNE  490



>ref|XP_009795520.1| PREDICTED: sugar transport protein 8-like [Nicotiana sylvestris]
Length=490

 Score =   439 bits (1128),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 248/284 (87%), Gaps = 0/284 (0%)
 Frame = -1

Query  1136  LGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQVKKPFKKLT  957
             +G  VI++TPASL+ERGK ++GKAALK++RG+E+VE E++ IVA C+ AKQVK PF+ L 
Sbjct  207   IGCFVITDTPASLIERGKEDQGKAALKKIRGIEDVEVEYKEIVAACEQAKQVKHPFRNLI  266

Query  956   KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGLVNVLATF  777
             K +  P L+I++ LQ+FQQFTGINAIMFYAPVLFQTMGFK++G+LLS++ITGLVNV ATF
Sbjct  267   KAASVPPLVIAIFLQIFQQFTGINAIMFYAPVLFQTMGFKSDGALLSAVITGLVNVGATF  326

Query  776   VSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTLSTVVVILICLYVM  597
             VSIY VDK GRRKLLLQ C QM+ISQ+A+G IL+ NLK TG+LD+TL+ +VV+L+C YVM
Sbjct  327   VSIYAVDKLGRRKLLLQACCQMLISQLAIGGILSVNLKETGTLDRTLAAIVVVLVCTYVM  386

Query  596   AFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGMQAFIFFFF  417
             +FAWSWGPL WLIPSE FP+ETRTAGFAFAVSTNML T +IAQAFL+M+C MQA+IFFFF
Sbjct  387   SFAWSWGPLGWLIPSETFPMETRTAGFAFAVSTNMLFTSLIAQAFLTMLCKMQAYIFFFF  446

Query  416   SAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SAWIV MGLFV F +PETKGVP+D MVE VWK+HPVW+K F+++
Sbjct  447   SAWIVVMGLFVIFLLPETKGVPIDSMVEDVWKKHPVWKKLFKNE  490



>ref|XP_004228841.2| PREDICTED: sugar transport protein 8-like [Solanum lycopersicum]
Length=489

 Score =   430 bits (1106),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PAV+L +G+ VI++TP SL+ERG  E+GK+ L ++RGV +VE E++ IV  C 
Sbjct  195   SLGLAAIPAVILFIGTFVITDTPTSLIERGNEEQGKSTLMKIRGVNDVEDEYKEIVIACQ  254

Query  995   AAKQVKK-PFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              AKQVK+   KKL K +  P L+I VLLQVFQQFTGINAIMFYAPVLFQTMGFKAN SLL
Sbjct  255   QAKQVKQHSLKKLLKPASIPPLVIGVLLQVFQQFTGINAIMFYAPVLFQTMGFKANASLL  314

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKT  639
             SS+ITG+VNV +TFVSIY VDK GRRKLLLQ C QM+ISQ+A+G IL T+L  TG+L+KT
Sbjct  315   SSVITGIVNVGSTFVSIYLVDKVGRRKLLLQACCQMLISQLAIGAILLTSLSDTGTLNKT  374

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+L+C YVM+FAWSWGPL WLIPSE FPLETRT GFAFAVSTNML T IIAQ FL
Sbjct  375   LALIVVVLVCTYVMSFAWSWGPLGWLIPSETFPLETRTTGFAFAVSTNMLFTSIIAQLFL  434

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             +M+C M+A+IFFFFS WIV MGL V+FF+PETKGVP+D MVE+VW QHP+W+K F
Sbjct  435   TMLCTMKAYIFFFFSGWIVVMGLVVYFFLPETKGVPIDSMVERVWMQHPIWKKLF  489



>ref|XP_010256217.1| PREDICTED: sugar transport protein 6-like [Nelumbo nucifera]
Length=514

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 245/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGL  VPA++L LGSLVI+ETP SL+ER + EEGK  LK++RG +NV+ EF+ I+A  D
Sbjct  202   SLGLTGVPAIILCLGSLVITETPTSLIERERFEEGKETLKKIRGTDNVDDEFDQILAASD  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+KKL K+S +P L+I++LLQ+FQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  262   MARQVKSPYKKLMKRSSRPPLVIAILLQIFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNVL+T VSIY VD+AGRR LLLQ  +QM I+Q  +G IL  +L  TGSL +T 
Sbjct  322   SVITGLVNVLSTMVSIYLVDRAGRRVLLLQASVQMFITQAIIGAILTMDLSATGSLGRTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLETRT+GFAFAVS+NMLCTFIIAQAFLS
Sbjct  382   AAIVVVLVCLFVMSFAWSWGPLGWLIPSETFPLETRTSGFAFAVSSNMLCTFIIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C MQA IFFFF+ WI+ MGLF FF +PETK +PVD M ++VWKQH  WR++   D
Sbjct  442   MLCTMQAGIFFFFAVWILIMGLFAFFLLPETKSIPVDEMTKRVWKQHWYWRRYMGED  498



>gb|EPS64536.1| hypothetical protein M569_10244 [Genlisea aurea]
Length=494

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 251/297 (85%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVP  +L +GSL+I+ETP SLVERG+ EEGK ALKR+RGV++VE EF+ IVAGC+
Sbjct  198   SLGLAAVPGSILLIGSLIITETPPSLVERGRSEEGKQALKRIRGVDDVEDEFQQIVAGCE  257

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+ + P+K L  KS  P L I   +Q+FQQFTGINAIMFYAPVLFQT+GF+++ SL+S
Sbjct  258   EAKRFQNPWKNLLSKSSFPALFIGNTIQIFQQFTGINAIMFYAPVLFQTLGFRSDASLMS  317

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+I GLVNVL+TFVSI  VDK GRRKLLLQ  +QM ISQ+++G IL T+LK TGSL+K++
Sbjct  318   SLIIGLVNVLSTFVSITFVDKFGRRKLLLQASVQMFISQVSIGAILLTHLKPTGSLEKSM  377

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C +VM+FAWSWGP+ WLIP+EI+P+ETR AGFA AVSTNM+ TF+IAQAFLS
Sbjct  378   AGVVVLLVCSFVMSFAWSWGPMGWLIPTEIYPIETRAAGFAVAVSTNMMFTFLIAQAFLS  437

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             MMC M+A+IFFFFSAWIVAMGLF +F +PETKG+P++ + E+VWK HPVW KFF+ D
Sbjct  438   MMCHMKAYIFFFFSAWIVAMGLFAYFLLPETKGIPIEHVEERVWKVHPVWSKFFKDD  494



>ref|XP_002517214.1| sugar transporter, putative [Ricinus communis]
 gb|EEF45377.1| sugar transporter, putative [Ricinus communis]
Length=515

 Score =   425 bits (1092),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 252/302 (83%), Gaps = 0/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+MLGLGSL+I ETP SLVER ++EEG+A LK++RGV+NV+ EF++IV  C+
Sbjct  203   SLGLAGVPALMLGLGSLLIVETPTSLVERNRIEEGRAVLKKIRGVDNVDLEFDSIVHACE  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QV  P++KL K+  +P L+I++LLQ+FQQFTGINAIMFYAPVLFQT+GF  + SLLS
Sbjct  263   MARQVTDPYRKLMKRPSRPPLVIAILLQIFQQFTGINAIMFYAPVLFQTVGFGNDASLLS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S++TGLVNVL+T VSI  VD+AGRR LLL+ C+QM+I+Q  +G +L  +LK TG L  + 
Sbjct  323   SVVTGLVNVLSTVVSIVVVDRAGRRILLLESCVQMLITQTIIGALLLKDLKPTGELPSSE  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+++C+YV  FAWSWGPL WLIPSE FPLETRTAG++FAVS+NMLCTFIIAQAFLS
Sbjct  383   AMVVVVMVCIYVAGFAWSWGPLGWLIPSETFPLETRTAGYSFAVSSNMLCTFIIAQAFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C MQA IFFFF+AWIV M LF +FF+PETKGVPVD+MVE+VWKQH  W++FF  + + 
Sbjct  443   MLCSMQAGIFFFFAAWIVVMMLFAYFFIPETKGVPVDVMVERVWKQHWFWKRFFDGEEKE  502

Query  275   YE  270
              E
Sbjct  503   VE  504



>ref|XP_006378398.1| hypothetical protein POPTR_0010s10030g [Populus trichocarpa]
 gb|ERP56195.1| hypothetical protein POPTR_0010s10030g [Populus trichocarpa]
Length=492

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 244/293 (83%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAV L +GS+VI+ETP SL+ERG    G++ L+++RGV+NV +EFE I A  +
Sbjct  198   SLGLAGVPAVFLFIGSIVITETPTSLIERGNETAGQSTLRKIRGVDNVNSEFEQIKAASE  257

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QV+ P+KKL K+S  P LII +LLQVFQQ TGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  258   IARQVRHPYKKLMKRSSMPPLIIGILLQVFQQLTGINAIMFYAPVLFQTVGFKNDASLLS  317

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG+VNVL+T VSI+ VDK GRR LLLQ C+QM+ISQ A+G IL   L TTGSL K  
Sbjct  318   AVITGIVNVLSTLVSIFYVDKVGRRVLLLQACVQMLISQTAIGGILLAFLTTTGSLTKLQ  377

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+C++VM+FAWSWGPL WLIPSE FP ETRTAGFAFAVS+NML TF+IAQAFLS
Sbjct  378   AAFVVVLVCMFVMSFAWSWGPLGWLIPSETFPQETRTAGFAFAVSSNMLFTFLIAQAFLS  437

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M+AFIFFFF+ WI+ MGLFV+F +PETK VP+DLMVE+VWKQHPVW++F
Sbjct  438   MLCHMRAFIFFFFAGWILKMGLFVYFLLPETKNVPIDLMVERVWKQHPVWKRF  490



>gb|KHG00927.1| Sugar transport 8 -like protein [Gossypium arboreum]
 gb|KHG01686.1| Sugar transport 8 -like protein [Gossypium arboreum]
Length=507

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/300 (68%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA+ML LGS++I ETP SL+ER KVEEG+  L+++RGVENV+ EF++I+  C+
Sbjct  202   SLGIAGVPALMLCLGSILICETPTSLIERHKVEEGRKVLRKIRGVENVDDEFDSIIHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+KL K   +PQL+IS+ LQ+FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  262   MAKQVKDPFRKLMKPVSRPQLVISICLQIFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTG-SLDKT  639
             S+ITGLVNV +T VSIY VD+AGRR LLL+ C+QM ISQ+ +GIIL   LKTTG +L K 
Sbjct  322   SVITGLVNVFSTVVSIYVVDRAGRRILLLEACVQMFISQVIIGIILFKELKTTGDNLSKG  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VVIL+C +VM FAWSWGPL WLIPSEIFPLETR+AGFAFAVSTNML TFII QAFL
Sbjct  382   EGIFVVILVCTFVMGFAWSWGPLGWLIPSEIFPLETRSAGFAFAVSTNMLFTFIIGQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C MQA IFFFF+AW++ MG F +F +PETKGVPVD MV+KVWKQH  WR F   D R
Sbjct  442   SMLCQMQAGIFFFFAAWVIIMGAFTWFLLPETKGVPVDSMVDKVWKQHWFWRSFMMEDNR  501



>ref|XP_011021554.1| PREDICTED: sugar transport protein 8 [Populus euphratica]
Length=492

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 243/293 (83%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAV L +GS+VI+ETP SL+ERG    G++ L+++RGV+NV +EFE I A  +
Sbjct  198   SLGLAGVPAVFLFIGSIVITETPTSLIERGNETAGQSTLRKIRGVDNVNSEFEQIKAASE  257

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PFKKL K+S  P LII +LLQVFQQ TGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  258   IARQVKHPFKKLMKRSSMPPLIIGILLQVFQQLTGINAIMFYAPVLFQTVGFKNDASLLS  317

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG+VNVL+T VSI+ VDK GRR LLLQ C+QM+ISQ A+G IL   L  TGSL K  
Sbjct  318   AVITGIVNVLSTLVSIFYVDKVGRRVLLLQACVQMLISQTAIGGILLAFLTPTGSLTKLQ  377

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+C++VM+FAWSWGPL WLIPSE FP ETRTAGFAFAVS+NML TF+IAQAFLS
Sbjct  378   AAFVVVLVCMFVMSFAWSWGPLGWLIPSETFPQETRTAGFAFAVSSNMLFTFLIAQAFLS  437

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M+AFIFFFF+ WI+ MGLFV+F +PETK VP+DLMVE+VWKQHPVW++F
Sbjct  438   MLCNMRAFIFFFFAGWILKMGLFVYFLLPETKNVPIDLMVERVWKQHPVWKRF  490



>emb|CDO99034.1| unnamed protein product [Coffea canephora]
Length=683

 Score =   426 bits (1094),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 255/301 (85%), Gaps = 4/301 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPAV+L  GSLVI+E+PASLVER + EEGKAALK++RGV+ V+AEFE I++ C+
Sbjct  167   SLGGAAVPAVVLFAGSLVITESPASLVERKREEEGKAALKKIRGVDEVDAEFEEILSACE  226

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A ++K+PFKKL KK   P L+I+V LQVFQQFTGINAIMFYAPVLFQT+GFK++ SLLS
Sbjct  227   IASKIKQPFKKLMKKQSLPPLVIAVALQVFQQFTGINAIMFYAPVLFQTLGFKSDASLLS  286

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +TFV+I+ VDK GRRKLLLQ C QM+ISQ+A+G+IL   L  TGSLDK L
Sbjct  287   SVITGLVNVGSTFVAIFLVDKVGRRKLLLQACCQMLISQVAIGVILHLKLSETGSLDKGL  346

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+++C +VM+FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TF+IAQ FLS
Sbjct  347   AAVVVVMVCTFVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFVIAQMFLS  406

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             MMC M+A+IFFFFSAWIV MGLFV   +PETKG+P+D MVE+VWK+HP    +F+S + +
Sbjct  407   MMCHMKAYIFFFFSAWIVVMGLFVIVLLPETKGIPIDSMVERVWKKHP----YFQSKITA  462

Query  275   Y  273
             Y
Sbjct  463   Y  463


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLR  1047
             SLGLA  PA++L +GS+VI+ETP+SLVERGK E+G  ALK++ 
Sbjct  641   SLGLAGAPAILLFIGSIVITETPSSLVERGKEEKGIEALKKIN  683



>ref|XP_006419890.1| hypothetical protein CICLE_v10006537mg [Citrus clementina]
 gb|ESR33130.1| hypothetical protein CICLE_v10006537mg [Citrus clementina]
 gb|KDO74666.1| hypothetical protein CISIN_1g040949mg [Citrus sinensis]
Length=490

 Score =   417 bits (1073),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 201/294 (68%), Positives = 239/294 (81%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA+ L +GS+VI+ETP SL+ERG    G  ALK++RGVE+V AE+E I    D
Sbjct  194   SLALAGVPAIFLFIGSIVITETPTSLIERGNEVAGHKALKKIRGVEDVNAEYEQIKLASD  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PFK+L K+S  P LII VLLQVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  254   IARQVKHPFKELMKRSSMPPLIIGVLLQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             S+ITG VNVL+T VSIY VDK GRRKLLLQ C+QM ISQ  +G +L  +LK T+ +L  T
Sbjct  314   SVITGTVNVLSTLVSIYAVDKVGRRKLLLQACVQMFISQSTIGGMLLVHLKATSNTLTTT  373

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV L+CL+VMAFAWSWGPL WLIPSE FPLETRTAGFAFAVS+NM  TF+IAQAFL
Sbjct  374   QAGFVVFLVCLFVMAFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMFFTFLIAQAFL  433

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SMMC M+A+IFFFF+ WI+ MGLF  F +PETKGVP+D+MVE+VWK+HPVW++F
Sbjct  434   SMMCHMRAYIFFFFAGWILVMGLFALFLLPETKGVPIDVMVERVWKKHPVWKRF  487



>gb|EYU41505.1| hypothetical protein MIMGU_mgv1a004927mg [Erythranthe guttata]
Length=504

 Score =   417 bits (1073),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 249/304 (82%), Gaps = 1/304 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LGLA VP V+L +GS +I ETP+SL+ERG   +G+ ALK++RGV++VEAE E+I + C+
Sbjct  200   ALGLAGVPGVVLLIGSFIIMETPSSLIERGMETDGREALKKIRGVDDVEAELESIRSACE  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+ VK PFKKL K++  P L+I++ +QVFQQFTGINA+MFYAPVLFQT+GFK + SLLS
Sbjct  260   KARLVKHPFKKLMKRASVPPLVIAISIQVFQQFTGINAVMFYAPVLFQTVGFKTDSSLLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+I G+VNVL+T VSI  VD+ GRRKLLLQ  +QM I  + VG IL  +LK TGSLDK L
Sbjct  320   SVIMGMVNVLSTIVSIIAVDRVGRRKLLLQASVQMFICMVGVGSILLVHLKPTGSLDKRL  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+CL+VM+FAWSWGP+ WLIPSEIFPLETRTAGFAFAVSTNML TF+IAQ FLS
Sbjct  380   AAAVVVLVCLFVMSFAWSWGPMGWLIPSEIFPLETRTAGFAFAVSTNMLFTFVIAQGFLS  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD-VR  279
             M+C MQ++IFFFF+AWI+ MGLFV F +PETKGVP++ + E+VW++HPVW+ F   + VR
Sbjct  440   MLCNMQSYIFFFFAAWILVMGLFVLFLLPETKGVPIEAITERVWRKHPVWKNFMAKEIVR  499

Query  278   SYEM  267
             + EM
Sbjct  500   NTEM  503



>ref|XP_006356032.1| PREDICTED: sugar transport protein 8-like [Solanum tuberosum]
Length=487

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/294 (67%), Positives = 239/294 (81%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A VPA +L +G+ VIS+TP SLV RGK E+GK ALK++RGV +V+ E+E IVA C+
Sbjct  194   SLGSAVVPAAILFIGTFVISDTPMSLVARGKPEKGKTALKKIRGVTDVDVEYEEIVASCE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK  F+ LT+    P L+I+++LQ+FQQ TGINAIMFYAPVLFQTMGFK +G L+S
Sbjct  254   QAKQVKHAFRNLTQPPSIPPLVIAIMLQIFQQLTGINAIMFYAPVLFQTMGFKGSGPLIS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TGLVNVL+T V+I  VDK GR+KLL+Q C QM+I QMA+G IL  NL  TG LDKT+
Sbjct  314   AVVTGLVNVLSTCVAIIAVDKVGRKKLLIQSCCQMLICQMAIGFILLKNLSETGGLDKTM  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+C YVMAFAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML T IIAQAFL+
Sbjct  374   AVIVVLLVCTYVMAFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTAIIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
              +C MQA+ FFFFSAWI  MGL   FF+PETKG+P+D MVE+ WK+HPVW+K F
Sbjct  434   TLCFMQAYTFFFFSAWIFVMGLCAIFFLPETKGIPIDAMVERAWKKHPVWKKLF  487



>ref|XP_004234231.1| PREDICTED: sugar transport protein 8-like [Solanum lycopersicum]
Length=487

 Score =   414 bits (1064),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 239/294 (81%), Gaps = 0/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A +PA +L LG+ VI++TP SLV RGK E+ K ALK++RGV NV+ E+E IVA C+
Sbjct  194   SLGSAVIPATVLFLGTFVINDTPMSLVARGKPEKAKVALKKVRGVSNVDVEYEEIVASCE  253

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK  F+ LTK    P L+I+++LQ+FQQFTGINAIMFYAPVLFQTMGFK +G L+S
Sbjct  254   QAKQVKHAFRNLTKPPSIPPLVIAIMLQIFQQFTGINAIMFYAPVLFQTMGFKGSGPLIS  313

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG VNVL+T V+IY VDK GR+KLL+Q C QM+I Q+A+G IL  NL  TG L+KT+
Sbjct  314   AVVTGSVNVLSTCVAIYAVDKVGRKKLLIQSCCQMLICQVAIGFILLKNLSDTGGLNKTM  373

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV L+C YVMAFAWSWGPL WLIPSE FP+ETRTAGFAFAVSTNML T IIAQAFL+
Sbjct  374   AMIVVFLVCAYVMAFAWSWGPLGWLIPSETFPMETRTAGFAFAVSTNMLFTAIIAQAFLT  433

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
              +C ++A+ FFFFSAWI  MGLF  FF+PETKG+P+D MVE+ WK+HPVW+K F
Sbjct  434   TLCLLRAYTFFFFSAWIFVMGLFAIFFLPETKGIPIDAMVERAWKKHPVWKKLF  487



>ref|XP_006837022.1| hypothetical protein AMTR_s02390p00006900, partial [Amborella 
trichopoda]
 gb|ERM99875.1| hypothetical protein AMTR_s02390p00006900, partial [Amborella 
trichopoda]
Length=323

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 239/299 (80%), Gaps = 0/299 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L  GSL+I ETP SL+ERGK E+GKA L+R+RG +NVE EF+ +V  C+
Sbjct  23    SLGLAGVPAALLCFGSLLIVETPTSLIERGKSEKGKATLERIRGTKNVEPEFQQLVKACE  82

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK P+ +L ++ G P+L IS++LQVFQQ TGINAIMFYAPVLFQTMGFK + SLLS
Sbjct  83    TASEVKHPYHRLMRRDGHPRLFISIILQVFQQLTGINAIMFYAPVLFQTMGFKNDASLLS  142

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV+ATFVSI  VD+ GR+ LLLQ  +QM I Q A+GIIL  +L  T SL+ T+
Sbjct  143   AVITGLVNVIATFVSIAIVDRVGRKALLLQAAVQMFICQGAIGIILLKDLHLTNSLNPTV  202

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVIL+C YV +FAWSWGPL WLIPSEIFPLETR+AGF+FAV +NML TF+IAQAFLS
Sbjct  203   AIVVVILVCCYVASFAWSWGPLGWLIPSEIFPLETRSAGFSFAVCSNMLFTFLIAQAFLS  262

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             MMC ++A IFFFF+ WI+ MG FV FF+PETKGVP+D M E+VWK+H +W +F   +  
Sbjct  263   MMCHLKAGIFFFFAGWILIMGTFVVFFLPETKGVPIDQMTERVWKKHWLWARFMAEETN  321



>ref|XP_010666755.1| PREDICTED: sugar transport protein 8-like [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   413 bits (1061),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 245/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L LG+++I+ETP SL+ER +V+EG+  LK++RG+++VEAE + I+  CD
Sbjct  198   SLGLAIVPALLLLLGAIIITETPTSLIERNRVDEGRKVLKKIRGIDDVEAELQQIIEACD  257

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF++L KK   P L+I + +QVFQQ TGINAIMFYAP+LFQT+GFK++GSLLS
Sbjct  258   QAKLVKHPFRELRKKQSVPPLVIGISMQVFQQMTGINAIMFYAPILFQTVGFKSDGSLLS  317

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++I GLVNV +T VS++ VDK GRRKLLLQ C+QM ISQ+A+GIIL   L  T +L K  
Sbjct  318   AVIIGLVNVFSTLVSVFGVDKFGRRKLLLQACVQMFISQIAIGIILIVKLTDTNTLPKGA  377

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L C++VM+FAWSWGPL WLIPSE FP+ETRTAGFAFAVS+NML TFIIAQAFLS
Sbjct  378   AMLVVVLTCMFVMSFAWSWGPLGWLIPSETFPVETRTAGFAFAVSSNMLFTFIIAQAFLS  437

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M+A+IF FFSAWIV MG+FV F +PETKGVP+D + E+VWK+HPVW++F   D
Sbjct  438   MLCHMRAYIFIFFSAWIVVMGIFVIFLLPETKGVPIDAVAERVWKKHPVWKRFMDED  494



>ref|XP_002530190.1| sugar transporter, putative [Ricinus communis]
 gb|EEF32204.1| sugar transporter, putative [Ricinus communis]
Length=503

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 240/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV L  GSL+I++TP SL+ERGK +EG  AL+ +R + +V+ EF+ I + CD
Sbjct  209   SLGLAGLPAVFLFFGSLIITDTPTSLIERGKEDEGIQALENIRDLSDVDIEFKQIQSACD  268

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              ++QVK PF  + K+  +P L+I +L+QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  269   VSRQVKTPFWNVFKRPSRPPLVIGILMQVFQQFTGINAIMFYAPVLFQTVGFKDDASLLS  328

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITG+VNVL+T VS+Y VDK GRRKLLLQ C+QM ISQ+A+G+IL   L  +GSL K L
Sbjct  329   SVITGIVNVLSTSVSVYAVDKFGRRKLLLQACVQMFISQVAIGLILLLKLTASGSLSKLL  388

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV L+CLYVM+FAWSWGPL WLIPSE FPLETRT GFAFAVS+NMLCTFIIAQAFLS
Sbjct  389   AGIVVGLVCLYVMSFAWSWGPLGWLIPSETFPLETRTYGFAFAVSSNMLCTFIIAQAFLS  448

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC MQA IFFFF+  I+ MGLFV+  +PETK VP+DLMVE+VWK+HP W +F
Sbjct  449   MMCSMQACIFFFFAGCILVMGLFVWKLLPETKNVPIDLMVEEVWKKHPFWSRF  501



>ref|XP_010026975.1| PREDICTED: sugar transport protein 8-like [Eucalyptus grandis]
 gb|KCW60807.1| hypothetical protein EUGRSUZ_H03542 [Eucalyptus grandis]
Length=503

 Score =   408 bits (1048),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 249/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAV+L +GS +I ETP SL+ER +V++GKA L+R+RG  NV+AEF +IVA  +
Sbjct  202   SLGLAGVPAVILLVGSFIICETPTSLIERNRVDQGKATLRRIRGTNNVDAEFNSIVAASE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PF+KL + S +P L+I++LLQVFQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  262   AARRVKHPFRKLMRPSSRPPLVIAMLLQVFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +T VSIY+VDKAGRR LLL+ C+QM I+Q+ +G++L  +LK TGSLD T 
Sbjct  322   TVITGLVNVFSTLVSIYSVDKAGRRVLLLEACVQMFITQIIIGVLLLLHLKPTGSLDSTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C++VM FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TFIIAQAFLS
Sbjct  382   AIVVVVLVCVFVMGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFIIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M+A IFFFF+AWI+ MGLF  F +PETKGVPVDLMVE+VWKQH  W+++
Sbjct  442   MLCHMKAGIFFFFAAWILVMGLFALFLLPETKGVPVDLMVERVWKQHWFWKRY  494



>ref|XP_010026977.1| PREDICTED: sugar transport protein 8-like [Eucalyptus grandis]
 gb|KCW60812.1| hypothetical protein EUGRSUZ_H03546 [Eucalyptus grandis]
Length=503

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 249/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAV+L +GS +I ETP SL+ER +V++GKA L+R+RG  NV+AEF +IVA  +
Sbjct  202   SLGLAGVPAVILLVGSFIICETPTSLIERNRVDQGKATLRRIRGTNNVDAEFNSIVAASE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PF+KL + S +P L+I++LLQVFQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  262   AARRVKHPFRKLMRPSSRPPLVIAMLLQVFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +T VSIY+VDKAGRR LLL+ C+QM I+Q+ +G++L  +LK TGSLD T 
Sbjct  322   TVITGLVNVFSTLVSIYSVDKAGRRVLLLEACVQMFITQIIIGVLLLLHLKPTGSLDFTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C++VM FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TFIIAQAFLS
Sbjct  382   AIVVVVLVCVFVMGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFIIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M+A IFFFF+AWI+ MGLF  F +PETKGVPVDLMVE+VWKQH  W+++
Sbjct  442   MLCHMKAGIFFFFAAWILVMGLFALFLLPETKGVPVDLMVERVWKQHWFWKRY  494



>ref|XP_010551756.1| PREDICTED: sugar transport protein 8-like [Tarenaya hassleriana]
Length=512

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 239/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AAVP+V+LG+GSLVI ETP SL+ER +VEEGKA L+++RGVE+VE EFE+IV  C+
Sbjct  202   ALGGAAVPSVILGVGSLVICETPTSLIERNRVEEGKATLRKIRGVEDVEEEFESIVRACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P  +I +LLQ+FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  262   LARQVKDPYRKLMKPASRPPFVIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV IY VDK GRR LLL+  + M I Q  +GIILA NL+ TGSL +  
Sbjct  322   AVITGSINVLSTFVGIYLVDKTGRRILLLESAVHMFICQTIIGIILAKNLEITGSLGRVE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI + L+VM FAWSWGPL WLIPSE FPLETRTAGFAFAVS NM  TF+IAQAFLS
Sbjct  382   ALVVVICVLLFVMGFAWSWGPLGWLIPSETFPLETRTAGFAFAVSCNMFFTFLIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M++ IFFFFS+WI+ MGLF  FFVPETKGVP+D+M ++VWK H  W++F
Sbjct  442   MLCNMRSGIFFFFSSWILVMGLFAMFFVPETKGVPIDMMRDRVWKPHWFWKRF  494



>ref|XP_007034706.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY05632.1| Major facilitator superfamily protein [Theobroma cacao]
Length=497

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 242/294 (82%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA++L +GS VI ETP SL+ER +VE+G+  L+++RGVENV+ EF++IV  C+
Sbjct  201   SLALAGVPALVLCVGSFVICETPTSLIERDEVEKGRQVLRKIRGVENVDDEFDSIVHACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+Q K PF+KL K + +P L+I++LLQVFQQFTGINAIMFYAPVLFQTMGF+ + +L S
Sbjct  261   MARQEKHPFRKLMKPASRPPLVIAILLQVFQQFTGINAIMFYAPVLFQTMGFRNDAALAS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTG-SLDKT  639
             ++ITG+VNV++TF S+Y VD+ GRR LLL+ C+QM ++Q  +G+IL  +LK TG +L + 
Sbjct  321   AVITGVVNVVSTFFSVYAVDRVGRRILLLEACVQMFLTQSIIGVILLKDLKPTGDNLGRG  380

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +T VVIL+CL+VM FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TFIIAQAFL
Sbjct  381   EATFVVILVCLFVMGFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFIIAQAFL  440

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C MQA IFFFF+AWI+ MG F +F +PETKGVP+D MV++VWKQH  W +F
Sbjct  441   SMLCNMQAGIFFFFAAWIIIMGSFTWFLLPETKGVPIDSMVDEVWKQHWFWSRF  494



>gb|ADP37143.1| putative hexose transporter [Vitis vinifera]
Length=314

 Score =   394 bits (1011),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 253/308 (82%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  5     SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  64

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  65    AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  124

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  125   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  184

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  185   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  244

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-----R  291
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F      +
Sbjct  245   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRFMDDYDGK  304

Query  290   SDVRSYEM  267
              DV++  M
Sbjct  305   EDVKNVGM  312



>gb|KDP40152.1| hypothetical protein JCGZ_02150 [Jatropha curcas]
Length=515

 Score =   400 bits (1029),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 245/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+MLGLGSL+I ETP SL+ER +VEEG+A LK++RG++NV+ EF++IV  C+
Sbjct  202   SLGLAGVPALMLGLGSLIIVETPTSLIERDRVEEGRAVLKKIRGIDNVDPEFDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++V  P+ KL  +  +P LII+++LQ+FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  262   IARRVTDPYAKLMTRPSRPPLIIAIMLQIFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S++TG VNVL T VS+  VD+AGRR LL++ C+QM+I+Q  +G+IL  +LK TG L  + 
Sbjct  322   SVVTGTVNVLCTIVSVVVVDRAGRRILLIEACLQMLITQTVIGVILMKDLKPTGDLPSSE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+++C++V  FAWSWGPL WLIPSE FPLETRTAG++FAVS+NMLCTFIIAQAFLS
Sbjct  382   ALIVVVMVCVFVAGFAWSWGPLGWLIPSETFPLETRTAGYSFAVSSNMLCTFIIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C MQA IFFFF+AWIVAM +F  FF+PETKG+P+D MV++VWKQH  W +FF  +
Sbjct  442   MLCKMQAGIFFFFAAWIVAMMVFALFFIPETKGIPIDEMVDRVWKQHWFWYRFFDDE  498



>gb|KCW84229.1| hypothetical protein EUGRSUZ_B01091 [Eucalyptus grandis]
Length=471

 Score =   399 bits (1024),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 242/303 (80%), Gaps = 7/303 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L +GS  I ETP SL+ER       A LK++RG ++V AEFE++VA  +
Sbjct  167   SLGLAVVPAFILLVGSFAICETPTSLIER------NATLKKIRGTDDVTAEFESLVAASE  220

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+ VK PF KL + S +P L+I++LLQVFQQFTGINAIMFYAPVLFQT+GF +N SLLS
Sbjct  221   MARLVKNPFSKLMQPSSRPPLVIAILLQVFQQFTGINAIMFYAPVLFQTVGFGSNASLLS  280

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +T VSIYTVD AGRR LLL+ C+QM ++Q+ +G+IL  +LKTTGSL+ + 
Sbjct  281   TVITGLVNVFSTLVSIYTVDWAGRRILLLEACVQMFLTQIVIGLILLIDLKTTGSLNHSE  340

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV L+C++V  FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TFIIAQAFLS
Sbjct  341   ALIVVTLVCIFVGGFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFIIAQAFLS  400

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A IFFFF+AWI+ MGLF  FF+PETKGVP+D MVEKVWKQH  W+++   +V  
Sbjct  401   MLCHMKAGIFFFFAAWILVMGLFTLFFLPETKGVPIDSMVEKVWKQHWFWKRYM-VNVNE  459

Query  275   YEM  267
              EM
Sbjct  460   EEM  462



>ref|XP_010454979.1| PREDICTED: sugar transport protein 8 [Camelina sativa]
Length=507

 Score =   399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 230/293 (78%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A VPA++L  GSL+I ETP SL+ER K +EGK  LK++RGVENV+ E+E+IV  CD
Sbjct  201   ALGGAGVPALILLFGSLLICETPTSLIERNKTKEGKDTLKKIRGVENVDEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+ KL K + +P  +I +LLQ FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  261   IARQVKDPYTKLMKPASRPPFVIGMLLQFFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV I+ VDK GRR LLLQ  + M+I Q+ +GIILA NL  TG+L +T 
Sbjct  321   AVITGTINVLSTFVGIFLVDKTGRRFLLLQSSVHMLICQLVIGIILAKNLDVTGTLGRTQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +CLYVM FAWSWGPL WLIPSE FPLETRT GFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCLYVMGFAWSWGPLGWLIPSETFPLETRTEGFALAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+CGM++ IFFFFS WIV MGLF  FFVPETKGV +D M + VWK H  W++F
Sbjct  441   MLCGMKSGIFFFFSGWIVVMGLFALFFVPETKGVSIDDMRDSVWKLHWYWKRF  493



>ref|XP_008777629.1| PREDICTED: sugar transport protein 13-like [Phoenix dactylifera]
Length=515

 Score =   399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/308 (63%), Positives = 238/308 (77%), Gaps = 0/308 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L  GSL+I+ETPASL+ER K++EG A LK++RG E VE EF  IV    
Sbjct  203   SLGLAGVPALILCFGSLLITETPASLIERQKLDEGLAVLKKIRGTEKVELEFNEIVDASK  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ +  +  +PQL+I++L+QVFQQFTGINAIMFYAPVLFQT+GFK +GSLLS
Sbjct  263   IAQQVKHPFRNVMMRRSRPQLVIAILMQVFQQFTGINAIMFYAPVLFQTIGFKNDGSLLS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++I GLVNVL T VSI  VD+ GRR LLL+ C QM+ISQ A+G +L   +K   +L + +
Sbjct  323   AVIMGLVNVLCTVVSILLVDRLGRRILLLEACAQMLISQAAIGAVLHVFMKANNNLHQDV  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+CL+V +FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TFIIAQAFLS
Sbjct  383   AIWVVVLVCLFVSSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFIIAQAFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             MMC M+A IFFFF+AWIVAM  FV F +PETK VP+D M E+VWK+H  WR+F       
Sbjct  443   MMCHMKAGIFFFFAAWIVAMAFFVVFLLPETKNVPIDEMTERVWKKHWYWRRFVDHGEDQ  502

Query  275   YEMA*IED  252
              E   +ED
Sbjct  503   NETRDVED  510



>ref|XP_007034707.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY05633.1| Major facilitator superfamily protein [Theobroma cacao]
Length=508

 Score =   399 bits (1025),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/297 (69%), Positives = 241/297 (81%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA ML +GSL+I+ETPASLVERGK   G   LK++RGV+ V++EF+ IV    
Sbjct  209   SLGLAGVPATMLCIGSLIITETPASLVERGKELAGHKTLKKIRGVDEVDSEFDQIVRASK  268

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PFKKL K S  P LII ++LQVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  269   IAQEVKHPFKKLMKLSSMPPLIIGIMLQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  328

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITG VNVL+T VS+Y VDK GRRKLLLQ CIQM I Q A+G IL  +L +  SL KT 
Sbjct  329   SVITGTVNVLSTLVSVYAVDKIGRRKLLLQACIQMFICQTAIGAILLVHLHSKDSLTKTQ  388

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV L+CL+VM+FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TFIIAQAFLS
Sbjct  389   AAFVVTLVCLFVMSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFIIAQAFLS  448

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             MMC ++A IFFFF+AWI AMGLFV F +PETK VP+D+MV++VWK+HPVW++F   D
Sbjct  449   MMCHLRASIFFFFAAWIFAMGLFVLFLLPETKNVPIDVMVDRVWKKHPVWKRFMVGD  505



>ref|XP_006419889.1| hypothetical protein CICLE_v10004752mg [Citrus clementina]
 ref|XP_006489584.1| PREDICTED: sugar transport protein 8-like [Citrus sinensis]
 gb|ESR33129.1| hypothetical protein CICLE_v10004752mg [Citrus clementina]
 gb|KDO74667.1| hypothetical protein CISIN_1g035636mg [Citrus sinensis]
Length=515

 Score =   399 bits (1025),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL +A VPA+ L +GS+ I ETP SL+ERG++EEG+  L+R+RGV NV+ EF++IV  C+
Sbjct  202   SLAIAGVPALFLCVGSMSICETPTSLIERGRLEEGRVVLQRIRGVANVDNEFDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QV KPF KL K+S +P L+I++LLQVFQQFTGINAIMFYAPVLFQT+GF +  SLLS
Sbjct  262   MANQVTKPFSKLMKRSSRPPLVIAILLQVFQQFTGINAIMFYAPVLFQTVGFGSEASLLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +T VS+Y VDKAGRR LLL+  +QM I+Q  +GIILA  LK TGSL+K  
Sbjct  322   AVITGLVNVFSTLVSVYAVDKAGRRALLLEAVVQMFITQSIIGIILAIWLKPTGSLNKVE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+C++VM FAWSWGPL WLIPSE FPLETRTAGFAFAVSTNML TF++AQAFLS
Sbjct  382   AIIVVVLVCVFVMGFAWSWGPLGWLIPSETFPLETRTAGFAFAVSTNMLFTFLVAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-RSDVR  279
             M+C M+A IFFFF+AWIV MGLF  F +PETKGVPVD + E+VWKQH  W++F    DV+
Sbjct  442   MLCNMKAGIFFFFAAWIVVMGLFAMFLLPETKGVPVDAVTERVWKQHWFWKRFMDEEDVK  501



>ref|XP_010045842.1| PREDICTED: sugar transport protein 8-like [Eucalyptus grandis]
Length=507

 Score =   398 bits (1023),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 242/303 (80%), Gaps = 7/303 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L +GS  I ETP SL+ER       A LK++RG ++V AEFE++VA  +
Sbjct  203   SLGLAVVPAFILLVGSFAICETPTSLIER------NATLKKIRGTDDVTAEFESLVAASE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+ VK PF KL + S +P L+I++LLQVFQQFTGINAIMFYAPVLFQT+GF +N SLLS
Sbjct  257   MARLVKNPFSKLMQPSSRPPLVIAILLQVFQQFTGINAIMFYAPVLFQTVGFGSNASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLVNV +T VSIYTVD AGRR LLL+ C+QM ++Q+ +G+IL  +LKTTGSL+ + 
Sbjct  317   TVITGLVNVFSTLVSIYTVDWAGRRILLLEACVQMFLTQIVIGLILLIDLKTTGSLNHSE  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV L+C++V  FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TFIIAQAFLS
Sbjct  377   ALIVVTLVCIFVGGFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A IFFFF+AWI+ MGLF  FF+PETKGVP+D MVEKVWKQH  W+++   +V  
Sbjct  437   MLCHMKAGIFFFFAAWILVMGLFTLFFLPETKGVPIDSMVEKVWKQHWFWKRYM-VNVNE  495

Query  275   YEM  267
              EM
Sbjct  496   EEM  498



>ref|XP_010935205.1| PREDICTED: sugar transport protein 8-like [Elaeis guineensis]
Length=513

 Score =   397 bits (1020),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 239/293 (82%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L LGSL+I+ETP SL+ER K++EG A LK++RG E VE EF  IV    
Sbjct  203   SLGLAGVPAIILFLGSLLITETPTSLIERQKLDEGLAMLKKIRGTEKVELEFNEIVHASK  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK+PF+ +  +S +PQL+I++L+QVFQQFTGINAIMFYAPVLFQT+GFK +GSLLS
Sbjct  263   IAQEVKRPFRNVMMRSSRPQLVIAILMQVFQQFTGINAIMFYAPVLFQTIGFKNDGSLLS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++I G VNVL T VSI  VD+ GRR LLL+ C+QM+ISQ A+G+IL   +K T +L + +
Sbjct  323   AVIMGSVNVLCTVVSILLVDRLGRRILLLEACVQMLISQAAIGVILQLFMKATNTLHQDV  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+CL+V +FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TF+IAQAFLS
Sbjct  383   AIWVVVLVCLFVSSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFVIAQAFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+A IFFFF+AWIV M LFV F +PETK VP+D M+E+VWK+H  W+++
Sbjct  443   MMCHMKAGIFFFFAAWIVLMALFVVFLLPETKNVPIDEMMERVWKKHWYWKRY  495



>ref|XP_006290071.1| hypothetical protein CARUB_v10003709mg [Capsella rubella]
 gb|EOA22969.1| hypothetical protein CARUB_v10003709mg [Capsella rubella]
Length=507

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 232/297 (78%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A VPA++L  GSL+I ETP SL+ER K +EGK  LK++RGVENV+AE+E+IV  CD
Sbjct  201   ALGGAGVPALILLFGSLLICETPTSLIERNKTKEGKDTLKKIRGVENVDAEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+ KL K   +P L+I +LLQ FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  261   FARQVKDPYTKLMKPESRPPLVIGLLLQFFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV I+ VDK GRR LLLQ  + M++ Q+ +GIILA +L  TG+L +  
Sbjct  321   AVITGSINVLSTFVGIFLVDKTGRRFLLLQSSVHMLVCQLVIGIILAKDLNVTGTLGRPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +CLYVM FAWSWGPL WLIPSE FP+ETRT GFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCLYVMGFAWSWGPLGWLIPSETFPVETRTEGFALAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             ++CGM++ IFFFFS WIV MGLF  FFVPETKGV +D M + VWK H  W++F R +
Sbjct  441   LLCGMKSGIFFFFSGWIVVMGLFALFFVPETKGVSIDDMRDSVWKLHWYWKRFMREE  497



>ref|XP_010655156.1| PREDICTED: sugar transport protein 8-like [Vitis vinifera]
 emb|CBI25296.3| unnamed protein product [Vitis vinifera]
 gb|ADP37136.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 255/308 (83%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G++ LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGRSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK+L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKRLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-----R  291
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F      +
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRFMDDYDGK  496

Query  290   SDVRSYEM  267
              DV++  M
Sbjct  497   EDVKNVGM  504



>ref|XP_002268130.1| PREDICTED: sugar transport protein 8 [Vitis vinifera]
 gb|ADP37137.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   394 bits (1013),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 254/308 (82%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK+L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKRLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-----R  291
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F      +
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRFMDDYDGK  496

Query  290   SDVRSYEM  267
              DV++  M
Sbjct  497   EDVKNVGM  504



>emb|CBI17742.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 248/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK+L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKRLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489



>ref|XP_002268567.2| PREDICTED: sugar transport protein 8 [Vitis vinifera]
Length=506

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 253/308 (82%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEHIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-----R  291
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F      +
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRFMDDYDGK  496

Query  290   SDVRSYEM  267
              DV++  M
Sbjct  497   EDVKNVGM  504



>emb|CAN79503.1| hypothetical protein VITISV_029241 [Vitis vinifera]
Length=506

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 248/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK+L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKRLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489



>ref|XP_011090062.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=504

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 234/298 (79%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A  PA+ LGLGSL+I ETP SL+ERGK EEG  ALK  RGVE+VE E+E IV   +
Sbjct  200   SLGGAGFPAIFLGLGSLLIVETPTSLIERGKREEGLRALKTTRGVEDVEKEYEEIVRATE  259

Query  995   AAKQVKKPFKKLT-KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              AK+VK PF+ L  K+S  PQL    +LQVFQQFTGIN IMFYAPVLFQTMG   + SLL
Sbjct  260   NAKKVKHPFRNLIMKRSSWPQLFCGTILQVFQQFTGINVIMFYAPVLFQTMGLGGDASLL  319

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKT  639
             S++ITG +NV +T V+++ VDK GRRKLL+Q  +QM+ISQ+ VG+ILA +LKTT ++   
Sbjct  320   SAVITGSINVASTMVAVFGVDKFGRRKLLIQAAVQMLISQVFVGVILAKHLKTTNAIPMP  379

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + + + LIC+YVM FAWSWGPL WLIPSEIFPLETR AGF FAVSTNM+CTFIIAQAFL
Sbjct  380   FAYLTLFLICVYVMGFAWSWGPLGWLIPSEIFPLETRPAGFFFAVSTNMICTFIIAQAFL  439

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             +M+C M++ IFFFF+AWI+ MG F  F +PETKGVP+D M E+VWK+H  WR+FFR++
Sbjct  440   TMLCQMRSGIFFFFAAWIIVMGSFALFLLPETKGVPIDEMNERVWKKHWFWRRFFRNE  497



>ref|XP_002268177.1| PREDICTED: sugar transport protein 8 [Vitis vinifera]
 gb|ADP37138.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 248/293 (85%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK+L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKRLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489



>gb|ADP37141.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 253/308 (82%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEHIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-----R  291
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F      +
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRFMDDYDGK  496

Query  290   SDVRSYEM  267
              DV++  M
Sbjct  497   EDVKNVGM  504



>ref|XP_009609771.1| PREDICTED: sugar transport protein 6-like, partial [Nicotiana 
tomentosiformis]
Length=361

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 233/297 (78%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA+ LGLGS +I ETP SL+ERG+ +EGK AL+++RGV +VE E++ I+   +
Sbjct  51    SLGGAAVPAIFLGLGSFLIVETPTSLIERGQKDEGKQALRKIRGVHDVEKEYQEILQATE  110

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+Q+K+PF+ L  KS +PQLI   +LQ+FQQFTGIN IMFYAPVLFQTMGF    SLLS
Sbjct  111   LAQQIKQPFRNLMSKSSRPQLICGTILQIFQQFTGINVIMFYAPVLFQTMGFGGKASLLS  170

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +I+TG+VNV++T V+I  VDK GRR LL++  +QM+++Q   G ILA +LK T  + K  
Sbjct  171   AIVTGMVNVVSTIVAILGVDKFGRRVLLIEAAVQMLVAQCVTGGILAVHLKATNVIPKNY  230

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+LIC++V  FAWSWGPL WLIPSEIFPLETRTAGF FAVS NM+CTFIIAQAFL+
Sbjct  231   AYFVVVLICVFVSGFAWSWGPLGWLIPSEIFPLETRTAGFFFAVSMNMICTFIIAQAFLT  290

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++ IFFFF+ WIV MG F +FF+PETKG+P+D M E+ WK+H  W+++F  D
Sbjct  291   MLCHMRSGIFFFFAVWIVIMGSFAYFFLPETKGIPIDEMNERAWKKHWFWKRYFDDD  347



>emb|CDY52634.1| BnaC07g49600D [Brassica napus]
Length=501

 Score =   392 bits (1008),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 235/297 (79%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PA++L  GSL+I ETP SL+ER K EEGKA LK++RGVE+V+ E++++V  C+
Sbjct  202   ALGGAGIPALILLFGSLLICETPTSLIERNKTEEGKATLKKIRGVEDVDEEYQSLVQACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+++L K   +P L+I +LLQ+FQQFTGINAIMFYAPVLFQT+GF  N +LLS
Sbjct  262   FARQVKDPYRRLMKPESRPPLVIGLLLQLFQQFTGINAIMFYAPVLFQTVGFGNNAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VNVL+T V I+ VD+ GRR LLLQ  +QM+  Q+ +GIILA +L   G+L KT 
Sbjct  322   AVITGSVNVLSTLVGIFLVDRTGRRFLLLQAAVQMLSCQLVIGIILAKDLGVKGTLGKTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C+YVM FAWSWGPL WLIPSE FPLETRT G+A AVS NM  TF+IAQAFLS
Sbjct  382   AMIVVILVCVYVMGFAWSWGPLGWLIPSETFPLETRTEGYALAVSCNMFFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++ IFFFFSAWIV MGLF  FFVPETKGV +D + + VWK+H  W++F R +
Sbjct  442   MLCAMKSGIFFFFSAWIVVMGLFALFFVPETKGVSIDDIKDSVWKRHWYWKRFMRQE  498



>gb|ADP37140.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   392 bits (1008),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 247/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489



>emb|CDY49992.1| BnaC03g34490D [Brassica napus]
Length=508

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 239/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV+L LGSL+I ETP SL+ER K EEG+  L+++RGVE++  E+E+IV  C+
Sbjct  201   ALGGAAIPAVILLLGSLIICETPTSLIERNKNEEGRETLRKIRGVEDINDEYESIVHACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P LII +LLQ+FQQF+GINAIMFYAPVLFQT+GF +N +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPLIIGMLLQLFQQFSGINAIMFYAPVLFQTVGFGSNAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV IY VD+ GRR LLLQ  + M+ISQ+ +GIILA +L  TG+L K  
Sbjct  321   AVITGSINVLSTFVGIYLVDRTGRRFLLLQSSVHMLISQLIIGIILAKDLGITGTLGKAQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+ +C YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NML TF+IAQAFLS
Sbjct  381   AMVVVVFVCAYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMLFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGV +D + E+VWK H  W+++  ++
Sbjct  441   MLCGMKSGIFFFFSAWIIVMGLFALFFIPETKGVAIDDVRERVWKPHWFWKRYMLAE  497



>ref|XP_010524814.1| PREDICTED: sugar transport protein 6-like [Tarenaya hassleriana]
 ref|XP_010524815.1| PREDICTED: sugar transport protein 6-like [Tarenaya hassleriana]
Length=508

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 240/308 (78%), Gaps = 0/308 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AAVPAV+LGLGSLVI ETP SL+ER K+E GKA LK++RGVENVE EFE+IV  C+
Sbjct  201   ALGGAAVPAVILGLGSLVICETPTSLIERNKLEAGKATLKKIRGVENVEEEFESIVQACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P  +I +LLQ+FQQFTGINAIMFYAP LFQT+GF  + +LLS
Sbjct  261   FARQVKDPYRKLMKPASRPPFVIGMLLQLFQQFTGINAIMFYAPALFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL TFV IY VD+ GRR LLL+  + M+ISQ  +G+ILA +L  +G+L +  
Sbjct  321   AVITGTINVLCTFVGIYLVDRTGRRVLLLESAVHMLISQAIIGVILAKDLTISGTLGRAE  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             S VVV+ + L+VM FAWSWGPL WLIPSE FPLETRTAGFA AVS NM  TF+IAQAFLS
Sbjct  381   SIVVVVCVLLFVMGFAWSWGPLGWLIPSETFPLETRTAGFACAVSCNMFFTFLIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M+A IFFFFS WI+ MGLF +FFVPETKGVP+D M E+VWK H  W+++   +   
Sbjct  441   MLCNMRAGIFFFFSGWIIIMGLFAYFFVPETKGVPIDAMRERVWKPHWFWKRYMLPEDDR  500

Query  275   YEMA*IED  252
              ++  I D
Sbjct  501   NDVEKIHD  508



>emb|CBI26224.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   390 bits (1001),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 237/307 (77%), Gaps = 0/307 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA  L +GSL+I ETP SLVER   E+G+  LK++RGV+NV+ EFE I   C+
Sbjct  167   SLGLAAIPATGLFIGSLIIPETPTSLVERNHEEKGRKTLKKIRGVDNVDPEFEQIKVACE  226

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK P++ L K S  P LII +++QVFQQFTGINAIMFYAP+LFQT+GFK + SLLS
Sbjct  227   IARRVKHPYRSLMKLSSMPPLIIGIMMQVFQQFTGINAIMFYAPILFQTVGFKNDASLLS  286

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +IITGLVNV  T VSIY VDK GRR LLLQ C+QM +SQ A+G IL   L  T SL K  
Sbjct  287   AIITGLVNVFCTVVSIYAVDKVGRRLLLLQACVQMFVSQTAIGGILLAKLNATNSLPKGQ  346

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C+YV +FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TF+IAQ+FLS
Sbjct  347   AWVVVVLVCVYVSSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFVIAQSFLS  406

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             MMC M+A IF FF+ WIV MG+FV F +PETKGVP+D M E+VWK+HP+W+KF   D   
Sbjct  407   MMCHMRAGIFLFFAGWIVIMGIFVLFLLPETKGVPIDEMKERVWKKHPIWKKFMSDDADD  466

Query  275   YEMA*IE  255
                  IE
Sbjct  467   RAKKTIE  473



>emb|CDX74116.1| BnaA03g29310D [Brassica napus]
Length=508

 Score =   390 bits (1003),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 239/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV+L LGSL+I ETP SL+ER K EEG+  L+++RGVE++  E+E+IV  C+
Sbjct  201   ALGGAAIPAVILLLGSLIICETPTSLIERNKNEEGRETLRKIRGVEDINDEYESIVHACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P LII +LLQ+FQQF+GINAIMFYAPVLFQT+GF +N +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPLIIGMLLQLFQQFSGINAIMFYAPVLFQTVGFGSNAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VD+ GRR LLLQ  + M+ISQ+ +GIILA +L  TG+L K  
Sbjct  321   AVVTGSINVLSTFVGIYLVDRTGRRFLLLQSSVHMLISQLIIGIILAKDLGITGTLGKAQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+ +C YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NML TF+IAQAFLS
Sbjct  381   AMVVVVFVCAYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMLFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGV +D + E+VWK H  W+++  ++
Sbjct  441   MLCGMRSGIFFFFSAWIIVMGLFALFFIPETKGVAIDDVRERVWKPHWFWKRYMLAE  497



>ref|XP_002268611.2| PREDICTED: sugar transport protein 8-like [Vitis vinifera]
 gb|ADP37139.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   390 bits (1002),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 246/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIV MGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVVMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489



>ref|XP_002277946.2| PREDICTED: sugar transport protein 8-like [Vitis vinifera]
 emb|CAN61764.1| hypothetical protein VITISV_025411 [Vitis vinifera]
 gb|ADP37134.1| putative hexose transporter [Vitis vinifera]
Length=506

 Score =   389 bits (1000),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 237/307 (77%), Gaps = 0/307 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA  L +GSL+I ETP SLVER   E+G+  LK++RGV+NV+ EFE I   C+
Sbjct  198   SLGLAAIPATGLFIGSLIIPETPTSLVERNHEEKGRKTLKKIRGVDNVDPEFEQIKVACE  257

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK P++ L K S  P LII +++QVFQQFTGINAIMFYAP+LFQT+GFK + SLLS
Sbjct  258   IARRVKHPYRSLMKLSSMPPLIIGIMMQVFQQFTGINAIMFYAPILFQTVGFKNDASLLS  317

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +IITGLVNV  T VSIY VDK GRR LLLQ C+QM +SQ A+G IL   L  T SL K  
Sbjct  318   AIITGLVNVFCTVVSIYAVDKVGRRLLLLQACVQMFVSQTAIGGILLAKLNATNSLPKGQ  377

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+L+C+YV +FAWSWGPL WLIPSE FPLETRTAGFAFAVS+NML TF+IAQ+FLS
Sbjct  378   AWVVVVLVCVYVSSFAWSWGPLGWLIPSETFPLETRTAGFAFAVSSNMLFTFVIAQSFLS  437

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             MMC M+A IF FF+ WIV MG+FV F +PETKGVP+D M E+VWK+HP+W+KF   D   
Sbjct  438   MMCHMRAGIFLFFAGWIVIMGIFVLFLLPETKGVPIDEMKERVWKKHPIWKKFMSDDADD  497

Query  275   YEMA*IE  255
                  IE
Sbjct  498   RAKKTIE  504



>ref|XP_009134865.1| PREDICTED: sugar transport protein 6-like [Brassica rapa]
Length=508

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV+L LGSL+I ETP SL+ER K EEG+  L+++RGVE++  E+E+IV  C+
Sbjct  201   ALGGAAIPAVILLLGSLIICETPTSLIERNKNEEGRETLRKIRGVEDINDEYESIVHACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P LII +LLQ+FQQF+GINAIMFYAPVLFQT+GF  N +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPLIIGMLLQLFQQFSGINAIMFYAPVLFQTVGFGNNAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV IY VD+ GRR LLLQ  + M+ISQ+ +GIILA +L  TG+L K  
Sbjct  321   AVITGSINVLSTFVGIYLVDRTGRRFLLLQSSVHMLISQLIIGIILAKDLGITGTLGKAQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVV+ +C YVM FAWSWGPL WLIPSE FPLETR+AGF  AVS NML TF+IAQAFLS
Sbjct  381   AMVVVVFVCAYVMGFAWSWGPLGWLIPSETFPLETRSAGFPVAVSCNMLFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGV +D + E+VWK H  W+++  ++
Sbjct  441   MLCGMRSGIFFFFSAWIIVMGLFALFFIPETKGVAIDDVRERVWKPHWFWKRYMLAE  497



>ref|XP_002311613.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE88980.2| sugar transporter family protein [Populus trichocarpa]
Length=514

 Score =   388 bits (996),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 244/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L  GSL I ETP SL+ER KVE+G+A LK++RGV+NV+ E+++IV  C+
Sbjct  202   SLGIAGVPALLLCFGSLAIYETPTSLIERKKVEQGRAVLKKIRGVDNVDLEYDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A Q+ +P+ +L K+  +P L+I++++QVFQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  262   VASQITQPYHELMKRESRPPLVIAIVMQVFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S++TGLVNVL+T VS+  VDK GRR LLL+ C+QM+I+Q  +G +L  +LKTTG+L    
Sbjct  322   SVVTGLVNVLSTIVSVVLVDKVGRRALLLEACVQMLITQCIIGGVLMKDLKTTGTLPNGD  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI++C++V  FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQAFLS
Sbjct  382   ALVVVIMVCVFVAGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C ++A IFFFF+AWIV MGLF  F +PETKGVP+D MV++VWKQH  W++FF  +
Sbjct  442   MLCNLRAGIFFFFAAWIVVMGLFALFLLPETKGVPIDEMVDRVWKQHWFWKRFFNDE  498



>ref|XP_010256218.1| PREDICTED: sugar transport protein 8-like [Nelumbo nucifera]
Length=515

 Score =   387 bits (994),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 237/294 (81%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA +L LGS  I+ETP SL++R ++E+GKA L+++RGV +V+AEF+ IV   +
Sbjct  204   SLGIAGVPASVLLLGSFFITETPTSLIQRQQLEKGKATLEKVRGVVDVDAEFDQIVIAAE  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+KL  +S +P L+I +LLQVFQQ TGINAIMFYAPVLFQ++GFK + SL S
Sbjct  264   KARQVKHPFRKLMSRSNRPPLVIGILLQVFQQLTGINAIMFYAPVLFQSVGFKNDASLFS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITGLVNVL+T VSI  VD+ GR+ LLL+ C+QM+I+Q  +G +L  +LKT   +L + 
Sbjct  324   SVITGLVNVLSTIVSIVLVDRCGRKVLLLEACVQMLIAQSIIGGLLEAHLKTYADTLGRG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              S VVV L+C YVM FAWSWGPL WLIPSE FP+ETRTAGFAFAVS+NML TF+IAQAFL
Sbjct  384   ESFVVVFLVCFYVMGFAWSWGPLGWLIPSETFPVETRTAGFAFAVSSNMLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+A IFFFF+ WIV MGLFV F +PETK VP+D+MV++VWK+H  W++F
Sbjct  444   SMLCRMRAAIFFFFAGWIVVMGLFVLFLLPETKKVPIDVMVDRVWKKHWYWKRF  497



>ref|XP_011026212.1| PREDICTED: sugar transport protein 8-like [Populus euphratica]
Length=514

 Score =   387 bits (994),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 244/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L  GSL I ETP SL+ER KVE+G+A LK++RGV+NV+ E+++IV  C+
Sbjct  202   SLGIAGVPALLLCFGSLAIYETPTSLIERKKVEQGRAVLKKIRGVDNVDLEYDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A Q+ +P+ +L K+  +P L+I++++QVFQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  262   VASQITQPYHELMKRESRPPLVIAIVMQVFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S++TGLVNVL+T VS+  VDK GRR LLL+ C+QM+I+Q  +G +L  +LKTTG+L    
Sbjct  322   SVVTGLVNVLSTTVSVVLVDKVGRRALLLEACVQMLITQCIIGGVLMKDLKTTGTLPNGD  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI++C++V  FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQAFLS
Sbjct  382   ALVVVIMVCVFVAGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C ++A IFFFF+AWIV MGLF  F +PETKGVPVD MV++VWKQH  W++FF  +
Sbjct  442   MLCHLRAGIFFFFAAWIVVMGLFALFLLPETKGVPVDEMVDRVWKQHWFWKRFFNDE  498



>ref|XP_009151134.1| PREDICTED: sugar transport protein 8 [Brassica rapa]
Length=499

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 232/293 (79%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PA++L  GSL+I ETP SL+ER K EEGKA LK++RGVE+V+ E++++V  C+
Sbjct  202   ALGGAGIPALILLFGSLLICETPTSLIERNKTEEGKATLKKIRGVEDVDEEYQSLVQACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+++L K   +P L+I +LLQ+FQQFTGINAIMFYAPVLFQT+GF  N +LLS
Sbjct  262   FARQVKDPYRRLMKPESRPPLVIGLLLQLFQQFTGINAIMFYAPVLFQTVGFGNNAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VNV++T V I  VD+ GRR LLLQ  +QM+  Q+ +GIILA +L   G+L KT 
Sbjct  322   AVITGSVNVVSTLVGILLVDRTGRRFLLLQAAVQMLSCQLVIGIILAKDLGVKGTLGKTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C+YVM FAWSWGPL WLIPSE FPLETRT G+A AVS NM  TF+IAQAFLS
Sbjct  382   AMIVVILVCVYVMGFAWSWGPLGWLIPSETFPLETRTEGYALAVSCNMFFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M++ IFFFFSAWIV MGLF  FFVPETKGV +D + + VWK+H  W++F
Sbjct  442   MLCAMKSGIFFFFSAWIVVMGLFALFFVPETKGVSIDDIKDSVWKRHWYWKRF  494



>emb|CDX88227.1| BnaA06g28180D [Brassica napus]
Length=499

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 232/293 (79%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PA++L  GSL+I ETP SL+ER K EEGKA LK++RGVE+V+ E++++V  C+
Sbjct  202   ALGGAGIPALILLFGSLLICETPTSLIERNKTEEGKATLKKIRGVEDVDEEYQSLVNACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+++L K   +P L+I +LLQ+FQQFTGINAIMFYAPVLFQT+GF  N +LLS
Sbjct  262   FARQVKDPYRRLMKPESRPPLVIGLLLQLFQQFTGINAIMFYAPVLFQTVGFGNNAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VNV++T V I  VD+ GRR LLLQ  +QM+  Q+ +GIILA +L   G+L KT 
Sbjct  322   AVITGSVNVVSTLVGILLVDRTGRRFLLLQAAVQMLSCQLVIGIILAKDLGVKGTLGKTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C+YVM FAWSWGPL WLIPSE FPLETRT G+A AVS NM  TF+IAQAFLS
Sbjct  382   AMIVVILVCVYVMGFAWSWGPLGWLIPSETFPLETRTEGYALAVSCNMFFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M++ IFFFFSAWIV MGLF  FFVPETKGV +D + + VWK+H  W++F
Sbjct  442   MLCAMKSGIFFFFSAWIVVMGLFALFFVPETKGVSIDDIKDSVWKRHWYWKRF  494



>ref|XP_006408005.1| hypothetical protein EUTSA_v10020542mg [Eutrema salsugineum]
 gb|ESQ49458.1| hypothetical protein EUTSA_v10020542mg [Eutrema salsugineum]
Length=508

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 240/303 (79%), Gaps = 0/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGVEN+  E+ETIV  CD
Sbjct  201   ALGGAGIPAVILLFGSLIIIETPTSLIERNKNEEGKEALRKIRGVENINDEYETIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VDK GRR LLLQ  + M+I Q+ +GIILA +L TTG+L K  
Sbjct  321   AVVTGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGV +D M E+VWK H  W+++  ++   
Sbjct  441   MLCGMRSGIFFFFSAWIIVMGLFAMFFIPETKGVAIDDMRERVWKPHWFWKRYMLAEDDH  500

Query  275   YEM  267
             +++
Sbjct  501   HDL  503



>emb|CAG27608.1| monosaccharide transporter [Populus tremula x Populus tremuloides]
Length=514

 Score =   386 bits (991),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 243/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L  GSL I ETP SL+ER KVE+G+A LK++RGV+NV+ E+++IV  C+
Sbjct  202   SLGIAGVPALLLCFGSLAIYETPTSLIERKKVEQGRAVLKKIRGVDNVDLEYDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A Q+ +P+ +L K+  +P L+I++++QVFQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  262   VASQITQPYHELMKRESRPPLVIAIVMQVFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S++TGLVNVL+T VS+  VDK GRR LLL+ C+QM+I+Q  +G +L  +LKTTG+L    
Sbjct  322   SVVTGLVNVLSTIVSVVLVDKVGRRALLLEACVQMLITQCIIGGVLMKDLKTTGTLPNGD  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI++C++V  FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQAFLS
Sbjct  382   ALVVVIMVCVFVAGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFVIAQAFLS  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
              +C ++A IFFFF+AWIV MGLF  F +PETKGVPVD MV++VWKQH  W++FF  +
Sbjct  442   TLCHLKAGIFFFFAAWIVVMGLFALFLLPETKGVPVDDMVDRVWKQHWFWKRFFNDE  498



>ref|XP_009417165.1| PREDICTED: sugar transport protein 8-like [Musa acuminata subsp. 
malaccensis]
Length=509

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 238/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L LGS +I+ETP SL+ER K + G A LK++RG ENVE E++ I   C+
Sbjct  203   SLGLAGVPATILCLGSFLITETPTSLIEREKTDAGLAMLKKIRGTENVELEYQEIARACE  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ L K+  +PQL+I+VL+QVFQQFTGINAIMFY+PVLFQT+GFK + SLLS
Sbjct  263   TARQVKHPFRTLMKRHSRPQLVIAVLMQVFQQFTGINAIMFYSPVLFQTIGFKNDASLLS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VN L+T VSI  VD+ GRR LLL+ C+QM++SQ  +GI+L  NLK+  +L + +
Sbjct  323   AVITGTVNTLSTVVSIVLVDRVGRRMLLLEACVQMLLSQALIGILLQVNLKSNNTLHQGV  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CLYV +FAWSWGPL WLIPSEIFPLETRTAGFAFAVS+NML TF+IAQAFLS
Sbjct  383   AVLVVVLVCLYVSSFAWSWGPLGWLIPSEIFPLETRTAGFAFAVSSNMLFTFLIAQAFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M+A IFFFF+AWIV MGLF  F +PETK VP+D MVE VWKQH  W+ +   +
Sbjct  443   MLCHMRAGIFFFFAAWIVVMGLFTIFLLPETKNVPIDEMVEMVWKQHWYWKGYMDKE  499



>emb|CDY18836.1| BnaAnng03010D [Brassica napus]
Length=507

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 240/297 (81%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  C+
Sbjct  201   ALGGAAIPAVILLFGSLIICETPTSLIERNKNEEGKKALRKIRGVDDINEEYESIVNACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG++NVL+TFV IY VD+ GRR LLLQ  + M+I Q+ +GIILA +L TTG+L K  
Sbjct  321   AVITGVINVLSTFVGIYLVDRTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGVP+D M E+VWK H  W+++  ++
Sbjct  441   MLCGMRSGIFFFFSAWIIVMGLFAMFFIPETKGVPIDEMRERVWKPHWFWKRYMLAE  497



>ref|XP_009129619.1| PREDICTED: sugar transport protein 6 [Brassica rapa]
 emb|CDY27726.1| BnaA05g31350D [Brassica napus]
Length=504

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 233/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV L  GSL+I ETP SL+ER K EEGK AL+++RGVE++  E+E+IV  CD
Sbjct  201   ALGGAAIPAVFLLFGSLIICETPTSLIERNKNEEGKEALRKIRGVEDINEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF +  +LLS
Sbjct  261   IASQVKDPFRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSEAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV IY VDK GRR LLLQ  + M+I Q+ +GIILA +L TTG+L K  
Sbjct  321   AVITGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+CGM++ IFFFFSAWIV MGLF  FF+PETKGV +D M E VWK H  W+++
Sbjct  441   MLCGMRSGIFFFFSAWIVVMGLFAMFFIPETKGVAIDDMRESVWKPHWFWKRY  493



>ref|XP_011080689.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=505

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 231/298 (78%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A  PA+ LGLGSL+I ETP SL+ERGK EEG  ALK  RGVE+V+ E+E IV   +
Sbjct  201   SLGGAGFPAIFLGLGSLLIVETPTSLIERGKTEEGLKALKTTRGVEDVQKEYEEIVKATE  260

Query  995   AAKQVKKPFKKLT-KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              AK++K PF+ L  K+S  PQL    +LQVFQQFTGIN IMFYAPVLFQTMG  A+ SLL
Sbjct  261   TAKKIKHPFRNLIIKRSSWPQLFCGTILQVFQQFTGINVIMFYAPVLFQTMGLGADASLL  320

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKT  639
             S+++TG +N ++T V+++ VDK GRRKLL+Q  +QM+ISQ+ VG IL  +LKTT ++   
Sbjct  321   SAVVTGSINSVSTLVAVFGVDKFGRRKLLIQAAVQMLISQVLVGTILTQHLKTTNAIPLP  380

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + + V LIC++VM FAWSWGPL WLIPSEIFPLETR AGF FAVS+NM+CTFIIAQAFL
Sbjct  381   YAYLTVFLICVFVMGFAWSWGPLGWLIPSEIFPLETRPAGFFFAVSSNMICTFIIAQAFL  440

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             +M+C M++ IFFFF+AWIV MG F  F +PETKGVP+D M E+VWK+H  W +FF+ +
Sbjct  441   TMLCQMRSGIFFFFAAWIVVMGSFAVFLLPETKGVPIDEMNEQVWKKHWFWHRFFKPE  498



>emb|CDY05216.1| BnaC05g45870D [Brassica napus]
Length=504

 Score =   382 bits (981),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 190/293 (65%), Positives = 233/293 (80%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV L  GSL+I ETP SL+ER K EEGK AL+++RGVE++  E+E+IV  CD
Sbjct  201   ALGGAAIPAVFLLFGSLIICETPTSLIERNKNEEGKEALRKIRGVEDINEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+KL K + +P  +I +LLQ+FQQFTGINAIMFYAPVLFQT+GF +  +LLS
Sbjct  261   IASQVKDPFRKLLKPASRPPFVIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSEAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV IY VDK GRR LLLQ  + M+I Q+ +GIILA +L TTG+L K  
Sbjct  321   AVITGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+CGM++ IFFFFSAWIV MGLF  FF+PETKGV +D M E VWK H  W+++
Sbjct  441   MLCGMRSGIFFFFSAWIVVMGLFAMFFIPETKGVAIDDMRESVWKPHWFWKRY  493



>ref|XP_011080684.1| PREDICTED: sugar transport protein 8-like [Sesamum indicum]
Length=505

 Score =   382 bits (981),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 231/298 (78%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A  PA+ LGLGSL+I ETP SL+ERGK EEG  ALK  RGVE+V+ E+E IV   +
Sbjct  201   SLGGAGFPAIFLGLGSLLIVETPTSLIERGKAEEGLKALKTTRGVEDVQKEYEEIVKATE  260

Query  995   AAKQVKKPFKKLT-KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              AK++K PF+ L  K+S  PQL    +LQVFQQFTGIN IMFYAPVLFQTMG  A+ SLL
Sbjct  261   TAKKIKHPFRNLIMKRSSWPQLFCGTILQVFQQFTGINVIMFYAPVLFQTMGLGADASLL  320

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKT  639
             S+++TG +N ++T V+++ VDK GRRKLL+Q  +QM+ISQ+ VG IL  +LKTT ++   
Sbjct  321   SAVVTGSINSVSTLVAVFGVDKFGRRKLLIQAAVQMLISQVLVGAILTQHLKTTNAIPLP  380

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + + V LIC++VM FAWSWGPL WLIPSEIFPLETR AGF FAVS+NM+CTFIIAQAFL
Sbjct  381   YAYLTVFLICVFVMGFAWSWGPLGWLIPSEIFPLETRPAGFFFAVSSNMICTFIIAQAFL  440

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             +M+C M++ IFFFF+AWIV MG F  F +PETKGVP+D M E+VWK+H  W +FF+ +
Sbjct  441   TMLCQMRSGIFFFFAAWIVVMGSFAVFLLPETKGVPIDEMNEQVWKKHWFWHRFFKPE  498



>ref|XP_009758106.1| PREDICTED: sugar transport protein 8-like [Nicotiana sylvestris]
Length=500

 Score =   382 bits (980),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 231/297 (78%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA+ LGLGS +I ETP SL+ERG+ E+GK AL+++RGV +VE E++ I+   +
Sbjct  201   SLGGAAVPAIFLGLGSFLIVETPTSLIERGQKEQGKQALRKIRGVYDVEKEYQEILQATE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+Q+KKPF+ L  KS +PQLI   +LQ+FQQFTGIN IMFYAPVLFQTMGF    SLLS
Sbjct  261   LAQQIKKPFRNLMNKSSRPQLICGTILQIFQQFTGINVIMFYAPVLFQTMGFGGKASLLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +I+TG+VNV++T V+I  VDK GRR LL++  +QM+++Q   G ILA +LK T  + K  
Sbjct  321   AIVTGMVNVVSTIVAILGVDKFGRRVLLIEAAVQMLVAQCVTGGILAVHLKATNVIPKNY  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+LIC++V  FAWSWGPL WLIPSEIFPLETRTAGF FAVS NM+CTFIIAQAFL+
Sbjct  381   AYFVVVLICIFVSGFAWSWGPLGWLIPSEIFPLETRTAGFFFAVSMNMICTFIIAQAFLT  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++ IFFFF+  IV MG F + F+PETKG+P+D M E+ WK+H  W+++F  D
Sbjct  441   MLCHMRSGIFFFFAVCIVIMGSFAYLFLPETKGIPIDEMNERAWKKHWFWKRYFDDD  497



>ref|XP_011035196.1| PREDICTED: sugar transport protein 8-like [Populus euphratica]
Length=517

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 238/308 (77%), Gaps = 0/308 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GSLVI ETPASL+ERGK EE    L+++RGV+NV+ E+  I+   +
Sbjct  202   SLGCAAVPAIILAIGSLVIVETPASLLERGKNEEALRVLRKIRGVDNVDKEYAEILNAIE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L  +S +PQLI   +LQ FQQFTGIN +MFYAPVLFQTMG+ ++GSLLS
Sbjct  262   LAKQVKHPFRNLMSRSNRPQLICGTVLQFFQQFTGINVVMFYAPVLFQTMGYGSDGSLLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++T LVN ++T V+++ VD  GRR LL++ C+QM+++Q  +G ILA +LK+   + K  
Sbjct  322   AVVTDLVNAVSTLVAVFLVDIIGRRVLLIEACLQMLVAQSIMGRILAVHLKSANIMPKAS  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C++V  FAWSWGPL WLIPSEIFPLETR+AGF FAVS NM CTF++AQAFL+
Sbjct  382   AKLVVILVCVFVSGFAWSWGPLGWLIPSEIFPLETRSAGFFFAVSMNMFCTFLVAQAFLT  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C M++ IFFFF+AWIV MG+F  FF+PETKG+P+D M E+VWK+H  W+++ +    +
Sbjct  442   MLCHMRSGIFFFFAAWIVVMGIFAIFFLPETKGIPIDEMNERVWKKHWFWKRYHKDSYIN  501

Query  275   YEMA*IED  252
                  I+D
Sbjct  502   KRSQEIQD  509



>gb|KFK38009.1| hypothetical protein AALP_AA3G058600 [Arabis alpina]
Length=507

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A VPAV+L  GSL+I ETP SL+ER K E+GK AL+++RGVE++  E+E+IV  CD
Sbjct  200   ALGGAGVPAVILLFGSLLICETPTSLIERNKNEQGKEALRKIRGVEDINDEYESIVHACD  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  260   IASQVKDPFRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGTDAALLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VDK GRR LLLQ  + M+I Q+ +GIILA +L TTG+L +  
Sbjct  320   AVVTGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGRPQ  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  380   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+CGM++ IFFFFSAWIV MGLF  FF+PETKGV +D M E VWK H  W+++   +   
Sbjct  440   MLCGMRSGIFFFFSAWIVVMGLFAMFFIPETKGVAIDDMRESVWKPHWFWKRYMLPEDDH  499

Query  275   YEM  267
             +++
Sbjct  500   HDV  502



>ref|XP_002884547.1| hypothetical protein ARALYDRAFT_317457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60806.1| hypothetical protein ARALYDRAFT_317457 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   380 bits (975),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 238/303 (79%), Gaps = 0/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  CD
Sbjct  200   ALGGAGIPAVILLFGSLLIIETPTSLIERNKNEEGKEALRKIRGVDDINDEYESIVHACD  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  260   IASQVKDPYRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVLATFV IY VDK GRR LLLQ  + M+I Q+ +GIILA +L  TG+L +  
Sbjct  320   AVITGTINVLATFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGITGTLGRPQ  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  380   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+CGM++ IFFFFSAWI+ MGLF FFF+PETKG+ +D M E VWK H  W+++   +   
Sbjct  440   MLCGMRSGIFFFFSAWIIVMGLFAFFFIPETKGIAIDDMRESVWKPHWFWKRYMLPEDDH  499

Query  275   YEM  267
             +++
Sbjct  500   HDV  502



>ref|XP_002298323.2| hypothetical protein POPTR_0001s25600g [Populus trichocarpa]
 gb|EEE83128.2| hypothetical protein POPTR_0001s25600g [Populus trichocarpa]
Length=517

 Score =   380 bits (975),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 239/306 (78%), Gaps = 3/306 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GSLVI ETP SL+ERGK EE    L+++RGV+NV+ E+  I+   +
Sbjct  202   SLGCAAVPAIILAIGSLVIMETPTSLLERGKNEEALRVLRKIRGVDNVDKEYAEILNAIE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L  +S +PQLI   +LQ FQQFTGIN +MFYAPVLFQTMG+ ++GSLLS
Sbjct  262   LAKQVKHPFRNLMSRSNRPQLICGTVLQFFQQFTGINVVMFYAPVLFQTMGYGSDGSLLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++T LVNVL+T V+++ VD  GRR LL++ C+QM+ +Q  +G ILA +LK+   + K  
Sbjct  322   AVVTDLVNVLSTLVAVFLVDIIGRRVLLIEACLQMLAAQSIMGRILAVHLKSANIMPKGS  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VVIL+C++V  FAWSWGPL WLIPSEIFPLETR+AGF FAV  NM CTF++AQAFL+
Sbjct  382   AKLVVILVCVFVSGFAWSWGPLGWLIPSEIFPLETRSAGFFFAVGMNMFCTFLVAQAFLT  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFR-SDV-  282
             M+C M++ IFFFF+AWIV MG+F  FF+PETKG+P+D M E+VWK+H  W++++  SD+ 
Sbjct  442   MLCHMRSGIFFFFAAWIVVMGIFAIFFLPETKGIPIDEMNERVWKKHWFWKRYYEDSDIN  501

Query  281   -RSYEM  267
              RS E+
Sbjct  502   KRSQEI  507



>ref|XP_009124947.1| PREDICTED: sugar transport protein 6-like [Brassica rapa]
Length=507

 Score =   379 bits (974),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 238/297 (80%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AA+PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  C+
Sbjct  201   ALGGAAIPAVILLFGSLIICETPTSLIERNKNEEGKEALRKIRGVDDINEEYESIVNACE  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  261   IASQVKDPYRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG++NVL+TFV IY VD+ GRR LLLQ  + M+I Q+ +GIILA +L TTG+L K  
Sbjct  321   AVITGVINVLSTFVGIYLVDRTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA  VS NM   F+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVEVSCNMFFKFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM++ IFFFFSAWI+ MGLF  FF+PETKGVP+D M E+VWK H  W+++  ++
Sbjct  441   MLCGMRSGIFFFFSAWIIVMGLFAMFFIPETKGVPIDEMRERVWKPHWFWKRYMLAE  497



>ref|XP_002461666.1| hypothetical protein SORBIDRAFT_02g006150 [Sorghum bicolor]
 gb|EER98187.1| hypothetical protein SORBIDRAFT_02g006150 [Sorghum bicolor]
Length=512

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 234/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG AAVPA  L LGSLVI+ETP SLVERG+ + G+  L+++RG  +V+AEF+ I A CD
Sbjct  204   ALGGAAVPAAGLFLGSLVITETPTSLVERGRDDAGRRTLEKIRGTADVDAEFDEIRAACD  263

Query  995   AAK---QVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGS  825
              A+   + +KP+++L +   +P L+I+V +QVFQQFTGINAIMFYAPVLFQTMG   + S
Sbjct  264   LARALSEEEKPYRRLMRPESRPPLVIAVAMQVFQQFTGINAIMFYAPVLFQTMGLGTDSS  323

Query  824   LLSSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLD  645
             LLS+++TG VNV++T VSI  VDK GRRKLLL+ C+QM+++Q AVG I+  +++      
Sbjct  324   LLSAVVTGGVNVVSTVVSILLVDKVGRRKLLLEACVQMLVAQTAVGGIMVVHVRADNEPS  383

Query  644   KTLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQA  465
             ++ +  +V+LIC+YV +FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQA
Sbjct  384   RSWAVAIVVLICVYVSSFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFLIAQA  443

Query  464   FLSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             FLSMMC M+AFIFFFF+ WIVAM  FV   +PETKGVP+D MV++VW++H  W++ F
Sbjct  444   FLSMMCSMRAFIFFFFAVWIVAMAAFVLALLPETKGVPIDEMVDRVWRRHWFWKRCF  500



>ref|XP_009364224.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=511

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 235/301 (78%), Gaps = 4/301 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLVIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQM V +++   ++  T +L + 
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRMLLLEAGVQMFLSQMVVAVVMGLKVQDNTNNLTQG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VVI++C +V +FAWSWGPL WLIPSE FPLE R+AG + AVS NML TF+IAQAFL
Sbjct  384   MAILVVIMVCSFVASFAWSWGPLGWLIPSETFPLEARSAGQSVAVSINMLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FFSAW++ M +F  F +PETKGVP++ M E+VWKQH  W++F   F  
Sbjct  444   SMLCHMKFGIFLFFSAWVLVMTIFAMFLIPETKGVPIEEMTERVWKQHWFWKRFMDDFED  503

Query  287   D  285
             D
Sbjct  504   D  504



>ref|NP_187247.1| sugar transport protein 6 [Arabidopsis thaliana]
 sp|Q9SFG0.1|STP6_ARATH RecName: Full=Sugar transport protein 6; AltName: Full=Hexose 
transporter 6 [Arabidopsis thaliana]
 gb|AAF23220.1|AC013454_7 putative hexose transporter [Arabidopsis thaliana]
 emb|CAC69073.1| STP6 protein [Arabidopsis thaliana]
 gb|AEE74323.1| sugar transport protein 6 [Arabidopsis thaliana]
Length=507

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/303 (61%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  CD
Sbjct  200   ALGGAGIPAVILLFGSLLIIETPTSLIERNKNEEGKEALRKIRGVDDINDEYESIVHACD  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK P++KL K + +P  II +LLQ+FQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  260   IASQVKDPYRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVLATFV IY VD+ GRR LLLQ  + M+I Q+ +GIILA +L  TG+L +  
Sbjct  320   AVITGSINVLATFVGIYLVDRTGRRFLLLQSSVHMLICQLIIGIILAKDLGVTGTLGRPQ  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  380   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLS  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+CGM++ IFFFFS WI+ MGLF FFF+PETKG+ +D M E VWK H  W+++   +   
Sbjct  440   MLCGMRSGIFFFFSGWIIVMGLFAFFFIPETKGIAIDDMRESVWKPHWFWKRYMLPEDDH  499

Query  275   YEM  267
             +++
Sbjct  500   HDI  502



>ref|XP_006394871.1| hypothetical protein EUTSA_v10005607mg [Eutrema salsugineum]
 gb|ESQ32157.1| hypothetical protein EUTSA_v10005607mg [Eutrema salsugineum]
Length=507

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 235/303 (78%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A VPA++L  GS +I ETP SL+ER K E+GK  LK++RGVE+V+ E+E+IV  CD
Sbjct  201   ALGGAGVPALILLFGSFLICETPTSLIERNKTEQGKETLKKIRGVEDVDEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P L+I +LLQ+FQQFTGINAI+FYAPVLFQT+GF  + +LLS
Sbjct  261   FARQVKDPYRKLLKPASRPPLVIGMLLQLFQQFTGINAIIFYAPVLFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VDK GRR LLLQ  + M++ Q+ +GIILA +L  TG+L +  
Sbjct  321   AVVTGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLVCQLVIGIILAKDLDVTGTLGRAE  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FP+ETRT GFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPVETRTEGFALAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF-FRSDVR  279
             M+CGM++ IFFFFSAWIV MGLF  FFVPETKGV +D M + VWK H  W++F  + D  
Sbjct  441   MLCGMKSGIFFFFSAWIVVMGLFALFFVPETKGVSIDDMRDSVWKPHWYWKRFMLQEDEH  500

Query  278   SYE  270
               E
Sbjct  501   DVE  503



>ref|XP_010026974.1| PREDICTED: sugar transport protein 8-like [Eucalyptus grandis]
 gb|KCW60806.1| hypothetical protein EUGRSUZ_H03541 [Eucalyptus grandis]
Length=509

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 224/297 (75%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             S GLA +PA ML   S  I ETP SL+ER + E GKA L+R+RG +NV AEF  IVA   
Sbjct  202   SFGLAGIPATMLLGASFAICETPTSLIERNQFELGKATLRRIRGTDNVAAEFNLIVAASK  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA+QVK PF+KL   S +P L+I++LLQVFQ FTGI+AIMFYAPVLFQ  GF  N  LLS
Sbjct  262   AARQVKHPFRKLMALSSRPPLVIAILLQVFQHFTGIDAIMFYAPVLFQMAGFGNNAVLLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITGLV V +T VS+YTVD+AGRR LLL+GC+QM I+Q  +G++L  +LK TGSL  T 
Sbjct  322   TVITGLVKVFSTLVSMYTVDRAGRRVLLLEGCVQMFINQTVIGLLLLLHLKPTGSLHPTE  381

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + V ++L   ++M FAWSWGPL WLIPSE FPLETRTAGFA AVS NML   I AQAFL 
Sbjct  382   AMVTLVLASGFMMGFAWSWGPLGWLIPSETFPLETRTAGFACAVSFNMLLIVIFAQAFLP  441

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M+A  FFFF+AWIVA GLF  FFVPETKGVPVDLMVE VWKQH  W+++  +D
Sbjct  442   MLCHMKAGTFFFFAAWIVAFGLFTVFFVPETKGVPVDLMVESVWKQHWFWKRYMIND  498



>emb|CBI17743.3| unnamed protein product [Vitis vinifera]
Length=1092

 Score =   391 bits (1005),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 247/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEHIKMACE  256

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  257   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  316

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  317   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  376

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  377   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  436

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  437   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  489


 Score =   389 bits (1000),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 246/293 (84%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPASLVER +  +G + LK++RGVE+V+AEFE I   C+
Sbjct  672   SLGLASLPAAFLFVGSVVIIETPASLVERNQESQGLSTLKKIRGVEDVDAEFEQIKMACE  731

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  732   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  791

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  792   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  851

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  852   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  911

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIV MGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  912   MMCHMRAFIFFFFAAWIVVMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  964



>ref|XP_002311614.2| hypothetical protein POPTR_0008s15020g [Populus trichocarpa]
 gb|EEE88981.2| hypothetical protein POPTR_0008s15020g [Populus trichocarpa]
Length=521

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 243/304 (80%), Gaps = 7/304 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L  GSL I ETP SL+ER KVE+G+A LK++RGV+NV+ E+++IV  C+
Sbjct  202   SLGIAGVPALLLCFGSLAIYETPTSLIERKKVEQGRAVLKKIRGVDNVDLEYDSIVHACE  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A Q+ +P+ +L K+  +P L+I++++QVFQQFTGINAIMFYAPVLFQT+GF ++ +LLS
Sbjct  262   VASQITQPYHELMKRESRPPLVIAIVMQVFQQFTGINAIMFYAPVLFQTVGFGSDAALLS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-------KTT  657
             S++TGLVNVL+T VS+  VDK GRR LLL+ C+QM+I+Q+ + I L+  L        TT
Sbjct  322   SVVTGLVNVLSTIVSVVLVDKVGRRALLLEACVQMLITQVWILITLSIFLAPMNHPINTT  381

Query  656   GSLDKTLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFI  477
             G+L    + VVVI++C++V  FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+
Sbjct  382   GTLPNGDALVVVIMVCVFVAGFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFV  441

Query  476   IAQAFLSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             IAQAFLSM+C ++A IFFFF+AWIV MGLF  F +PETKGVP+D MV++VWKQH  W++F
Sbjct  442   IAQAFLSMLCNLRAGIFFFFAAWIVVMGLFALFLLPETKGVPIDEMVDRVWKQHWFWKRF  501

Query  296   FRSD  285
             F  +
Sbjct  502   FNDE  505



>ref|XP_008390875.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=511

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 234/301 (78%), Gaps = 4/301 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLVIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQM V I++   ++  + +L + 
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRMLLLEAGVQMFLSQMVVAIVMGLKVQDNSNNLTQG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VVI++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TF+IAQAFL
Sbjct  384   MAILVVIMVCSFVASFAWSWGPLGWLIPSETFPLEARSAGQSVAVCINMLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FFSAW++ M +F  F +PETKGVP++ M E+VWKQH  W++F   F  
Sbjct  444   SMLCHMKFGIFLFFSAWVLVMTIFAMFLIPETKGVPIEEMTERVWKQHWFWKRFMDDFED  503

Query  287   D  285
             D
Sbjct  504   D  504



>ref|XP_009366952.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=509

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 235/305 (77%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLIIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRILLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W++F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMTERVWKQHWFWKRFMDDFED  503

Query  287   DVRSY  273
             D + +
Sbjct  504   DPKGH  508



>ref|XP_009366956.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=509

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 235/305 (77%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLIIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRILLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W++F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMTERVWKQHWFWKRFMDDFED  503

Query  287   DVRSY  273
             D + +
Sbjct  504   DPKGH  508



>ref|XP_008652769.1| PREDICTED: sugar transport protein 13 isoform X2 [Zea mays]
Length=392

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 229/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L +++TP SL+ERG+++EGKA LKR+RG +NVE EF  IV    
Sbjct  81    SLSLAGIPAALLTLGALFVTDTPNSLIERGRLDEGKAVLKRIRGTDNVEPEFNEIVEASR  140

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  141   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  200

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ I+L   +   + +L   
Sbjct  201   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAIVLGIKVTDHSDNLGHG  260

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  261   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  320

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW++ M LFV FF+PETK VP++ M E+VWKQH  W+++   D
Sbjct  321   SMLCHLKYAIFVFFSAWVLVMSLFVLFFLPETKNVPIEEMTERVWKQHWFWKRYMDDD  378



>ref|XP_008380300.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=509

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 233/305 (76%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA ML LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGMLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K+  +PQLII+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKDVKNPFQNLLKRRNRPQLIIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRVLLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG +  V  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVTVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W++F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMTERVWKQHWFWKRFMDDFED  503

Query  287   DVRSY  273
             D + +
Sbjct  504   DPKGH  508



>gb|EMT20071.1| Sugar transport protein 13 [Aegilops tauschii]
Length=514

 Score =   372 bits (956),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 230/305 (75%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA ML LG+L +++TP SL+ERG +EEGKA LKR+RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAAMLTLGALFVTDTPNSLIERGHLEEGKAVLKRIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   IAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVLAT VS+Y VD+AGRR LLL+  +QM +SQ+ + ++L   +   + +L   
Sbjct  323   AVITGAVNVLATLVSVYAVDRAGRRALLLEAGVQMFLSQVVIAVVLGIKVTDKSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C YV +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAILVVVMVCTYVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFLIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFSAW++ M +FV FF+PETK VP++ M +KVWKQH  W++F   D  
Sbjct  443   SMLCHLKFAIFIFFSAWVLVMSVFVLFFLPETKNVPIEEMTDKVWKQHWFWKRFMDDDDH  502

Query  278   SYEMA  264
              + +A
Sbjct  503   HHNIA  507



>ref|XP_010667424.1| PREDICTED: sugar transport protein 13 [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 227/303 (75%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++++TP SL+ERG++EEGKA L+R+RG +N+E EF  +V    
Sbjct  208   SLGLAGIPACLLTLGALIVTDTPNSLIERGRLEEGKAVLRRIRGTDNIEPEFLELVEASR  267

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ L ++  +PQL+ISV +QVFQQFTGINAIMFYAPVLF T+GF AN SL S
Sbjct  268   MAQQVKHPFRNLLQRRNRPQLVISVAMQVFQQFTGINAIMFYAPVLFNTLGFGANASLYS  327

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ  +QM ISQ+ + IIL   +K  + SL   
Sbjct  328   AVITGAVNVLSTVVSIYSVDKLGRRILLLQAGVQMFISQLIIAIILGLKVKDHSNSLSHG  387

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVIL+C +V +FAWSWGPL WLIPSEIFPLETR+AG +  V  NML TFII QAFL
Sbjct  388   YAIFVVILVCTFVSSFAWSWGPLGWLIPSEIFPLETRSAGQSVTVCVNMLFTFIIGQAFL  447

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M +FV F +PETK VP++ M E+VWK H +W+++   D R
Sbjct  448   SMLCKFKFGIFLFFSGWVLIMSIFVVFLIPETKNVPIEEMTERVWKNHWLWKRYMEDDHR  507

Query  278   SYE  270
               +
Sbjct  508   YRD  510



>ref|NP_197997.1| sugar transport protein 8 [Arabidopsis thaliana]
 sp|Q9SBA7.2|STP8_ARATH RecName: Full=Sugar transport protein 8; AltName: Full=Hexose 
transporter 8 [Arabidopsis thaliana]
 gb|AAC26232.1| contains similarity to sugar transporters (Pfam: sugar_tr.hmm, 
score: 395.91) [Arabidopsis thaliana]
 emb|CAC69068.1| STP8 protein [Arabidopsis thaliana]
 gb|AED93541.1| sugar transport protein 8 [Arabidopsis thaliana]
Length=507

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/293 (62%), Positives = 228/293 (78%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PA++L  GSL+I ETP SL+ER K +EGK  LK++RGVE+V+ E+E+IV  CD
Sbjct  201   ALGGAGIPALILLFGSLLICETPTSLIERNKTKEGKETLKKIRGVEDVDEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+ KL K + +P  +I +LLQ FQQFTGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  261   IARQVKDPYTKLMKPASRPPFVIGMLLQFFQQFTGINAIMFYAPVLFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV I+ VDK GRR LLLQ  + M+I Q+ +GIILA +L  TG+L +  
Sbjct  321   AVVTGTINVLSTFVGIFLVDKTGRRFLLLQSSVHMLICQLVIGIILAKDLDVTGTLARPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETRT GFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRTEGFALAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C M++ IFFFFS WIV MGLF  FFVPETKGV +D M + VWK H  W++F
Sbjct  441   MLCAMKSGIFFFFSGWIVVMGLFALFFVPETKGVSIDDMRDSVWKLHWYWKRF  493



>ref|XP_010434418.1| PREDICTED: sugar transport protein 6 [Camelina sativa]
Length=507

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 232/297 (78%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  CD
Sbjct  200   ALGGAGIPAVILLFGSLLIIETPTSLIERNKNEEGKEALRKIRGVDDINDEYESIVHACD  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P L+I +LLQ FQQFTGINAIMFYAPVLFQT+GF +N +LLS
Sbjct  260   IARQVKDPYRKLLKPASRPPLVIGMLLQFFQQFTGINAIMFYAPVLFQTVGFGSNAALLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VD+ GRR LLLQ  + M+I  + +G ILA +L  TG+L +  
Sbjct  320   AVVTGTINVLSTFVGIYLVDRTGRRFLLLQSSVHMLICHLIIGSILAKDLGVTGTLGRAQ  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  380   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFLIAQAFLS  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM+  IFFFF+ WI+ MGLF  FF+PETKG+ +D M E VWK H  W+++  ++
Sbjct  440   MLCGMRYGIFFFFAGWIIVMGLFALFFIPETKGIAIDDMRESVWKPHWFWKRYMLAE  496



>ref|XP_009366951.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
 ref|XP_009366957.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=511

 Score =   370 bits (950),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL+ RGK+EEGKA LKR+RGV+NVE EF  IV    
Sbjct  204   SLGLAGVPALMLTLGSLIVVDTPNSLIARGKLEEGKAILKRIRGVDNVEPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK PFK L K+  +PQLII++ +Q+FQQFTGINAIMFYAPVLF+T+GFK++ SL S
Sbjct  264   VANEVKSPFKNLLKRRNRPQLIIAIFMQIFQQFTGINAIMFYAPVLFKTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTT-GSLDKT  639
             S ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ V I++   +K    +L   
Sbjct  324   SAITGAVNVLSTMVSIYFVDRAGRRVLLLEAGVQMFLSQLVVAIVMGLKVKDNVNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V++ +C++V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TFIIAQAFL
Sbjct  384   LGILVLVFVCIFVASFAWSWGPLGWLIPSETFPLEARSAGQSVAVFFNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AWI+ M +FV F +PETKGVP++ M E+VWKQH  W+++
Sbjct  444   SMLCHMKFAIFLFFAAWILVMTIFVIFLLPETKGVPIEEMTERVWKQHWFWKRY  497



>ref|XP_008348363.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=514

 Score =   370 bits (950),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 232/305 (76%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA ML LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  209   SLGLAGIPAGMLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  268

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K+  +PQLII+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  269   VAKDVKNPFQNLLKRRNRPQLIIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  328

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  329   AVITGAVNVLSTVVSIYFVDKAGRRXLLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  388

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG +  V  NML TFIIAQAFL
Sbjct  389   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVTVCINMLFTFIIAQAFL  448

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W+ F   F  
Sbjct  449   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMSERVWKQHWFWKGFMDDFED  508

Query  287   DVRSY  273
               ++Y
Sbjct  509   GAKAY  513



>gb|KDP46531.1| hypothetical protein JCGZ_08503 [Jatropha curcas]
Length=506

 Score =   370 bits (949),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 231/297 (78%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GSL ISETP SL+ERGK E+G + LK++RGV+NV+ E+  I+    
Sbjct  201   SLGGAAVPAIILFIGSLAISETPTSLIERGKNEKGISVLKKIRGVDNVDEEYIEILNAIV  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ L  +S + QL+   +LQ+FQQFTGIN +MFYAPVLFQTMGF  + SLLS
Sbjct  261   LARQVKNPFRNLMNRSNRGQLVCGTILQIFQQFTGINVVMFYAPVLFQTMGFGGDASLLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++T  +NV+ T V+++ VDK GR+ LLL+  +QM+++Q  +G+ L  +LK+T  + K  
Sbjct  321   AVVTDSINVVCTLVAVFGVDKFGRKFLLLEAVLQMLVAQTVMGVTLDMHLKSTNIMPKHS  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +V++++C++V  FAWSWGPL WLIPSEIFPLETR+AGF FAVS NM CTF+IAQAFL+
Sbjct  381   AVLVLVMVCIFVSGFAWSWGPLGWLIPSEIFPLETRSAGFFFAVSMNMFCTFLIAQAFLT  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++ IFFFF AWI+ MGLF  FF+PETKGVP+D M E+VWK+H  WR++F+  
Sbjct  441   MLCHMRSGIFFFFVAWIIVMGLFAIFFLPETKGVPIDEMNERVWKKHWYWRRYFKDS  497



>ref|XP_004292942.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   370 bits (949),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 229/297 (77%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L +GSL++++TP SL+ RGK+EEGKA LKR+RGV+NV+ E+  IV    
Sbjct  202   SLGLAGVPALLLTVGSLIVTDTPNSLIARGKLEEGKAILKRIRGVDNVDQEYNEIVDASR  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PFK L K+  +P L+I +++Q+FQQFTGINAIMFYAPVLFQT+GFK+N SL+S
Sbjct  262   AATEVKNPFKNLLKRRNRPTLVIGIMMQIFQQFTGINAIMFYAPVLFQTLGFKSNASLVS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             + ITG VNV++T VS+  VD AGRRKLL+Q   QM +SQM V +++   +K  + +L   
Sbjct  322   AAITGSVNVVSTIVSVILVDIAGRRKLLIQAGFQMFLSQMVVAVLMGLKVKDHSNNLGHD  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VV+L+C +V +FAWSWGPL WLIPSE F  ETR+AG +  VSTNML TF+IAQAFL
Sbjct  382   LGILVVVLVCSFVASFAWSWGPLGWLIPSETFAAETRSAGQSMVVSTNMLFTFVIAQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SM+C M+  IF+FFSAW++ M LF +FF+PETK +P+D + E+VWKQH  W+++   
Sbjct  442   SMLCHMKFGIFYFFSAWVLVMTLFTYFFIPETKNIPIDEINERVWKQHWYWKRYMED  498



>ref|XP_009366953.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=509

 Score =   369 bits (948),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 234/305 (77%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA L+R+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLRRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLVIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRILLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W+ F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMSERVWKQHWFWKGFMDDFED  503

Query  287   DVRSY  273
               ++Y
Sbjct  504   GAKAY  508



>ref|XP_009383001.1| PREDICTED: sugar transport protein 8-like [Musa acuminata subsp. 
malaccensis]
Length=508

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 243/297 (82%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LGLA VPA ML LGS+VI+ETP SL+ER ++ EG A LK++RG +NV AE+E I+  C+
Sbjct  204   ALGLAGVPATMLCLGSMVIAETPTSLIEREQLMEGLAMLKKIRGTDNVNAEYEEILHACE  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK+PF+ L K+S +PQL+I++ +QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  264   MARQVKQPFRNLMKRSSRPQLVIAIAMQVFQQFTGINAIMFYAPVLFQTIGFKNDASLLS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG+VNVL+T VS+  VDK GRR LLL+ C QM+I+Q+A+G +L  NLK+T  L+  +
Sbjct  324   AVITGIVNVLSTVVSVVLVDKLGRRFLLLEACGQMLITQVAIGGVLLVNLKSTNELEHGV  383

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV+L+CLYV +FAWSWGPL WLIPSE FPL TRTAG+AFAVS+NML TF+IAQAFLS
Sbjct  384   AVWVVVLVCLYVSSFAWSWGPLGWLIPSETFPLATRTAGYAFAVSSNMLFTFVIAQAFLS  443

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             MMC ++A IFFFF+AWIV MGLFV F +PETK VP+D M E+VWK+H  W++F   +
Sbjct  444   MMCHLRAGIFFFFAAWIVVMGLFVIFLLPETKNVPIDEMSERVWKRHWYWKRFMDEE  500



>ref|XP_009366955.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=509

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 234/305 (77%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA L+R+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLRRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLVIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRILLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W+ F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMSERVWKQHWFWKGFMDDFED  503

Query  287   DVRSY  273
               ++Y
Sbjct  504   GAKAY  508



>ref|XP_007223243.1| hypothetical protein PRUPE_ppa004420mg [Prunus persica]
 ref|XP_007223244.1| hypothetical protein PRUPE_ppa004423mg [Prunus persica]
 gb|EMJ24442.1| hypothetical protein PRUPE_ppa004420mg [Prunus persica]
 gb|EMJ24443.1| hypothetical protein PRUPE_ppa004423mg [Prunus persica]
Length=511

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 231/301 (77%), Gaps = 2/301 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA ML +GSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGMLTIGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I++ +Q+FQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKHPFRNLLKRRNRPQLVIAIWMQIFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ V II+   +K  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQLVVAIIMGLKVKDHSNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV TNML TFIIAQAFL
Sbjct  384   LAIIVVLMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCTNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C M+  IF FF+ W+  M +FV   +PETKGVP++ M E+VWKQH  W++F   DV 
Sbjct  444   SMLCNMKFGIFLFFTFWVFVMTIFVVVLIPETKGVPIEEMTERVWKQHWFWKRFM-DDVE  502

Query  278   S  276
              
Sbjct  503   D  503



>ref|XP_008222843.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=511

 Score =   369 bits (947),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 231/301 (77%), Gaps = 2/301 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA ML +GSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGMLTVGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I++ +Q+FQQFTGINAIMFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKHPFRNLLKRRNRPQLVIAIWMQIFQQFTGINAIMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ V II+   +K  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQLVVAIIMGLKVKDHSNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG + AV TNML TFIIAQAFL
Sbjct  384   LAILVVLMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVAVCTNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C M+  IF FF+ W+  M +FV   +PETKGVP++ M E+VWKQH  W++F   DV 
Sbjct  444   SMLCNMKFGIFLFFTFWVFVMTIFVVVLIPETKGVPIEEMTERVWKQHWFWKRFM-DDVE  502

Query  278   S  276
              
Sbjct  503   D  503



>ref|XP_008380301.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=509

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 233/305 (76%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LGSL++ +TP SL+ERGK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAGIPAGLLTLGSLIVVDTPNSLIERGKLEEGKAVLKRIRGVDNVDPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V++QVFQQFTGINA+MFYAPVLFQT+GFK++ SL S
Sbjct  264   VAKEVKNPFQNLLKRRNRPQLVIAVMMQVFQQFTGINAVMFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDKAGRR LLL+  +QM +SQ+ V I++   ++  + +L   
Sbjct  324   AVITGAVNVLSTVVSIYFVDKAGRRILLLEAGVQMFLSQLVVAIVMGLRVQEHSNNLTPG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG +  V  NML TFIIAQAFL
Sbjct  384   LAILVVVMVCSFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVTVCINMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF---FRS  288
             SM+C M+  IF FF AW++ M +FV F +PETKGVP++ M E+VWKQH  W+ F   F  
Sbjct  444   SMLCHMKFGIFLFFCAWVLVMTIFVVFLIPETKGVPIEEMSERVWKQHWFWKGFMDDFED  503

Query  287   DVRSY  273
               ++Y
Sbjct  504   GAKAY  508



>ref|XP_002872209.1| hypothetical protein ARALYDRAFT_351641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48468.1| hypothetical protein ARALYDRAFT_351641 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 228/293 (78%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PA++L  GSL+I ETP SL+ER K +EGK  LK++RGVE+V+ E+E+IV  CD
Sbjct  201   ALGGAGIPALILLFGSLLICETPTSLIERNKTKEGKETLKKIRGVEDVDEEYESIVHACD  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P+ KL K + +P  +I +LLQ FQQ TGINAIMFYAPVLFQT+GF  + +LLS
Sbjct  261   FARQVKDPYTKLMKPASRPPFVIGMLLQFFQQLTGINAIMFYAPVLFQTVGFGNDAALLS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG +NVL+TFV I+ VDK GRR LLLQ  + M++ Q+ +GIILA +L  TG+L +  
Sbjct  321   AVITGTINVLSTFVGIFLVDKTGRRFLLLQSSVHMLVCQLVIGIILAKDLDVTGTLGRPQ  380

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FP+ETRT GFA AVS NM  TF+IAQAFLS
Sbjct  381   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPVETRTEGFALAVSCNMFFTFVIAQAFLS  440

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+CGM++ IFFFFS WIV MGLF  FFVPETKGV +D M + VWK H  W++F
Sbjct  441   MLCGMKSGIFFFFSGWIVVMGLFALFFVPETKGVAIDDMRDSVWKLHWYWKRF  493



>ref|XP_004955790.1| PREDICTED: LOW QUALITY PROTEIN: sugar transport protein 8-like 
[Setaria italica]
Length=513

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 224/284 (79%), Gaps = 3/284 (1%)
 Frame = -1

Query  1136  LGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQV---KKPFK  966
             LGSLVI+ETP SLVERG  + G+  L+++RG  +V+AEF+ I + CD A  +   +KP++
Sbjct  218   LGSLVITETPTSLVERGHPDAGRRTLEKIRGTADVDAEFDEIRSACDVAAALNAEEKPYR  277

Query  965   KLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGLVNVL  786
             +L ++  +P L+I++ +QVFQQFTGINA+MFYAPVLFQTMGF  +GSLLS+++TG VNV+
Sbjct  278   RLLRRESRPPLVIAIAMQVFQQFTGINALMFYAPVLFQTMGFATDGSLLSAVVTGGVNVV  337

Query  785   ATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTLSTVVVILICL  606
             AT VSI  VDK GRRKLLL+ C QM+++Q AVG I+   +K   S     +  +V+LIC+
Sbjct  338   ATVVSIVLVDKVGRRKLLLEACAQMLVAQTAVGGIMLAKVKADTSPSSGWAVAIVVLICI  397

Query  605   YVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGMQAFIF  426
             YV +FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQAFLSMMC M+A+IF
Sbjct  398   YVSSFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFLIAQAFLSMMCTMRAYIF  457

Query  425   FFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             FFF+AWIV MG FV   +PET+GVP+D MVE+VW++H  W++ F
Sbjct  458   FFFAAWIVVMGTFVLVLLPETEGVPIDEMVERVWRRHWFWKRCF  501



>ref|XP_004985175.1| PREDICTED: sugar transport protein 13-like [Setaria italica]
Length=517

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 230/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PAV+L LG+L +++TP SL+ERG+++EGKA LK++RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAVLLTLGALFVTDTPNSLIERGRLDEGKAVLKKIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   IAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  323   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDHSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW+V M LFV FF+PETK VP++ M E+VWKQH  W++F   D
Sbjct  443   SMLCHLKYAIFVFFSAWVVVMSLFVLFFLPETKNVPIEEMTERVWKQHWFWKRFMDDD  500



>ref|XP_004162276.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
Length=395

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 230/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ +TP SL+ERG++EEGKA LK++RG +NVEAEF  +V    
Sbjct  76    SLGLAGIPAGLLTLGALMVVDTPNSLIERGRMEEGKAVLKKIRGTDNVEAEFLELVEASR  135

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  136   VAREIKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFKSSASLYS  195

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNV +T +SIY+VDK GRR LLL+  +QM ISQ+ + I+L   +   + +L K+
Sbjct  196   AVITGAVNVASTVISIYSVDKVGRRMLLLEAGVQMFISQLMIAIVLGIKVNDHSDNLTKS  255

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +T+VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  256   FATLVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  315

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS+W++ M +FV F +PETK VP++ M E+VWK+H  W++F   D
Sbjct  316   SMLCHLKFGIFLFFSSWVLIMSVFVLFLLPETKNVPIEEMTEQVWKRHWFWKRFVEED  373



>ref|XP_008652761.1| PREDICTED: sugar transport protein 13 isoform X1 [Zea mays]
Length=514

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 229/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L +++TP SL+ERG+++EGKA LKR+RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAALLTLGALFVTDTPNSLIERGRLDEGKAVLKRIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ I+L   +   + +L   
Sbjct  323   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAIVLGIKVTDHSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW++ M LFV FF+PETK VP++ M E+VWKQH  W+++   D
Sbjct  443   SMLCHLKYAIFVFFSAWVLVMSLFVLFFLPETKNVPIEEMTERVWKQHWFWKRYMDDD  500



>ref|XP_008390869.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=528

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 222/303 (73%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PA +L LG+L + ETP SLVERG +E+GK+ LKR+RG ENVE EF  +V    
Sbjct  204   SLGLAGFPAGLLTLGALFVVETPNSLVERGLLEQGKSVLKRIRGTENVEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  264   IAKEVKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFGNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ  +QM ISQ+A+ IIL   +K  +  L K 
Sbjct  324   AVITGAVNVLSTVVSIYSVDKVGRRLLLLQAGVQMFISQVAIAIILGIKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQ FL
Sbjct  384   FAIFVVVLICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSLTVCTNLLFTFVIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F   D  
Sbjct  444   SMLCHFKYGIFLFFSGWVLVMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDDDY  503

Query  278   SYE  270
               E
Sbjct  504   HIE  506



>tpg|DAA44110.1| TPA: hypothetical protein ZEAMMB73_406835 [Zea mays]
Length=538

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 229/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L +++TP SL+ERG+++EGKA LKR+RG +NVE EF  IV    
Sbjct  227   SLSLAGIPAALLTLGALFVTDTPNSLIERGRLDEGKAVLKRIRGTDNVEPEFNEIVEASR  286

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  287   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  346

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ I+L   +   + +L   
Sbjct  347   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAIVLGIKVTDHSDNLGHG  406

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  407   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  466

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW++ M LFV FF+PETK VP++ M E+VWKQH  W+++   D
Sbjct  467   SMLCHLKYAIFVFFSAWVLVMSLFVLFFLPETKNVPIEEMTERVWKQHWFWKRYMDDD  524



>ref|XP_004298157.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/302 (58%), Positives = 228/302 (75%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGL  +PAVML +GSL++ +TP SL+ RGK+EEGKAALK++RGV NVEA++  IV    
Sbjct  205   SLGLGGIPAVMLTVGSLIVVDTPDSLITRGKLEEGKAALKKIRGVSNVEADYLEIVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK P + L K+  +PQL+I+V +Q+FQQ TGINAIMFYAPVLF T+GFK++ SL S
Sbjct  265   MASEVKNPMRNLLKRRNRPQLVIAVCMQIFQQCTGINAIMFYAPVLFSTVGFKSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG VNVL+T VS+Y+VDK GRR LLLQ  +QM ISQM V ++L   +K  + SL + 
Sbjct  325   SVITGAVNVLSTVVSLYSVDKVGRRLLLLQAGVQMFISQMVVALVLGIKVKDHSESLTQG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V  FAWSWGPL WLIPSE FPLETR+AG +  V  NML TF+IAQAFL
Sbjct  385   LALLVVVMVCTFVAGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M ++VWKQH  WR+F   D  
Sbjct  445   SMLCNFKFGIFIFFSAWVLVMSVFVLFLLPETKNVPIEEMTDRVWKQHWYWRRFMDDDGD  504

Query  278   SY  273
             ++
Sbjct  505   AF  506



>gb|EMS63665.1| Sugar transport protein 13 [Triticum urartu]
Length=515

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA ML LG+L +++TP SL+ERG +EEGKA LKR+RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAAMLTLGALFVTDTPNSLIERGHLEEGKAVLKRIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   IAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVLAT VS+Y VD+AGRR LLL+  +QM +SQ+ + ++L   +   + +L   
Sbjct  323   AVITGAVNVLATLVSVYAVDRAGRRALLLEAGVQMFLSQVVIAVVLGIKVTDRSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C YV +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAILVVVMVCTYVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFLIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C ++  IF FFSAW++ M +FV FF+PETK VP++ M +KVWKQH  W+++
Sbjct  443   SMLCHLKFAIFIFFSAWVLVMSVFVLFFLPETKNVPIEEMTDKVWKQHWFWKRY  496



>ref|XP_008380303.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=528

 Score =   365 bits (938),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 222/303 (73%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L  G+L++ ETP SLVERG +++GK+ LKR+RG ENVE EF  +V    
Sbjct  204   SLGLAXLPAGLLTXGALLVVETPNSLVERGLLDQGKSVLKRIRGTENVEPEFLDLVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  264   IAKEVKHPFRNLIKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFDTLGFGNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ   QM ISQ+A+ IIL   +K  +  L K 
Sbjct  324   AVITGAVNVLSTVVSIYSVDKVGRRMLLLQAGFQMFISQVAIAIILGIKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TFIIAQ FL
Sbjct  384   FAIFVVVLICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFIIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F   D  
Sbjct  444   SMLCHFKYGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDDDY  503

Query  278   SYE  270
               E
Sbjct  504   HIE  506



>ref|XP_002465636.1| hypothetical protein SORBIDRAFT_01g042690 [Sorghum bicolor]
 gb|EER92634.1| hypothetical protein SORBIDRAFT_01g042690 [Sorghum bicolor]
Length=517

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 229/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PAV+L LG+L +++TP SL+ERG+++EGKA LK++RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAVLLTLGALFVTDTPNSLIERGRLDEGKAVLKKIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  323   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDHSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW++ M  FV FF+PETK VP++ M E+VWKQH  W+++   D
Sbjct  443   SMLCHLKYAIFVFFSAWVLVMSFFVLFFLPETKNVPIEEMTERVWKQHWFWKRYMDDD  500



>gb|KEH27346.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=473

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G++V+ +TP SL+ERG++EEGKA LK++RG +N+E EF  +     
Sbjct  156   SLGLAGIPALLLTVGAIVVVDTPNSLIERGRLEEGKAVLKKIRGTDNIEPEFLELCEASR  215

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLIIS+ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  216   VAKEVKHPFRNLLKRKNRPQLIISIALQIFQQFTGINAIMFYAPVLFNTVGFKNDASLYS  275

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  276   AVITGAVNVLSTIVSIYFVDKLGRRMLLLEAGVQMFLSQIVIAIILGIKVTDHSDDLSKG  335

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVIL+C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  NML TF+IAQAFL
Sbjct  336   YAIFVVILVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMLFTFVIAQAFL  395

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M +FV F VPETK +P++ M E+VWKQH  W++F   D
Sbjct  396   SMLCHFKFGIFLFFSGWVLIMSIFVLFLVPETKNIPIEEMTERVWKQHWFWKRFMEDD  453



>ref|XP_008438691.1| PREDICTED: sugar transport protein 13-like [Cucumis melo]
Length=526

 Score =   365 bits (936),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 229/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ +TP SL+ERG++EEGK  LK++RG +NVEAEF  +V    
Sbjct  207   SLGLAGIPAGLLTLGALMVVDTPNSLIERGRMEEGKTVLKKIRGTDNVEAEFLELVEASR  266

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  267   VAREIKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFKSSASLYS  326

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNV +T +SIY+VDK GRR LLL+  +QM ISQ+ + I+L   +K  +  L KT
Sbjct  327   AVITGAVNVASTVISIYSVDKVGRRMLLLEAGVQMFISQLVIAIVLGIKVKDHSDDLTKT  386

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +T+VVI++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  387   FATLVVIMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  446

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS+W++ M +FV F +PETK VP++ M E+VWKQH  W++F   +
Sbjct  447   SMLCHLKFGIFLFFSSWVLIMSVFVLFLLPETKNVPIEEMTEQVWKQHWFWKRFVEEE  504



>ref|XP_009366904.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=508

 Score =   364 bits (934),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 228/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VP+++L LG++++++TP SL++RGK+E+GK  LKR+RG+ENV+ EF  I+    
Sbjct  203   SLGLAGVPSLLLTLGAVIVTDTPNSLIQRGKLEQGKKVLKRIRGIENVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+VK PF+ L K+  +PQLII++ LQ FQQFTGIN+I FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVKHPFRNLLKRKNRPQLIITIFLQFFQQFTGINSINFYAPVLFQTLGFKNDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG++ VL   +SIY VDKAGRR LL++G IQM +S + V IIL   LK  +  LD+ 
Sbjct  323   SVITGVIMVLGAIISIYFVDKAGRRVLLIEGGIQMFLSHVVVAIILGMKLKDQSNDLDRG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VVI++C +V +F WSWGPLCWL+ SEIFPLE R+AG +  VS NML TF+IAQAFL
Sbjct  383   LGILVVIVVCSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVSVNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AW+  M +FVFF +PETKGVP++ MV+ VW++H  W+++
Sbjct  443   SMLCHMKFAIFLFFAAWVFLMTVFVFFLLPETKGVPIEEMVDVVWREHWYWKRY  496



>gb|KCW85471.1| hypothetical protein EUGRSUZ_B02275, partial [Eucalyptus grandis]
Length=497

 Score =   363 bits (933),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 230/297 (77%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA+ L +GSL I ETP SL+ERGK++EG  ALKR+RG ++V+ E+E I+   +
Sbjct  195   SLGGAAVPAIALLIGSLTIVETPTSLIERGKLDEGLRALKRIRGTDSVDTEYEEILHATE  254

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+ +  F+ L K S +PQLI   ++Q+FQQFTGIN IMFYAPVLFQTMGF ++ SLLS
Sbjct  255   MAKKAEGSFQSLAKPSSRPQLICGTIIQIFQQFTGINVIMFYAPVLFQTMGFGSDASLLS  314

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TGL+NV++TF++I+TVD+ GR+ LL++  IQM+++Q  +GI LA +LK+T  +    
Sbjct  315   AVVTGLINVMSTFIAIFTVDRCGRKVLLIEAAIQMLVAQCTMGITLAIHLKSTNEIPNGY  374

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV L+  +V  FAWSWGPL WLIPSEI+PLETR+AGF FAV  NMLCTFIIAQ FL+
Sbjct  375   ALFVVFLVSFFVAGFAWSWGPLGWLIPSEIYPLETRSAGFFFAVGMNMLCTFIIAQVFLT  434

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++  FFFFSAWIV MG F  F +PETKG+P+D M E+VWK+H  W+K+F+ +
Sbjct  435   MLCTMRSATFFFFSAWIVVMGCFATFMLPETKGIPIDEMNERVWKKHWFWKKYFKDE  491



>ref|XP_010046383.1| PREDICTED: sugar transport protein 6-like [Eucalyptus grandis]
Length=499

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 230/297 (77%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA+ L +GSL I ETP SL+ERGK++EG  ALKR+RG ++V+ E+E I+   +
Sbjct  195   SLGGAAVPAIALLIGSLTIVETPTSLIERGKLDEGLRALKRIRGTDSVDTEYEEILHATE  254

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+ +  F+ L K S +PQLI   ++Q+FQQFTGIN IMFYAPVLFQTMGF ++ SLLS
Sbjct  255   MAKKAEGSFQSLAKPSSRPQLICGTIIQIFQQFTGINVIMFYAPVLFQTMGFGSDASLLS  314

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TGL+NV++TF++I+TVD+ GR+ LL++  IQM+++Q  +GI LA +LK+T  +    
Sbjct  315   AVVTGLINVMSTFIAIFTVDRCGRKVLLIEAAIQMLVAQCTMGITLAIHLKSTNEIPNGY  374

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  VV L+  +V  FAWSWGPL WLIPSEI+PLETR+AGF FAV  NMLCTFIIAQ FL+
Sbjct  375   ALFVVFLVSFFVAGFAWSWGPLGWLIPSEIYPLETRSAGFFFAVGMNMLCTFIIAQVFLT  434

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M++  FFFFSAWIV MG F  F +PETKG+P+D M E+VWK+H  W+K+F+ +
Sbjct  435   MLCTMRSATFFFFSAWIVVMGCFATFMLPETKGIPIDEMNERVWKKHWFWKKYFKDE  491



>ref|XP_009366920.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=508

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VP+++L LG++++++TP SL++RGK+E+GK  LKR+RG+ENV+ EF  I+    
Sbjct  203   SLGLAGVPSLLLTLGAVIVTDTPNSLIQRGKLEQGKKVLKRIRGIENVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+VK PF+ L K+  +PQLII++ LQ FQQFTGIN+I FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVKHPFRNLLKRKNRPQLIITIFLQFFQQFTGINSINFYAPVLFQTLGFKNDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG++ VL   +SIY VDKAGRR LL++G IQM +S + V IIL   LK  +  LD  
Sbjct  323   SVITGVIMVLGAIISIYFVDKAGRRVLLIEGGIQMFLSHVVVAIILGMKLKDQSNDLDHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VVI++C +V +F WSWGPLCWL+ SEIFPLE R+AG +  VS NML TF+IAQAFL
Sbjct  383   LGILVVIVVCSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVSVNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AW+  M +FVFF +PETKGVP++ MV+ VW++H  W+++
Sbjct  443   SMLCHMKFAIFLFFAAWVFLMTVFVFFLLPETKGVPIEEMVDVVWREHWYWKRY  496



>gb|EYU45974.1| hypothetical protein MIMGU_mgv1a004836mg [Erythranthe guttata]
Length=508

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 230/297 (77%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA+ LG+GS+ I ETP SL+ERG  E+G  ALK  RGV++V  EFE IV   +
Sbjct  204   SLGLAAIPAIFLGVGSIFIVETPTSLIERGHKEDGMRALKITRGVDDVAREFEEIVGATE  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +++ PF+ L KKS  PQ+  +++LQVFQQ TGIN IMFYAPVLFQTMG  A+ SLLS
Sbjct  264   AAAKIETPFRNLRKKSSFPQVFCAMVLQVFQQLTGINVIMFYAPVLFQTMGLGADASLLS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NV ATFV+++ VDK GRRKLL+Q  +QM+I+Q+ VG ILA  LK T  + K L
Sbjct  324   AVLTGGINVAATFVAVFGVDKFGRRKLLIQAAVQMLIAQVVVGSILAHYLKATNVIPKPL  383

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +V+  IC++VM FAWSWGPL WLIPSEIFPLETRTAGF  AVSTNM+ TF+IAQ FL+
Sbjct  384   AYLVLCFICVFVMGFAWSWGPLGWLIPSEIFPLETRTAGFFVAVSTNMIFTFLIAQVFLT  443

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M+A IFFFF+ WIV MG F  F +PETKG+P+D M E+VWK+H  W +FF SD
Sbjct  444   MLCQMRAAIFFFFAFWIVLMGSFAVFLLPETKGIPIDEMNERVWKKHWFWHRFFDSD  500



>ref|XP_003558480.1| PREDICTED: sugar transport protein 13-like [Brachypodium distachyon]
Length=517

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 227/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA ML LG+L +++TP SL+ERG+++EGKA LKR+RG +NVE EF  IV    
Sbjct  203   SLSLAGIPAGMLTLGALFVTDTPNSLIERGRLDEGKAVLKRIRGTDNVEPEFNEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  263   IAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNV++T VS+Y VD+ GRR LLL+  +QM +SQ+ + ++L   +   + +L   
Sbjct  323   AVITGAVNVVSTLVSVYCVDRVGRRVLLLEAGVQMFLSQVVIAVVLGIKVTDRSDNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C YV +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAVLVVVMVCTYVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFLIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW++ M +FV FF+PETK VP++ M EKVWKQH  W+++   D
Sbjct  443   SMLCHLKYAIFIFFSAWVLVMSVFVLFFLPETKNVPIEEMTEKVWKQHWFWKRYMDHD  500



>ref|XP_004134452.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
 gb|KGN57000.1| hypothetical protein Csa_3G149310 [Cucumis sativus]
Length=526

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 230/298 (77%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ +TP SL+ERG++EEGKA LK++RG +NVEAEF  +V    
Sbjct  207   SLGLAGIPAGLLTLGALMVVDTPNSLIERGRMEEGKAVLKKIRGTDNVEAEFLELVEASR  266

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  267   VAREIKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFKSSASLYS  326

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNV +T +SIY+VDK GRR LLL+  +QM ISQ+ + I+L   +   + +L K+
Sbjct  327   AVITGAVNVASTVISIYSVDKVGRRMLLLEAGVQMFISQLMIAIVLGIKVNDHSDNLTKS  386

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +T+VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  387   FATLVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  446

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS+W++ M +FV F +PETK VP++ M E+VWK+H  W++F   D
Sbjct  447   SMLCHLKFGIFLFFSSWVLIMSVFVLFLLPETKNVPIEEMTEQVWKRHWFWKRFVEED  504



>ref|XP_006649643.1| PREDICTED: sugar transport protein 13-like [Oryza brachyantha]
Length=515

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 227/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L + +TP SL+ERG++EEGKA L+++RG +NVE EF  IV    
Sbjct  202   SLSLAGIPAALLTLGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNVEPEFNEIVEASR  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQVFQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  262   VAQEVKHPFRNLLQRRNRPQLVIAVLLQVFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  322   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDRSDNLGHG  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  382   WAILVVVMVCTFVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW+V M +FV FF+PETK VP++ M E+VW QH  W++F   D
Sbjct  442   SMLCHLKYAIFAFFSAWVVVMSIFVLFFLPETKNVPIEEMTERVWMQHWYWKRFMDGD  499



>ref|XP_003610701.1| Hexose transporter [Medicago truncatula]
 gb|AES93659.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=521

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G++V+ +TP SL+ERG++EEGKA LK++RG +N+E EF  +     
Sbjct  204   SLGLAGIPALLLTVGAIVVVDTPNSLIERGRLEEGKAVLKKIRGTDNIEPEFLELCEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLIIS+ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  264   VAKEVKHPFRNLLKRKNRPQLIISIALQIFQQFTGINAIMFYAPVLFNTVGFKNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  324   AVITGAVNVLSTIVSIYFVDKLGRRMLLLEAGVQMFLSQIVIAIILGIKVTDHSDDLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVIL+C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  NML TF+IAQAFL
Sbjct  384   YAIFVVILVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M +FV F VPETK +P++ M E+VWKQH  W++F   D
Sbjct  444   SMLCHFKFGIFLFFSGWVLIMSIFVLFLVPETKNIPIEEMTERVWKQHWFWKRFMEDD  501



>ref|XP_003592418.1| Hexose transporter [Medicago truncatula]
 gb|AES62669.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=499

 Score =   362 bits (929),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 221/296 (75%), Gaps = 1/296 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL  A +PAVML +GSL++ +TP SL+ERG  E+GKA L+++RGVEN+E EFE I+    
Sbjct  204   SLAGAIIPAVMLTVGSLIVDDTPNSLIERGFEEKGKAVLRKIRGVENIEPEFEDILRASK  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK PFK L K    P LII++ +QVFQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  264   VANEVKSPFKDLVKSHNLPPLIIAICMQVFQQFTGINAIMFYAPVLFNTLGFHNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             S+ITG VNVL T VS+Y VDK GRR LLL+ C+QM +SQ+ +G++L   +   + SL K 
Sbjct  324   SVITGGVNVLCTLVSVYFVDKVGRRVLLLEACVQMFVSQVVIGVVLGMKVTDHSDSLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TNML TF+IAQAFL
Sbjct  384   YAMLVVVMVCTFVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVFTNMLFTFLIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFR  291
             SM+C ++  IF FFSAW+  MG+F  FF+PETK +P++ M EKVWKQH  W++F  
Sbjct  444   SMLCHLKFGIFLFFSAWVFVMGVFTVFFIPETKNIPIEDMAEKVWKQHWFWKRFMH  499



>emb|CDO99036.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 226/303 (75%), Gaps = 2/303 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ +TP SL+ERG++EEGKA L+++RG +N+E E+E ++    
Sbjct  203   SLGLAGIPAGLLTLGALIVVDTPNSLIERGRLEEGKAVLRKIRGTDNIEPEYEELLEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L  +  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF T+GF  N SL S
Sbjct  263   VAKQVKHPFRNLLMRRNRPQLVIAVALQIFQQFTGINAIMFYAPVLFNTVGFGGNASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM ISQ+ + IIL   +K  + SL   
Sbjct  323   AVITGAVNVLSTLVSIYSVDKVGRRMLLLEAGVQMFISQVVIAIILGIKVKDHSESLSHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVIL+C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   WAIFVVILVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M LFVFF +PETK VP++ M E+VWKQH +W+ F   DV 
Sbjct  443   SMLCHFKFGIFLFFSGWVLIMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKNFM-DDVH  501

Query  278   SYE  270
               E
Sbjct  502   PGE  504



>ref|XP_004511353.1| PREDICTED: sugar transport protein 13-like [Cicer arietinum]
Length=526

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L++ +TP SL+ERGK+E+GK  L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGIPALLLTVGALLVVDTPNSLIERGKLEQGKVVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+IS+ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  265   IAKEVKHPFRNLLKRKNRPQLVISIALQIFQQFTGINAIMFYAPVLFNTLGFKNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRRKLLL+  +QM ++Q+ + IIL   +   +  L K 
Sbjct  325   AVITGAVNVLSTMVSIYSVDKVGRRKLLLEAGVQMFLAQVVIAIILGIKVTDHSDDLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVI++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   YAIFVVIMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M  FVFF VPETK +P++ M E+VWKQH  W++F   D
Sbjct  445   SMLCHFKYGIFLFFSGWVLIMSFFVFFLVPETKNIPIEEMTERVWKQHWYWKRFIEDD  502



>ref|NP_001049396.1| Os03g0218400 [Oryza sativa Japonica Group]
 gb|ABF94668.1| Sugar carrier protein C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11310.1| Os03g0218400 [Oryza sativa Japonica Group]
 dbj|BAG91313.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=515

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 228/302 (75%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L + +TP SL+ERG++EEGKA L+++RG +NVE EF  IV    
Sbjct  201   SLSLAGIPAALLTLGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNVEPEFNEIVEASR  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  261   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKTDASLYS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  321   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDRSDNLGHG  380

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  381   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  440

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFSAW+V M LFV FF+PETK +P++ M E+VWKQH  W++F     +
Sbjct  441   SMLCHLKYAIFAFFSAWVVVMSLFVLFFLPETKNIPIEEMTERVWKQHWFWKRFMDDADK  500

Query  278   SY  273
              +
Sbjct  501   HH  502



>gb|KDP40155.1| hypothetical protein JCGZ_02153 [Jatropha curcas]
Length=528

 Score =   362 bits (930),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L++SETP SL+ERG++EEGK+ L+R+RG + +E EFE +V    
Sbjct  205   SLGLAGIPALLLTVGALLVSETPNSLIERGRLEEGKSVLRRIRGTDRIEPEFEELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF+T+GF  + SL S
Sbjct  265   IAKEVKHPFRNLLKRRNRPQLVIAVALQIFQQFTGINAIMFYAPVLFKTLGFGGDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  IQM +SQ+ + I+L   +   +  L K 
Sbjct  325   AVITGAVNVLSTVVSIYSVDKVGRRVLLLEAGIQMFLSQVIIAIVLGIKVTDHSKDLHKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VVI++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFL
Sbjct  385   FAILVVIMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFAIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH  WR+F   D
Sbjct  445   SMLCHFKYGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWFWRRFMDDD  502



>ref|XP_004296902.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   362 bits (928),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 232/304 (76%), Gaps = 5/304 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +GSL++ +TP SL++RGK+EEGK+ LKR+RG++NV+ E+  IV    
Sbjct  203   SLGLAGIPALLLTVGSLIVVDTPNSLIQRGKLEEGKSVLKRIRGIDNVDPEYLEIVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A ++K PF+ L ++  +P LII++L+QVFQQFTGINAIMFYAPVLFQT+GFK+  SL S
Sbjct  263   LAAEIKDPFRNLLQRRNRPSLIIAILMQVFQQFTGINAIMFYAPVLFQTLGFKSGASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITGLVNVL+T VSI  VDKAGRR LLL+  +QM +SQM V +++   +K  T +L   
Sbjct  323   AVITGLVNVLSTVVSIVIVDKAGRRMLLLEAGVQMFLSQMGVAVVMGLKVKDYTNNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VVILIC +V +FAWSWGPL WLIPSE F LE R+AG + AV TNM  TF+IAQAFL
Sbjct  383   LGILVVILICSFVSSFAWSWGPLGWLIPSETFSLEARSAGQSVAVFTNMFFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C +++ IFFFFSAW++ M LF  F +PETK VP++ M ++VW++H  W++F    + 
Sbjct  443   SMLCTLKSGIFFFFSAWVLLMTLFTIFLIPETKNVPIEEMTDRVWRRHWFWKRF----ID  498

Query  278   SYEM  267
              +EM
Sbjct  499   EWEM  502



>gb|EEE58602.1| hypothetical protein OsJ_09938 [Oryza sativa Japonica Group]
Length=529

 Score =   362 bits (929),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 228/302 (75%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L + +TP SL+ERG++EEGKA L+++RG +NVE EF  IV    
Sbjct  215   SLSLAGIPAALLTLGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNVEPEFNEIVEASR  274

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  275   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKTDASLYS  334

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  335   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDRSDNLGHG  394

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  395   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  454

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFSAW+V M LFV FF+PETK +P++ M E+VWKQH  W++F     +
Sbjct  455   SMLCHLKYAIFAFFSAWVVVMSLFVLFFLPETKNIPIEEMTERVWKQHWFWKRFMDDADK  514

Query  278   SY  273
              +
Sbjct  515   HH  516



>gb|KHN35184.1| Sugar transport protein 13 [Glycine soja]
Length=519

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L LG+L + +TP SL+ERG++EEGK  LK++RG +N+E EF+ +V    
Sbjct  202   SLGLAGIPAVLLTLGALFVVDTPNSLIERGRLEEGKTVLKKIRGTDNIELEFQELVEASR  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+IS+ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  262   VAKEVKHPFRNLLKRRNRPQLVISIALQIFQQFTGINAIMFYAPVLFNTLGFKNDASLYS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  322   AVITGAVNVLSTVVSIYSVDKLGRRMLLLEAGVQMFLSQVVIAIILGIKVTDHSDDLSKG  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  382   IAILVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS W++ M +FV F +PETK VP++ M E+VWKQH  W++F
Sbjct  442   SMLCHFKFGIFLFFSGWVLVMSVFVLFLLPETKNVPIEEMTERVWKQHWFWKRF  495



>ref|XP_003539275.1| PREDICTED: sugar transport protein 13-like [Glycine max]
Length=522

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L LG+L + +TP SL+ERG++EEGK  LK++RG +N+E EF+ +V    
Sbjct  205   SLGLAGIPAVLLTLGALFVVDTPNSLIERGRLEEGKTVLKKIRGTDNIELEFQELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+IS+ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  265   VAKEVKHPFRNLLKRRNRPQLVISIALQIFQQFTGINAIMFYAPVLFNTLGFKNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  325   AVITGAVNVLSTVVSIYSVDKLGRRMLLLEAGVQMFLSQVVIAIILGIKVTDHSDDLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   IAILVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS W++ M +FV F +PETK VP++ M E+VWKQH  W++F
Sbjct  445   SMLCHFKFGIFLFFSGWVLVMSVFVLFLLPETKNVPIEEMTERVWKQHWFWKRF  498



>gb|EEC74774.1| hypothetical protein OsI_10546 [Oryza sativa Indica Group]
Length=529

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 228/302 (75%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L + +TP SL+ERG++EEGKA L+++RG +NVE EF  IV    
Sbjct  215   SLSLAGIPAALLTLGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNVEPEFNEIVEASR  274

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  275   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKTDASLYS  334

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VD+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  335   AVITGAVNVLSTLVSVYSVDRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDRSDNLGHG  394

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  395   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  454

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFSAW+V M LFV FF+PETK +P++ M E+VWKQH  W++F     +
Sbjct  455   SMLCHLKYAIFAFFSAWVVVMSLFVLFFLPETKNIPIEEMTERVWKQHWFWKRFMDGADK  514

Query  278   SY  273
              +
Sbjct  515   HH  516



>gb|AAQ24871.1| monosaccharide transporter 4 [Oryza sativa Japonica Group]
Length=515

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 227/302 (75%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA +L LG+L + +TP SL+ERG++EEGKA L+++RG +NVE EF  IV    
Sbjct  201   SLSLAGIPAALLTLGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNVEPEFNEIVEASR  260

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L ++  +PQL+I+VLLQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  261   VAQEVKHPFRNLLQRRNRPQLVIAVLLQIFQQFTGINAIMFYAPVLFNTLGFKTDASLYS  320

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+ D+ GRR LLL+  +QM +SQ+A+ ++L   +   + +L   
Sbjct  321   AVITGAVNVLSTLVSVYSADRVGRRMLLLEAGVQMFLSQVAIAVVLGIKVTDRSDNLGHG  380

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  381   WAIMVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  440

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFSAW+V M LFV FF+PETK +P++ M E+VWKQH  W++F     +
Sbjct  441   SMLCHLKYAIFAFFSAWVVVMSLFVLFFLPETKNIPIEEMTERVWKQHWFWKRFMDDADK  500

Query  278   SY  273
              +
Sbjct  501   HH  502



>ref|XP_008380302.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=510

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +P+++L LG++++++TP SL++RGK+E+GK  LKR+RG+ENV+ EF  I+    
Sbjct  203   SLGLAGIPSLLLTLGAVIVTDTPNSLIQRGKLEQGKKVLKRIRGIENVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PF+ L K+  +PQLII++ LQ FQQFTGIN+I FYAPVLFQT+GFK + SL S
Sbjct  263   AAXEVKHPFRNLLKRKNRPQLIITIFLQFFQQFTGINSINFYAPVLFQTLGFKNDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG++ VL   +SIY VDKAGRR LL++G IQM +S + V IIL   LK  +  LD  
Sbjct  323   SVITGVIMVLGAIISIYFVDKAGRRVLLIEGGIQMFLSHVVVAIILGMKLKDQSNDLDHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VVI++C +V +F WSWGPLCWL+ SEIFPLE R+AG +  VS NML TF+IAQAFL
Sbjct  383   LGILVVIVVCSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVSVNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AW+  M +FVFF +PETKGVP++ MV+ VW++H  W+++
Sbjct  443   SMLCHMKFAIFLFFAAWVFLMTVFVFFLLPETKGVPIEEMVDVVWREHWYWKRY  496



>ref|XP_003517581.1| PREDICTED: sugar transport protein 13 [Glycine max]
 gb|KHN30468.1| Sugar transport protein 13 [Glycine soja]
Length=522

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L LG+L + +TP SL+ERG++EEGK  LK++RG +N+E EF+ ++    
Sbjct  205   SLGLAGIPAVLLTLGALFVVDTPNSLIERGRLEEGKTVLKKIRGTDNIELEFQELLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+ISV LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  265   VAKEVKHPFRNLLKRRNRPQLVISVALQIFQQFTGINAIMFYAPVLFNTLGFKNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  325   AVITGAVNVLSTVVSIYSVDKVGRRILLLEAGVQMFLSQVVIAIILGIKVTDHSDDLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   IAILVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS W++ M +FV F +PETK VP++ M E+VWKQH  W++F
Sbjct  445   SMLCHFKFGIFLFFSGWVLVMSVFVLFLLPETKNVPIEEMTERVWKQHWFWKRF  498



>ref|XP_010108003.1| Sugar transport protein 13 [Morus notabilis]
 gb|EXC17568.1| Sugar transport protein 13 [Morus notabilis]
Length=507

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 225/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAVML +GS+++ +TP SL+ERG++EEGKA L+++RG +N+E EF  IV    
Sbjct  206   SLGLAGVPAVMLTVGSILVVDTPNSLIERGRLEEGKAVLRKIRGTDNIEPEFFDIVEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              +K+VK PF+ L K+  +PQLII++ +QVFQQ TGIN+IMFYAPVLF T+GF  + SL S
Sbjct  266   ISKEVKHPFRSLLKRRNRPQLIIAIFMQVFQQCTGINSIMFYAPVLFSTLGFGGDASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ  + ++L   L+  +  + + 
Sbjct  326   AVITGAVNVLSTVVSIYSVDKIGRRALLLEAGVQMFVSQTVIAVVLGLKLRDNSDDMSRG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VVI++C +V +FAWSWGPL WL+PSEIFPLETR+AG +  V  NML TFIIAQAFL
Sbjct  386   LAVLVVIMVCTFVSSFAWSWGPLGWLVPSEIFPLETRSAGQSVTVCVNMLFTFIIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M LFV F +PETK VP++ M E+VWKQH  W+++   +
Sbjct  446   SMLCHFKFGIFLFFSGWVLVMSLFVMFLLPETKNVPIEEMTERVWKQHWFWKRYMDDN  503



>ref|XP_003536538.1| PREDICTED: sugar transport protein 13-like isoform 1 [Glycine 
max]
 gb|KHN02704.1| Sugar transport protein 13 [Glycine soja]
Length=500

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 225/297 (76%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             S+ LA +PA+ML  GSL++ +TP SL+ERG  +EGKA LK++RGVENVE EF+ I+    
Sbjct  204   SVALAGIPAIMLTFGSLLVHDTPNSLIERGLEDEGKAVLKKIRGVENVEPEFQEILKASK  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K+  +P LII+V++QVFQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  264   VAKAVKNPFQNLLKRHNRPPLIIAVMMQVFQQFTGINAIMFYAPVLFSTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VS+Y VDKAGRR LLL+ C+QM +SQM +G +L   ++  + SL+K 
Sbjct  324   AVITGAVNVLSTLVSVYFVDKAGRRMLLLEACVQMFVSQMVIGTVLGLKVQDHSDSLNKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG +  V TNML TFIIAQ FL
Sbjct  384   LGVLVVVMVCTFVASFAWSWGPLGWLIPSETFPLEARSAGQSVTVFTNMLFTFIIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SMMC ++  IFFFFSAW++AM +F    +PETK +P++ M +KVW+ H  W+ +   
Sbjct  444   SMMCHLKFGIFFFFSAWVLAMAIFTVLLIPETKNIPIEEMTDKVWRNHWFWKSYMED  500



>ref|XP_004496749.1| PREDICTED: sugar transport protein 13-like [Cicer arietinum]
Length=503

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 218/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL  A VPAVML LGS+++ +TP SL+ERGK EEGKA LK++RGVENV+ EF  I+    
Sbjct  205   SLAGAGVPAVMLTLGSIIVDDTPNSLIERGKEEEGKAVLKKIRGVENVDPEFHDILKASK  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              +  VK PFK L K   +P L I++ +QVFQQFTGINAIMFYAPVLF T+GF +  SL S
Sbjct  265   VSVAVKSPFKDLLKPHNRPPLTIAIFMQVFQQFTGINAIMFYAPVLFNTLGFHSEASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG VNVL+T VS+Y VDK GR+ LLL+ C+QM +SQ+ +G +L   L+  + SL K 
Sbjct  325   SVITGGVNVLSTLVSVYFVDKVGRKVLLLEACVQMFVSQVVIGTVLGLKLQDHSDSLGKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+L+C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TNML TFIIAQAFL
Sbjct  385   YAMLVVVLVCTFVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVFTNMLFTFIIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C ++  IF FFSAW+    LF  F +PETK VP++ M EKVWKQH  W+K+
Sbjct  445   SMLCTLKFGIFLFFSAWVFVASLFTVFLIPETKNVPIEDMAEKVWKQHWFWKKY  498



>ref|XP_009394723.1| PREDICTED: sugar transport protein 13-like [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   360 bits (924),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 227/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA++L +G+L++ +TP SL+ERG++EEGKA LK++RG ENVE E+  I+    
Sbjct  203   SLSLAGIPALLLTVGALLVVDTPNSLIERGRLEEGKAVLKKIRGTENVEPEYNEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+ L ++  +PQLII++ LQ+FQQFTGINAIMFYAPVLF T+GFK++ +L S
Sbjct  263   IAHQVKHPFRNLLQRRNRPQLIIAIFLQIFQQFTGINAIMFYAPVLFNTLGFKSDAALYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VD+ GRR LLL+  +QM +SQ+ + ++L   +   + +L + 
Sbjct  323   AVITGAVNVLSTVVSIYSVDRVGRRVLLLEAGVQMFLSQVVIAVVLGLKVSDHSDNLGRG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  383   YAIFVVLMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFSAW+V M +FV FF+PETK VP++ M EKVWKQH  W++F   D
Sbjct  443   SMLCHLKYGIFAFFSAWVVVMSVFVLFFLPETKNVPIEEMAEKVWKQHWFWKRFIADD  500



>ref|XP_004296901.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 223/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPAVML LGSL++ +TP SL+ RGK+ EGKAALK++RGV NVE E+  IV    
Sbjct  205   SLGLAGVPAVMLTLGSLIVVDTPNSLIARGKLVEGKAALKKIRGVSNVEPEYLEIVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK P K L K+  +PQL+I+V +Q+FQQ TGINAIMFYAPVLF T+GFK++ SL S
Sbjct  265   VASEVKHPMKNLLKRRNRPQLVIAVCMQIFQQVTGINAIMFYAPVLFSTVGFKSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG VNVL+T VSIY+VD+ GRR LLLQ  +QM ISQ+ V ++L   +K  + SL   
Sbjct  325   SVITGAVNVLSTCVSIYSVDRLGRRMLLLQAGVQMFISQIVVAVVLGIKVKDHSESLTPG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V  FAWSWGPL WLIPSE FPLETR+AG +  V  NM+ TFIIAQAFL
Sbjct  385   LALLVVVMVCTFVAGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFIIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFSAW++ M +FV   +PETK VP++ M ++VW+QH  WR+F   D
Sbjct  445   SMLCHFKFGIFLFFSAWVLVMSVFVLILLPETKNVPIEEMTDRVWRQHWYWRRFMDDD  502



>ref|XP_007157147.1| hypothetical protein PHAVU_002G046800g [Phaseolus vulgaris]
 gb|ESW29141.1| hypothetical protein PHAVU_002G046800g [Phaseolus vulgaris]
Length=522

 Score =   359 bits (922),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 225/303 (74%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +G+L++ +TP SL+ERG++EEGKA LK++RG +N+E EF  +V    
Sbjct  205   SLGLAGIPAVLLTVGALLVVDTPNSLIERGRLEEGKAVLKKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQ++IS+ LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   VAKEVKHPFRNLLKRRNRPQIVISIALQIFQQFTGINAIMFYAPVLFSTVGFGNDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +K  +  L K 
Sbjct  325   AVITGAVNVLSTVVSIYSVDKLGRRLLLLEAGVQMFLSQVVIAIILGIKVKDDSNDLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+L+C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAVLVVVLVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W+  M  FV F +PETK VP++ M E+VWKQH  W++F   D  
Sbjct  445   SMLCHFKFGIFLFFSGWVFIMSFFVLFLLPETKNVPIEEMTERVWKQHWFWKRFIDDDYT  504

Query  278   SYE  270
             + E
Sbjct  505   ADE  507



>ref|XP_002517216.1| sugar transporter, putative [Ricinus communis]
 gb|EEF45379.1| sugar transporter, putative [Ricinus communis]
Length=530

 Score =   359 bits (922),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 229/308 (74%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L++SETP SL+ERG+++EGKA L+R+RG + +E EF  +V    
Sbjct  205   SLGLAGIPALLLTVGALLVSETPNSLIERGRLDEGKAVLRRIRGTDKIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK VK PF+ L K+  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   AAKAVKHPFRNLMKRRNRPQLVIAVALQIFQQFTGINAIMFYAPVLFDTVGFGSDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNV++T VSIY+VDK GRR LLL+  IQM ISQ+ + IIL   +   +  L K 
Sbjct  325   AVITGAVNVVSTVVSIYSVDKLGRRVLLLEAGIQMFISQVIIAIILGIKVTDHSDDLSKA  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAIIVVVMVCGFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FVFF +PETK VP++ M E+VWKQH  W++F    + 
Sbjct  445   SMLCHFKFGIFLFFSGWVLIMSFFVFFLLPETKNVPIEEMTERVWKQHWFWKRF----MD  500

Query  278   SYEMA*IE  255
              YE   IE
Sbjct  501   DYEDGAIE  508



>ref|XP_008438688.1| PREDICTED: sugar transport protein 13-like [Cucumis melo]
Length=511

 Score =   358 bits (920),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA++L LG+ ++ +TP SL+ERG +EEGKA LK++RG ENVE E+  I+    
Sbjct  206   SLALAGIPALLLTLGAFLVDDTPNSLIERGHLEEGKAVLKKIRGTENVEPEYLEILEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PFK L  +  +P L+I++LLQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  266   IAQEVKHPFKNLRMRQNRPPLVIAILLQIFQQFTGINAIMFYAPVLFNTLGFGNDASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM ISQM + ++L   L+  T ++   
Sbjct  326   AVITGAVNVLSTLVSIYSVDKIGRRMLLLEAGVQMFISQMIIAVVLGVKLQDNTNNMSHG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWS+GPL WLIPSE FPLETR+AG +  V  NML TF+IAQ+FL
Sbjct  386   LAIVVVLMVCTFVSSFAWSFGPLGWLIPSETFPLETRSAGQSVTVCVNMLFTFVIAQSFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FFSAW++ M LFV F +PETKGVP++ M EKVWKQH  W+++
Sbjct  446   SMLCYMKFGIFLFFSAWVLVMSLFVMFLLPETKGVPIEEMTEKVWKQHWFWKRY  499



>ref|XP_008222844.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=511

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA++L +GSL++++TP SL+ RGK+EEGKA LK++RGV+NVE EF  IV    
Sbjct  204   SLGLAAIPALLLTMGSLIVTDTPNSLIARGKMEEGKAILKKIRGVDNVEPEFVEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PF+ L K+  +PQL+I++ +Q+FQQ TGINAIMFYAPVLF+T+GFK++ SL S
Sbjct  264   AANEVKHPFRNLLKRRNRPQLVIAICMQIFQQLTGINAIMFYAPVLFKTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTT-GSLDKT  639
             S ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ + ++L   LK    +L   
Sbjct  324   SAITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQIVITVVLGIKLKDDVNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V++ +C +V +FAWSWGPL WLIPSEIF L+ R+AG + AV  NML TFIIAQAFL
Sbjct  384   LGILVLVFVCSFVASFAWSWGPLGWLIPSEIFALDARSAGQSVAVFFNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+ W+ AM LF  F +PETKGVP++ M E+VWK+H  W+++
Sbjct  444   SMLCHMKFAIFLFFAIWVFAMTLFALFLIPETKGVPIEEMTERVWKKHWFWKRY  497



>ref|XP_003592419.1| Hexose transporter [Medicago truncatula]
Length=562

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 220/296 (74%), Gaps = 1/296 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL  A +PAVML +GSL++ +TP SL+ERG  E+GKA L ++RGVEN+E EFE I+    
Sbjct  205   SLAGAIIPAVMLTMGSLIVDDTPNSLIERGFEEKGKAVLTKIRGVENIEPEFEDILRASK  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK PFK L K   +P LII++ +QVFQQ TGINAIMFYAPVLF T+GF  + SL S
Sbjct  265   VANEVKSPFKDLVKSHNRPPLIIAICMQVFQQCTGINAIMFYAPVLFSTLGFHNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG VNVL T VS+Y VDKAGRR LLL+ C+QM +SQ+ +GI+L   L+  + SL K 
Sbjct  325   SVITGGVNVLCTLVSVYFVDKAGRRVLLLEACVQMFVSQVVIGIVLGAKLQDHSDSLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TNML TF+IAQAFL
Sbjct  385   YAMLVVVMVCTFVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVFTNMLFTFLIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFR  291
             S++C  +  IF FFSAW+  MG+F  F +PETK +P++ M E VWKQH  WR+F R
Sbjct  445   SLLCLFKFGIFLFFSAWVFVMGVFTVFLIPETKNIPIEDMAETVWKQHWFWRRFMR  500



>gb|AES62670.2| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=500

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 219/296 (74%), Gaps = 1/296 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL  A +PAVML +GSL++ +TP SL+ERG  E+GKA L ++RGVEN+E EFE I+    
Sbjct  205   SLAGAIIPAVMLTMGSLIVDDTPNSLIERGFEEKGKAVLTKIRGVENIEPEFEDILRASK  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK PFK L K   +P LII++ +QVFQQ TGINAIMFYAPVLF T+GF  + SL S
Sbjct  265   VANEVKSPFKDLVKSHNRPPLIIAICMQVFQQCTGINAIMFYAPVLFSTLGFHNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG VNVL T VS+Y VDKAGRR LLL+ C+QM +SQ+ +GI+L   L+  + SL K 
Sbjct  325   SVITGGVNVLCTLVSVYFVDKAGRRVLLLEACVQMFVSQVVIGIVLGAKLQDHSDSLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TNML TF+IAQAFL
Sbjct  385   YAMLVVVMVCTFVASFAWSWGPLGWLIPSETFPLETRSAGQSVTVFTNMLFTFLIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFR  291
             S++C  +  IF FFSAW+  MG+F  F +PETK +P++ M E VWKQH  WR+F  
Sbjct  445   SLLCLFKFGIFLFFSAWVFVMGVFTVFLIPETKNIPIEDMAETVWKQHWFWRRFMH  500



>ref|XP_008222938.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=511

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA++L +GSL++++TP SL+ RGK+EEGKA LK++RGV+NVE EF  IV    
Sbjct  204   SLGLAAIPALLLTMGSLIVTDTPNSLIARGKMEEGKAILKKIRGVDNVEPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PF+ L K+  +PQL+I++ +Q+FQQ TGINAIMFYAPVLF+T+GFK++ SL S
Sbjct  264   AANEVKHPFRNLLKRRNRPQLVIAICMQIFQQLTGINAIMFYAPVLFKTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTT-GSLDKT  639
             S ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ + ++L   LK    +L   
Sbjct  324   SAITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQIVITVVLGIKLKDDVNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V++ +C +V +FAWSWGPL WLIPSEIF L+ R+AG + AV  NML TFIIAQAFL
Sbjct  384   LGILVLVFVCSFVASFAWSWGPLGWLIPSEIFALDARSAGQSVAVFFNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+ W+ AM LF  F +PETKGVP++ M E+VWK+H  W+++
Sbjct  444   SMLCHMKFAIFLFFAIWVFAMTLFALFLIPETKGVPIEEMTERVWKKHWFWKRY  497



>ref|XP_010277661.1| PREDICTED: sugar transport protein 13-like [Nelumbo nucifera]
Length=534

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L  G+L + +TP SL+ERG +EEGKA L+++RG +N+E EF+ ++    
Sbjct  205   SLGLAGIPAFLLTAGALFVVDTPNSLIERGYLEEGKAVLRKIRGTDNIEPEFQELLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L K+  +PQ++I++ LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  265   VAKQVKHPFRNLLKRRNRPQMVIAIALQIFQQFTGINAIMFYAPVLFSTLGFHNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNV +T VSIYTVDK GRR LLL+  +QM +SQ+ + ++L   +   + +L K 
Sbjct  325   AVITGAVNVASTVVSIYTVDKVGRRILLLEAGVQMFLSQVVIAVLLGIKVTDHSDNLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  NML TF+IAQAFL
Sbjct  385   YAILVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C M+  IF FFS W+V M LFV F VPETK +P++ M E+VWKQH  W++F   D
Sbjct  445   SMLCHMKYGIFLFFSGWVVIMSLFVLFLVPETKNIPIEEMTERVWKQHWFWKRFMDGD  502



>ref|XP_009411272.1| PREDICTED: sugar transport protein 13-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 223/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA++L +G+L + +TP SL+ERG++EEGKA LK++RG +NVE EF  I+    
Sbjct  202   SLSLAGVPALLLTVGALFVVDTPNSLIERGRLEEGKAVLKKIRGTDNVEPEFNEILEASR  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+ L K+  +PQL+I++L Q+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  262   VAHQVKHPFRNLLKRRNRPQLVIAILFQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VD+ GRR LLL+  +QM ISQ+ + I+L   +   + +L   
Sbjct  322   AVITGAVNVLSTVVSIYSVDRVGRRILLLEAGVQMFISQVVIAIVLGIKVTDRSENLSHG  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+++C +V +FAWSWGPL WLIPSE FP+ETR+AG +  V  N+L TF+IAQAFL
Sbjct  382   YAIFVVVMVCTFVSSFAWSWGPLGWLIPSETFPMETRSAGQSVTVCVNLLFTFVIAQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C ++  IF FFS W+V M +FV FF+PETK VP++ M EKVWKQH  W++F
Sbjct  442   SMLCHLKYGIFAFFSGWVVVMSVFVLFFLPETKNVPIEEMTEKVWKQHWFWKRF  495



>ref|XP_008801700.1| PREDICTED: sugar transport protein 13 [Phoenix dactylifera]
Length=517

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 223/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PAV+L +G+L + +TP SL+ERG++EEGKA L+++RG +N+E EF  I+    
Sbjct  204   SLSLAGIPAVLLTVGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNIEPEFNEILEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ L K+   PQL I++LLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  264   IAQQVKHPFRNLLKRRNIPQLTIAILLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VD+ GRR LLL+  +QM +SQ+ + +IL   +   + +L   
Sbjct  324   AVITGAVNVLSTVVSIYSVDRVGRRVLLLEAGVQMFLSQVVISVILGIKVTDHSDNLSHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  384   YAVFVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSITVCVNLLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS W+V M LFV F +PETK VP++ M E+VWKQH  W++F   D
Sbjct  444   SMLCHLKYGIFAFFSGWVVVMSLFVLFLLPETKNVPIEEMTERVWKQHWFWKRFMDDD  501



>ref|XP_007223245.1| hypothetical protein PRUPE_ppa004424mg [Prunus persica]
 gb|EMJ24444.1| hypothetical protein PRUPE_ppa004424mg [Prunus persica]
Length=511

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA++L +GSL++++TP SL+ RGK+EEGKA LK++RGV+NVE EF  IV    
Sbjct  204   SLGLAAIPALLLTMGSLIVTDTPNSLIARGKMEEGKAILKKIRGVDNVEPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PF+ L K+  +PQL+I++ +Q+FQQ TGINAIMFYAPVLF+T+GFK++ SL S
Sbjct  264   AANEVKHPFRNLLKRRNRPQLVIAICMQIFQQLTGINAIMFYAPVLFKTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTT-GSLDKT  639
             S ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ + ++L   LK    +L   
Sbjct  324   SAITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQIVITVVLGIKLKDDVNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V++ +C +V +FAWSWGPL WLIPSEIF L+ R+AG + AV  NML TFIIAQAFL
Sbjct  384   LGILVLVFVCSFVASFAWSWGPLGWLIPSEIFALDARSAGQSVAVFFNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M   IF FF+ W+ AM LF  F +PETKGVP++ M E+VWK+H  W+++
Sbjct  444   SMLCHMMFAIFLFFAIWVFAMTLFTLFLIPETKGVPIEEMTERVWKKHWFWKRY  497



>ref|XP_007221814.1| hypothetical protein PRUPE_ppa004132mg [Prunus persica]
 gb|EMJ23013.1| hypothetical protein PRUPE_ppa004132mg [Prunus persica]
Length=528

 Score =   358 bits (919),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 221/294 (75%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +G+L++ ETP SLVERG +EEGKA L+R+RG +NVE EF  +V    
Sbjct  204   SLGLAGLPAGLLTVGALLVVETPNSLVERGLLEEGKAVLRRIRGTDNVEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  264   IAKEVKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFGNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNV++T VSIY+VDK GRR LLLQ  +QM +SQ+ + +IL   +K  +  L K 
Sbjct  324   AVITGAVNVVSTVVSIYSVDKVGRRMLLLQAGVQMFLSQVVIAVILGLKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+L+C YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQ FL
Sbjct  384   FAIFVVVLVCTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFVIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F
Sbjct  444   SMLCHFKFGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRF  497



>ref|NP_198006.1| sugar transport protein 13 [Arabidopsis thaliana]
 sp|Q94AZ2.2|STP13_ARATH RecName: Full=Sugar transport protein 13; AltName: Full=Hexose 
transporter 13; AltName: Full=Multicopy suppressor of snf4 
deficiency protein 1 [Arabidopsis thaliana]
 gb|AAG10146.1|AF250340_1 putative hexose transporter MSS1 [Arabidopsis thaliana]
 gb|AAC26243.1| contains similarity to sugar transporters (Pfam: sugar_tr.hmm, 
score: 395.39) [Arabidopsis thaliana]
 gb|AAK96596.1| AT5g26340/F9D12_17 [Arabidopsis thaliana]
 emb|CAC69074.1| STP13 protein [Arabidopsis thaliana]
 gb|AED93553.1| sugar transport protein 13 [Arabidopsis thaliana]
Length=526

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 228/303 (75%), Gaps = 2/303 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  205   SLGLAGIPALLLTVGALLVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +  T+ +L K 
Sbjct  325   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGVKVTDTSTNLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  385   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFSAW++ M +FV F +PETK +P++ M E+VWK+H  W +F   D  
Sbjct  445   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNIPIEEMTERVWKKHWFWARFM-DDHN  503

Query  278   SYE  270
              +E
Sbjct  504   DHE  506



>ref|XP_007223242.1| hypothetical protein PRUPE_ppa004417mg [Prunus persica]
 gb|EMJ24441.1| hypothetical protein PRUPE_ppa004417mg [Prunus persica]
Length=511

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA++L +GSL++++TP SL+ RGK+EEGKA LK++RGV+NVE EF  IV    
Sbjct  204   SLGLAAIPALLLTMGSLIVTDTPNSLIARGKMEEGKAILKKIRGVDNVEPEFLEIVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA +VK PF+ L K+  +PQL+I++ +Q+FQQ TGINAIMFYAPVLF+T+GFK++ SL S
Sbjct  264   AANEVKHPFRNLLKRRNRPQLVIAICMQIFQQLTGINAIMFYAPVLFKTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTT-GSLDKT  639
             S ITG VNVL+T VSIY VD+AGRR LLL+  +QM +SQ+ + ++L   LK    +L   
Sbjct  324   SAITGAVNVLSTVVSIYFVDRAGRRVLLLEAGVQMFLSQIVITVVLGIKLKDDVNNLGHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V++ +C +V +FAWSWGPL WLIPSEIF L+ R+AG + AV  NML TFIIAQAFL
Sbjct  384   LGILVLVFVCSFVASFAWSWGPLGWLIPSEIFALDARSAGQSVAVFFNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M   IF FF+ W+ AM LF  F +PETKGVP++ M E+VWK+H  W+++
Sbjct  444   SMLCHMMFGIFLFFAIWVFAMTLFTLFLIPETKGVPIEEMTERVWKKHWFWKRY  497



>ref|XP_010108002.1| Sugar transport protein 13 [Morus notabilis]
 gb|EXC17567.1| Sugar transport protein 13 [Morus notabilis]
Length=530

 Score =   358 bits (918),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +G+L++ +TP SL+ERG +EEGKA L+++RG +NVE EF  +V    
Sbjct  203   SLGLAGIPAGLLTIGALLVVDTPNSLIERGHMEEGKAVLRKIRGTDNVEPEFLELVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L K+  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ SL S
Sbjct  263   IAKLVKHPFRNLIKRKNRPQLVIAVSLQIFQQFTGINAIMFYAPVLFSTLGFGSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+   QM +SQ+ + IILA  +  T+  L K 
Sbjct  323   AVITGAVNVLSTVVSIYSVDKVGRRMLLLEAGAQMFLSQVVIAIILAIKVTDTSNDLGKV  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+LIC YV +FAWSWGPL WLIPSEIFPLETR+AG +  V  N+L TF+IAQ+FL
Sbjct  383   WAILVVVLICTYVSSFAWSWGPLGWLIPSEIFPLETRSAGQSVTVCVNLLFTFVIAQSFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C ++  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W+++
Sbjct  443   SMLCHLKYGIFLFFSGWVLIMSFFVMFLLPETKNIPIEEMTERVWKQHWLWKRY  496



>ref|XP_009594387.1| PREDICTED: sugar transport protein 13, partial [Nicotiana tomentosiformis]
Length=327

 Score =   351 bits (900),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 219/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A  PA++L LG++ + +TP SL+ERG +EEGK  L+++RG +N+E EF  +V    
Sbjct  9     SLGIAGFPALLLTLGAIFVVDTPNSLIERGHLEEGKNVLRKIRGTDNIEPEFLELVEASR  68

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  69    IAKEVKHPFRNLLQRRNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGNSAALYS  128

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM+ISQ+ V IIL   +   + +L   
Sbjct  129   AVITGAVNVLSTVVSVYSVDKLGRRILLLEAGVQMLISQVVVAIILGIKVTDHSDNLSHG  188

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  189   WGIFVVVIICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  248

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF +PETK VP++ M E+VWKQH +W+++
Sbjct  249   SMLCHFKYGIFLFFSGWIFVMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKRY  302



>ref|XP_010454987.1| PREDICTED: sugar transport protein 13 isoform X1 [Camelina sativa]
 ref|XP_010454988.1| PREDICTED: sugar transport protein 13 isoform X2 [Camelina sativa]
Length=525

 Score =   358 bits (918),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 225/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  204   SLGLAGIPALLLTVGALMVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  264   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFNTLGFGSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  324   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSTNLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  384   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M E+VWK+H  W +F   D
Sbjct  444   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNVPIEEMTERVWKKHWFWARFMDDD  501



>dbj|BAO45901.1| hexose transporter [Acacia mangium]
Length=524

 Score =   357 bits (916),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L + +TP SL+ERG +++GKA LK++RG +NVE EF  +V    
Sbjct  205   SLGLAGIPAALLTLGALFVVDTPNSLIERGHLDQGKAVLKKIRGTDNVEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L K+  +PQL+I++ LQ+FQQFTGINAIMFYAPVLF T+GFK + SL S
Sbjct  265   IAQEVKHPFRNLLKRRNRPQLVIAIALQIFQQFTGINAIMFYAPVLFNTLGFKNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +   +  L K 
Sbjct  325   AVITGAVNVLSTIVSIYSVDKVGRRMLLLEAGVQMFLSQVVISIILGIKVTDHSDDLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAILVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M  FV F +PETK VP++ M E+VWKQH +W++F   D
Sbjct  445   SMLCHFKFGIFLFFSGWVLIMSCFVLFLLPETKNVPIEEMTERVWKQHWLWKRFMEDD  502



>ref|XP_010421503.1| PREDICTED: sugar transport protein 13-like [Camelina sativa]
Length=525

 Score =   357 bits (915),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  204   SLGLAGIPALLLTVGALMVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  264   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFNTLGFGSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ  + IIL   +   + +L K 
Sbjct  324   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQFVIAIILGIKVTDHSTNLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  384   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M E+VWK+H  W +F   D
Sbjct  444   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNVPIEEMTERVWKKHWFWARFMDDD  501



>ref|XP_009364267.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=503

 Score =   356 bits (913),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L LGSL++ +TP SL++RGK++EG+A LKR+RG ENVEAEF  I+    
Sbjct  200   SLGLAGVPALLLTLGSLIVVDTPNSLIQRGKLDEGRAVLKRIRGTENVEAEFSEILEASS  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK++K PFK L K   +P L+I++ +Q+FQQFTG+NAI+FYAP+LF TMGF  N SL +
Sbjct  260   AAKEIKHPFKNLLKWKNRPPLVIAIAMQIFQQFTGMNAILFYAPILFATMGFGNNASLYA  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++I G VNVLAT VSI+ VDK GRR LLL+  IQM++SQ+ +GI+LA  +K  + +L   
Sbjct  320   AVILGAVNVLATIVSIFLVDKVGRRMLLLEAGIQMLLSQLVIGIVLAFKVKDHSNNLSYG  379

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  NMLC F+I Q FL
Sbjct  380   LAIVVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCMNMLCCFLIGQVFL  439

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
              M+C M+  +F FFSAW++ M LFV F VPETK VP++ M E+VWKQH  W+++
Sbjct  440   LMLCSMKYGVFLFFSAWVLVMSLFVLFLVPETKNVPIEEMTERVWKQHWFWKRY  493



>ref|XP_007223259.1| hypothetical protein PRUPE_ppa004439mg [Prunus persica]
 gb|EMJ24458.1| hypothetical protein PRUPE_ppa004439mg [Prunus persica]
Length=510

 Score =   356 bits (914),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL++RGK++EG++ LK++RG EN+E EF  IV    
Sbjct  206   SLGLAGVPALMLTLGSLIVVDTPNSLIQRGKLDEGRSVLKKIRGTENIETEFAEIVEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA+++K PF+ L K+  +P L+I++ +QVFQQFTGINAI FYAP+LF +MGF  N SL +
Sbjct  266   AAEEIKNPFRNLLKRKNRPPLVIAIAMQVFQQFTGINAIFFYAPILFASMGFGNNASLYA  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVLAT VS++ VDK GRR LLL+  IQM +SQ+ V I+LA  +K  + +L   
Sbjct  326   AVITGAVNVLATIVSVFLVDKVGRRMLLLEAGIQMFLSQIVVAIVLALKVKDHSNNLSYG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             LS +VV+++C +V AFAWSWGP+ WLIPSE FPLE R+AG +  V  NMLC F+I Q FL
Sbjct  386   LSILVVVMVCTFVSAFAWSWGPIGWLIPSETFPLEARSAGQSVTVCVNMLCCFVIGQVFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
              M+C ++  IF FFSAW++ M LFV F +PETK VP++ M E+VWK+H  W+++    
Sbjct  446   LMLCSLKYAIFLFFSAWVLLMSLFVLFLIPETKNVPIEEMTERVWKKHWFWKRYMDDH  503



>ref|XP_006359910.1| PREDICTED: sugar transport protein 13-like [Solanum tuberosum]
Length=523

 Score =   357 bits (915),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 221/294 (75%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PAV+L LG+L + ETP SL+ERG +EEGK  L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGFPAVLLTLGALFVVETPNSLIERGYLEEGKEVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   VAKEVKHPFRNLLQRKNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGSSAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM++SQ+ V IIL   +  T+ +L   
Sbjct  325   AVITGAVNVLSTVVSLYSVDKLGRRFLLLEAGVQMLLSQIIVAIILGIKVTDTSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  385   WGIFVVVMICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF +PETK VP++ M E+VWKQH +W++F
Sbjct  445   SMLCHFKYGIFLFFSGWIFVMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKRF  498



>gb|ABR16571.1| unknown [Picea sitchensis]
Length=529

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 223/293 (76%), Gaps = 0/293 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +GS+ + ETP SL+ERG +E GK  LK++RG  NV+AEF  +V    
Sbjct  204   SLGLAGIPAILLTVGSIFLVETPNSLIERGHLENGKHVLKKIRGTNNVDAEFNELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A  VK PF+ L K+  +PQ++I++ LQ+FQQFTGINAIMFYAPVLFQT+GFK + SL S
Sbjct  264   IAATVKHPFRNLLKRRNRPQIVITICLQIFQQFTGINAIMFYAPVLFQTLGFKNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VNVL+T +SI+ VDK GRR LLL+  +QM ISQ+ + I+LAT LK    L    
Sbjct  324   AVITGAVNVLSTVISIFAVDKVGRRALLLEAGVQMFISQVIIAILLATGLKDGEDLPHAT  383

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + ++V+L+C++V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFLS
Sbjct  384   AIIIVLLVCVFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFAIAQAFLS  443

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C ++  IF FF++W++ M +FV F +PETK +P++ M+E+VW++H +W++F
Sbjct  444   MLCHLKYGIFLFFASWVLVMSVFVLFLLPETKNIPIEEMMERVWRKHWLWKRF  496



>gb|KDO74663.1| hypothetical protein CISIN_1g009833mg [Citrus sinensis]
 gb|KDO74664.1| hypothetical protein CISIN_1g009833mg [Citrus sinensis]
Length=473

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 221/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +GSL++++TP SL+ERG+ EEGKA L+++RG + +E EF  +V    
Sbjct  154   SLGLAGIPAALLTVGSLLVTDTPNSLIERGRFEEGKAVLRKIRGTDKIEPEFLELVEASR  213

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF+T+GF  + SL S
Sbjct  214   IAKEVKHPFRNLLKRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFKTLGFGGSASLYS  273

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  IQM +SQ  + IIL   +K  +  L   
Sbjct  274   TVITGAVNVLSTLVSIYSVDKVGRRMLLLEAGIQMFLSQTVIAIILGIKVKDHSEDLHTG  333

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VVI+IC ++ AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  334   FAVLVVIMICTFISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  393

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M  FVFF +PETK VP++ M E+VWKQH +W+ F   D
Sbjct  394   SMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDD  451



>ref|XP_008390874.1| PREDICTED: sugar transport protein 13-like [Malus domestica]
Length=510

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +P+++L LG++++++TP SL++RGK+E+GK  LKR+RG+ENV+ EF  I+    
Sbjct  203   SLGLAGIPSLLLTLGAIIVTDTPNSLIQRGKLEQGKKVLKRIRGIENVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+VK PF+ L  +  +PQL+I++ LQ FQQFTGIN+I FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVKHPFRNLLNRKNRPQLVITIFLQFFQQFTGINSINFYAPVLFQTLGFKNDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG++ VL   +SI+ VD+AGRR LL++G IQM +S + + IIL   LK  +  LD  
Sbjct  323   SVITGVIMVLGAIISIFFVDRAGRRVLLIEGGIQMFLSHVVIAIILGMKLKDQSNDLDHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VV++IC +V +F WSWGPLCWL+ SEIFPLE R+AG +  V  NML TF+IAQAFL
Sbjct  383   LGILVVVVICSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVCVNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AW+  M +FVFF +PETKGVP++ MVE VW++H  W+++
Sbjct  443   SMLCHMKFAIFLFFAAWVFLMTVFVFFLLPETKGVPIEEMVEVVWREHWFWKRY  496



>ref|XP_010645729.1| PREDICTED: sugar transport protein 8 [Vitis vinifera]
Length=485

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 231/293 (79%), Gaps = 21/293 (7%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA++PA  L +GS+VI ETPA                     ++V+AEFE I   C+
Sbjct  197   SLGLASLPAAFLFVGSVVIIETPA---------------------KDVDAEFEQIKMACE  235

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAPVLFQT+GFK + SLLS
Sbjct  236   AAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAPVLFQTVGFKNDASLLS  295

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             S+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G IL  +LK + SLD+ L
Sbjct  296   SVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGAILLVHLKGSNSLDEGL  355

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AVS+NML TFIIAQAFLS
Sbjct  356   AGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAVSSNMLFTFIIAQAFLS  415

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             MMC M+AFIFFFF+AWIVAMGLFV F +PETK VP+D MVE+VWKQHPVW++F
Sbjct  416   MMCHMRAFIFFFFAAWIVAMGLFVLFLLPETKNVPIDAMVERVWKQHPVWKRF  468



>ref|XP_003557399.1| PREDICTED: sugar transport protein 8-like [Brachypodium distachyon]
Length=512

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/299 (61%), Positives = 237/299 (79%), Gaps = 3/299 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AA PA +L LGSLVI+ETP SLVERG+ E G+A L+R+RG + V+ EFE I   C+
Sbjct  205   SLGGAAGPAAVLFLGSLVITETPTSLVERGQKEAGRAMLERIRGTKEVDEEFEEISLACE  264

Query  995   AAKQV---KKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGS  825
              A ++   +KPF++L ++  +P L+I++++QVFQQFTGINAIMFYAPVLFQTMGF +N S
Sbjct  265   TAAKMCEEEKPFRRLRRRESRPPLVIAIVMQVFQQFTGINAIMFYAPVLFQTMGFASNAS  324

Query  824   LLSSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLD  645
             LLS+++TG VNVL+T VSI  VDK GRRKLLL+ C+QM+I+Q+AVG I+  ++K + S  
Sbjct  325   LLSAVVTGGVNVLSTLVSIVLVDKIGRRKLLLEACVQMLIAQVAVGGIMWVHVKASNSPS  384

Query  644   KTLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQA  465
                +   V+LIC+YV +FAWSWGPL WLIPSE FPLETRTAGF+FAVS+NML TF+IAQA
Sbjct  385   HGWALATVVLICVYVSSFAWSWGPLGWLIPSETFPLETRTAGFSFAVSSNMLFTFVIAQA  444

Query  464   FLSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             FL+MMC M+AFIFFFF   IV MG FV   +PETKGVP+D MV++VW++H  W+++FR 
Sbjct  445   FLTMMCTMRAFIFFFFGICIVVMGAFVLTLLPETKGVPIDEMVDRVWRKHWFWKRYFRD  503



>ref|XP_004296900.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 226/303 (75%), Gaps = 5/303 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL++RGK+EEGKA L ++RG +N+EAE+  I+   +
Sbjct  207   SLGLAGVPALMLTLGSLIVVDTPNSLIQRGKLEEGKAVLGKIRGTQNIEAEYLDILEASN  266

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L K+  +P L+I++ +Q+FQQFTGINAIMFYAPVLF TMGF  N SL +
Sbjct  267   EAREIKHPFRNLLKRKNRPPLVIAIAMQIFQQFTGINAIMFYAPVLFATMGFGNNASLYA  326

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSI+ VDK GRR LLL+  +QM++SQ+ V I+LA  +K  + +L   
Sbjct  327   AVITGAVNVLSTIVSIFVVDKLGRRMLLLEAGVQMLLSQLVVAIVLALKVKDHSNNLSFG  386

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C +V  FAWSWGPL WLIPSE FPLETR+AG +  V  NM+C F+I Q FL
Sbjct  387   LAILVVVMVCSFVSGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCINMICCFLIGQIFL  446

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
              M+C  +  IF FFSAW++ M LFV F VPETK VP++ M E+VWKQH  W++F    + 
Sbjct  447   LMLCSWKYAIFLFFSAWVLVMTLFVLFLVPETKNVPIEEMTERVWKQHWFWKRF----ID  502

Query  278   SYE  270
              YE
Sbjct  503   EYE  505



>ref|XP_011090738.1| PREDICTED: sugar transport protein 13 [Sesamum indicum]
Length=530

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 220/303 (73%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L + +TP SL+ERG ++EGKA LKR+RG +N+E EF  +V    
Sbjct  205   SLGLAGIPAGLLTLGALFVVDTPNSLIERGYLDEGKAVLKRIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L  +  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   VAKQVKHPFRNLLMRRNRPQLVIAVALQIFQQFTGINAIMFYAPVLFDTVGFGSDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  IQM +SQ  + ++L   +K  T +L   
Sbjct  325   AVITGAVNVLSTVVSIYSVDKVGRRVLLLEAGIQMFLSQAIIAVLLGLKVKDNTDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVILIC +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   YAIFVVILICTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F VPETK VP++ M E+VWK+H +WR+F      
Sbjct  445   SMLCHFKYGIFLFFSGWVLVMSFFVLFLVPETKNVPIEEMTERVWKRHWLWRRFMEDGYA  504

Query  278   SYE  270
               E
Sbjct  505   DEE  507



>ref|XP_009366919.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=528

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 224/303 (74%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ ETP SLVERG +++GK+ LKR+RG ENVE EF  +V    
Sbjct  204   SLGLAGLPAGLLTLGALLVVETPNSLVERGLLDQGKSVLKRIRGTENVEPEFLDLVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  264   IAKEVKHPFRNLIKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFDTLGFGNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ  +QM ISQ+A+ IIL   +K  +  L K 
Sbjct  324   AVITGAVNVLSTVVSIYSVDKVGRRMLLLQAGVQMFISQVAIAIILGIKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQ FL
Sbjct  384   FAIFVVVLICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFVIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F   D  
Sbjct  444   SMLCHFKYGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDDDY  503

Query  278   SYE  270
               E
Sbjct  504   HIE  506



>ref|XP_009366906.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=528

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 224/303 (74%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ ETP SLVERG +++GK+ LKR+RG ENVE EF  +V    
Sbjct  204   SLGLAGLPAGLLTLGALLVVETPNSLVERGLLDQGKSVLKRIRGTENVEPEFLDLVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  264   IAKEVKHPFRNLIKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFDTLGFGNDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ  +QM ISQ+A+ IIL   +K  +  L K 
Sbjct  324   AVITGAVNVLSTVVSIYSVDKVGRRMLLLQAGVQMFISQVAIAIILGIKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQ FL
Sbjct  384   FAIFVVVLICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFVIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F   D  
Sbjct  444   SMLCHFKYGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDDDY  503

Query  278   SYE  270
               E
Sbjct  504   HIE  506



>ref|XP_009364266.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=510

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 225/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +P+++L LG++++++TP SL++RGK+E+GK  LKR+RG+ENV+ EF  I+    
Sbjct  203   SLGLAGIPSLLLTLGAVIVTDTPNSLIQRGKLEQGKKVLKRIRGIENVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+VK PF+ L  +  +PQL+I++ LQ FQQFTGIN+I FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVKHPFRNLLNRKNRPQLVITIFLQFFQQFTGINSINFYAPVLFQTLGFKNDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG++ VL   +SI+ VD+AGRR LL++G IQM +S + + IIL   LK  +  LD  
Sbjct  323   SVITGVIMVLGAIISIFFVDRAGRRVLLIEGGIQMFLSHVVIAIILGMKLKDQSNDLDHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +VV++IC +V +F WSWGPLCWL+ SEIFPLE R+AG +  V  NML TF+IAQAFL
Sbjct  383   LGILVVVVICSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVCVNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FF+AW+  M +FVFF +PETKGVP++ MVE VW++H  W+++
Sbjct  443   SMLCHMKFAIFLFFAAWVFLMTVFVFFLLPETKGVPIEEMVEVVWREHWFWKRY  496



>ref|XP_004298160.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 224/301 (74%), Gaps = 1/301 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VP+V+L +G+LV+ +TP SL+ERGK+E+GKA LKR+RGV+NV+ EF  ++    
Sbjct  204   SLGLAGVPSVLLTIGALVVVDTPNSLIERGKLEQGKAVLKRIRGVQNVDPEFLELLEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L K+  +PQLII+V LQ FQQFTGINAI FYAPVLFQT+GFK++ SL S
Sbjct  264   TAQEVKNPFRNLLKRKNRPQLIITVFLQFFQQFTGINAINFYAPVLFQTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG   V+   +SIY  D+AGRR LLL+G IQM++S + V IIL   LK TT SLD+ 
Sbjct  324   AVITGSCMVVGAIISIYLADRAGRRVLLLEGAIQMLVSHVGVTIILGLKLKETTSSLDRG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VV+L+C +V +F WSWGPL WLI SEIFPLETR+AG +  V  NM  TF+IAQAFL
Sbjct  384   MAILVVVLVCSFVGSFGWSWGPLAWLIASEIFPLETRSAGQSVTVGVNMFFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FF  ++  M LFV F +PETKGVP++ M + VW+QH  WR+F   D  
Sbjct  444   SMLCHLKFGIFLFFGVFVFIMFLFVLFLLPETKGVPIEEMTDVVWRQHWFWRRFIEDDCE  503

Query  278   S  276
              
Sbjct  504   D  504



>ref|XP_008222925.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=510

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 220/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL++RGK++EG++ LK++RG EN+E EF  IV    
Sbjct  206   SLGLAGVPALMLTLGSLIVVDTPNSLIQRGKLDEGRSVLKKIRGTENIETEFAEIVEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L K+  +P LII++ +Q+FQQFTGINAI FYAP+LF +MGF  N SL +
Sbjct  266   VAEEIKHPFRNLLKRKNRPPLIIAIAMQIFQQFTGINAIFFYAPILFASMGFGNNASLYA  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVLAT VS++ VDK GRR LLL+  IQM +SQ+ V I+LA  +K  +  L   
Sbjct  326   AVITGAVNVLATIVSVFLVDKVGRRMLLLEAGIQMFLSQIVVAIVLALKVKDHSNDLSYG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             LS +VV+++C +V AFAWSWGP+ WLIPSE FPLE R+AG +  V  NMLC F+I Q FL
Sbjct  386   LSILVVVMVCTFVSAFAWSWGPIGWLIPSETFPLEARSAGQSVTVCVNMLCCFVIGQVFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
              M+C ++  IF FFSAW++ M LFV F +PETK VP++ M E+VWK+H  W+++    
Sbjct  446   LMLCSLKYAIFLFFSAWVLVMSLFVLFLIPETKNVPIEEMTERVWKKHWFWKRYMDDH  503



>ref|XP_009364223.1| PREDICTED: sugar transport protein 13-like [Pyrus x bretschneideri]
Length=528

 Score =   355 bits (912),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 224/303 (74%), Gaps = 1/303 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PA +L LG+L++ ETP SLVERG +E+GK+ LKR+RG ENVE EF  +V    
Sbjct  204   SLGLACFPAGLLTLGALLVVETPNSLVERGLLEQGKSVLKRIRGTENVEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  264   IAKEVKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFGNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDKAGRR LLLQ  +QM ISQ+A+ IIL   +K  +  L K 
Sbjct  324   AVITGAVNVLSTTVSIYSVDKAGRRLLLLQAGVQMFISQVAIAIILGIKVKDHSDDLHKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  384   FAIFVVVLICTYVAAFAWSWGPLAWLIPSETFPLETRSAGQSVTVCINLLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F   D  
Sbjct  444   SMLCHFKYGIFLFFSGWVLVMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDDDY  503

Query  278   SYE  270
               E
Sbjct  504   HIE  506



>ref|XP_010905220.1| PREDICTED: sugar transport protein 13 [Elaeis guineensis]
Length=517

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PAV+L  G+L + +TP SL+ERG++EEGKA L+++RG +N+E EF  I+    
Sbjct  204   SLSLAGIPAVLLTAGALFVVDTPNSLIERGRLEEGKAVLRKIRGTDNIEPEFNEILEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK PF+ L K+   PQL I++LLQ+FQQFTGINAIMFYAPVLF T+GFK++ SL S
Sbjct  264   IAQQVKHPFRNLIKRRNIPQLTIAILLQIFQQFTGINAIMFYAPVLFNTLGFKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VSIY+VD+ GRR LLL+  +QM +SQ+ + +IL   +   + +L   
Sbjct  324   AVITGAVNVLSTVVSIYSVDRVGRRMLLLEAGVQMFLSQVVISVILGIKVTDHSDNLSHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  384   YAVFVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSITVCVNLLFTFVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS W++ M +FV F +PETK VP++ M E+VWK+H  W++F   D
Sbjct  444   SMLCHLKYAIFAFFSGWVLVMSVFVLFLLPETKNVPIEEMTERVWKKHWFWKRFMDDD  501



>ref|XP_004298158.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   354 bits (908),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 230/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L LGSL++ +TP SL+ERGK+E+GK+ L+R+RG+ENVE E+E I+    
Sbjct  203   SLGLAGVPALLLTLGSLIVVDTPHSLIERGKLEQGKSILRRIRGIENVEPEYEEILEANR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A QVK PF+ L K+  +P L+I +++Q+FQQFTGINAIMFYAPVLFQT+GFK++ SL S
Sbjct  263   EAAQVKNPFQNLLKRRNRPTLVIGMMMQIFQQFTGINAIMFYAPVLFQTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITGLVNVL+T VS+  VDKAGRR LL++  IQM +SQM V +I+   +K  + +L   
Sbjct  323   SVITGLVNVLSTVVSVVVVDKAGRRMLLIEAGIQMFLSQMGVAVIMGLKVKDHSNNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V+IL+C +V +FAWSWGPL WLIPSE F +E R+AG + AV TNML TF+IAQAFL
Sbjct  383   LGILVLILVCSFVASFAWSWGPLGWLIPSETFAVEARSAGQSIAVFTNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+A IF FFS+W++ M LF  FF+PETK +P+D M E+VWKQH  W++F
Sbjct  443   SMLCHMKAGIFIFFSSWVLVMTLFTIFFIPETKNIPIDEMNERVWKQHWYWKRF  496



>ref|XP_004167176.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
Length=538

 Score =   355 bits (910),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/298 (58%), Positives = 225/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L +G+L++ ETP SL+ERG++EEGKA L+R+RG ENVE EF  +V    
Sbjct  204   SLGLAGVPAGLLTIGALLVVETPNSLIERGRLEEGKAILRRIRGTENVEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  QPQLII+V LQVFQQ TGINAIMFYAPVLF T+GFK + +L S
Sbjct  264   IAKEVKHPFRNLLKRRNQPQLIIAVALQVFQQLTGINAIMFYAPVLFNTLGFKNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNV++T VSIY+VDK GRR LLL+  +QM ISQ+ + +IL   +K  T +L   
Sbjct  324   AVITGAVNVVSTVVSIYSVDKLGRRILLLEAGVQMFISQVVIAVILGIKVKDDTNNLHNA  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFL
Sbjct  384   LAIVVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSITVCVNLLFTFAIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M +FV F +PETK +P++ M E+VWKQH +W++F   +
Sbjct  444   SMLCHFKFGIFLFFSGWVLVMSVFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDDN  501



>gb|KFK26411.1| hypothetical protein AALP_AA8G245100 [Arabis alpina]
Length=535

 Score =   355 bits (910),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 224/297 (75%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L ++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  210   SLGLAGIPALLLTVGALFVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  269

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ +L S
Sbjct  270   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGSDAALYS  329

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +K  + +L K 
Sbjct  330   AVVTGAVNVLSTVVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVKDHSENLSKG  389

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  390   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  449

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SM+C  +  IF FFS+W++ M LFV F +PETK VP++ M E+VWK+H  W +F   
Sbjct  450   SMLCHFKFGIFIFFSSWVLVMSLFVMFLLPETKNVPIEEMTERVWKKHWFWARFMND  506



>ref|XP_006419892.1| hypothetical protein CICLE_v10004729mg [Citrus clementina]
 ref|XP_006489360.1| PREDICTED: sugar transport protein 13-like [Citrus sinensis]
 gb|ESR33132.1| hypothetical protein CICLE_v10004729mg [Citrus clementina]
 gb|KDO74662.1| hypothetical protein CISIN_1g009833mg [Citrus sinensis]
Length=524

 Score =   354 bits (909),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 221/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +GSL++++TP SL+ERG+ EEGKA L+++RG + +E EF  +V    
Sbjct  205   SLGLAGIPAALLTVGSLLVTDTPNSLIERGRFEEGKAVLRKIRGTDKIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF+T+GF  + SL S
Sbjct  265   IAKEVKHPFRNLLKRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFKTLGFGGSASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  IQM +SQ  + IIL   +K  +  L   
Sbjct  325   TVITGAVNVLSTLVSIYSVDKVGRRMLLLEAGIQMFLSQTVIAIILGIKVKDHSEDLHTG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VVI+IC ++ AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAVLVVIMICTFISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M  FVFF +PETK VP++ M E+VWKQH +W+ F   D
Sbjct  445   SMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDD  502



>ref|XP_006287497.1| hypothetical protein CARUB_v10000707mg [Capsella rubella]
 gb|EOA20395.1| hypothetical protein CARUB_v10000707mg [Capsella rubella]
Length=525

 Score =   354 bits (909),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 226/305 (74%), Gaps = 2/305 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG ++EGKA L+R+RG +NVE EF  ++    
Sbjct  204   SLGLAGIPALLLTVGALMVTETPNSLVERGHLDEGKAVLRRIRGTDNVEPEFNDLLEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ +L S
Sbjct  264   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGSDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  324   AVVTGAVNVLSTVVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSTNLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  384   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M E+VWK+H  W +F   D  
Sbjct  444   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNVPIEEMTERVWKKHWFWARFM-DDHH  502

Query  278   SYEMA  264
               E A
Sbjct  503   DQEFA  507



>ref|XP_010255992.1| PREDICTED: sugar transport protein 13 [Nelumbo nucifera]
Length=503

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ +TP SL+ERG++EEGKA L+++RG E VE EF+ +V    
Sbjct  205   SLGLAGIPAFLLTLGALLVVDTPNSLIERGRLEEGKAVLRKIRGTEKVEPEFQELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L K+  +PQL+I++ LQ+FQQFTGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   VAKQVKHPFRNLLKRRNRPQLLIAIALQIFQQFTGINAIMFYAPVLFNTVGFHSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNV +T VSIY+VDK GRR LLL+  +QM  SQ+ + ++L   +   + +L K 
Sbjct  325   AVITGAVNVASTVVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAVLLGIKVTDHSDNLGKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++  +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   YAILVVVMVSTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C M+  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH  W++F   D
Sbjct  445   SMLCHMKYAIFAFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWFWKRFMDDD  502



>ref|XP_007034709.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY05635.1| Major facilitator superfamily protein [Theobroma cacao]
Length=529

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L++ ++P SLVERG +EEGKA L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGIPALLLTVGALLVVDSPNSLVERGHLEEGKAVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L ++  +PQL+I++ LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   VAKQVKHPFRNLLQRRNRPQLVIAIALQIFQQCTGINAIMFYAPVLFDTLGFGNDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +K  +  L K+
Sbjct  325   AVITGAVNVLSTIVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVKDHSDDLHKS  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAILVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M +F  F +PETK VP++ M E+VWKQH  W++F   D
Sbjct  445   SMLCHFKYGIFLFFSGWVLIMSIFTLFLIPETKNVPIEEMTERVWKQHWFWKRFIDDD  502



>ref|XP_006394875.1| hypothetical protein EUTSA_v10003980mg [Eutrema salsugineum]
 gb|ESQ32161.1| hypothetical protein EUTSA_v10003980mg [Eutrema salsugineum]
Length=530

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 223/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  206   SLGLAGIPALLLTVGALLVTETPNSLVERGRLDEGKAVLRRIRGTDNVELEFADLLEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  266   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGNDAALYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + I+L   +   + +L K 
Sbjct  326   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIVLGIKVTDHSKNLSKG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  386   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFSAW++ M LFV F +PETK VP++ M E+VWK+H  W +F    
Sbjct  446   SMLCHFKFGIFIFFSAWVLVMSLFVMFLLPETKNVPIEEMTERVWKKHWFWARFMNDH  503



>ref|XP_010493897.1| PREDICTED: sugar transport protein 13-like [Camelina sativa]
Length=525

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  204   SLGLAGIPALLLTVGALMVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L +   +PQLII+V LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  264   LAKEVKHPFRNLLQCRNRPQLIIAVALQIFQQCTGINAIMFYAPVLFNTLGFGSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  324   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSTNLSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  384   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M E+VWK+H  W +F   +
Sbjct  444   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNVPIEEMTERVWKKHWFWARFMDDE  501



>ref|XP_007143232.1| hypothetical protein PHAVU_007G055200g [Phaseolus vulgaris]
 gb|ESW15226.1| hypothetical protein PHAVU_007G055200g [Phaseolus vulgaris]
Length=500

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 222/297 (75%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA+ML LGSL++ +TP SL+ERG  +EGK  LK++RGVENVE EF+ I+    
Sbjct  204   SLALAGVPALMLTLGSLLVHDTPNSLIERGLEDEGKIVLKKIRGVENVEPEFQEILKASK  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PFK L K+  +P LI++V+LQ+FQQFTGINAIMFYAPVLF+T+GFK+  SL S
Sbjct  264   TAKMVKNPFKNLIKRHNRPPLIMAVMLQIFQQFTGINAIMFYAPVLFRTLGFKSEASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VS+Y VDK GRR LLL+ C+QM +SQ+ +G++L   ++  + SL+  
Sbjct  324   AVITGAVNVLSTLVSVYFVDKVGRRILLLEACVQMFVSQVVIGMVLGMKVQDHSESLNTG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C +V +FAWSWGPL WLIPSE FPLE R+AG +  V  NML TFIIAQ FL
Sbjct  384   FAVLVVVMVCTFVSSFAWSWGPLGWLIPSETFPLEARSAGQSVTVFMNMLFTFIIAQGFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SMMC  +  IFFFFSAW++ M LF  F VPETK +P++ M EKVW+ H  W+ F   
Sbjct  444   SMMCHFKFGIFFFFSAWVLVMSLFTIFLVPETKNIPIEEMTEKVWRNHWFWKSFMED  500



>ref|NP_001268207.1| hexose transporter [Vitis vinifera]
 gb|AAT09979.1| hexose transporter [Vitis vinifera]
 emb|CBI26226.3| unnamed protein product [Vitis vinifera]
 gb|ADP37129.1| hexose transporter [Vitis vinifera]
Length=536

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 224/302 (74%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +GSL++ +TP SL+ERG++EEGKA L+++RG + +E E++ ++    
Sbjct  203   SLGLAGIPAVLLTVGSLLVVDTPNSLIERGRLEEGKAVLRKIRGTDKIEPEYQELLEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L ++  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ SL S
Sbjct  263   VAKLVKHPFRNLMQRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFDTLGFGSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM  SQ+ + IIL   +K  + +L   
Sbjct  323   AVITGAVNVLSTLVSVYSVDKVGRRLLLLEAGVQMFFSQVVIAIILGIKVKDHSNNLHTG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+L+C +V  FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQ+FL
Sbjct  383   YAVLVVVLVCTFVAGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQSFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFS W+  M  FV F +PETK +P++ M E+VWK+H +W++F    V 
Sbjct  443   SMLCHLKYGIFLFFSGWVFIMSFFVLFLLPETKNIPIEEMTERVWKKHWLWKRFMDDHVE  502

Query  278   SY  273
              +
Sbjct  503   GF  504



>ref|XP_009763608.1| PREDICTED: sugar transport protein 13 [Nicotiana sylvestris]
Length=523

 Score =   352 bits (904),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 220/294 (75%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PA++L LG++ + +TP SL+ERG +EEGK  LK++RG +N+E EF  +V    
Sbjct  205   SLGLAGFPALLLTLGAIFVVDTPNSLIERGHLEEGKNVLKKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   IAKEVKHPFRNLLQRRNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGSSAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM+ISQ+ + IIL   +   + +L   
Sbjct  325   AVITGAVNVLSTVVSVYSVDKLGRRILLLEAGVQMLISQVVIAIILGIKVTDHSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  385   WGIFVVVMICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF +PETK VP++ M E+VWKQH +W+++
Sbjct  445   SMLCHFKYGIFLFFSGWIFVMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKRY  498



>ref|XP_004298159.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=510

 Score =   352 bits (902),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 230/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L +GSL++ +TP+SL+ERGK+E+GKA L+R+RGV NVE E+  IV    
Sbjct  203   SLGLAGVPALLLTIGSLIVVDTPSSLIERGKLEQGKAVLRRIRGVNNVEPEYLEIVEANR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA ++K PF+ L K+  +P L+I++++Q+FQQFTGINAIMFYAPVLFQT+GFK++ SL S
Sbjct  263   AAAEIKNPFQNLLKRRNRPTLVIAMMMQIFQQFTGINAIMFYAPVLFQTLGFKSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITGLVNVL+T VS+  VDKAGRR LL++  +QM +SQM V II+   +K  T +L   
Sbjct  323   AVITGLVNVLSTVVSVVLVDKAGRRMLLIEAGLQMFLSQMGVAIIMGLKVKDFTNNLGHG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L  +V+IL+C +V +FAWSWGPL WLIPSE F +E R+AG + AV TNML TF+IAQAFL
Sbjct  383   LGILVLILVCSFVASFAWSWGPLGWLIPSETFAVEARSAGQSIAVFTNMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+A IF FFSAW++ M LF  F +PETK +P+D M E+VWKQH  W++F
Sbjct  443   SMLCHMKASIFVFFSAWVLVMTLFTIFLIPETKNIPLDEMTERVWKQHWYWKRF  496



>ref|XP_008438690.1| PREDICTED: sugar transport protein 13-like [Cucumis melo]
Length=508

 Score =   352 bits (902),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 223/297 (75%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA +L LG++++ +TP SL+ERG +E+GKA LK++RG ENVE E+  I+    
Sbjct  205   SLALAGVPAFLLTLGAILVDDTPNSLIERGHLEKGKAVLKKIRGTENVEPEYLEILEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PFK L  +  +P L+I+++LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   IAQEVKHPFKNLLMRQNRPPLVIAIMLQIFQQLTGINAIMFYAPVLFNTVGFGNDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             S+ITG VNVL+T VSIY+VDK GRR LLL+  IQM +SQ  + ++L   L+ ++  + + 
Sbjct  325   SVITGAVNVLSTLVSIYSVDKIGRRMLLLEAGIQMFVSQTIIAVLLGLKLQDSSNDMSRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ VVV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  385   MAIVVVLMVCSFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMIFTFVIAQSFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SM+C M+  IF FFS W++ M LFV F +PETKGVP++ M EKVWKQH  W++F  +
Sbjct  445   SMLCHMKFGIFLFFSGWVLVMSLFVLFLLPETKGVPLEEMTEKVWKQHWFWKRFMDN  501



>gb|KCW60804.1| hypothetical protein EUGRSUZ_H03539 [Eucalyptus grandis]
Length=478

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 220/305 (72%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +G++ + +TP SL+ERG +EEGKA L+R+RG +N+E EF+ ++    
Sbjct  155   SLGLAGIPAGLLTVGAIFVLDTPNSLIERGHIEEGKAVLRRIRGTDNIEPEFQELLEASR  214

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L  +  +PQL+I+V +QVFQQFTGINAIMFYAPVLF+T+GF  + SL S
Sbjct  215   IAKEVKHPFRNLMMRKNRPQLVIAVAMQVFQQFTGINAIMFYAPVLFKTVGFGDDASLYS  274

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++I G VNV++T VSIYTVDK GRR LLL+  +QM +SQ+ + I+L   +K  +  L   
Sbjct  275   AVIIGAVNVVSTLVSIYTVDKIGRRVLLLEAGVQMFLSQVIIAIVLGLKVKDHSEDLGHG  334

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              S  VVI++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TN L TF+I QAFL
Sbjct  335   YSIFVVIMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNFLFTFVIGQAFL  394

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M +F  F +PETK +P++ M E+VWKQH  W+++   D  
Sbjct  395   SMLCQFKYGIFLFFSGWVLIMSIFTLFLIPETKNIPIEEMTERVWKQHWYWKRYMDDDHH  454

Query  278   SYEMA  264
               E A
Sbjct  455   DAEAA  459



>emb|CAN61766.1| hypothetical protein VITISV_025413 [Vitis vinifera]
Length=536

 Score =   352 bits (903),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 223/301 (74%), Gaps = 1/301 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +GSL++ +TP SL+ERG++EEGKA L+++RG + +E E++ ++    
Sbjct  203   SLGLAGIPAVLLTVGSLLVVDTPNSLIERGRLEEGKAVLRKIRGTDKIEPEYQELLEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L ++  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ SL S
Sbjct  263   VAKLVKHPFRNLMQRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFDTLGFGSDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM  SQ+ + IIL   +K  + +L   
Sbjct  323   AVITGAVNVLSTLVSVYSVDKVGRRLLLLEAGVQMFFSQVVIAIILGIKVKDHSNNLHTG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+L+C +V  FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQ+FL
Sbjct  383   YAVLVVVLVCTFVAGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQSFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C ++  IF FFS W+  M  FV F +PETK +P++ M E+VWK+H +W++F    V 
Sbjct  443   SMLCHLKYGIFLFFSGWVFIMSFFVLFLLPETKNIPIEEMTERVWKKHWLWKRFMDDHVE  502

Query  278   S  276
              
Sbjct  503   G  503



>ref|XP_008449560.1| PREDICTED: sugar transport protein 13 [Cucumis melo]
Length=539

 Score =   352 bits (903),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 225/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA +L +G+L++ ETP SL+ERG++EEGKA L+++RG ENVE EF  +V    
Sbjct  204   SLGLAGVPAGLLTIGALLVVETPNSLIERGRLEEGKATLRKIRGTENVEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  QPQLII+V LQ+FQQ TGINAIMFY+PVLF T+GFK + +L S
Sbjct  264   IAKEVKHPFRNLLKRRNQPQLIIAVALQIFQQLTGINAIMFYSPVLFSTLGFKNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNV++T VSIY+VDK GRR LLL+  +QM ISQ+ + +IL   +K  T +L   
Sbjct  324   AVITGAVNVVSTVVSIYSVDKLGRRILLLEAGVQMFISQVVIAVILGIKVKDDTNNLHNA  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFL
Sbjct  384   LAIVVVVMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSITVCVNLLFTFAIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS W++ M +FV F +PETK +P++ M E+VWKQH +W++F   +
Sbjct  444   SMLCHFKFGIFLFFSGWVLVMSIFVLFLLPETKNIPIEEMTERVWKQHWLWKRFMDHN  501



>ref|XP_004168644.1| PREDICTED: LOW QUALITY PROTEIN: sugar transport protein 13-like 
[Cucumis sativus]
Length=508

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 223/297 (75%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA +L LG++++ +TP SL+ERG +E+GKA LK++RG ENVE E+  I+    
Sbjct  205   SLALAGVPAFLLTLGAILVDDTPNSLIERGHLEKGKAVLKKIRGTENVEPEYLEILEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PFK L  +  +P L+I+++LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   IAQEVKHPFKNLLMRQNRPPLVIAIMLQIFQQLTGINAIMFYAPVLFNTVGFGNDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGS-LDKT  639
             S+ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ  + ++L   L+ + + + + 
Sbjct  325   SVITGAVNVLSTLVSIYSVDKIGRRMLLLEAGVQMFVSQTIIAVLLGLKLQDSANDMSRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ VVV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  385   MAIVVVLMVCSFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFVIAQSFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SM+C M+  IF FFS W++ M LFV F +PETKGVP++ M EKVWKQH  W+KF  +
Sbjct  445   SMLCHMKFGIFLFFSGWVLVMSLFVLFLLPETKGVPLEEMTEKVWKQHWFWKKFMDN  501



>ref|XP_004134451.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
 gb|KGN56999.1| hypothetical protein Csa_3G149300 [Cucumis sativus]
Length=508

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 223/297 (75%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA VPA +L LG++++ +TP SL+ERG +E+GKA LK++RG ENVE E+  I+    
Sbjct  205   SLALAGVPAFLLTLGAILVDDTPNSLIERGHLEKGKAVLKKIRGTENVEPEYLEILEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PFK L  +  +P L+I+++LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   IAQEVKHPFKNLLMRQNRPPLVIAIMLQIFQQLTGINAIMFYAPVLFNTVGFGNDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGS-LDKT  639
             S+ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ  + ++L   L+ + + + + 
Sbjct  325   SVITGAVNVLSTLVSIYSVDKIGRRMLLLEAGVQMFVSQTIIAVLLGLKLQDSANDMSRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ VVV+++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  385   MAIVVVLMVCSFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFVIAQSFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             SM+C M+  IF FFS W++ M LFV F +PETKGVP++ M EKVWKQH  W+KF  +
Sbjct  445   SMLCHMKFGIFLFFSGWVLVMSLFVLFLLPETKGVPLEEMTEKVWKQHWFWKKFMDN  501



>ref|XP_010489690.1| PREDICTED: sugar transport protein 8-like [Camelina sativa]
Length=840

 Score =   360 bits (924),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 229/297 (77%), Gaps = 7/297 (2%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  CD
Sbjct  540   ALGGAGIPAVILLFGSLLIIETPTSLIERNKNEEGKEALRKIRGVDDINDEYESIVHACD  599

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P L+I +LLQ FQQFTGINAIMFYAPVLFQT+GF +N +LLS
Sbjct  600   IARQVKDPYRKLLKPASRPPLVIGMLLQFFQQFTGINAIMFYAPVLFQTVGFGSNAALLS  659

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VD+ GRR LLLQ       S + +G ILA +L  TG+L K  
Sbjct  660   AVVTGSINVLSTFVGIYLVDRTGRRFLLLQ-------SSLIIGSILAKDLGVTGTLGKAQ  712

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  713   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFLIAQAFLS  772

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+CGM+  IFFFF+ WI+ MGLF  FF+PETKG+ +D M E VWK H  W+++  ++
Sbjct  773   MLCGMRYGIFFFFAGWIIVMGLFALFFIPETKGIAIDDMRESVWKPHWFWKRYMLAE  829


 Score =   310 bits (794),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 198/250 (79%), Gaps = 0/250 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             +LG A +PAV+L  GSL+I ETP SL+ER K EEGK AL+++RGV+++  E+E+IV  CD
Sbjct  200   ALGGAGIPAVILLFGSLLIIETPTSLIERNKNEEGKEALRKIRGVDDINDEYESIVHACD  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+QVK P++KL K + +P L+I +LLQ FQQFTGINAIMFYAPVLFQT+GF +N +LLS
Sbjct  260   IARQVKDPYRKLLKPASRPPLVIGMLLQFFQQFTGINAIMFYAPVLFQTVGFGSNAALLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++TG +NVL+TFV IY VD+ GRR LLLQ  + M+I  + +G ILA +L  TG+L K  
Sbjct  320   AVVTGSINVLSTFVGIYLVDRTGRRFLLLQSSVHMLICHLIIGSILAKDLGVTGTLGKAQ  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + VVVI +C+YVM FAWSWGPL WLIPSE FPLETR+AGFA AVS NM  TF+IAQAFLS
Sbjct  380   ALVVVIFVCVYVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFLIAQAFLS  439

Query  455   MMCGMQAFIF  426
             M+CGM+  IF
Sbjct  440   MLCGMRYGIF  449



>ref|XP_007226274.1| hypothetical protein PRUPE_ppa020009mg [Prunus persica]
 gb|EMJ27473.1| hypothetical protein PRUPE_ppa020009mg [Prunus persica]
Length=510

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 223/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +P+++L  G+L++++TP SL++RGK+EEGK  LKR+RG++NV+ EF  I+    
Sbjct  203   SLGLAGIPSLLLTFGALIVTDTPNSLIQRGKLEEGKKVLKRIRGIDNVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+V+ PF+ L K+  +PQLII+V LQ FQQFTGIN++ FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVQHPFRNLFKRRNRPQLIITVFLQFFQQFTGINSVNFYAPVLFQTLGFKHDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG + VL   VSI+ VD+AGRR LLL+G IQM IS + + +IL   LK  +  LDK 
Sbjct  323   SVITGGIMVLGAIVSIFLVDRAGRRMLLLEGGIQMFISHVVIAVILGWKLKDQSNDLDKG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             +  +VV++IC +V +F WSWGPLCWL+ SEIFPLE R+AG +  V  NML TF+IAQAFL
Sbjct  383   MGILVVVIICSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVCINMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FF+AW + M +FV+F +PETKGVP++ M + VW+QH  W+++
Sbjct  443   SMLCHFRFGIFLFFAAWCLIMTVFVYFLLPETKGVPIEEMSDVVWRQHWFWKRY  496



>emb|CDX87052.1| BnaC09g03670D [Brassica napus]
Length=532

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++    
Sbjct  206   SLGLAGVPALLLTVGALLVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  266   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGNDAALYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  326   AVVTGAVNVLSTVVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSQNLSKG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  386   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS+W++ M  FV F +PETK +P++ M E+VWK+H  W +F
Sbjct  446   SMLCHFKFGIFIFFSSWVLVMSFFVMFLLPETKNIPIEEMTERVWKKHWFWARF  499



>ref|NP_001234785.1| hexose transporter protein [Solanum lycopersicum]
 emb|CAA09419.1| hexose transporter protein [Solanum lycopersicum]
Length=523

 Score =   350 bits (898),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 219/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PAV+L LG+L + ETP SL+ERG +EEGK  L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGFPAVLLTLGALFVVETPNSLIERGYLEEGKEVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   VAKQVKHPFRNLLQRKNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGNSAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM++SQ+ + IIL   +   + +L   
Sbjct  325   AVITGAVNVLSTVVSVYSVDKLGRRVLLLEAGVQMLLSQIIIAIILGIKVTDHSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  385   WGIFVVVLICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF VPETK VP++ M E+VWKQH +W++F
Sbjct  445   SMLCHFKYGIFLFFSGWIFVMSLFVFFLVPETKNVPIEEMTERVWKQHWLWKRF  498



>gb|ADP37145.1| putative hexose transporter [Vitis vinifera]
Length=266

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 211/249 (85%), Gaps = 0/249 (0%)
 Frame = -1

Query  1043  VENVEAEFETIVAGCDAAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAP  864
             VE+V+AEFE I   C+AA++VK PFK L K+S  P LII V++QVFQQFTGINAIMFYAP
Sbjct  1     VEDVDAEFEQIKMACEAAREVKDPFKTLMKRSSMPPLIIGVMMQVFQQFTGINAIMFYAP  60

Query  863   VLFQTMGFKANGSLLSSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGI  684
             VLFQT+GFK + SLLSS+ITGLVNV +T VSIY VD+ GRRKLLLQ C+QM ISQ A+G 
Sbjct  61    VLFQTVGFKNDASLLSSVITGLVNVFSTLVSIYGVDRVGRRKLLLQACVQMFISQTAIGA  120

Query  683   ILATNLKTTGSLDKTLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAV  504
             IL  +LK + SLD+ L+ +VV+L+CL+VM+FAWSWGPL WLIPSE FPLE RT+GFA AV
Sbjct  121   ILLVHLKGSNSLDEGLAGLVVVLVCLFVMSFAWSWGPLGWLIPSETFPLEIRTSGFACAV  180

Query  503   STNMLCTFIIAQAFLSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVW  324
             S+NML TFIIAQAFLSMMC M+AFIFFFF+AWIV MGLFV F +PETK VP+D MVE+VW
Sbjct  181   SSNMLFTFIIAQAFLSMMCHMRAFIFFFFAAWIVVMGLFVLFLLPETKNVPIDAMVERVW  240

Query  323   KQHPVWRKF  297
             KQHPVW++F
Sbjct  241   KQHPVWKRF  249



>emb|CDY19773.1| BnaA09g04260D [Brassica napus]
Length=532

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L +G+L+++ETP SLVERG+++EGKA L+++RG +NVE EF  ++    
Sbjct  206   SLGLAGVPALLLTVGALLVTETPNSLVERGRLDEGKAVLRKIRGTDNVEPEFADLLEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  266   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGNDAALYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  326   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSQNLSKG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  386   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS+W++ M  FV F +PETK +P++ M E+VWK+H  W +F
Sbjct  446   SMLCHFKFGIFIFFSSWVLVMSFFVMFLLPETKNIPIEEMTERVWKKHWFWARF  499



>ref|XP_010546806.1| PREDICTED: sugar transport protein 13 [Tarenaya hassleriana]
Length=538

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +G+L +++TP SLVERG+++EGKA L+R+RG +NVEAEF  ++    
Sbjct  206   SLGLAGIPAVLLTVGALFVTDTPNSLVERGRLDEGKAILRRIRGTDNVEAEFADLLQASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  266   LAKEVKHPFRNLLRRRNRPQLVIAVALQIFQQFTGINAIMFYAPVLFNTLGFGNDAALYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +K  +  L K+
Sbjct  326   AVVTGAVNVLSTVVSIYSVDKVGRRMLLLEAGVQMFLSQVVIAIILGIKVKDHSEDLHKS  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+LIC +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  386   FAILVVVLICTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCINLLFTFVIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS+W++ M +FV F +PETK VP++ M E+VWK+H  W +F
Sbjct  446   SMLCHFKYGIFLFFSSWVLVMSVFVQFLLPETKNVPIEEMTERVWKKHWFWARF  499



>ref|XP_010024355.1| PREDICTED: sugar transport protein 13-like [Eucalyptus grandis]
Length=528

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 220/305 (72%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +G++ + +TP SL+ERG +EEGKA L+R+RG +N+E EF+ ++    
Sbjct  205   SLGLAGIPAGLLTVGAIFVLDTPNSLIERGHIEEGKAVLRRIRGTDNIEPEFQELLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L  +  +PQL+I+V +QVFQQFTGINAIMFYAPVLF+T+GF  + SL S
Sbjct  265   IAKEVKHPFRNLMMRKNRPQLVIAVAMQVFQQFTGINAIMFYAPVLFKTVGFGDDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++I G VNV++T VSIYTVDK GRR LLL+  +QM +SQ+ + I+L   +K  +  L   
Sbjct  325   AVIIGAVNVVSTLVSIYTVDKIGRRVLLLEAGVQMFLSQVIIAIVLGLKVKDHSEDLGHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              S  VVI++C +V +FAWSWGPL WLIPSE FPLETR+AG +  V TN L TF+I QAFL
Sbjct  385   YSIFVVIMVCTFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNFLFTFVIGQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M +F  F +PETK +P++ M E+VWKQH  W+++   D  
Sbjct  445   SMLCQFKYGIFLFFSGWVLIMSIFTLFLIPETKNIPIEEMTERVWKQHWYWKRYMDDDHH  504

Query  278   SYEMA  264
               E A
Sbjct  505   DAEAA  509



>ref|XP_010533292.1| PREDICTED: sugar transport protein 8-like [Tarenaya hassleriana]
Length=510

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 230/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+AA+PAV+L +GS VI ETP SLV+RG   +G+ ALK++RGVE+V  EFE I   C+
Sbjct  199   SLGVAALPAVLLFVGSFVIPETPTSLVQRGHESKGREALKKIRGVEDVNEEFEEIKEACE  258

Query  995   AAKQVKKPFKKLTKK-SGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              A++ K  F ++ KK S  P L+I V+LQVFQQFTGIN+IMFYAPVLFQT+G K+  SL 
Sbjct  259   KAERAKGSFWEMAKKRSNWPPLVIGVMLQVFQQFTGINSIMFYAPVLFQTVGMKSGASLY  318

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKT  639
             SS+ITG  NVLAT ++I+ VDKAGRR LLL  C+ M ISQ+ +G +L   LK   +L   
Sbjct  319   SSVITGAFNVLATLLAIFAVDKAGRRMLLLAACVIMFISQVIIGGLLLGYLKEANTLTVG  378

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             +  VVV+L+C++V+AFAWSWGP+ WLIPSE FPLE RT G+A AVSTNM+CTFIIAQAFL
Sbjct  379   MGIVVVVLVCMFVIAFAWSWGPMGWLIPSETFPLEMRTEGYACAVSTNMICTFIIAQAFL  438

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+AFIFFFF+AWI+ M LFVFF +PETK VP+D MV++VWK HPVW KF
Sbjct  439   SMLCRMRAFIFFFFAAWILLMALFVFFLLPETKNVPIDAMVDRVWKLHPVWSKF  492



>ref|XP_004296903.1| PREDICTED: sugar transport protein 13-like [Fragaria vesca subsp. 
vesca]
Length=529

 Score =   350 bits (897),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 225/301 (75%), Gaps = 1/301 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ ETP SLVERG++EEGKA L+R+RG +NVE EF  +V    
Sbjct  203   SLGLAGIPAGLLTLGALLVVETPNSLVERGRLEEGKAVLRRIRGTDNVEPEFLELVEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L  +  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  263   VAKEVKHPFRNLLHRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFDTLGFGNDAALYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + IIL   +K     L K 
Sbjct  323   AVITGAVNVLSTMVSIYSVDKVGRRMLLLEAGVQMFLSQVVIAIILGIKVKDHNDDLQKG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VVI++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQAFL
Sbjct  383   FAVLVVIMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFS W++ M +FV F VPETK +P++ M E+VW+QH +W+K+  +D  
Sbjct  443   SMLCHFKFGIFLFFSGWVLIMSIFVLFLVPETKNIPIEEMTERVWRQHWLWKKYIDADYH  502

Query  278   S  276
             +
Sbjct  503   T  503



>ref|XP_009111698.1| PREDICTED: sugar transport protein 13 [Brassica rapa]
Length=532

 Score =   350 bits (897),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA++L +G+L+++ETP SLVERG+++EGKA L+++RG +NVE EF  ++    
Sbjct  206   SLGLAGVPALLLTVGALLVTETPNSLVERGRLDEGKAVLRKIRGTDNVEPEFADLLEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + +L S
Sbjct  266   LAKEVKHPFRNLLQRRNRPQLVIAVALQIFQQCTGINAIMFYAPVLFSTLGFGNDAALYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   + +L K 
Sbjct  326   AVVTGAVNVLSTLVSIYSVDKVGRRVLLLEAGVQMFFSQVVIAIILGIKVTDHSQNLSKG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFL
Sbjct  386   FAILVVVMICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS+W++ M  FV F +PETK +P++ M E+VWK+H  W +F
Sbjct  446   SMLCHFKFGIFIFFSSWVLVMSFFVMFLLPETKNIPIEEMTERVWKKHWFWARF  499



>ref|XP_010035273.1| PREDICTED: sugar transport protein 13-like [Eucalyptus grandis]
 gb|KCW84228.1| hypothetical protein EUGRSUZ_B01090 [Eucalyptus grandis]
Length=520

 Score =   349 bits (896),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 222/299 (74%), Gaps = 1/299 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +G+L++ +TP SL+ERG+ EEGKA L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGIPAVLLTVGALMVVDTPNSLIERGRHEEGKAVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL+I++ LQ+FQQ TGINAIMFYAPVLF T+GF  + SL S
Sbjct  265   IAKEVKHPFRNLLQRRNRPQLVIAMSLQLFQQCTGINAIMFYAPVLFNTVGFGGDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++I G VNVL+T VSIY+VDK GRR LLL+  +QM +SQ A+ I+L   +K  + +L   
Sbjct  325   AVIIGAVNVLSTCVSIYSVDKVGRRMLLLEAGVQMFLSQTAIAIVLGIKVKDHSENLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+L+C ++ AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF+IAQAFL
Sbjct  385   FAIFVVVLVCTFISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCINLLFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDV  282
             SM+C  +  IF FFS W++ M LFV F +PETK VP++ M EKVW QH +W++F   D+
Sbjct  445   SMLCHFKFGIFLFFSGWVLVMSLFVLFLLPETKNVPIEEMTEKVWMQHWLWKRFMDDDI  503



>ref|XP_008222842.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=510

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +P+++L  G+L++++TP SL++RGK+EEGK  LKR+RG++NV+ EF  I+    
Sbjct  203   SLGLAGIPSLLLTFGALIVTDTPNSLIQRGKLEEGKKVLKRIRGIDNVDPEFLEILEASR  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK+V+ PF+ L K+  +PQLII+V LQ FQQFTGIN++ FYAPVLFQT+GFK + SL S
Sbjct  263   AAKEVQHPFRNLFKRRNRPQLIITVFLQFFQQFTGINSVNFYAPVLFQTLGFKHDASLYS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             S+ITG + VL   VSI+ VD+ GRR LLL+G IQM IS + + +IL   LK  +  LDK 
Sbjct  323   SVITGGIMVLGAIVSIFLVDRTGRRVLLLEGGIQMFISHVVIAVILGWKLKDQSNDLDKG  382

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             +  +VV++IC +V +F WSWGPLCWL+ SEIFPLE R+AG +  V  NML TF+IAQAFL
Sbjct  383   MGILVVVIICSFVGSFGWSWGPLCWLVASEIFPLEARSAGQSVTVCINMLFTFVIAQAFL  442

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FF+AW + M +FV+F +PETKGVP++ M + VW+QH  W+++
Sbjct  443   SMLCHFRFGIFLFFAAWCLIMTVFVYFLLPETKGVPIEEMSDVVWRQHWFWKRY  496



>ref|XP_008222939.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=529

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L LG+L++ ETP SLVERG +EEGKA L+R+RG +NVE EF  +V    
Sbjct  205   SLGLAGLPAGLLTLGALLVVETPNSLVERGLLEEGKAVLRRIRGTDNVEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQLII+V LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   IAKEVKHPFRNLLKRRNRPQLIIAVALQIFQQFTGINAIMFYAPVLFNTLGFGSDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVL+T VSIY+VDK GRR LLLQ  +QM +SQ+ + +IL   +K  +  L + 
Sbjct  325   AVITGAVNVLSTVVSIYSVDKVGRRMLLLQAGVQMFLSQVVIAVILGIKVKDHSDDLHQG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V TN+L TF+IAQ FL
Sbjct  385   FAIFVVVLICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCTNLLFTFVIAQGFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS W++ M  FV F +PETK +P++ M E+VWKQH +W++F
Sbjct  445   SMLCHFKFGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWKQHWLWKRF  498



>dbj|BAO96217.1| sugar transporter 2 [Solanum lycopersicum]
Length=523

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 219/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PAV+L LG+L + ETP SL+ERG +EEGK  L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGFPAVLLTLGALFVVETPNSLIERGYLEEGKEVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   VAKQVKHPFRNLLQRKNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGNSAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM++SQ+ + IIL   +   + +L   
Sbjct  325   AVITGAVNVLSTVVSVYSVDKLGRRVLLLEAGVQMLLSQIIIAIILGIKVTDHSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  385   WGIFVVVLICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF +PETK VP++ M E+VWKQH +W++F
Sbjct  445   SMLCHFKYGIFLFFSGWIFVMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKRF  498



>emb|CAB52689.1| hexose transporter [Solanum lycopersicum]
Length=523

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 219/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA  PAV+L LG+L + ETP SL+ERG +EEGK  L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGFPAVLLTLGALFVVETPNSLIERGYLEEGKEVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ L ++  +PQLIISV LQ+FQQFTGINAIMFYAPVLF T+GF  + +L S
Sbjct  265   VAKQVKHPFRNLLQRKNRPQLIISVALQIFQQFTGINAIMFYAPVLFSTLGFGNSAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++ITG VNVL+T VS+Y+VDK GRR LLL+  +QM++SQ+ + IIL   +   + +L   
Sbjct  325   AVITGAVNVLSTVVSVYSVDKLGRRVLLLEAGVQMLLSQIIIAIILGIKVTDHSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                 VV+LIC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF++AQAFL
Sbjct  385   WGIFVVVLICTYVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFS WI  M LFVFF +PETK VP++ M E+VWKQH +W++F
Sbjct  445   SMLCHFKYGIFLFFSGWIFVMSLFVFFLLPETKNVPIEEMTERVWKQHWLWKRF  498



>ref|XP_003592420.1| Hexose transporter [Medicago truncatula]
 gb|AES62671.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=523

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 227/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGL  +PA++L LG+ ++ +TP SL+ERG +++GKA L+++RG +N+E EF  +V    
Sbjct  204   SLGLGGIPALLLTLGAYLVVDTPNSLIERGHLDKGKAVLRKIRGTDNIEPEFLELVEASR  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K++ +PQL+IS+ L +FQQFTGINAIMFYAPVLF T+GFK + +L S
Sbjct  264   VAKEVKHPFRNLLKRNNRPQLVISIALMIFQQFTGINAIMFYAPVLFNTLGFKNDAALYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG +NV++T VSIY+VDK GRRKLLL+  +QM++SQM + I+L   +K  +  L K 
Sbjct  324   AVITGAINVISTIVSIYSVDKLGRRKLLLEAGVQMLLSQMVIAIVLGIKVKDHSEELSKG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C++V AFAWSWGPL WLIPSEIFPLETR+AG +  V  N L T +IAQAFL
Sbjct  384   YAALVVVMVCIFVSAFAWSWGPLAWLIPSEIFPLETRSAGQSVTVCVNFLFTAVIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IFFFFS WI+ M  FVFF VPETK VP++ M ++VWKQH  W++F  +D
Sbjct  444   SMLCYFKFGIFFFFSGWILFMSTFVFFLVPETKNVPIEEMTQRVWKQHWFWKRFVEND  501



>ref|XP_007224819.1| hypothetical protein PRUPE_ppa023527mg [Prunus persica]
 gb|EMJ26018.1| hypothetical protein PRUPE_ppa023527mg [Prunus persica]
Length=503

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL++RGK++EG++ LK++RG EN+E EF  IV    
Sbjct  206   SLGLAGVPALMLTLGSLIVVDTPNSLIQRGKLDEGRSVLKKIRGTENIETEFAEIVEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AA+++K PF+ L ++  +P L+I++ +Q+FQQFTGINAI FYAP+LF +MGF +N SL +
Sbjct  266   AAEEIKNPFRNLLERKNRPPLVIAIAMQIFQQFTGINAIFFYAPILFASMGFGSNASLYA  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVLAT VS++ VDK GRR LLL+  IQM +SQ+ V I+LA  +K  + +L   
Sbjct  326   AVITGAVNVLATIVSVFLVDKVGRRMLLLEAGIQMFLSQIVVAIVLALKVKDHSNNLSFG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C++V AFAWSWGP+ WLIPSE FPLE R+AG +  V  NML  F+I Q FL
Sbjct  386   LAILVVVMVCIFVSAFAWSWGPIGWLIPSETFPLEARSAGQSVTVCVNMLFCFVIGQVFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
              M+C ++  IF FF+AW++ M LFV   +PETK VP++ M E+VWK+H  W++F    
Sbjct  446   LMLCSLKYAIFLFFAAWVLIMSLFVLLLIPETKNVPIEEMTERVWKKHWFWKRFMDDH  503



>ref|XP_008222924.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=503

 Score =   346 bits (887),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 222/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA VPA+ML LGSL++ +TP SL++RGK++EG++ LK++RG EN+E EF  IV    
Sbjct  206   SLGLAGVPALMLTLGSLIVVDTPNSLIQRGKLDEGRSVLKKIRGTENIETEFVEIVEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A+++K PF+ L ++  +P L+I++ +Q+FQQFTGINAI FYAP+LF +MGF +N SL +
Sbjct  266   VAEEIKHPFRNLLERKNRPPLVIAIAMQIFQQFTGINAIFFYAPILFASMGFGSNASLYA  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNVLAT VS++ VDK GRR LLL+  IQM++SQ+ V I+LA  +K  + +L   
Sbjct  326   AVITGAVNVLATIVSLFLVDKVGRRMLLLEAGIQMLLSQIVVAIVLAVKVKDHSNNLSFG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV+++C++V AFAWSWGP+ WLIPSE FPLE R+AG +  V  NML  F+I Q FL
Sbjct  386   LAILVVVMVCIFVSAFAWSWGPIGWLIPSETFPLEARSAGQSVTVCVNMLFCFVIGQVFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
              M+C ++  IF FF+AW++ M LFV   +PETK VP++ M E+VWK+H  W++F    
Sbjct  446   LMLCSLKYAIFLFFAAWVLIMSLFVLLLIPETKNVPIEEMTERVWKKHWFWKRFMDDH  503



>gb|EYU41503.1| hypothetical protein MIMGU_mgv1a004471mg [Erythranthe guttata]
Length=525

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 223/303 (74%), Gaps = 2/303 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA +L +G+L++ ETP SL+ERG+++EGKA L+R+RG +N+E EF  +V    
Sbjct  205   SLGLAGIPAGLLTIGALLVVETPNSLIERGRLDEGKAVLRRIRGTDNIEPEFNELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK VK PF+ L  +  +PQLII++ LQVFQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   VAKLVKHPFRNLLMRKNRPQLIIALSLQVFQQFTGINAIMFYAPVLFTTVGFGSDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             S+I G VNVL+T VSIY+VDK GRR LLL+  +QM +SQ+ + +IL   +   + +L   
Sbjct  325   SVILGAVNVLSTIVSIYSVDKLGRRVLLLEAGVQMFLSQVVIAVILGLKVTDHSDNLSHG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              +  VVIL+C +V AFAWSWGPL WLIPSE FPLETR+A  +  V  N++ TF+IAQAFL
Sbjct  385   YAIFVVILVCTFVSAFAWSWGPLGWLIPSETFPLETRSAAQSVTVCVNLVFTFVIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C  +  IF FFSAW++ M  FVFF +PETK VP++ M E VWK+H +W++F  SDV 
Sbjct  445   SMLCVFKFGIFLFFSAWVLVMSFFVFFLLPETKNVPIEEMTEMVWKKHWLWKRFM-SDVG  503

Query  278   SYE  270
               E
Sbjct  504   DEE  506



>ref|XP_002525597.1| sugar transporter, putative [Ricinus communis]
 gb|EEF36715.1| sugar transporter, putative [Ricinus communis]
Length=509

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 226/308 (73%), Gaps = 0/308 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AA PA++L +GSL ISETP SL+ERGK E+GK  LK++RGV++VE EF  I+   +
Sbjct  200   SLGGAAGPAIILLIGSLAISETPTSLIERGKHEQGKKVLKKIRGVDDVEEEFSEILNAIN  259

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK P+ KL   + +PQL    +LQ+FQQFTGIN +MFYAPVLFQTMG   + SLLS
Sbjct  260   LAKQVKNPWGKLMSTTYRPQLFCGTILQIFQQFTGINVVMFYAPVLFQTMGLGGDASLLS  319

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +++T  +NV+AT ++I  VDK GRR LL+Q  +QM I+Q  +G ILAT LK+T  + ++ 
Sbjct  320   AVVTDSINVVATLIAIACVDKVGRRSLLIQAAVQMFIAQTVMGAILATQLKSTNMIPRSY  379

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  V++LIC++V  FAWSWGPL WLI SEIFPLETR++GF FAVS NM CTFIIAQAFL+
Sbjct  380   ALAVLVLICVFVSGFAWSWGPLGWLIASEIFPLETRSSGFFFAVSMNMFCTFIIAQAFLT  439

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRS  276
             M+C ++   FFFF+ ++  MGLF +  +PETKGVP+D M E+VW +H  W++++R     
Sbjct  440   MLCHLRYMTFFFFAVFLFVMGLFAYCILPETKGVPIDEMNERVWSKHWFWKRYYRDCNTG  499

Query  275   YEMA*IED  252
                  IED
Sbjct  500   KGAQEIED  507



>ref|XP_006838270.1| hypothetical protein AMTR_s00103p00075300 [Amborella trichopoda]
 gb|ERN00839.1| hypothetical protein AMTR_s00103p00075300 [Amborella trichopoda]
Length=522

 Score =   345 bits (884),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 225/298 (76%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L++SETP SLVERG+++EG+A LKR+RG +NVEAEF  +V   +
Sbjct  205   SLGLAGIPALLLTIGALIVSETPNSLVERGRLDEGRAVLKRIRGTDNVEAEFAELVEASE  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             AAK V+ PF+ L  +  +  L+I++ LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   AAKAVQHPFRNLLSRKNRAPLVIAIALQIFQQLTGINAIMFYAPVLFDTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNV++T VSIY+VDK GRR LLL+  +QM ++Q+ + ++L TNL   TG L K+
Sbjct  325   TVITGAVNVVSTVVSIYSVDKLGRRLLLLEAGVQMFMAQIVITVLLGTNLSGETGELSKS  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             +  VVV+++C ++ AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFL
Sbjct  385   VGIVVVVMVCTFISAFAWSWGPLGWLIPSETFPLETRSAGQSITVCVNLLFTFAIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C M+  IF FFS W++ M LFVFF +PETK + ++ M  +VW  H  W++F   +
Sbjct  445   SMLCHMKYGIFAFFSGWVLIMSLFVFFLLPETKNISIEEMPYRVWGSHWFWKRFMEEE  502



>ref|XP_001768225.1| predicted protein [Physcomitrella patens]
 gb|EDQ66839.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   344 bits (883),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/293 (56%), Positives = 220/293 (75%), Gaps = 2/293 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL +A +PA+ + LG L++ +TP SLV+RGK E  +  L+R+RGV+N+E EF+ I+   +
Sbjct  204   SLAIAGLPAIFITLGGLLLPDTPNSLVQRGKHESARQVLRRIRGVDNIEEEFDDILIASN  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A  VK PF+ + K+  +PQL+IS+ LQ FQQFTGINAIMFYAPVLFQT+GF ++ SL S
Sbjct  264   EAASVKHPFRNILKRRNRPQLVISMALQFFQQFTGINAIMFYAPVLFQTLGFGSSASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++I G VNVLAT V+I  VD+ GRR LLL+ CIQM ++Q A+ IILA  LK T  + + L
Sbjct  324   AVIVGAVNVLATCVAIAVVDRFGRRWLLLEACIQMFLAQTAIAIILAAGLKGT-EMPEYL  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
               + V+LIC+YV +FAWSWGPL WLIPSEIFPLETR+AG A  VSTNM+ TF+IAQ FLS
Sbjct  383   GWIAVVLICVYVSSFAWSWGPLGWLIPSEIFPLETRSAGQAITVSTNMVFTFLIAQVFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C  +  IF FF+AW+V M LF +F +PETKG+P++ M + VW +H  W+++
Sbjct  443   MLCAFKWGIFLFFAAWVVVMFLFTYFLIPETKGIPIEEM-DLVWTKHWFWKRY  494



>ref|XP_007143231.1| hypothetical protein PHAVU_007G055100g [Phaseolus vulgaris]
 gb|ESW15225.1| hypothetical protein PHAVU_007G055100g [Phaseolus vulgaris]
Length=507

 Score =   343 bits (881),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 213/288 (74%), Gaps = 1/288 (0%)
 Frame = -1

Query  1130  SLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQVKKPFKKLTKK  951
             + ++ +TP SL+ERG +EEGKA L+R+RG++N+E EF  +V  C  A++VK PF+ + K+
Sbjct  214   AFLVVDTPNSLIERGHLEEGKAVLRRIRGIDNIEPEFLELVDACTVAREVKHPFRNILKR  273

Query  950   SGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGLVNVLATFVS  771
               +PQL+IS+ LQVFQQFTGINAIMFYAPVLF T+GFK + SL S++ITG VNV++T VS
Sbjct  274   RNRPQLLISIALQVFQQFTGINAIMFYAPVLFNTLGFKNDASLYSAVITGAVNVISTVVS  333

Query  770   IYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTG-SLDKTLSTVVVILICLYVMA  594
             IY+VD+ GRR LLL+  +QM +SQ  + +I+   ++     L K  + +VV+++C++V A
Sbjct  334   IYSVDRLGRRMLLLEAGVQMFLSQFVIAVIIGMKVRDHDEDLSKGFAVLVVVMVCIFVSA  393

Query  593   FAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGMQAFIFFFFS  414
             FAWSWGPL WLIPSEIFPLETR+AG + AV  N+LCTF IAQAFLSM+C  +  IF FFS
Sbjct  394   FAWSWGPLSWLIPSEIFPLETRSAGQSIAVCVNLLCTFFIAQAFLSMLCIFKFGIFLFFS  453

Query  413   AWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVRSYE  270
               ++ M  FV   +PETK VP++ M E+VWKQH +W++F   D    E
Sbjct  454   GCVLIMSTFVLLLLPETKNVPIEEMTERVWKQHWLWKRFAEDDCVKEE  501



>ref|XP_006289688.1| hypothetical protein CARUB_v10003245mg [Capsella rubella]
 gb|EOA22586.1| hypothetical protein CARUB_v10003245mg [Capsella rubella]
Length=504

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 220/300 (73%), Gaps = 1/300 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A  PA++L +G+L+++ETP SLVERG ++EGKA L+ +RG  NVE EF  ++    
Sbjct  205   SLGMAGGPALLLTVGALLVTETPNSLVERGHLDEGKAVLRSIRGTHNVEPEFAYLLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L  +  +PQL+++V LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRNLLHRRNRPQLVVTVALQIFQQCTGINAIMFYAPVLFNTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GR  L L+  +QM  S + + IIL   +     ++ + 
Sbjct  325   AVVTGAVNVLSTLVSIYSVDKVGRWVLFLEAGVQMFFSHVVIAIILGNKVTDHYTNISQG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV++IC YV AFAWSWGPL WLIPSEIFPLETR+AG + AV  N+L TFIIAQAFL
Sbjct  385   LAILVVVMICTYVAAFAWSWGPLSWLIPSEIFPLETRSAGQSVAVCVNLLFTFIIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
              M+C ++  IF FFSAW++ M LFV F +PETK VP++ M E+VWK+H  W +F    ++
Sbjct  445   LMLCHLKFGIFIFFSAWVLVMTLFVMFLLPETKNVPIEEMNERVWKKHWFWARFMDDHIQ  504



>ref|XP_006841839.1| hypothetical protein AMTR_s00003p00270500 [Amborella trichopoda]
 gb|ERN03514.1| hypothetical protein AMTR_s00003p00270500 [Amborella trichopoda]
Length=427

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 229/307 (75%), Gaps = 4/307 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LAAVPA ++ +GSL + +TP SL+ERG+ ++  A LKR+RG ++V+ EF+ ++   +
Sbjct  114   SLALAAVPAAIITIGSLFLPDTPNSLIERGRPDQAHAMLKRIRGADDVKEEFQDLIDASE  173

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
             A+K+V+ P++ + ++  +PQL++++ +  FQQ TGIN IMFYAPVLF+T+GF +N SL+S
Sbjct  174   ASKKVENPWRNIVRRKYRPQLVMALAIPFFQQLTGINVIMFYAPVLFKTIGFGSNASLMS  233

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILAT--NLKTTGSLDK  642
             ++ITG+VNV+ATFVSI+TVD+ GRR L L+G IQM ISQ+ +GI+L     L  TG L K
Sbjct  234   AVITGVVNVVATFVSIFTVDRYGRRFLFLEGGIQMFISQVLIGILLGVKFGLSGTGHLSK  293

Query  641   TLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAF  462
               + +VV  IC+YV AFAWSWGPL WL+PSEIFPLE R+AG +  VSTN+L TF IAQAF
Sbjct  294   GYADLVVFFICVYVAAFAWSWGPLGWLVPSEIFPLEIRSAGQSINVSTNLLFTFAIAQAF  353

Query  461   LSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF-RSD  285
             L+M+C ++  +FFFF+ W+  M  F++FF+PETK VP++ M   VW++H  WR+     D
Sbjct  354   LAMLCHLKFGLFFFFAGWVFVMTTFIYFFLPETKNVPIEEMA-LVWRKHWFWRRILPHDD  412

Query  284   VRSYEMA  264
               ++EMA
Sbjct  413   DAAFEMA  419



>ref|XP_001753303.1| predicted protein [Physcomitrella patens]
 gb|EDQ81932.1| predicted protein [Physcomitrella patens]
Length=514

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 218/297 (73%), Gaps = 1/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAAVPAV+L LG L   ETP SL+ERGK E+G+  L R+RG ++V AE++ +V   +
Sbjct  206   SLGLAAVPAVLLTLGGLFCPETPNSLIERGKTEQGRHILTRIRGTDDVNAEYDDMVEASE  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L +K  +PQL++++ +  FQQ TGINA+MFY PVLF T+GF  N SL S
Sbjct  266   IAQRVKHPFRNLLQKRNRPQLVMAIAIPFFQQVTGINAVMFYIPVLFNTIGFSTNASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++ITG VNV+AT VS+  VDK GRR L LQG +QM+ISQ+ +GIILA     T  L K  
Sbjct  326   AVITGAVNVVATLVSLGVVDKWGRRVLFLQGGMQMLISQVIIGIILALKFSGTNELSKGE  385

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             +  +VIL+C+YV AFAWSWGPL WL+PSEIFP+ETR+AG A  V  N++ TF+IAQAFL+
Sbjct  386   AMAIVILVCIYVAAFAWSWGPLGWLVPSEIFPIETRSAGMAITVCVNLIFTFVIAQAFLT  445

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             ++C  +  IF FF+ W+V M +F+  F+PETKGVP++ M+  VW+QH  W++   +D
Sbjct  446   ILCHFEYGIFLFFAGWVVIMTVFIALFLPETKGVPIEEMI-YVWRQHWFWKRIVPAD  501



>ref|XP_010421502.1| PREDICTED: sugar transport protein 13-like [Camelina sativa]
Length=532

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L +G+L+++ETP SLVERG+++EGKA L+ +RG   VE EF  ++    
Sbjct  205   SLGMAGVPALLLTVGALLVTETPNSLVERGRLDEGKAVLRSIRGTHYVEPEFAYLLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL++++ L +FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRHLFQRRNRPQLVVALALPMFQQCTGINAIMFYAPVLFDTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNVL+T VSIY+VDK GRR L L+  +QM  SQ+ + I+L TN+   + ++ + 
Sbjct  325   AVVTGAVNVLSTLVSIYSVDKVGRRVLFLEAGVQMFFSQVVIAIVLGTNVTDHSTNISRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSEIFPL TR+AG + AV  N+L TFIIAQAFL
Sbjct  385   FAVLVVVMICTYVAAFAWSWGPLGWLIPSEIFPLGTRSAGQSVAVCVNLLFTFIIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C  +  IF FFSAW++ M +FV F +PETK VP++ M E+VWK+H  W +F
Sbjct  445   SMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNVPIEEMTERVWKKHWFWGRF  498



>ref|XP_002874309.1| hypothetical protein ARALYDRAFT_489474 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50568.1| hypothetical protein ARALYDRAFT_489474 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 215/287 (75%), Gaps = 1/287 (0%)
 Frame = -1

Query  1154  PAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQVKK  975
             PA++L +G+L+++ETP SLVERG+++EGKA L+R+RG +NVE EF  ++     AK+VK 
Sbjct  209   PALLLTVGALLVTETPNSLVERGRLDEGKAVLRRIRGTDNVEPEFADLLEASRLAKEVKH  268

Query  974   PFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGLV  795
             PF+ L ++  +PQL+I+V LQ+FQQ TGINAIMFYAPVLF T+GF  + SL S+++TG V
Sbjct  269   PFRNLLQRKNRPQLVIAVALQIFQQCTGINAIMFYAPVLFNTVGFGNDASLYSAVVTGAV  328

Query  794   NVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKTLSTVVVI  618
             NVL+T VSIY+VDK GRR LLL+   QM  SQ+ + IIL   +   + +L K  + +VV+
Sbjct  329   NVLSTVVSIYSVDKVGRRFLLLEAGFQMFFSQVVIAIILGIKVTDHSTNLSKGFAILVVV  388

Query  617   LICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGMQ  438
             +IC YV AFAWSWGPL WLIPSE FPLETR+AG +  V  N+L TFIIAQAFLSM+C  +
Sbjct  389   MICTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFLSMLCHFK  448

Query  437   AFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
               IF FFSAW++ M  FV F +PETK VP++ M E+VWK+H  W +F
Sbjct  449   FGIFIFFSAWVLVMSFFVMFLLPETKNVPIEEMTERVWKKHWFWARF  495



>gb|ADJ68005.1| putative hexose transporter [Manihot esculenta]
 gb|ADJ68006.1| putative hexose transporter 2 [Manihot esculenta]
Length=529

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L  GSL++SETP SL+ERG++EEGKA L+++RG + +E EF  +V    
Sbjct  205   SLGLAGIPALLLTFGSLLVSETPNSLIERGRLEEGKAILRKIRGTDKIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+  +PQL+ISV LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   IAKEVKHPFRNLMKRRNRPQLVISVALQIFQQLTGINAIMFYAPVLFDTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG VNV++T VSIY+VD+ GRR LLL+  +QM +SQ+ + IIL   +K  +  L + 
Sbjct  325   AVITGAVNVISTVVSIYSVDRVGRRVLLLEAGVQMFVSQVIIAIILGIKVKDHSEDLHRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             ++ +VVI+IC +V  FAWSWGPL WLIPSE FPLETR+AG +  V  N+L TF IAQAFL
Sbjct  385   IAVLVVIMICTFVSGFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFAIAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IF FFS+W+  M  FVFF VPETK +P++ M E+VWKQH +W++F   +
Sbjct  445   SMLCHFKYGIFLFFSSWVFVMSFFVFFLVPETKNIPIEEMTERVWKQHWLWKRFMDDN  502



>gb|EEC68623.1| hypothetical protein OsI_37004 [Oryza sativa Indica Group]
Length=304

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 215/292 (74%), Gaps = 1/292 (0%)
 Frame = -1

Query  1157  VPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCDAAKQVK  978
             +PA +L L +L + +TP +L+ERG++E+G+A LK++RG +NVEAEF  IV     A++VK
Sbjct  1     MPAALLILCTLFLVDTPNNLIERGRLEKGRAVLKKIRGTDNVEAEFNEIVEASRVAQEVK  60

Query  977   KPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLSSIITGL  798
              PF+ L ++  QPQL+I+VLLQ+FQQ +GINA+MFYAPVLF T+GFK   SL S++ITG 
Sbjct  61    HPFRNLLRRRNQPQLVIAVLLQMFQQVSGINAVMFYAPVLFNTLGFKTETSLYSAVITGG  120

Query  797   VNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKTLSTVVV  621
             VNVL+T VSIY+VD+AGRR LLL+G + M++S +A+ ++    +  ++  L    + +VV
Sbjct  121   VNVLSTLVSIYSVDRAGRRMLLLEGGVYMLLSHVAIAVVFRIKVTDSSDDLGHDWAVLVV  180

Query  620   ILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLSMMCGM  441
             +++C +V +FAWSWGPL WLIPSE FPLE R+ G +  V  NML TF+ AQ FLS++C +
Sbjct  181   VMVCTFVFSFAWSWGPLPWLIPSETFPLEARSVGQSVTVCVNMLFTFVFAQTFLSILCHL  240

Query  440   QAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             +  IF FFS  +V M LFV FF+PETK VP++ M EKVWKQH  W++F   +
Sbjct  241   KYTIFAFFSVCVVVMSLFVLFFLPETKNVPIEEMTEKVWKQHWFWKRFIDDN  292



>ref|XP_004496753.1| PREDICTED: sugar transport protein 13-like [Cicer arietinum]
Length=514

 Score =   341 bits (875),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 224/298 (75%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+  +PA++L LG+ ++ +TP SL++RG +E+GK  L ++RG +NV+ EF  +V    
Sbjct  202   SLGMGGIPALLLTLGAYLVVDTPNSLIQRGHLEQGKIVLTKIRGTDNVDPEFFELVEATR  261

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AKQVK PF+ + +++ +PQL+I++ LQVFQQFTGINAIMFYAPVLF T+GFK + +L S
Sbjct  262   VAKQVKHPFRNILRRNNRPQLVIAIALQVFQQFTGINAIMFYAPVLFNTLGFKHDTALYS  321

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
             ++ITG +NV++T VSIY+VDK GRR LLL+  +QM +SQM + I+L   +K  +  L K 
Sbjct  322   AVITGAINVVSTIVSIYSVDKLGRRGLLLEAGVQMFLSQMVIAIVLGIKVKDHSEELSKG  381

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV+++C++V AFAWSWGPL WLIPSEIFPLETR+AG +  V  N L TF+IAQAFL
Sbjct  382   YAALVVVMVCIFVSAFAWSWGPLGWLIPSEIFPLETRSAGQSVTVCVNFLFTFVIAQAFL  441

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C  +  IFFFFS WI+ M  FV F VPETK VP++ M E+VWKQH +W++F   +
Sbjct  442   SMLCNFKFGIFFFFSGWILIMSAFVLFLVPETKNVPIEEMTERVWKQHWLWKRFVEDE  499



>dbj|BAJ92881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   335 bits (858),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 216/305 (71%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA  PA++L LG+L + +TP SL+ERG + EGK  LK++RG  NVE+EF  IV    
Sbjct  25    SLSLAGFPAMLLTLGALFMVDTPNSLIERGHLVEGKVVLKKIRGTNNVESEFNEIVEASR  84

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A  VK PF  L ++  +P L I+V+LQ+FQQ TGINAIMFYAPVL  T+GFK   SL +
Sbjct  85    IAHDVKHPFCSLLQRRNRPLLTITVMLQMFQQLTGINAIMFYAPVLLTTLGFKTEASLYT  144

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGS-LDKT  639
             ++ITG VNVL+T VS+YTVD+ GRR LLL   +QM +S +A+ +++ T +      +D  
Sbjct  145   TVITGAVNVLSTLVSMYTVDRVGRRMLLLDASMQMFLSLVAMAVVMRTKVTDRSDVIDHN  204

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VVI+IC +V +F+WSWGPL WLIPSE FPLETR+A  +  V TN+L TF+IAQ FL
Sbjct  205   WAIMVVIIICNFVSSFSWSWGPLGWLIPSETFPLETRSARQSICVCTNLLFTFVIAQVFL  264

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C +++FIF FFS  +  M LFV FF+PETK +P++ MVE+VWKQH  W++F      
Sbjct  265   SMLCHLKSFIFVFFSVCVAIMSLFVLFFLPETKNIPIEKMVERVWKQHWFWKRFMNEGCN  324

Query  278   SYEMA  264
             ++ ++
Sbjct  325   NHAIS  329



>ref|XP_008222904.1| PREDICTED: sugar transport protein 13-like [Prunus mume]
Length=566

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 220/298 (74%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLAA+PA +L +GSL++++TP SL+E GK+EEGKA LKR+RGV+NV+ EF  IV    
Sbjct  204   SLGLAAIPACLLTVGSLIVADTPNSLIEPGKLEEGKAVLKRIRGVDNVDPEFLEIVEASH  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK++K PF+ L K+  +PQL+I++ +Q+FQQFTGINAIMFYAPVLF T+G K++ SL S
Sbjct  264   VAKEMKHPFRNLLKRRNRPQLVIAIWMQIFQQFTGINAIMFYAPVLFHTLGLKSDASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKT-TGSLDKT  639
              +ITG VNVL+T VSIY VD+AGRR LLL+   QM   Q+ V II+  NLK  + +LD  
Sbjct  324   VVITGAVNVLSTIVSIYFVDRAGRRVLLLEASFQMFQCQLVVAIIMGHNLKDHSNNLDHG  383

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ +VV ++C +V +F WS GPL WLIPSE+ PLE  +A  + AV TNML TFIIAQAFL
Sbjct  384   LAILVVFMVCSFVFSFGWSLGPLGWLIPSEMLPLEAHSACQSVAVCTNMLFTFIIAQAFL  443

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C M+  IF FF+ W+  M  FV   +PETKGVP++ M E+V KQH  W ++F  +
Sbjct  444   SMLCNMKFGIFLFFTFWVFVMTTFVVVLIPETKGVPIEEMTERVLKQHWFWERYFEDN  501



>ref|XP_010942230.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=523

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/295 (55%), Positives = 220/295 (75%), Gaps = 3/295 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LAAVP  ++ +G+L + +TP SL+ERG  EE KA L+++RG  ++EAEFE +V   +
Sbjct  204   SLALAAVPGAIIAIGALTLPDTPNSLIERGHDEEAKAMLRKIRGTTDIEAEFEDLVVASN  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              +K VK PF  +  +  +PQL +++LL  FQQ TGIN +MFYAPVLF+T+GF ++ SL+S
Sbjct  264   QSKAVKHPFANIRMRKYRPQLTMAILLPFFQQLTGINVVMFYAPVLFKTIGFGSSASLMS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLD--K  642
             S+ITGL+NV+ATFVSI+TVDK GRRKLLL+G IQM + Q+ +GI++A    T+G  D  K
Sbjct  324   SLITGLINVIATFVSIFTVDKLGRRKLLLEGGIQMFLGQIVLGILIAIKFGTSGVADVSK  383

Query  641   TLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAF  462
             T +  VV  IC++V  FAWSWGP+ WL+PSEIFPLE R+AG + +VS NML TF IAQ F
Sbjct  384   TYAIFVVAFICVFVTGFAWSWGPMGWLVPSEIFPLEIRSAGQSISVSMNMLLTFTIAQVF  443

Query  461   LSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             L+M+C M+  +FFFF+AW+  M +FV+FF+PETK VP++ M+  VWK+H  W  F
Sbjct  444   LAMLCHMKFGLFFFFAAWMFIMTMFVYFFLPETKNVPIEEMI-LVWKKHWFWGNF  497



>ref|XP_002889642.1| sugar transport protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65901.1| sugar transport protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 217/298 (73%), Gaps = 2/298 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AAVPA++L +GS  I ETPASL+ERGK E+GK  L+++RGVE++E EF  I    +
Sbjct  201   SLGGAAVPALILLIGSFFIHETPASLIERGKDEKGKQVLRKIRGVEDIELEFNEIKYATE  260

Query  995   AAKQVKKPFKKL-TKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              + +VK PFK+L T +  +P L+   LLQ FQQFTGIN +MFYAPVLFQTMG   N SL+
Sbjct  261   VSTKVKSPFKELFTNRENRPPLVCGTLLQFFQQFTGINVVMFYAPVLFQTMGSGNNASLI  320

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSL-DK  642
             S+++T  VN +AT +S+  VD AGR+ LL++G IQM  +QM +G IL  +LK  G +   
Sbjct  321   STVVTNGVNAVATIISLVMVDLAGRKCLLVEGAIQMTATQMTIGGILLAHLKLVGPITGH  380

Query  641   TLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAF  462
              +  +V++LIC+YV  FAWSWGPL WL+PSEI+PLE R AG+  AV+ NM+CTFII Q F
Sbjct  381   AVPLIVLVLICIYVSGFAWSWGPLGWLVPSEIYPLEVRNAGYFCAVAMNMVCTFIIGQFF  440

Query  461   LSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRS  288
             LS +C  ++++FFFF    +AMGLFV +++PETKGVPV+ M EK WK H  W+K+F+ 
Sbjct  441   LSALCRFRSYLFFFFGVMNIAMGLFVVYYLPETKGVPVEEMAEKRWKTHSRWKKYFKD  498



>ref|NP_001059153.1| Os07g0206600 [Oryza sativa Japonica Group]
 dbj|BAC83237.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF21067.1| Os07g0206600 [Oryza sativa Japonica Group]
 gb|EEC81714.1| hypothetical protein OsI_25324 [Oryza sativa Indica Group]
Length=515

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 232/297 (78%), Gaps = 3/297 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG A VPA +L LGSLVI+ETP SLVERG+ + G+A L+R+RG  +V  E + I   C+
Sbjct  208   SLGGAGVPAAVLFLGSLVITETPTSLVERGRRDAGRATLERIRGTRDVGDELDEIARACE  267

Query  995   AAKQVKKP---FKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGS  825
             AA  +      +++L ++  +P L+I+V +QVFQQFTGINAIMFYAPVLFQTMGFK+NGS
Sbjct  268   AAAALSAEESAYRRLRRRESRPPLVIAVAMQVFQQFTGINAIMFYAPVLFQTMGFKSNGS  327

Query  824   LLSSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLD  645
             LLS+++TG VNV++T VSI  VDK GRR+LLLQ C QM+I+Q AVG I+  ++K  G+  
Sbjct  328   LLSAVVTGGVNVVSTLVSIVAVDKIGRRRLLLQACGQMLIAQTAVGAIMWEHVKANGNPG  387

Query  644   KTLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQA  465
             +  +  +V+LIC+YV +FAWSWGPL WLIPSE FPL TRT GF+FAVS+NML TF+IAQA
Sbjct  388   EKWAVAIVVLICVYVSSFAWSWGPLGWLIPSETFPLATRTTGFSFAVSSNMLFTFLIAQA  447

Query  464   FLSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFF  294
             FLSMMC M+AFIFFFF+ WIV M  FVF+ +PETKGVP+D MV+ VW++H  W++FF
Sbjct  448   FLSMMCSMKAFIFFFFAIWIVIMAAFVFWLLPETKGVPIDEMVDTVWRRHWFWKRFF  504



>ref|XP_009412437.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 219/306 (72%), Gaps = 3/306 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LAAVPA ++ LG+L + +TP SL+ERG  EE K  L+R+RG +++  E+  +VA   
Sbjct  204   SLALAAVPACIISLGALFLPDTPNSLIERGHSEEAKQMLRRIRGTDDINEEYNDLVAASQ  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              +K VK P+  + K+  +PQL +++L+  FQQ TGIN IMFYAPVLF+T+GF +  SL+S
Sbjct  264   ESKVVKHPWSNIMKRKYRPQLTMTILIPFFQQVTGINVIMFYAPVLFKTIGFGSEASLMS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTG--SLDK  642
             ++I+GLVNV ATFVSI+TVDK GRRKL LQG IQM+I Q+ VG ++A    T+G  +L K
Sbjct  324   AVISGLVNVFATFVSIFTVDKLGRRKLFLQGGIQMIICQIIVGTLIAIKFGTSGEATLSK  383

Query  641   TLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAF  462
               +  VV+ IC+YV  FAWSWGPL WL+PSEIFPLE R+AG +  VS NML TF+IAQAF
Sbjct  384   AYAAFVVLFICVYVAGFAWSWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFVIAQAF  443

Query  461   LSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDV  282
             LSM+C M+  +F+FF+ W+V M +F+  F+PETK VP++ M+  VWK H  W KF   D 
Sbjct  444   LSMLCHMKFGLFYFFAGWVVVMTIFIALFLPETKNVPIEEMI-LVWKAHWFWGKFIADDD  502

Query  281   RSYEMA  264
                EM 
Sbjct  503   VRVEMG  508



>ref|XP_001785042.1| predicted protein [Physcomitrella patens]
 gb|EDQ50157.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   339 bits (869),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 217/293 (74%), Gaps = 2/293 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL +A +PA+ + LG +++ +TP SLV+RGK E  +  L+++RG+ENVE EF+ I+   +
Sbjct  204   SLAIAGLPAIFITLGGILLPDTPNSLVQRGKHERARQVLRKIRGIENVEEEFDDILIASN  263

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A  VK PF+ + K+  +PQL+IS++LQ FQQFTGINAIMFYAPVLFQT+GF ++ SL S
Sbjct  264   EAAAVKHPFRNILKRRNRPQLVISMILQFFQQFTGINAIMFYAPVLFQTLGFASSASLYS  323

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             ++I G VNVLAT V+I  VD+ GRR LLL+ CIQM ++Q A+ IILA  L     +   L
Sbjct  324   AVIVGAVNVLATCVAITLVDRIGRRWLLLEACIQMFVAQTAIAIILALGLDGN-YMPTYL  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
               + V LIC+YV +FAWSWGPL WLIPSEIFPLETR+AG A  VSTNM+ TF+IAQ FLS
Sbjct  383   GWIAVALICVYVSSFAWSWGPLGWLIPSEIFPLETRSAGQAITVSTNMVFTFLIAQVFLS  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             M+C  +  IF FF+AW+V M LF +FF+PETKG+P++ M + VW +H  W+ +
Sbjct  443   MLCTFKWGIFLFFAAWVVVMFLFTYFFIPETKGIPIEEM-DLVWTRHWFWKNY  494



>emb|CDY67102.1| BnaA06g39540D [Brassica napus]
Length=503

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 217/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG++ EGKA L+++RG  NVE EF  ++    
Sbjct  205   SLGLAGIPALLLTVGALLVTETPNSLVERGRLNEGKAVLRQIRGTVNVEPEFADLLKASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +P L+I++ LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRNLLQRRNRPHLLIAIALQIFQQCTGINAIMFYAPVLFSTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNV +T VSIY VDK GRR LLL+  +QM  SQ+ + I+L   +   + +L K 
Sbjct  325   AVLTGAVNVPSTLVSIYFVDKVGRRVLLLEAGVQMFFSQLVIAIVLGIKVADHSNNLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSEIFPLETR+AG +  V  N+L TFIIAQAF+
Sbjct  385   FAVLVVVMICTYVAAFAWSWGPLGWLIPSEIFPLETRSAGQSVTVCVNLLFTFIIAQAFV  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
              M+C  +  IF FF +W++ M LFV F +PETK VP++ M E VWK+H  W +F
Sbjct  445   LMLCHFKFGIFIFFCSWVLVMTLFVMFLLPETKNVPIEEMRESVWKKHWFWARF  498



>ref|XP_009151136.1| PREDICTED: sugar transport protein 13-like [Brassica rapa]
Length=503

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 217/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PA++L +G+L+++ETP SLVERG++ EGKA L+++RG  NVE EF  ++    
Sbjct  205   SLGLAGIPALLLTVGALLVTETPNSLVERGRLNEGKAVLRQIRGTVNVEPEFADLLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +P L+I++ LQ+FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRNLLQRRNRPHLLIAIALQIFQQCTGINAIMFYAPVLFSTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             +++TG VNV +T VSIY VDK GRR LLL+  +QM  SQ+ + I+L   +   + +L K 
Sbjct  325   AVLTGAVNVPSTLVSIYFVDKVGRRVLLLEAGVQMFFSQLVIAIVLGIKVADHSNNLSKG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSEIFPLETR+AG +  V  N+L TFIIAQAF+
Sbjct  385   FAVLVVVMICTYVAAFAWSWGPLGWLIPSEIFPLETRSAGQSVTVCVNLLFTFIIAQAFV  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
              M+C  +  IF FF +W++ M LFV F +PETK VP++ M E VWK+H  W +F
Sbjct  445   LMLCHFKFGIFIFFCSWVLVMTLFVMFLLPETKNVPIEEMRESVWKKHWFWARF  498



>ref|XP_004168645.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
Length=511

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA++L +G+L++ +TP SL+ERG +EEGKA LK++RG ENVE E+  I+    
Sbjct  206   SLALAGIPALLLTIGALMVDDTPNSLIERGHLEEGKAVLKKIRGTENVEPEYLEILEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L  +  +P L+I++ LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  266   IAQEVKHPFRNLKMRQNRPPLVIAIWLQIFQQFTGINAIMFYAPVLFNTLGFGNDASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDK GRR LLL+  +QM ISQM + ++L   L+  T S+   
Sbjct  326   AVITGAVNVLSTLVSIYFVDKIGRRMLLLEAGVQMFISQMIIAVVLGVKLQDNTNSMSHG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWS+GPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  386   LAIVVVVMVCSFVSSFAWSFGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFVIAQSFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FFS W+V M LFV F +PETKG+P++ M +KVWKQH  W+++
Sbjct  446   SMLCYMKYGIFLFFSGWVVVMSLFVMFLLPETKGIPIEEMTDKVWKQHWFWKRY  499



>ref|XP_002961014.1| hypothetical protein SELMODRAFT_437470 [Selaginella moellendorffii]
 gb|EFJ38553.1| hypothetical protein SELMODRAFT_437470 [Selaginella moellendorffii]
Length=517

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 220/295 (75%), Gaps = 3/295 (1%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L +GSL + ETP SL+ERG +E GK  L+R+RG +N+  EF+ +V    
Sbjct  203   SLGLAGIPAVLLTVGSLCLCETPNSLIERGHLERGKTVLRRVRGTDNIHEEFDELVEVSR  262

Query  995   AAKQVKKPFKKLT-KKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLL  819
              AK V+ P++ L   ++ +PQL+IS+ LQ+FQQ TGINAIMFYAPVLFQT+GF+++ SL 
Sbjct  263   LAKSVEHPYRNLFFSRAYRPQLVISLALQIFQQLTGINAIMFYAPVLFQTLGFESDASLY  322

Query  818   SSIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGS-LDK  642
             S+ ITG VNV++T VSI TVD+ GRR LLL+  +QM ++Q+ + IIL T LK  GS L  
Sbjct  323   SAAITGAVNVVSTVVSILTVDRFGRRVLLLEAGVQMFLAQVVIAIILGTGLKEDGSQLSH  382

Query  641   TLSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAF  462
               + VVV +IC +V AFAWSWGPL WLIPSEIFPLE R++G +  V TN+L TF+IAQAF
Sbjct  383   AAAIVVVCMICTFVSAFAWSWGPLGWLIPSEIFPLEIRSSGQSVVVCTNLLFTFVIAQAF  442

Query  461   LSMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             LSM+C  +  IF FF+AW++ M  F  F +PETKG+P++ MV  VW++H +WR+F
Sbjct  443   LSMLCHFKYGIFLFFAAWVLVMTTFTLFLIPETKGIPIEEMV-FVWRRHWLWRRF  496



>ref|XP_002312523.1| hypothetical protein POPTR_0008s15050g [Populus trichocarpa]
 gb|EEE89890.1| hypothetical protein POPTR_0008s15050g [Populus trichocarpa]
Length=523

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 218/298 (73%), Gaps = 1/298 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLGLA +PAV+L  G+L++ ETP SL+ERG+++EGK+ L+++RG +N+E EF  +V    
Sbjct  205   SLGLAGIPAVLLTGGALLVLETPNSLIERGRLDEGKSVLRKIRGTDNIEPEFLELVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L K+   PQL I++ LQ+FQQFTGINAIMFYAPVLF T+GF ++ +L S
Sbjct  265   MAKEVKHPFRNLLKRRNWPQLSITIALQIFQQFTGINAIMFYAPVLFDTVGFGSDAALYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             ++I G VNVL+T VSIY+VDK GRR LLL+  +QM  SQ+ + IIL   +   +  L + 
Sbjct  325   AVIIGAVNVLSTCVSIYSVDKVGRRMLLLEAGVQMFFSQVVIAIILGVKVTDDSNDLHRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
                +VV+++C +V AFAWSWGPL WLIPSE FPLETR+AG +  V  N++ TF++AQAFL
Sbjct  385   YGILVVVMVCTFVSAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLIFTFVMAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             SM+C ++  IF FFS W+  M +FV F +PETK +P++ M + VWK+H  W++F   +
Sbjct  445   SMLCTLKFGIFLFFSGWVFIMSIFVVFLLPETKNIPIEEMTDTVWKKHWFWKRFIDDN  502



>ref|XP_010454983.1| PREDICTED: sugar transport protein 13-like [Camelina sativa]
 ref|XP_010454986.1| PREDICTED: sugar transport protein 13-like [Camelina sativa]
Length=532

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 219/294 (74%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG+A VPA++L +G+L+++ETP SLVERG+++EGKA L+ +RG   VE EF  ++    
Sbjct  205   SLGMAGVPALLLTVGALLVTETPNSLVERGRLDEGKAVLRSIRGTHYVEPEFAYLLEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              AK+VK PF+ L ++  +PQL++++ L +FQQ TGINAIMFYAPVLF T+GF ++ SL S
Sbjct  265   LAKEVKHPFRHLFQRRNRPQLVVALALPMFQQCTGINAIMFYAPVLFSTLGFGSDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGS-LDKT  639
             +++TG VNVL+T VSIY+VDK GRR L L+  +QM  SQ+ + I+L T +    + + + 
Sbjct  325   AVVTGAVNVLSTLVSIYSVDKVGRRVLFLEAGVQMFFSQVVIAIVLGTKVTDHSTKISRG  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC YV AFAWSWGPL WLIPSEIFPL TR+AG + AV  N+L TFI+AQAFL
Sbjct  385   FAVLVVVMICTYVAAFAWSWGPLGWLIPSEIFPLGTRSAGQSVAVCVNLLFTFIVAQAFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             S +C ++  IF FFSAW++ M  FV F +PETK VP++ M E+VWK+H  W KF
Sbjct  445   STLCHLKFGIFIFFSAWVLVMSFFVTFLLPETKNVPIEEMSERVWKKHWFWGKF  498



>ref|XP_011032149.1| PREDICTED: sugar transport protein 8 [Populus euphratica]
Length=518

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 221/297 (74%), Gaps = 0/297 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SLG AA PA++L LGSL+I ETP SL+ERGK EEG   LK++RGV+NV+ E+E I    +
Sbjct  203   SLGGAACPALLLLLGSLMIVETPTSLIERGKDEEGLYTLKKIRGVDNVDKEYEEISQAVE  262

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              ++Q++ PFK L K+SG+PQL+   L+Q+FQQFTGI+ +M YAPVLFQTMG   N SL+S
Sbjct  263   FSRQIRHPFKNLWKQSGRPQLVCGALIQIFQQFTGISVVMLYAPVLFQTMGLGENASLMS  322

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLKTTGSLDKTL  636
             +I+T  V  + T  +I  VD+ GRR LL++  IQM IS  A+G+ILA +L +T  + K  
Sbjct  323   AIMTNTVKPIGTAFAIVVVDRFGRRALLIEAAIQMFISLGAIGVILAVHLHSTNVVAKHY  382

Query  635   STVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFLS  456
             + +V++L+C+++ AFAWSWGPL WLIPSEIFP+ETR+AGF+ AV  N + TF++AQ FL+
Sbjct  383   AVLVIVLVCVFLAAFAWSWGPLGWLIPSEIFPIETRSAGFSVAVIMNFVFTFLVAQTFLT  442

Query  455   MMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSD  285
             M+C M+A  FF + A +  M LF  +F+PETKG+P+D MVE+VWKQH  W+++++  
Sbjct  443   MLCHMRAGTFFLYCAMLAVMCLFAKYFLPETKGIPIDEMVERVWKQHWFWKRYYKDH  499



>gb|KGN56998.1| hypothetical protein Csa_3G148800 [Cucumis sativus]
Length=511

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA++L +G+L++ +TP SL+ERG +EEGKA +K++RG ENVE E+  I+    
Sbjct  206   SLALAGIPALLLTIGALMVDDTPNSLIERGHLEEGKAGVKKIRGTENVEPEYLEILEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L  +  +P L+I++ LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  266   IAQEVKHPFRNLKMRQNRPPLVIAIWLQIFQQFTGINAIMFYAPVLFNTLGFGNDASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDK GRR LLL+  +QM ISQM + ++L   L+  T S+   
Sbjct  326   AVITGAVNVLSTLVSIYFVDKIGRRMLLLEAGVQMFISQMIIAVVLGVKLQDNTNSMSHG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWS+GPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  386   LAIVVVVMVCSFVSSFAWSFGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFVIAQSFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FFS W+V M LFV F +PETKG+P++ M +KVWKQH  W+++
Sbjct  446   SMLCYMKYGIFLFFSGWVVVMSLFVMFLLPETKGIPIEEMTDKVWKQHWFWKRY  499



>ref|XP_004134450.1| PREDICTED: sugar transport protein 13-like [Cucumis sativus]
Length=511

 Score =   336 bits (861),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 222/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL LA +PA++L +G+L++ +TP SL+ERG +E+GKA LK++RG ENVE E+  I+    
Sbjct  206   SLALAGIPALLLTIGALMVDDTPNSLIERGHLEKGKAVLKKIRGTENVEPEYLEILEASR  265

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A++VK PF+ L  +  +P L+I++ LQ+FQQFTGINAIMFYAPVLF T+GF  + SL S
Sbjct  266   IAQEVKHPFRNLKMRQNRPPLVIAIWLQIFQQFTGINAIMFYAPVLFNTLGFGNDASLYS  325

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNLK-TTGSLDKT  639
             ++ITG VNVL+T VSIY VDK GRR LLL+  +QM ISQM + ++L   L+  T S+   
Sbjct  326   AVITGAVNVLSTLVSIYFVDKIGRRMLLLEAGVQMFISQMIIAVVLGVKLQDNTNSMSHG  385

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
             L+ VVV+++C +V +FAWS+GPL WLIPSE FPLETR+AG +  V  NM+ TF+IAQ+FL
Sbjct  386   LAIVVVVMVCSFVSSFAWSFGPLGWLIPSETFPLETRSAGQSVTVCVNMVFTFVIAQSFL  445

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKF  297
             SM+C M+  IF FFS W+V M LFV F +PETKG+P++ M +KVWKQH  W+++
Sbjct  446   SMLCYMKYGIFLFFSGWVVVMSLFVMFLLPETKGIPIEEMTDKVWKQHWFWKRY  499



>ref|XP_003575949.1| PREDICTED: sugar transport protein 13-like [Brachypodium distachyon]
Length=519

 Score =   336 bits (862),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 214/302 (71%), Gaps = 1/302 (0%)
 Frame = -1

Query  1175  SLGLAAVPAVMLGLGSLVISETPASLVERGKVEEGKAALKRLRGVENVEAEFETIVAGCD  996
             SL L  +PAV+L LG+L + +TP SL+ERG++EEGKA LK++RG  NVE EF  IV    
Sbjct  205   SLSLGGIPAVVLTLGALFVVDTPNSLIERGQLEEGKAVLKKVRGTNNVEPEFNEIVEASR  264

Query  995   AAKQVKKPFKKLTKKSGQPQLIISVLLQVFQQFTGINAIMFYAPVLFQTMGFKANGSLLS  816
              A +VK PF+ L  +  +P +  +VLLQ+FQQ TGINA+MFYAPVLF T+GFK + SL S
Sbjct  265   VACKVKHPFRSLLHRHNRPLIATTVLLQMFQQLTGINAVMFYAPVLFATLGFKNDASLYS  324

Query  815   SIITGLVNVLATFVSIYTVDKAGRRKLLLQGCIQMVISQMAVGIILATNL-KTTGSLDKT  639
             + +TG VNVL+T VSIYTVD  GRR LLL   +QM +S  A+ +++   +   + +L   
Sbjct  325   AAVTGAVNVLSTLVSIYTVDWVGRRMLLLDAGLQMFLSLAAMAVVMKIKVTDRSDNLGHD  384

Query  638   LSTVVVILICLYVMAFAWSWGPLCWLIPSEIFPLETRTAGFAFAVSTNMLCTFIIAQAFL  459
              + +VV++IC +V +FAWSWGPL WLIPSE FPLETR+AG +  V  N L +F+ AQ FL
Sbjct  385   WAIMVVVIICNFVSSFAWSWGPLGWLIPSETFPLETRSAGQSVCVCVNFLSSFLFAQVFL  444

Query  458   SMMCGMQAFIFFFFSAWIVAMGLFVFFFVPETKGVPVDLMVEKVWKQHPVWRKFFRSDVR  279
             SM+C +  FIF FFSAW++ M LFV FF+PET  VP++ M E+VWKQH  W++FF  D  
Sbjct  445   SMLCHLNCFIFVFFSAWVIIMSLFVLFFLPETTKVPIEEMTERVWKQHWFWKRFFIDDGN  504

Query  278   SY  273
             ++
Sbjct  505   NH  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2881079744160