BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25253_g1_i13 len=646 path=[19033:0-36 28733:37-54 15200:55-61
17747:62-108 29223:109-116 17802:117-136 17822:137-141 17827:142-145
12750:146-212 17896:213-237 17921:238-268 16748:269-302
17985:303-305 17988:306-336 18019:337-367 18049:368-428
15362:429-429 16044:430-454 29383:455-469 18149:470-581
7170:582-645]

Length=646
                                                                      Score     E

ref|XP_006346643.1|  PREDICTED: uncharacterized protein LOC102596878  63.5    7e-16   
ref|XP_004252492.1|  PREDICTED: uncharacterized protein LOC101252964  56.2    1e-14   
emb|CDO98051.1|  unnamed protein product                              60.1    1e-14   
gb|EYU21539.1|  hypothetical protein MIMGU_mgv1a006326mg              63.5    1e-13   
ref|XP_009345999.1|  PREDICTED: uncharacterized protein LOC103937771  57.0    2e-13   
ref|XP_009624172.1|  PREDICTED: uncharacterized protein LOC104115283  57.8    2e-13   
gb|KHG30472.1|  IST1-like protein                                     58.2    4e-13   
ref|XP_011072343.1|  PREDICTED: muscle M-line assembly protein un...  55.5    6e-13   
ref|XP_006341716.1|  PREDICTED: eukaryotic translation initiation...  53.5    2e-12   
ref|XP_008342703.1|  PREDICTED: uncharacterized protein DDB_G0284...  53.1    3e-12   
ref|XP_008342701.1|  PREDICTED: uncharacterized protein LOC103405...  53.1    3e-12   
ref|XP_004235713.1|  PREDICTED: uncharacterized protein LOC101251365  51.2    1e-11   
ref|XP_007024151.1|  Regulator of Vps4 activity in the MVB pathwa...  53.5    3e-11   
ref|XP_002516070.1|  conserved hypothetical protein                   53.9    5e-11   Ricinus communis
ref|XP_010062462.1|  PREDICTED: hepatoma-derived growth factor-re...  52.0    6e-11   
ref|XP_008228522.1|  PREDICTED: uncharacterized protein LOC103327924  52.4    6e-11   
ref|XP_009789851.1|  PREDICTED: uncharacterized protein LOC104237398  46.2    6e-11   
ref|XP_009628260.1|  PREDICTED: uncharacterized protein LOC104118666  46.2    9e-11   
ref|XP_007217726.1|  hypothetical protein PRUPE_ppa005697mg           51.6    1e-10   
gb|KFK42395.1|  hypothetical protein AALP_AA2G250400                  51.6    1e-10   
ref|XP_009587741.1|  PREDICTED: uncharacterized protein LOC104085428  51.6    2e-10   
gb|KDP37221.1|  hypothetical protein JCGZ_06277                       45.8    2e-10   
ref|XP_009797328.1|  PREDICTED: uncharacterized protein LOC104243...  56.2    5e-10   
ref|XP_009353633.1|  PREDICTED: uncharacterized protein LOC103944882  57.0    6e-10   
ref|XP_009353645.1|  PREDICTED: uncharacterized protein LOC103944899  57.0    6e-10   
ref|XP_009772496.1|  PREDICTED: uncharacterized protein LOC104222870  51.2    7e-10   
gb|KFK42396.1|  hypothetical protein AALP_AA2G250400                  51.6    9e-10   
ref|XP_010249755.1|  PREDICTED: uncharacterized protein LOC104592225  58.5    1e-09   
ref|XP_006465523.1|  PREDICTED: DNA topoisomerase 1-like              61.6    2e-09   
ref|XP_010098054.1|  hypothetical protein L484_026185                 47.4    2e-09   
ref|XP_008378772.1|  PREDICTED: lisH domain-containing protein C1...  52.4    2e-09   
ref|XP_006466555.1|  PREDICTED: uncharacterized protein LOC102629217  61.2    3e-09   
ref|XP_009797320.1|  PREDICTED: uncharacterized protein LOC104243...  56.2    3e-09   
ref|XP_009610737.1|  PREDICTED: cyclin-dependent kinase 12 isofor...  53.5    3e-09   
ref|XP_006427005.1|  hypothetical protein CICLE_v10025304mg           60.8    3e-09   
gb|KHN20537.1|  hypothetical protein glysoja_029550                   47.4    4e-09   
gb|KDO51235.1|  hypothetical protein CISIN_1g0114102mg                60.8    4e-09   
ref|XP_002299697.2|  hypothetical protein POPTR_0001s18160g           44.7    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010654667.1|  PREDICTED: uncharacterized protein LOC100251435  43.1    5e-09   
emb|CBI36150.3|  unnamed protein product                              43.1    5e-09   
ref|XP_006385472.1|  hypothetical protein POPTR_0003s05340g           40.4    5e-09   
ref|XP_010323436.1|  PREDICTED: uncharacterized protein LOC101256...  56.6    6e-09   
ref|XP_004305290.1|  PREDICTED: uncharacterized protein LOC101293619  46.2    9e-09   
ref|XP_002889320.1|  hypothetical protein ARALYDRAFT_477272           52.0    9e-09   
gb|AAG52247.1|AC011717_15  unknown protein; 49130-47169               54.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178109.2|  Regulator of Vps4 activity in the MVB pathway p...  54.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031304.1|  Regulator of Vps4 activity in the MVB pathwa...  54.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007592.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  42.4    1e-08   
ref|XP_009610736.1|  PREDICTED: uncharacterized protein LOC104104...  53.5    2e-08   
emb|CDP03341.1|  unnamed protein product                              49.7    2e-08   
ref|XP_004486736.1|  PREDICTED: uncharacterized protein LOC101507...  46.2    2e-08   
ref|XP_008462153.1|  PREDICTED: biorientation of chromosomes in c...  40.8    2e-08   
ref|XP_010323437.1|  PREDICTED: uncharacterized protein LOC101256...  52.0    3e-08   
ref|XP_010323438.1|  PREDICTED: uncharacterized protein LOC101256...  51.6    3e-08   
ref|XP_006302429.1|  hypothetical protein CARUB_v10020510mg           50.8    3e-08   
ref|XP_010656332.1|  PREDICTED: uncharacterized protein LOC104880647  52.8    3e-08   
gb|KHM98759.1|  hypothetical protein glysoja_030812                   48.5    4e-08   
ref|XP_004486735.1|  PREDICTED: uncharacterized protein LOC101507...  46.2    4e-08   
gb|KDO51245.1|  hypothetical protein CISIN_1g024456mg                 61.2    4e-08   
ref|XP_004141848.1|  PREDICTED: uncharacterized protein LOC101220202  40.8    5e-08   
ref|XP_011043454.1|  PREDICTED: uncharacterized protein LOC105138916  45.8    5e-08   
ref|XP_006371896.1|  hypothetical protein POPTR_0018s05830g           45.8    5e-08   
ref|XP_008344097.1|  PREDICTED: uncharacterized protein LOC103406904  49.3    5e-08   
ref|XP_006595474.1|  PREDICTED: uncharacterized protein LOC100790792  45.1    6e-08   
ref|XP_006347864.1|  PREDICTED: ankyrin repeat domain-containing ...  52.8    6e-08   
gb|EPS68178.1|  hypothetical protein M569_06595                       44.3    6e-08   
ref|XP_008362394.1|  PREDICTED: IST1-like protein                     53.1    8e-08   
ref|XP_008354523.1|  PREDICTED: IST1 homolog                          48.5    9e-08   
ref|XP_004512972.1|  PREDICTED: uncharacterized protein LOC101515...  47.8    1e-07   
ref|XP_006385469.1|  hypothetical protein POPTR_0003s053101g          38.9    1e-07   
ref|XP_006388732.1|  hypothetical protein POPTR_0109s00230g           38.9    1e-07   
ref|XP_010538025.1|  PREDICTED: uncharacterized protein LOC104812...  43.1    1e-07   
ref|XP_010538026.1|  PREDICTED: uncharacterized protein LOC104812...  43.1    1e-07   
gb|KHN32613.1|  IST1-like protein                                     44.7    1e-07   
ref|XP_006389711.1|  hypothetical protein EUTSA_v10018725mg           49.7    1e-07   
gb|KDP33662.1|  hypothetical protein JCGZ_07233                       47.4    1e-07   
emb|CDY41108.1|  BnaC05g10990D                                        46.6    1e-07   
ref|XP_009347177.1|  PREDICTED: uncharacterized protein LOC103938859  45.1    1e-07   
gb|KCW79693.1|  hypothetical protein EUGRSUZ_C01045                   49.3    1e-07   
emb|CDY37561.1|  BnaA02g20090D                                        46.6    2e-07   
ref|XP_004242950.1|  PREDICTED: uncharacterized protein LOC101256...  52.0    2e-07   
ref|XP_010473010.1|  PREDICTED: uncharacterized protein LOC104752541  50.8    2e-07   
ref|XP_003630799.1|  IST1-like protein                                44.7    2e-07   
ref|XP_008242618.1|  PREDICTED: G patch domain-containing protein 8   45.8    2e-07   
ref|XP_009128459.1|  PREDICTED: uncharacterized protein LOC103853288  43.5    3e-07   
ref|XP_004506922.1|  PREDICTED: uncharacterized protein LOC101512015  42.7    4e-07   
ref|XP_009374011.1|  PREDICTED: uncharacterized protein LOC103962956  45.1    5e-07   
ref|XP_003604452.1|  IST1-like protein                                46.2    6e-07   
ref|XP_004512970.1|  PREDICTED: uncharacterized protein LOC101515...  47.8    7e-07   
gb|KDO50897.1|  hypothetical protein CISIN_1g006077mg                 50.8    7e-07   
ref|XP_006451156.1|  hypothetical protein CICLE_v10007676mg           50.8    7e-07   
ref|XP_006475623.1|  PREDICTED: uncharacterized protein LOC102616577  50.8    7e-07   
ref|XP_004512971.1|  PREDICTED: uncharacterized protein LOC101515...  47.8    8e-07   
ref|XP_010047736.1|  PREDICTED: uncharacterized protein LOC104436...  48.9    8e-07   
ref|XP_010047737.1|  PREDICTED: uncharacterized protein LOC104436...  49.7    1e-06   
ref|XP_010430041.1|  PREDICTED: uncharacterized protein LOC104714391  47.8    1e-06   
gb|AES86649.2|  regulator of Vps4 activity in the MVB pathway pro...  46.2    1e-06   
ref|XP_008337435.1|  PREDICTED: uncharacterized protein LOC103400560  45.1    2e-06   
ref|XP_003597767.1|  IST1-like protein                                42.4    2e-06   
ref|XP_002514318.1|  conserved hypothetical protein                   42.4    2e-06   Ricinus communis
ref|XP_004287101.1|  PREDICTED: uncharacterized protein LOC101304409  42.4    3e-06   
gb|KHN47812.1|  IST1-like protein                                     45.4    3e-06   
ref|XP_003533053.1|  PREDICTED: uncharacterized protein LOC100792068  45.4    5e-06   
gb|KHG09331.1|  IST1-like protein                                     38.9    5e-06   
ref|XP_011093573.1|  PREDICTED: uncharacterized protein LOC105173509  47.4    5e-06   
ref|XP_010545712.1|  PREDICTED: uncharacterized protein LOC104817992  45.8    6e-06   
ref|XP_011001627.1|  PREDICTED: uncharacterized protein LOC105108854  33.9    6e-06   
ref|XP_004503434.1|  PREDICTED: serine/arginine-rich splicing fac...  42.4    6e-06   
ref|XP_007150621.1|  hypothetical protein PHAVU_005G167600g           44.3    8e-06   
ref|XP_010417771.1|  PREDICTED: uncharacterized protein LOC104703452  49.3    9e-06   
gb|EYU18264.1|  hypothetical protein MIMGU_mgv1a003486mg              47.0    1e-05   
ref|XP_007013195.1|  Regulator of Vps4 activity in the MVB pathwa...  42.4    1e-05   
ref|XP_007135690.1|  hypothetical protein PHAVU_010G150200g           42.4    1e-05   
ref|XP_004242213.1|  PREDICTED: IST1-like protein                     42.4    2e-05   
ref|XP_009126121.1|  PREDICTED: uncharacterized protein LOC103851047  39.3    2e-05   
emb|CDX75238.1|  BnaA01g04640D                                        39.3    2e-05   
gb|KHG29697.1|  IST1-like protein                                     42.0    2e-05   
ref|XP_007150620.1|  hypothetical protein PHAVU_005G167500g           42.4    4e-05   
ref|XP_010254132.1|  PREDICTED: uncharacterized protein LOC104595...  44.7    5e-05   
gb|KHN39341.1|  IST1-like protein                                     43.9    5e-05   
ref|XP_006356261.1|  PREDICTED: uncharacterized protein LOC102584536  40.8    5e-05   
ref|XP_006582997.1|  PREDICTED: uncharacterized protein LOC102665874  44.3    6e-05   
ref|XP_010254133.1|  PREDICTED: uncharacterized protein LOC104595...  44.3    6e-05   
gb|KFK35790.1|  hypothetical protein AALP_AA4G036900                  44.3    6e-05   
ref|XP_009406523.1|  PREDICTED: uncharacterized protein LOC103989415  48.1    6e-05   
ref|XP_003529997.1|  PREDICTED: uncharacterized protein LOC100775349  46.2    7e-05   
gb|KHN20684.1|  IST1 like                                             46.2    7e-05   
gb|KHN45649.1|  IST1 like                                             46.2    8e-05   
ref|XP_006587516.1|  PREDICTED: uncharacterized protein LOC100820462  46.2    8e-05   
emb|CDX68838.1|  BnaC01g06150D                                        37.0    1e-04   
gb|KFK29843.1|  hypothetical protein AALP_AA7G186000                  36.2    2e-04   
ref|XP_010535999.1|  PREDICTED: uncharacterized protein LOC104811108  38.5    2e-04   
ref|XP_009144854.1|  PREDICTED: uncharacterized protein LOC103868512  42.7    3e-04   
emb|CDY49897.1|  BnaA05g14960D                                        43.1    3e-04   
ref|XP_010688190.1|  PREDICTED: uncharacterized protein LOC104902188  40.0    3e-04   
ref|XP_008463380.1|  PREDICTED: uncharacterized protein LOC103501...  38.5    5e-04   
ref|XP_008463379.1|  PREDICTED: uncharacterized protein LOC103501...  37.7    7e-04   
ref|XP_003532487.1|  PREDICTED: uncharacterized protein LOC100812...  42.0    8e-04   
ref|XP_006584836.1|  PREDICTED: uncharacterized protein LOC100812...  42.0    9e-04   



>ref|XP_006346643.1| PREDICTED: uncharacterized protein LOC102596878, partial [Solanum 
tuberosum]
Length=455

 Score = 63.5 bits (153),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGL  300
            IF ERYGN+L+CFVNKE V KLKS  P+KD K QLM+DI ++  G R   K L
Sbjct  67   IFTERYGNSLECFVNKEIVSKLKSQPPTKDMKLQLMRDI-AVESGVRWNSKAL  118


 Score = 34.7 bits (78),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAVSTLMF+AA
Sbjct  35   RECPEECREAVSTLMFSAA  53


 Score = 32.3 bits (72),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKP  322
            G+ WNSKALEHKL KP
Sbjct  110  GVRWNSKALEHKLSKP  125



>ref|XP_004252492.1| PREDICTED: uncharacterized protein LOC101252964 [Solanum lycopersicum]
Length=510

 Score = 56.2 bits (134),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGL  300
            IF ERYGN+L+C+VNKE V KLKS    KD K QLM+DI ++  G R   K L
Sbjct  125  IFNERYGNSLECYVNKEIVSKLKSQPSIKDMKLQLMRDI-AVESGVRWNSKAL  176


 Score = 35.8 bits (81),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (66%), Gaps = 4/32 (13%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQVSFLTSFMSIS  370
            G+ WNSKALEHKL KP    Q++   S MS S
Sbjct  168  GVRWNSKALEHKLSKP----QIAVQDSLMSHS  195


 Score = 34.7 bits (78),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAVSTLMF+AA
Sbjct  93   RECPEECREAVSTLMFSAA  111



>emb|CDO98051.1| unnamed protein product [Coffea canephora]
Length=464

 Score = 60.1 bits (144),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  TIF ER+GN+++ +VNKEFV KLKS  P+KD K QLMQDI
Sbjct  119  LRELRTIFTERFGNSIELYVNKEFVHKLKSTPPTKDMKLQLMQDI  163


 Score = 34.7 bits (78),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPA  328
            GI+WNSK LE KLYK PA
Sbjct  168  GIEWNSKTLEQKLYKSPA  185


 Score = 32.0 bits (71),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EA S+LMFAAA
Sbjct  93   RECPEECREAASSLMFAAA  111



>gb|EYU21539.1| hypothetical protein MIMGU_mgv1a006326mg [Erythranthe guttata]
Length=448

 Score = 63.5 bits (153),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+ERYGN+LD +VNK+F EKLKSG PSKD+K  L+QDI
Sbjct  124  TVFSERYGNSLDIYVNKQFGEKLKSGPPSKDEKLHLLQDI  163


 Score = 32.0 bits (71),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EA S+LMFAAA
Sbjct  93   RECPEECREAASSLMFAAA  111


 Score = 26.9 bits (58),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPA  328
            G++WNSK LE+KL+   A
Sbjct  168  GLEWNSKVLENKLFNESA  185



>ref|XP_009345999.1| PREDICTED: uncharacterized protein LOC103937771 [Pyrus x bretschneideri]
Length=473

 Score = 57.0 bits (136),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS  P+K+ K QLM DI
Sbjct  124  TLFSEKYGNSLEPFLNKEFVERLKSKPPTKEMKIQLMHDI  163


 Score = 34.7 bits (78),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KLY PPA +Q
Sbjct  167  FSIEWDSKALEQKLYTPPAPDQ  188


 Score = 30.8 bits (68),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV +LM+AAA
Sbjct  96   PEECKEAVPSLMYAAA  111



>ref|XP_009624172.1| PREDICTED: uncharacterized protein LOC104115283 [Nicotiana tomentosiformis]
Length=534

 Score = 57.8 bits (138),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
             F ERYGN+L+ FVNKEFVEKLKS  P+K+ K QLM+DI
Sbjct  125  TFTERYGNSLELFVNKEFVEKLKSQPPTKEMKLQLMRDI  163


 Score = 35.0 bits (79),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PEDC+EA STLMFAAA
Sbjct  96   PEDCREAASTLMFAAA  111


 Score = 28.9 bits (63),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQ  337
            GI WNS+ LE KLYK    EQ
Sbjct  168  GIKWNSRDLEQKLYKQLMSEQ  188



>gb|KHG30472.1| IST1-like protein [Gossypium arboreum]
Length=487

 Score = 58.2 bits (139),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            TIF E+YGN+LD ++N+EFV+KLK+  P+KD K QLM DI
Sbjct  124  TIFTEKYGNSLDSYLNQEFVQKLKAEPPTKDTKLQLMHDI  163


 Score = 34.7 bits (78),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            +  +W+SKALE KL+KPP +EQ
Sbjct  167  FSFEWDSKALEQKLFKPPPLEQ  188


 Score = 27.7 bits (60),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +L++AAA
Sbjct  96   PEECREAVPSLIYAAA  111



>ref|XP_011072343.1| PREDICTED: muscle M-line assembly protein unc-89 [Sesamum indicum]
Length=437

 Score = 55.5 bits (132),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+ +E+YGN+LDC++NKEF +K+K   PSKD K QL+Q+I
Sbjct  124  TLVSEKYGNSLDCYLNKEFAKKMKPDPPSKDLKLQLLQEI  163


 Score = 33.1 bits (74),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAVS+L+FAAA
Sbjct  93   KECPEECKEAVSSLVFAAA  111


 Score = 31.6 bits (70),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 1/24 (4%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQVSF  346
            GI+WNSKALE+KL+   +++Q SF
Sbjct  168  GIEWNSKALENKLFN-DSVKQQSF  190



>ref|XP_006341716.1| PREDICTED: eukaryotic translation initiation factor 4 gamma-like 
[Solanum tuberosum]
Length=476

 Score = 53.5 bits (127),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            L E  ++F ERYGN L+C VNKEF++ LKS  P+ + K QLM+DI S
Sbjct  119  LRELRSVFTERYGNFLECHVNKEFLQNLKSVPPTMEMKIQLMKDIAS  165


 Score = 34.7 bits (78),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQ  337
            GI+WNSKALE KLY P   EQ
Sbjct  168  GIEWNSKALEQKLYNPLVSEQ  188


 Score = 30.4 bits (67),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV++L+FAAA
Sbjct  93   RECPEECREAVASLIFAAA  111



>ref|XP_008342703.1| PREDICTED: uncharacterized protein DDB_G0284459 isoform X2 [Malus 
domestica]
Length=434

 Score = 53.1 bits (126),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS   +K+ K QLM DI
Sbjct  85   TLFSEKYGNSLEPFLNKEFVERLKSKPSTKEMKIQLMHDI  124


 Score = 34.3 bits (77),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KLY PPA +Q
Sbjct  128  FSIEWDSKALEQKLYTPPAPDQ  149


 Score = 30.4 bits (67),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV +LM+AAA
Sbjct  57   PEECKEAVPSLMYAAA  72



>ref|XP_008342701.1| PREDICTED: uncharacterized protein LOC103405475 isoform X1 [Malus 
domestica]
 ref|XP_008342702.1| PREDICTED: uncharacterized protein LOC103405475 isoform X1 [Malus 
domestica]
Length=473

 Score = 53.1 bits (126),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS   +K+ K QLM DI
Sbjct  124  TLFSEKYGNSLEPFLNKEFVERLKSKPSTKEMKIQLMHDI  163


 Score = 34.3 bits (77),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KLY PPA +Q
Sbjct  167  FSIEWDSKALEQKLYTPPAPDQ  188


 Score = 30.8 bits (68),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV +LM+AAA
Sbjct  96   PEECKEAVPSLMYAAA  111



>ref|XP_004235713.1| PREDICTED: uncharacterized protein LOC101251365 [Solanum lycopersicum]
Length=476

 Score = 51.2 bits (121),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            L E  ++F ERYGN L+C VNKEF + LKS  P+ + K QLM+DI S
Sbjct  119  LRELRSLFTERYGNFLECHVNKEFHQNLKSVPPTMEMKIQLMKDIAS  165


 Score = 33.9 bits (76),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQVS  343
            GI+WN+KALE KLY P   EQ S
Sbjct  168  GIEWNAKALEQKLYNPLVSEQDS  190


 Score = 30.4 bits (67),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV++L+FAAA
Sbjct  93   RECPEECREAVASLIFAAA  111



>ref|XP_007024151.1| Regulator of Vps4 activity in the MVB pathway protein, putative 
[Theobroma cacao]
 gb|EOY26773.1| Regulator of Vps4 activity in the MVB pathway protein, putative 
[Theobroma cacao]
Length=511

 Score = 53.5 bits (127),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ERYGN+L+ F+N+EFV KLK+  P+K+ K QLM D+
Sbjct  124  TMFTERYGNSLESFLNQEFVWKLKAEPPTKEMKLQLMHDV  163


 Score = 32.7 bits (73),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KL+KPP  +Q
Sbjct  167  FSIEWDSKALEQKLFKPPPPQQ  188


 Score = 28.1 bits (61),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEA+ +L++AAA
Sbjct  96   PEECKEAIPSLIYAAA  111



>ref|XP_002516070.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46490.1| conserved hypothetical protein [Ricinus communis]
Length=500

 Score = 53.9 bits (128),  Expect(3) = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +1

Query  112  ARIA----LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ARIA    L +  T+F ERYGN L+CF+NKEF E LK    +K+ K QLM DI
Sbjct  111  ARIAEFPELRDLRTLFNERYGNCLECFLNKEFAETLKPTPATKEMKLQLMHDI  163


 Score = 31.6 bits (70),  Expect(3) = 5e-11, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPA  328
            + I+WNSK LE KL++PP+
Sbjct  167  FNIEWNSKPLEQKLFRPPS  185


 Score = 28.5 bits (62),  Expect(3) = 5e-11, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV +L++AAA
Sbjct  93   RECPEECREAVQSLIYAAA  111



>ref|XP_010062462.1| PREDICTED: hepatoma-derived growth factor-related protein 2 [Eucalyptus 
grandis]
 gb|KCW69602.1| hypothetical protein EUGRSUZ_F03020 [Eucalyptus grandis]
Length=501

 Score = 52.0 bits (123),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYG +L+ FVNKEFVEK+++   +KD K QLM DI
Sbjct  124  SLFADRYGKSLEPFVNKEFVEKMRTPERTKDMKLQLMHDI  163


 Score = 31.6 bits (70),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + +DW+SKALE KLY P   +Q
Sbjct  167  FSVDWDSKALEQKLYNPTTHDQ  188


 Score = 29.6 bits (65),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EA+++LM+AAA
Sbjct  96   PEECREAIASLMYAAA  111



>ref|XP_008228522.1| PREDICTED: uncharacterized protein LOC103327924 [Prunus mume]
Length=448

 Score = 52.4 bits (124),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+ FVNKE VE+LK+  P+K+ K QL+ DI
Sbjct  125  MFTERYGNSLEPFVNKELVERLKAKPPTKEMKIQLLHDI  163


 Score = 31.2 bits (69),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KLY P  ++Q
Sbjct  167  FSIEWDSKALEQKLYTPSPLDQ  188


 Score = 29.6 bits (65),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +LM+AAA
Sbjct  96   PEECREAVPSLMYAAA  111



>ref|XP_009789851.1| PREDICTED: uncharacterized protein LOC104237398 [Nicotiana sylvestris]
Length=493

 Score = 46.2 bits (108),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            ++F ERY N+++C+V+KEFV+ LKS   +K+ K QLM+DI S
Sbjct  124  SVFTERYENSVECYVSKEFVQNLKSL-ATKEMKLQLMKDIAS  164


 Score = 35.0 bits (79),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQ  337
            GI+WNSKALE KLY P   EQ
Sbjct  167  GIEWNSKALEQKLYNPLVSEQ  187


 Score = 32.0 bits (71),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAVS+L+FAAA
Sbjct  93   RECPEECREAVSSLIFAAA  111



>ref|XP_009628260.1| PREDICTED: uncharacterized protein LOC104118666 [Nicotiana tomentosiformis]
Length=492

 Score = 46.2 bits (108),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            ++F ERY N+++C+V+KEFV+ LKS   +K+ K QLM+DI S
Sbjct  124  SVFTERYENSVECYVSKEFVQNLKSV-ATKEMKLQLMKDIAS  164


 Score = 35.0 bits (79),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQ  337
            GI+WNSKALE KLY P   EQ
Sbjct  167  GIEWNSKALEQKLYNPLVSEQ  187


 Score = 31.6 bits (70),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+L+FAAA
Sbjct  96   PEECREAVSSLIFAAA  111



>ref|XP_007217726.1| hypothetical protein PRUPE_ppa005697mg [Prunus persica]
 gb|EMJ18925.1| hypothetical protein PRUPE_ppa005697mg [Prunus persica]
Length=447

 Score = 51.6 bits (122),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+ FVNKE VE+LK+  P+K+ K QL+ D+
Sbjct  125  MFTERYGNSLEPFVNKELVERLKAKPPTKEMKIQLLHDV  163


 Score = 31.2 bits (69),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKALE KLY P  ++Q
Sbjct  167  FSIEWDSKALEQKLYTPSPLDQ  188


 Score = 29.6 bits (65),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +LM+AAA
Sbjct  96   PEECREAVPSLMYAAA  111



>gb|KFK42395.1| hypothetical protein AALP_AA2G250400 [Arabis alpina]
Length=387

 Score = 51.6 bits (122),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYGN+L+ FVN EFVE+ K+  PSK+ K QL+++I
Sbjct  124  SLFADRYGNSLEQFVNPEFVERFKAEPPSKEMKIQLLEEI  163


 Score = 33.9 bits (76),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQV  340
             I WN+KALE +LY PP I Q+
Sbjct  168  SIKWNAKALEQRLYTPPPINQI  189


 Score = 26.9 bits (58),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            + P++C+EA+S++++AAA
Sbjct  94   RCPDECREAISSIVYAAA  111



>ref|XP_009587741.1| PREDICTED: uncharacterized protein LOC104085428 [Nicotiana tomentosiformis]
Length=351

 Score = 51.6 bits (122),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            TIF+ERYGN+L+ +V+K+F EKLK     KD K QLMQDI
Sbjct  124  TIFSERYGNSLEFYVSKQFAEKLKPVPHKKDMKVQLMQDI  163


 Score = 32.7 bits (73),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV++LMFAAA
Sbjct  93   RECPENCREAVASLMFAAA  111


 Score = 27.7 bits (60),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYK  319
            GI+WNSKAL+ +LY+
Sbjct  168  GIEWNSKALQQELYE  182



>gb|KDP37221.1| hypothetical protein JCGZ_06277 [Jatropha curcas]
Length=467

 Score = 45.8 bits (107),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 4/53 (8%)
 Frame = +1

Query  112  ARIA----LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ARIA    L +  ++F ERYGN+L+ + NKEF E L+    SK+ K QLM +I
Sbjct  92   ARIAEFPELRDLRSLFTERYGNSLEPYTNKEFAEMLRPTSASKEMKLQLMHEI  144


 Score = 35.0 bits (79),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+WNSK+LE KL+KPP+ ++
Sbjct  148  FSIEWNSKSLEQKLFKPPSTQE  169


 Score = 30.4 bits (67),  Expect(3) = 2e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAV +L++AAA
Sbjct  74   KECPEECKEAVQSLIYAAA  92



>ref|XP_009797328.1| PREDICTED: uncharacterized protein LOC104243766 isoform X2 [Nicotiana 
sylvestris]
Length=595

 Score = 56.2 bits (134),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVEKL S  P+ +K+ QL+QDI
Sbjct  68   LFQERYGNSLECFVNQKFVEKLSSRPPAMEKRIQLLQDI  106


 Score = 34.7 bits (78),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PEDC+EAV++LMFAAA
Sbjct  33   QKLRDCPEDCREAVASLMFAAA  54



>ref|XP_009353633.1| PREDICTED: uncharacterized protein LOC103944882 [Pyrus x bretschneideri]
 ref|XP_009353634.1| PREDICTED: uncharacterized protein LOC103944882 [Pyrus x bretschneideri]
Length=448

 Score = 57.0 bits (136),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS  P+K+ K QLM DI
Sbjct  124  TLFSEKYGNSLEPFLNKEFVERLKSKPPTKEMKIQLMHDI  163


 Score = 26.9 bits (58),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 2/24 (8%)
 Frame = +2

Query  272  WGIDWNSKALEHKL--YKPPAIEQ  337
            + I+W+SKALE KL    PPA +Q
Sbjct  167  FSIEWDSKALEQKLNTNTPPASDQ  190


 Score = 25.8 bits (55),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ KEAV ++M+AAA
Sbjct  96   PEEGKEAVRSIMYAAA  111



>ref|XP_009353645.1| PREDICTED: uncharacterized protein LOC103944899 [Pyrus x bretschneideri]
Length=515

 Score = 57.0 bits (136),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS  P+K+ K QLM DI
Sbjct  191  TLFSEKYGNSLEPFLNKEFVERLKSKPPTKEMKIQLMHDI  230


 Score = 27.3 bits (59),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 2/24 (8%)
 Frame = +2

Query  272  WGIDWNSKALEHKL--YKPPAIEQ  337
            + I+W+SKALE KL    PPA +Q
Sbjct  234  FSIEWDSKALEQKLNTNTPPASDQ  257


 Score = 25.8 bits (55),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ KEAV ++M+AAA
Sbjct  163  PEEGKEAVRSIMYAAA  178



>ref|XP_009772496.1| PREDICTED: uncharacterized protein LOC104222870 [Nicotiana sylvestris]
Length=351

 Score = 51.2 bits (121),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            TIF+ERYGN+L+ +V+K+F EKLK     KD K QLMQDI
Sbjct  124  TIFSERYGNSLEFYVSKQFTEKLKPVPHKKDMKLQLMQDI  163


 Score = 31.2 bits (69),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++  EDC+EAV++LMFAAA
Sbjct  93   RECSEDCREAVASLMFAAA  111


 Score = 27.3 bits (59),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYK  319
            G +WNSKAL+ KLY+
Sbjct  168  GTEWNSKALQQKLYE  182



>gb|KFK42396.1| hypothetical protein AALP_AA2G250400 [Arabis alpina]
Length=386

 Score = 51.6 bits (122),  Expect(3) = 9e-10, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYGN+L+ FVN EFVE+ K+  PSK+ K QL+++I
Sbjct  124  SLFADRYGNSLEQFVNPEFVERFKAEPPSKEMKIQLLEEI  163


 Score = 30.8 bits (68),  Expect(3) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAI  331
             I WN+KALE +LY PP I
Sbjct  168  SIKWNAKALEQRLYTPPPI  186


 Score = 26.9 bits (58),  Expect(3) = 9e-10, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            + P++C+EA+S++++AAA
Sbjct  94   RCPDECREAISSIVYAAA  111



>ref|XP_010249755.1| PREDICTED: uncharacterized protein LOC104592225 [Nelumbo nucifera]
Length=594

 Score = 58.5 bits (140),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            IF E+YGN+L+ F+N+EFV+KL S  P+KDKK QLMQDI
Sbjct  125  IFTEKYGNSLEAFINQEFVDKLASKTPTKDKKLQLMQDI  163


 Score = 30.8 bits (68),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +LMFAAA
Sbjct  96   PEECREAVPSLMFAAA  111



>ref|XP_006465523.1| PREDICTED: DNA topoisomerase 1-like [Citrus sinensis]
Length=552

 Score = 61.6 bits (148),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ERYGN+L+ F+NKEF EKL+SG PSK+KK QL+ DI
Sbjct  123  TVFTERYGNSLEHFLNKEFAEKLRSGPPSKEKKLQLLHDI  162


 Score = 27.3 bits (59),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P +CKEAV +LM +AA
Sbjct  92   RECPNECKEAVQSLMHSAA  110



>ref|XP_010098054.1| hypothetical protein L484_026185 [Morus notabilis]
 gb|EXB74491.1| hypothetical protein L484_026185 [Morus notabilis]
Length=483

 Score = 47.4 bits (111),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQD  255
            +IF ERYGN+LD + +KEFVE+L+    +K+ K QL+QD
Sbjct  124  SIFTERYGNSLDSYTSKEFVERLRQKDFTKEMKLQLLQD  162


 Score = 31.6 bits (70),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQVS  343
             I+W+SKALE KL+ PP ++  S
Sbjct  168  SIEWDSKALEQKLFTPPPVQNQS  190


 Score = 29.6 bits (65),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAVS+L +AAA
Sbjct  93   RECPEECREAVSSLNYAAA  111



>ref|XP_008378772.1| PREDICTED: lisH domain-containing protein C1711.05-like [Malus 
domestica]
Length=458

 Score = 52.4 bits (124),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS   +K+ K QLM DI
Sbjct  124  TLFSEKYGNSLEPFLNKEFVERLKSKPLTKETKIQLMHDI  163


 Score = 30.0 bits (66),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV ++M+AAA
Sbjct  96   PEECKEAVRSIMYAAA  111


 Score = 25.4 bits (54),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 17/24 (71%), Gaps = 2/24 (8%)
 Frame = +2

Query  272  WGIDWNSKALEHKLY--KPPAIEQ  337
            + I+W+S++LE KLY   P A +Q
Sbjct  167  FSIEWDSRSLEQKLYTNTPSASDQ  190



>ref|XP_006466555.1| PREDICTED: uncharacterized protein LOC102629217 [Citrus sinensis]
Length=372

 Score = 61.2 bits (147),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = +1

Query  100  LQQPARIA----LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +   AR A    L E  T+F ERYGN+L+ F+NKEF EKL+SG PSK+KK QL+ DI
Sbjct  106  MHSAARFADMPELRELRTVFTERYGNSLEPFLNKEFAEKLRSGPPSKEKKLQLLHDI  162


 Score = 26.9 bits (58),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P +CKEAV +LM +AA
Sbjct  92   RECPNECKEAVQSLMHSAA  110



>ref|XP_009797320.1| PREDICTED: uncharacterized protein LOC104243766 isoform X1 [Nicotiana 
sylvestris]
Length=652

 Score = 56.2 bits (134),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVEKL S  P+ +K+ QL+QDI
Sbjct  125  LFQERYGNSLECFVNQKFVEKLSSRPPAMEKRIQLLQDI  163


 Score = 32.0 bits (71),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PEDC+EAV++LMFAAA
Sbjct  90   QKLRDCPEDCREAVASLMFAAA  111



>ref|XP_009610737.1| PREDICTED: cyclin-dependent kinase 12 isoform X2 [Nicotiana tomentosiformis]
Length=596

 Score = 53.5 bits (127),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVEKL S  P+ +K+ QL+Q I
Sbjct  68   LFQERYGNSLECFVNQKFVEKLSSRPPAMEKRIQLLQGI  106


 Score = 34.7 bits (78),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PEDC+EAV++LMFAAA
Sbjct  33   QKLRDCPEDCREAVASLMFAAA  54



>ref|XP_006427005.1| hypothetical protein CICLE_v10025304mg [Citrus clementina]
 gb|ESR40245.1| hypothetical protein CICLE_v10025304mg [Citrus clementina]
Length=552

 Score = 60.8 bits (146),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ERYGN+L+ F+NKEF EKL+SG PSK+KK QL+ DI
Sbjct  123  TVFTERYGNSLEPFLNKEFAEKLRSGPPSKEKKLQLLLDI  162


 Score = 27.3 bits (59),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P +CKEAV +LM +AA
Sbjct  92   RECPNECKEAVQSLMHSAA  110



>gb|KHN20537.1| hypothetical protein glysoja_029550 [Glycine soja]
Length=128

 Score = 47.4 bits (111),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  T+F  ++GN+L+ +++KEFVEKL+   PSK+ K QL+ D+
Sbjct  53   LRELRTLFTGKFGNSLELYISKEFVEKLRQDLPSKEMKIQLLHDV  97


 Score = 36.6 bits (83),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQVSF  346
            + I+WNSKALE +L  PP + +VSF
Sbjct  101  FSIEWNSKALEQRLQSPPQLHEVSF  125


 Score = 23.5 bits (49),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            +  P +CKEA+ +L+ AAA
Sbjct  27   RDCPVECKEAIQSLIHAAA  45



>gb|KDO51235.1| hypothetical protein CISIN_1g0114102mg, partial [Citrus sinensis]
Length=460

 Score = 60.8 bits (146),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ERYGN+L+ F+NKEF EKL+SG PSK+KK QL+ DI
Sbjct  31   TVFTERYGNSLEPFLNKEFAEKLRSGPPSKEKKLQLLLDI  70


 Score = 26.9 bits (58),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P +CKEAV +LM +AA
Sbjct  3    PNECKEAVQSLMHSAA  18



>ref|XP_002299697.2| hypothetical protein POPTR_0001s18160g [Populus trichocarpa]
 gb|EEE84502.2| hypothetical protein POPTR_0001s18160g [Populus trichocarpa]
Length=492

 Score = 44.7 bits (104),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            + F  RYG +L+ FVNKEFVE LK    +K+ K QLM DI
Sbjct  124  SAFIGRYGPSLEAFVNKEFVEMLKPKSTTKEIKLQLMHDI  163


 Score = 33.1 bits (74),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAI  331
            + I+WN+K+LE KL+KPP +
Sbjct  167  FSIEWNAKSLEQKLFKPPPV  186


 Score = 29.6 bits (65),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+C+EAV +L++AAA
Sbjct  93   KECPEECREAVQSLIYAAA  111



>ref|XP_010654667.1| PREDICTED: uncharacterized protein LOC100251435 [Vitis vinifera]
Length=501

 Score = 43.1 bits (100),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +1

Query  112  ARIA----LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            AR+A    L E   I  ERYGN+L+ FVNKEF EKLKS   SKD K QL++DI
Sbjct  111  ARMADVPELRELRNILTERYGNSLESFVNKEFAEKLKSKSSSKDMKLQLLRDI  163


 Score = 33.1 bits (74),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  278  IDWNSKALEHKLYKPPAIEQ  337
            I+W+SKALE KL+ PPA +Q
Sbjct  169  IEWDSKALEQKLFNPPASDQ  188


 Score = 30.8 bits (68),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P++C+EAVS+L+FAAA
Sbjct  93   RECPKECREAVSSLIFAAA  111



>emb|CBI36150.3| unnamed protein product [Vitis vinifera]
Length=204

 Score = 43.1 bits (100),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +1

Query  112  ARIA----LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            AR+A    L E   I  ERYGN+L+ FVNKEF EKLKS   SKD K QL++DI
Sbjct  111  ARMADVPELRELRNILTERYGNSLESFVNKEFAEKLKSKSSSKDMKLQLLRDI  163


 Score = 33.5 bits (75),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQ  337
             I+W+SKALE KL+ PPA +Q
Sbjct  168  SIEWDSKALEQKLFNPPASDQ  188


 Score = 30.4 bits (67),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P++C+EAVS+L+FAAA
Sbjct  93   RECPKECREAVSSLIFAAA  111



>ref|XP_006385472.1| hypothetical protein POPTR_0003s05340g [Populus trichocarpa]
 gb|ERP63269.1| hypothetical protein POPTR_0003s05340g [Populus trichocarpa]
Length=472

 Score = 40.4 bits (93),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++F  RYG  L+  VNKEFV+ LK    +++ K QLM DI
Sbjct  57   SVFINRYGPPLEALVNKEFVDMLKPKSITEEMKLQLMHDI  96


 Score = 35.8 bits (81),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQVSFL  349
            + I+WNSK+LE KL+KP   +Q SFL
Sbjct  100  FSIEWNSKSLEQKLFKPLPPQQASFL  125


 Score = 30.0 bits (66),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAV +L++AAA
Sbjct  26   KECPEECKEAVQSLIYAAA  44



>ref|XP_010323436.1| PREDICTED: uncharacterized protein LOC101256602 isoform X2 [Solanum 
lycopersicum]
Length=657

 Score = 56.6 bits (135),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVEKL S  P+ +K+ QL+QDI
Sbjct  125  LFQERYGNSLECFVNQKFVEKLSSSPPAVEKRIQLLQDI  163


 Score = 30.4 bits (67),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PE+C+EAV++LMFAAA
Sbjct  90   QKLRGCPENCREAVASLMFAAA  111



>ref|XP_004305290.1| PREDICTED: uncharacterized protein LOC101293619 [Fragaria vesca 
subsp. vesca]
Length=448

 Score = 46.2 bits (108),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            IF E+YG+++  FVNKE V+K KS  P+K+ K QLM  I
Sbjct  124  IFIEKYGDSIQAFVNKELVDKFKSNPPTKEMKVQLMHHI  162


 Score = 31.6 bits (70),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAIEQV  340
             I+W SKALE KL+ PP+  +V
Sbjct  167  SIEWGSKALEQKLFTPPSTNKV  188


 Score = 28.5 bits (62),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAVS++++A A
Sbjct  95   PEECKEAVSSVIYATA  110



>ref|XP_002889320.1| hypothetical protein ARALYDRAFT_477272 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65579.1| hypothetical protein ARALYDRAFT_477272 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score = 52.0 bits (123),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN L+ FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  110  SLFAERYGNKLEQFVNPEFVERFKAEPPSKEMKVELLQEI  149


 Score = 27.7 bits (60),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++C+EA+S+L++AAA
Sbjct  82   PDECREAISSLVYAAA  97


 Score = 26.2 bits (56),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKP  322
            + I+W++K+LE +LY P
Sbjct  153  YSINWDAKSLEQRLYTP  169



>gb|AAG52247.1|AC011717_15 unknown protein; 49130-47169 [Arabidopsis thaliana]
Length=389

 Score = 54.3 bits (129),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN LD FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  124  SLFAERYGNTLDQFVNPEFVERFKAEPPSKEMKVELLQEI  163


 Score = 27.7 bits (60),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            + P++C+EA+S+L++AAA
Sbjct  94   RCPDECREAISSLVYAAA  111


 Score = 23.5 bits (49),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 7/15 (47%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLY  316
            + I W++K+LE +LY
Sbjct  167  YSIKWDAKSLEQRLY  181



>ref|NP_178109.2| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AAM20533.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91262.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36322.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=381

 Score = 54.3 bits (129),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN LD FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  124  SLFAERYGNTLDQFVNPEFVERFKAEPPSKEMKVELLQEI  163


 Score = 27.7 bits (60),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            + P++C+EA+S+L++AAA
Sbjct  94   RCPDECREAISSLVYAAA  111


 Score = 23.5 bits (49),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 7/15 (47%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLY  316
            + I W++K+LE +LY
Sbjct  167  YSIKWDAKSLEQRLY  181



>ref|NP_001031304.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AEE36323.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=367

 Score = 54.3 bits (129),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN LD FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  110  SLFAERYGNTLDQFVNPEFVERFKAEPPSKEMKVELLQEI  149


 Score = 27.7 bits (60),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++C+EA+S+L++AAA
Sbjct  82   PDECREAISSLVYAAA  97


 Score = 23.5 bits (49),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 7/15 (47%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLY  316
            + I W++K+LE +LY
Sbjct  153  YSIKWDAKSLEQRLY  167



>ref|XP_011007592.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Populus 
euphratica]
 ref|XP_011007593.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Populus 
euphratica]
 ref|XP_011007594.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Populus 
euphratica]
Length=555

 Score = 42.4 bits (98),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            + F  RYG +L+ FVNKEFVE LK    +K+ K QLM +I
Sbjct  124  SAFIGRYGPSLEAFVNKEFVEMLKPKSTTKEIKLQLMHEI  163


 Score = 33.5 bits (75),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+WN+K+LE KL+KPP  +Q
Sbjct  167  FSIEWNAKSLEQKLFKPPPSQQ  188


 Score = 29.6 bits (65),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+C+EAV +L++AAA
Sbjct  93   KECPEECREAVQSLIYAAA  111



>ref|XP_009610736.1| PREDICTED: uncharacterized protein LOC104104374 isoform X1 [Nicotiana 
tomentosiformis]
Length=653

 Score = 53.5 bits (127),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVEKL S  P+ +K+ QL+Q I
Sbjct  125  LFQERYGNSLECFVNQKFVEKLSSRPPAMEKRIQLLQGI  163


 Score = 32.3 bits (72),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PEDC+EAV++LMFAAA
Sbjct  90   QKLRDCPEDCREAVASLMFAAA  111



>emb|CDP03341.1| unnamed protein product [Coffea canephora]
Length=785

 Score = 49.7 bits (117),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERYG+ L+CFVN++FVE L S  P+ +K+ QL++DI S
Sbjct  125  LFQERYGSTLECFVNQKFVEILSSKPPAMEKRLQLLKDIAS  165


 Score = 29.6 bits (65),  Expect(3) = 2e-08, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+E V++LMFAAA
Sbjct  93   RECPEECREPVASLMFAAA  111


 Score = 25.4 bits (54),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 8/23 (35%), Positives = 13/23 (57%), Gaps = 0/23 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQV  340
            + I+WNS   E ++  PP + Q 
Sbjct  167  FSINWNSGGFEQRMADPPTLVQA  189



>ref|XP_004486736.1| PREDICTED: uncharacterized protein LOC101507745 isoform X2 [Cicer 
arietinum]
Length=427

 Score = 46.2 bits (108),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E++GN+L+ +++KEF+E+L+   PSK+ K QL+ ++
Sbjct  124  TLFTEKFGNSLEPYISKEFIERLRQNPPSKEMKIQLLHEL  163


 Score = 30.0 bits (66),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQVSFL  349
            + I+W+ KALE +LY PP + +  + 
Sbjct  167  FSIEWDRKALEQRLYSPPLLHEECYF  192


 Score = 28.5 bits (62),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAA  110
            ++K  P++CKEA+ +L++AAA
Sbjct  91   KLKDCPDECKEAIPSLIYAAA  111



>ref|XP_008462153.1| PREDICTED: biorientation of chromosomes in cell division protein 
1-like 1 [Cucumis melo]
Length=455

 Score = 40.8 bits (94),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F E+YG++   F NKEF+EK ++   +K+ K QL+Q+I
Sbjct  125  LFTEKYGSSFGSFTNKEFIEKSRATTQTKEMKIQLLQEI  163


 Score = 33.5 bits (75),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
              IDWNSKALE +LY PP
Sbjct  167  TAIDWNSKALEQQLYTPP  184


 Score = 29.6 bits (65),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++CKEAV+TL++AAA
Sbjct  96   PDECKEAVATLIYAAA  111



>ref|XP_010323437.1| PREDICTED: uncharacterized protein LOC101256602 isoform X3 [Solanum 
lycopersicum]
Length=642

 Score = 52.0 bits (123),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = +1

Query  142  IFAERYGNALDCFVNK---EFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGLGTQ  309
            +F ERYGN+L+CFVN+   +FVEKL S  P+ +K+ QL+QDI    V + + +  +G Q
Sbjct  107  LFQERYGNSLECFVNQKCCQFVEKLSSSPPAVEKRIQLLQDIV---VEFSIRWDSMGFQ  162


 Score = 33.1 bits (74),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAA  110
            +++  PE+C+EAV++LMFAAA
Sbjct  73   KLRGCPENCREAVASLMFAAA  93



>ref|XP_010323438.1| PREDICTED: uncharacterized protein LOC101256602 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010323439.1| PREDICTED: uncharacterized protein LOC101256602 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010323440.1| PREDICTED: uncharacterized protein LOC101256602 isoform X4 [Solanum 
lycopersicum]
Length=577

 Score = 51.6 bits (122),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  142  IFAERYGNALDCFVNK---EFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN+   +FVEKL S  P+ +K+ QL+QDI
Sbjct  42   LFQERYGNSLECFVNQKCCQFVEKLSSSPPAVEKRIQLLQDI  83


 Score = 33.1 bits (74),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAA  110
            +++  PE+C+EAV++LMFAAA
Sbjct  8    KLRGCPENCREAVASLMFAAA  28



>ref|XP_006302429.1| hypothetical protein CARUB_v10020510mg [Capsella rubella]
 gb|EOA35327.1| hypothetical protein CARUB_v10020510mg [Capsella rubella]
Length=366

 Score = 50.8 bits (120),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN L+ FVN EFVE+ K+  PSK+ K +L+++I
Sbjct  124  SLFAERYGNTLEQFVNPEFVERFKAEPPSKEMKVELLREI  163


 Score = 29.3 bits (64),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            Q P++C+EA+S+L++AAA
Sbjct  94   QCPDECREAISSLVYAAA  111


 Score = 23.9 bits (50),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPP  325
             I W++K+LE +LY  P
Sbjct  168  SIKWDAKSLEQRLYTAP  184



>ref|XP_010656332.1| PREDICTED: uncharacterized protein LOC104880647 [Vitis vinifera]
 emb|CBI28081.3| unnamed protein product [Vitis vinifera]
Length=726

 Score = 52.8 bits (125),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF E+YGN ++ FVNKEF E L S  P+++KK QLMQDI S
Sbjct  125  IFQEKYGNYVEHFVNKEFAENLTSKPPTREKKIQLMQDIAS  165


 Score = 31.6 bits (70),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+LMFAAA
Sbjct  96   PEECREAVSSLMFAAA  111



>gb|KHM98759.1| hypothetical protein glysoja_030812, partial [Glycine soja]
Length=88

 Score = 48.5 bits (114),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  T+F  ++GN+L+ +++KEFVEKL+   PSK+ K QL+ D+
Sbjct  13   LRELRTLFTGKFGNSLELYISKEFVEKLRQDLPSKEMKIQLLHDV  57


 Score = 36.2 bits (82),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQVSF  346
            + I+WNSKALE +L  PP + +VSF
Sbjct  61   FSIEWNSKALEQRLQSPPQLHEVSF  85



>ref|XP_004486735.1| PREDICTED: uncharacterized protein LOC101507745 isoform X1 [Cicer 
arietinum]
Length=421

 Score = 46.2 bits (108),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E++GN+L+ +++KEF+E+L+   PSK+ K QL+ ++
Sbjct  124  TLFTEKFGNSLEPYISKEFIERLRQNPPSKEMKIQLLHEL  163


 Score = 28.9 bits (63),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+ KALE +LY PP + +
Sbjct  167  FSIEWDRKALEQRLYSPPLLHE  188


 Score = 28.5 bits (62),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAA  110
            ++K  P++CKEA+ +L++AAA
Sbjct  91   KLKDCPDECKEAIPSLIYAAA  111



>gb|KDO51245.1| hypothetical protein CISIN_1g024456mg [Citrus sinensis]
Length=267

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ERYGN+L+ F+NKEF EKL+SG PSK+KK QL+ DI
Sbjct  18   TVFTERYGNSLEHFLNKEFAEKLRSGPPSKEKKLQLLHDI  57



>ref|XP_004141848.1| PREDICTED: uncharacterized protein LOC101220202 [Cucumis sativus]
 ref|XP_004169319.1| PREDICTED: uncharacterized protein LOC101224816 [Cucumis sativus]
 gb|KGN45359.1| hypothetical protein Csa_7G446760 [Cucumis sativus]
Length=454

 Score = 40.8 bits (94),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F E+YG++   F NKEF+EK ++   +K+ K QL+Q+I
Sbjct  125  LFTEKYGSSFGSFTNKEFIEKSRTTTQTKEMKIQLLQEI  163


 Score = 33.5 bits (75),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
              IDWNSKALE +LY PP
Sbjct  167  TAIDWNSKALEQQLYTPP  184


 Score = 28.9 bits (63),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++CKE+V+TL++AAA
Sbjct  96   PDECKESVATLIYAAA  111



>ref|XP_011043454.1| PREDICTED: uncharacterized protein LOC105138916 [Populus euphratica]
 ref|XP_011043455.1| PREDICTED: uncharacterized protein LOC105138916 [Populus euphratica]
Length=637

 Score = 45.8 bits (107),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERYG++L+ FVN+EF EKL S   + +KK QLMQ+I S
Sbjct  125  VFYERYGSSLELFVNQEFREKLSSKFVTTEKKIQLMQNIAS  165


 Score = 38.1 bits (87),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAASKN  119
            ++++  PEDC+EAVS+LMFAAA  N
Sbjct  90   QKLRHCPEDCREAVSSLMFAAAGLN  114



>ref|XP_006371896.1| hypothetical protein POPTR_0018s05830g [Populus trichocarpa]
 gb|ERP49693.1| hypothetical protein POPTR_0018s05830g [Populus trichocarpa]
Length=570

 Score = 45.8 bits (107),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERYG++L+ FVN+EF EKL S   + +KK QLMQ+I S
Sbjct  83   VFYERYGSSLELFVNQEFREKLSSKFVTTEKKIQLMQNIAS  123


 Score = 38.1 bits (87),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAASKN  119
            ++++  PEDC+EAVS+LMFAAA  N
Sbjct  48   QKLRHCPEDCREAVSSLMFAAAGLN  72



>ref|XP_008344097.1| PREDICTED: uncharacterized protein LOC103406904, partial [Malus 
domestica]
Length=135

 Score = 49.3 bits (116),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY NAL+ FVN++FVE + S  P+ +KK QLM+DI
Sbjct  61   LFQERYANALELFVNQKFVENIASKPPTLEKKVQLMKDI  99


 Score = 28.5 bits (62),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKE VS+LM AAA
Sbjct  32   PEECKEPVSSLMIAAA  47


 Score = 25.8 bits (55),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 1/23 (4%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYK-PPAIEQ  337
            + I+W+SKA   ++ K PPAI Q
Sbjct  103  FSINWDSKAFVQRMSKPPPAITQ  125



>ref|XP_006595474.1| PREDICTED: uncharacterized protein LOC100790792 [Glycine max]
Length=430

 Score = 45.1 bits (105),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  ++F  ++GN+L+ +++KEFVEKL+   PSK+ K QL+ D+
Sbjct  119  LRELRSLFTGKFGNSLELYISKEFVEKLRQYPPSKEMKIQLLHDV  163


 Score = 32.3 bits (72),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQVSFL  349
            + I+WNSKALE +L+ PP +  +S L
Sbjct  167  FSIEWNSKALEQRLHSPPQLHLLSSL  192


 Score = 25.8 bits (55),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P +CKEA+ +L++AAA
Sbjct  96   PAECKEAIQSLIYAAA  111



>ref|XP_006347864.1| PREDICTED: ankyrin repeat domain-containing protein 12-like [Solanum 
tuberosum]
Length=658

 Score = 52.8 bits (125),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERYGN+L+CFVN++FVE L S  P+ +K+ QL+QDI
Sbjct  125  LFQERYGNSLECFVNQKFVEILSSRPPAVEKRIQLLQDI  163


 Score = 30.8 bits (68),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PE+C+EAV++LMFAAA
Sbjct  90   QKLRDCPENCREAVASLMFAAA  111



>gb|EPS68178.1| hypothetical protein M569_06595, partial [Genlisea aurea]
Length=180

 Score = 44.3 bits (103),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            T+F++RYG ++D +VNK+F+EKLK G   K  +  L+++I S
Sbjct  124  TLFSDRYGKSIDLYVNKQFLEKLKPGVSPKRVELNLLEEIAS  165


 Score = 34.7 bits (78),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PEDC+EAVS+LM+AAA
Sbjct  93   RECPEDCREAVSSLMYAAA  111


 Score = 24.3 bits (51),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKL  313
            G+DW+SKALE+ L
Sbjct  168  GLDWSSKALENSL  180



>ref|XP_008362394.1| PREDICTED: IST1-like protein [Malus domestica]
Length=164

 Score = 53.1 bits (126),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F+E+YGN+L+ F+NKEFVE+LKS   +K+ K QLM DI
Sbjct  124  TLFSEKYGNSLEPFLNKEFVERLKSKPSTKEMKIQLMHDI  163


 Score = 30.0 bits (66),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +3

Query  57   QWPEDCKEAVSTLMFAAA  110
            + PE+CKEAV +LM+AAA
Sbjct  94   ECPEECKEAVPSLMYAAA  111



>ref|XP_008354523.1| PREDICTED: IST1 homolog [Malus domestica]
Length=334

 Score = 48.5 bits (114),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY NAL+ FVN++FVE + S  P+ +KK QLM+DI
Sbjct  125  LFQERYANALELFVNQKFVENIASKPPTLEKKVQLMKDI  163


 Score = 28.9 bits (63),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKE VS+LM AAA
Sbjct  96   PEECKEPVSSLMIAAA  111


 Score = 25.0 bits (53),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 1/23 (4%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYK-PPAIEQ  337
            + I+W+SKA   ++ K PPAI Q
Sbjct  167  FSINWDSKAFVQRMSKPPPAITQ  189



>ref|XP_004512972.1| PREDICTED: uncharacterized protein LOC101515737 isoform X3 [Cicer 
arietinum]
Length=631

 Score = 47.8 bits (112),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+L+C+VNKEF   +     + +KK +LMQDI S
Sbjct  125  IFQERYGNSLECYVNKEFAANVNPKSFTLEKKVRLMQDISS  165


 Score = 31.6 bits (70),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EA+S+LMF+AA
Sbjct  96   PEECREAISSLMFSAA  111


 Score = 23.1 bits (48),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 13/22 (59%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+SKA E ++ K  A  Q
Sbjct  167  FSIKWDSKAFELRMSKSSAFAQ  188



>ref|XP_006385469.1| hypothetical protein POPTR_0003s053101g, partial [Populus trichocarpa]
 gb|ERP63266.1| hypothetical protein POPTR_0003s053101g, partial [Populus trichocarpa]
Length=391

 Score = 38.9 bits (89),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  145  FAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            F  RYG  L+  VNKEFV+ LK    +++ K QLM DI
Sbjct  33   FINRYGPPLEALVNKEFVDMLKPKSITEEMKLQLMHDI  70


 Score = 34.3 bits (77),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+WNSK+LE KL+KPP  +Q
Sbjct  74   FSIEWNSKSLEQKLFKPPPPQQ  95


 Score = 28.9 bits (63),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV +L++AAA
Sbjct  3    PEECKEAVQSLIYAAA  18



>ref|XP_006388732.1| hypothetical protein POPTR_0109s00230g [Populus trichocarpa]
 gb|ERP47646.1| hypothetical protein POPTR_0109s00230g [Populus trichocarpa]
Length=543

 Score = 38.9 bits (89),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++F  RYG  L+  VNKEFV+ LK    +++ K QL+ DI
Sbjct  124  SVFINRYGPPLEALVNKEFVDMLKPKSITEEMKLQLLHDI  163


 Score = 32.7 bits (73),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+WNSK+LE K++KPP  +Q
Sbjct  167  FSIEWNSKSLEQKVFKPPPPQQ  188


 Score = 30.4 bits (67),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAV +L++AAA
Sbjct  93   KECPEECKEAVQSLIYAAA  111



>ref|XP_010538025.1| PREDICTED: uncharacterized protein LOC104812521 isoform X1 [Tarenaya 
hassleriana]
Length=335

 Score = 43.1 bits (100),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +FA+RYG +L+ FV++E V+K K   PSK  K QLM +I
Sbjct  125  LFADRYGTSLEHFVSQELVDKFKVEPPSKQMKLQLMHEI  163


 Score = 29.6 bits (65),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+L++AAA
Sbjct  96   PEECREAVSSLIYAAA  111


 Score = 29.3 bits (64),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + ++W+SK+LE +LY PP
Sbjct  167  YSVEWDSKSLEQRLYTPP  184



>ref|XP_010538026.1| PREDICTED: uncharacterized protein LOC104812521 isoform X2 [Tarenaya 
hassleriana]
Length=331

 Score = 43.1 bits (100),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +FA+RYG +L+ FV++E V+K K   PSK  K QLM +I
Sbjct  125  LFADRYGTSLEHFVSQELVDKFKVEPPSKQMKLQLMHEI  163


 Score = 29.6 bits (65),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+L++AAA
Sbjct  96   PEECREAVSSLIYAAA  111


 Score = 29.3 bits (64),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + ++W+SK+LE +LY PP
Sbjct  167  YSVEWDSKSLEQRLYTPP  184



>gb|KHN32613.1| IST1-like protein [Glycine soja]
Length=374

 Score = 44.7 bits (104),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  ++F  ++GN+L+ +++KEFVEKL+   PSK+ K QL+ D+
Sbjct  97   LRELRSLFTGKFGNSLELYISKEFVEKLRQYPPSKEMKIQLLHDV  141


 Score = 31.2 bits (69),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAI  331
            + I+WNSKALE +L+ PP +
Sbjct  145  FSIEWNSKALEQRLHSPPQL  164


 Score = 25.8 bits (55),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P +CKEA+ +L++AAA
Sbjct  74   PAECKEAIQSLIYAAA  89



>ref|XP_006389711.1| hypothetical protein EUTSA_v10018725mg [Eutrema salsugineum]
 gb|ESQ26997.1| hypothetical protein EUTSA_v10018725mg [Eutrema salsugineum]
Length=375

 Score = 49.7 bits (117),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYGN+L+ FVN EFVE+ K+  PS + K +L+Q+I
Sbjct  124  SLFADRYGNSLEQFVNPEFVERFKAEPPSTEMKVELLQEI  163


 Score = 27.7 bits (60),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++C+EA+S+L++AAA
Sbjct  96   PDECREAISSLVYAAA  111


 Score = 24.6 bits (52),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + I W++K+LE +LY  P
Sbjct  167  YSIKWDAKSLEKRLYTTP  184



>gb|KDP33662.1| hypothetical protein JCGZ_07233 [Jatropha curcas]
Length=638

 Score = 47.4 bits (111),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
             F ERY N+L+ FVN+EF+EKL S   + +KK QLM+DI S
Sbjct  106  TFYERYMNSLELFVNQEFIEKLSSKPSTTEKKVQLMRDIAS  146


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAA  110
            +++  PEDC+EAV++LMFAAA
Sbjct  72   KMRHCPEDCREAVASLMFAAA  92



>emb|CDY41108.1| BnaC05g10990D [Brassica napus]
Length=378

 Score = 46.6 bits (109),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +1

Query  139  TIFAERYG-NALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYG N+L+ FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  124  SLFADRYGTNSLEQFVNPEFVERFKAEPPSKEMKVKLLQEI  164


 Score = 28.5 bits (62),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W++K+LE +LY PP  E+
Sbjct  168  YSIKWDAKSLEQRLYTPPPDEE  189


 Score = 26.6 bits (57),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C EA+S+L++AAA
Sbjct  96   PEECCEAISSLVYAAA  111



>ref|XP_009347177.1| PREDICTED: uncharacterized protein LOC103938859 [Pyrus x bretschneideri]
Length=554

 Score = 45.1 bits (105),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY N+L+ FVN++FVE + S  P+ +KK QL++DI
Sbjct  125  LFQERYANSLEYFVNQKFVENIASKPPTLEKKVQLLKDI  163


 Score = 29.3 bits (64),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKE VS+LM AAA
Sbjct  96   PEECKEPVSSLMIAAA  111


 Score = 27.3 bits (59),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + I+W+SKA E ++ KPP
Sbjct  167  FSINWDSKAFEQRMAKPP  184



>gb|KCW79693.1| hypothetical protein EUGRSUZ_C01045 [Eucalyptus grandis]
Length=577

 Score = 49.3 bits (116),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  145  FAERYGNALDCFVNKEFVEKLKSGRPSK-DKKHQLMQDIDS  264
            F ERYGN+LDCF+ +EF  KL +G+PS  +KK +LMQDI S
Sbjct  215  FQERYGNSLDCFIEQEFSNKL-AGKPSTLEKKVKLMQDIAS  254


 Score = 33.5 bits (75),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+LMFAAA
Sbjct  185  PEECREAVSSLMFAAA  200



>emb|CDY37561.1| BnaA02g20090D [Brassica napus]
Length=377

 Score = 46.6 bits (109),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +1

Query  139  TIFAERYG-NALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FA+RYG N+L+ FVN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  124  SLFADRYGTNSLEQFVNPEFVERFKAEPPSKEMKVKLLQEI  164


 Score = 28.5 bits (62),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W++K+LE +LY PP  E+
Sbjct  168  YSIKWDAKSLEQRLYTPPPDEE  189


 Score = 26.6 bits (57),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C EA+S+L++AAA
Sbjct  96   PEECCEAISSLVYAAA  111



>ref|XP_004242950.1| PREDICTED: uncharacterized protein LOC101256602 isoform X1 [Solanum 
lycopersicum]
Length=660

 Score = 52.0 bits (123),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = +1

Query  142  IFAERYGNALDCFVNK---EFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGLGTQ  309
            +F ERYGN+L+CFVN+   +FVEKL S  P+ +K+ QL+QDI    V + + +  +G Q
Sbjct  125  LFQERYGNSLECFVNQKCCQFVEKLSSSPPAVEKRIQLLQDIV---VEFSIRWDSMGFQ  180


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++  PE+C+EAV++LMFAAA
Sbjct  90   QKLRGCPENCREAVASLMFAAA  111



>ref|XP_010473010.1| PREDICTED: uncharacterized protein LOC104752541 [Camelina sativa]
 ref|XP_010473011.1| PREDICTED: uncharacterized protein LOC104752541 [Camelina sativa]
 ref|XP_010473012.1| PREDICTED: uncharacterized protein LOC104752541 [Camelina sativa]
Length=363

 Score = 50.8 bits (120),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN L+ FVN EFVE+ K+  PSK+ K +L+++I
Sbjct  124  SLFAERYGNTLEQFVNPEFVERFKAEPPSKEMKVELLREI  163


 Score = 27.7 bits (60),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++C+EA+S+L++AAA
Sbjct  96   PDECREAISSLVYAAA  111


 Score = 22.7 bits (47),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 3/23 (13%)
 Frame = +2

Query  275  GIDWNSKALEHKLY---KPPAIE  334
             I W++K+LE +LY    PP +E
Sbjct  168  SIKWDAKSLEQRLYTAATPPHME  190



>ref|XP_003630799.1| IST1-like protein [Medicago truncatula]
 gb|AET05275.1| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=641

 Score = 44.7 bits (104),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYG++++CFVN+EF   L S   + +KK  LMQ+I S
Sbjct  125  IFQERYGSSVECFVNQEFAANLNSKSSTLEKKVCLMQEIAS  165


 Score = 30.0 bits (66),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+ AVS+LMFAAA
Sbjct  96   PEECRVAVSSLMFAAA  111


 Score = 26.2 bits (56),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKA E ++ +P A  Q
Sbjct  167  FSINWDSKAFEIRMSRPSAFAQ  188



>ref|XP_008242618.1| PREDICTED: G patch domain-containing protein 8 [Prunus mume]
Length=643

 Score = 45.8 bits (107),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY N+L+ FVN++FVE L S  P+ +KK QLM+DI
Sbjct  125  LFQERYENSLEYFVNQKFVENLASKPPTLEKKVQLMKDI  163


 Score = 28.5 bits (62),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+SKA E ++ KPPA  Q
Sbjct  167  FSIKWDSKAFEQRMSKPPAFIQ  188


 Score = 26.2 bits (56),  Expect(3) = 2e-07, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+E VS+LM AAA
Sbjct  96   PEECREPVSSLMSAAA  111



>ref|XP_009128459.1| PREDICTED: uncharacterized protein LOC103853288 [Brassica rapa]
Length=379

 Score = 43.5 bits (101),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  139  TIFAERYG-NALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++F +RYG N+L+ +VN EFVE+ K+  PSK+ K +L+Q+I
Sbjct  124  SLFGDRYGTNSLEQYVNPEFVERFKAEPPSKEMKVKLLQEI  164


 Score = 30.4 bits (67),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIE  334
            + I W++K+LE +LY PPA E
Sbjct  168  YSIKWDAKSLEQRLYTPPADE  188


 Score = 26.6 bits (57),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C EA+S+L++AAA
Sbjct  96   PEECCEAISSLVYAAA  111



>ref|XP_004506922.1| PREDICTED: uncharacterized protein LOC101512015 [Cicer arietinum]
Length=438

 Score = 42.7 bits (99),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E+YGN+L+ ++NKE VEKL+    +++ K +L+ DI
Sbjct  221  TLFIEKYGNSLEPYINKEIVEKLRRDPSTREMKIRLLYDI  260


 Score = 30.4 bits (67),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEAV +LM+AAA
Sbjct  193  PEECKEAVPSLMYAAA  208


 Score = 26.9 bits (58),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAI  331
            + IDWN+KAL  +LY  P++
Sbjct  264  FSIDWNAKALMKRLYTHPSL  283



>ref|XP_009374011.1| PREDICTED: uncharacterized protein LOC103962956 [Pyrus x bretschneideri]
Length=644

 Score = 45.1 bits (105),  Expect(3) = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY N+L+ FVN++FVE + S  P+ +KK QL++DI
Sbjct  125  LFQERYANSLEYFVNQKFVENIASKPPTLEKKVQLLKDI  163


 Score = 27.3 bits (59),  Expect(3) = 5e-07, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKE VS+LM AAA
Sbjct  96   PEECKEPVSSLMIAAA  111


 Score = 27.3 bits (59),  Expect(3) = 5e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + I+W+SKA E ++ KPP
Sbjct  167  FSINWDSKAFEQRMAKPP  184



>ref|XP_003604452.1| IST1-like protein [Medicago truncatula]
Length=318

 Score = 46.2 bits (108),  Expect(3) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E+YGN+L+ ++NKEFVEKL+   P+++ K +L+ DI
Sbjct  95   TLFTEKYGNSLEPYINKEFVEKLRHS-PTREMKIRLLYDI  133


 Score = 31.2 bits (69),  Expect(3) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  51   IKQWPEDCKEAVSTLMFAAA  110
            I + PE+CKEA+ +LM+AAA
Sbjct  63   INECPEECKEAIPSLMYAAA  82


 Score = 22.3 bits (46),  Expect(3) = 6e-07, Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAI  331
            + I+W+ KAL+  LY  P++
Sbjct  137  FSIEWDGKALKKMLYTHPSL  156



>ref|XP_004512970.1| PREDICTED: uncharacterized protein LOC101515737 isoform X1 [Cicer 
arietinum]
Length=684

 Score = 47.8 bits (112),  Expect(3) = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+L+C+VNKEF   +     + +KK +LMQDI S
Sbjct  125  IFQERYGNSLECYVNKEFAANVNPKSFTLEKKVRLMQDISS  165


 Score = 28.9 bits (63),  Expect(3) = 7e-07, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EA+S+LMF+AA
Sbjct  96   PEECREAISSLMFSAA  111


 Score = 22.7 bits (47),  Expect(3) = 7e-07, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 13/22 (59%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+SKA E ++ K  A  Q
Sbjct  167  FSIKWDSKAFELRMSKSSAFAQ  188



>gb|KDO50897.1| hypothetical protein CISIN_1g006077mg [Citrus sinensis]
Length=662

 Score = 50.8 bits (120),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF E+YGN+L+ F N EFVEKL S   + DKK QLMQDI S
Sbjct  125  IFYEKYGNSLEHFANMEFVEKLSSKPATMDKKIQLMQDIAS  165


 Score = 29.3 bits (64),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P DC+E VS+LMFAAA
Sbjct  96   PMDCREVVSSLMFAAA  111



>ref|XP_006451156.1| hypothetical protein CICLE_v10007676mg [Citrus clementina]
 gb|ESR64396.1| hypothetical protein CICLE_v10007676mg [Citrus clementina]
Length=662

 Score = 50.8 bits (120),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF E+YGN+L+ F N EFVEKL S   + DKK QLMQDI S
Sbjct  125  IFYEKYGNSLEHFANMEFVEKLSSKPATMDKKIQLMQDIAS  165


 Score = 29.3 bits (64),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P DC+E VS+LMFAAA
Sbjct  96   PMDCREVVSSLMFAAA  111



>ref|XP_006475623.1| PREDICTED: uncharacterized protein LOC102616577 [Citrus sinensis]
Length=662

 Score = 50.8 bits (120),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF E+YGN+L+ F N EFVEKL S   + DKK QLMQDI S
Sbjct  125  IFYEKYGNSLEHFANMEFVEKLSSKPATMDKKIQLMQDIAS  165


 Score = 29.3 bits (64),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P DC+E VS+LMFAAA
Sbjct  96   PMDCREVVSSLMFAAA  111



>ref|XP_004512971.1| PREDICTED: uncharacterized protein LOC101515737 isoform X2 [Cicer 
arietinum]
Length=644

 Score = 47.8 bits (112),  Expect(3) = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+L+C+VNKEF   +     + +KK +LMQDI S
Sbjct  85   IFQERYGNSLECYVNKEFAANVNPKSFTLEKKVRLMQDISS  125


 Score = 28.5 bits (62),  Expect(3) = 8e-07, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EA+S+LMF+AA
Sbjct  56   PEECREAISSLMFSAA  71


 Score = 22.7 bits (47),  Expect(3) = 8e-07, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 13/22 (59%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+SKA E ++ K  A  Q
Sbjct  127  FSIKWDSKAFELRMSKSSAFAQ  148



>ref|XP_010047736.1| PREDICTED: uncharacterized protein LOC104436604 isoform X1 [Eucalyptus 
grandis]
Length=694

 Score = 48.9 bits (115),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  145  FAERYGNALDCFVNKEFVEKLKSGRPSK-DKKHQLMQDIDS  264
            F ERYGN+LDCF+ +EF  KL +G+PS  +KK +LMQDI S
Sbjct  126  FQERYGNSLDCFIEQEFSNKL-AGKPSTLEKKVKLMQDIAS  165


 Score = 31.2 bits (69),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAVS+LMFAAA
Sbjct  96   PEECREAVSSLMFAAA  111



>ref|XP_010047737.1| PREDICTED: uncharacterized protein LOC104436604 isoform X2 [Eucalyptus 
grandis]
 gb|KCW79694.1| hypothetical protein EUGRSUZ_C01046 [Eucalyptus grandis]
Length=684

 Score = 49.7 bits (117),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  145  FAERYGNALDCFVNKEFVEKLKSGRPSK-DKKHQLMQDIDS  264
            F ERYGN+L+CF+N+EF  KL +G+PS  +KK +LMQDI S
Sbjct  126  FQERYGNSLECFINQEFSNKL-AGKPSTLEKKVKLMQDIAS  165


 Score = 29.6 bits (65),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  24   LEEQTQDKEIKQWPEDCKEAVSTLMFAAA  110
            L++ +  ++  + PE+C EAVS+LMFAAA
Sbjct  83   LKQMSTMQKQSECPEECCEAVSSLMFAAA  111



>ref|XP_010430041.1| PREDICTED: uncharacterized protein LOC104714391 [Camelina sativa]
Length=364

 Score = 47.8 bits (112),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++F+ERYGN L+ FVN EFV++ K+  PSK+ K +L+++I
Sbjct  124  SLFSERYGNTLEQFVNPEFVKRFKAEPPSKEMKVELLREI  163


 Score = 27.7 bits (60),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++C+EA+S+L++AAA
Sbjct  96   PDECREAISSLVYAAA  111


 Score = 22.7 bits (47),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 3/23 (13%)
 Frame = +2

Query  275  GIDWNSKALEHKLY---KPPAIE  334
             I W++K+LE +LY    PP +E
Sbjct  168  SIKWDAKSLEQRLYTAATPPHME  190



>gb|AES86649.2| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=320

 Score = 46.2 bits (108),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E+YGN+L+ ++NKEFVEKL+   P+++ K +L+ DI
Sbjct  97   TLFTEKYGNSLEPYINKEFVEKLRHS-PTREMKIRLLYDI  135


 Score = 29.6 bits (65),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+CKEA+ +LM+AAA
Sbjct  69   PEECKEAIPSLMYAAA  84


 Score = 22.3 bits (46),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAI  331
            + I+W+ KAL+  LY  P++
Sbjct  139  FSIEWDGKALKKMLYTHPSL  158



>ref|XP_008337435.1| PREDICTED: uncharacterized protein LOC103400560 [Malus domestica]
Length=698

 Score = 45.1 bits (105),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY N+L  FVN++FVE + S  P+ +KK QL++DI
Sbjct  125  LFQERYANSLXYFVNQKFVENIASKPPTLEKKXQLLKDI  163


 Score = 27.3 bits (59),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPP  325
            + I+W+SKA E ++ KPP
Sbjct  167  FSINWDSKAFEQRMAKPP  184


 Score = 25.8 bits (55),  Expect(3) = 2e-06, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++CKE VS+LM AAA
Sbjct  96   PKECKEPVSSLMIAAA  111



>ref|XP_003597767.1| IST1-like protein [Medicago truncatula]
 gb|AES68018.1| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=432

 Score = 42.4 bits (98),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F +++G++LD + +KEF+E+L+   P+K+ K QL+ ++
Sbjct  124  TLFQQKFGDSLDPYTSKEFIERLRQTPPTKEMKIQLLHEL  163


 Score = 28.1 bits (61),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  275  GIDWNSKALEHKLYKPPAI  331
             I+W+ KALE KLY PP +
Sbjct  168  SIEWDRKALEQKLYLPPPV  186


 Score = 26.9 bits (58),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++CKEA+ +L++AAA
Sbjct  96   PDECKEAIPSLIYAAA  111



>ref|XP_002514318.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48272.1| conserved hypothetical protein [Ricinus communis]
Length=729

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERYG++L+ F N+EFV  L S   + +KK QLM +I S
Sbjct  125  VFYERYGSSLELFANQEFVGNLSSKPSTTEKKVQLMHEIAS  165


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++I+  PEDC+EAVS+LMFAAA
Sbjct  90   QKIRHCPEDCREAVSSLMFAAA  111



>ref|XP_004287101.1| PREDICTED: uncharacterized protein LOC101304409 [Fragaria vesca 
subsp. vesca]
Length=620

 Score = 42.4 bits (98),  Expect(3) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERY N++D  V+++FVE + S  P+ +KK QLM+DI S
Sbjct  125  LFQERYANSVDYCVDQKFVENIASKPPTLEKKVQLMKDIAS  165


 Score = 30.0 bits (66),  Expect(3) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+CKEAV++LM AAA
Sbjct  93   RECPEECKEAVASLMVAAA  111


 Score = 24.3 bits (51),  Expect(3) = 3e-06, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+S A E ++ KPPA  Q
Sbjct  167  FSIKWDSWAFEQRMSKPPAFIQ  188



>gb|KHN47812.1| IST1-like protein [Glycine soja]
Length=284

 Score = 45.4 bits (106),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E +GN+L+ ++NKEFVEKL+   P+++ K  L+ DI
Sbjct  86   TLFTETFGNSLEPYINKEFVEKLRQDPPTREMKIGLLYDI  125


 Score = 32.3 bits (72),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  P++CKEAVS+LM+AAA
Sbjct  55   KDCPDECKEAVSSLMYAAA  73



>ref|XP_003533053.1| PREDICTED: uncharacterized protein LOC100792068 [Glycine max]
Length=322

 Score = 45.4 bits (106),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E +GN+L+ ++NKEFVEKL+   P+++ K  L+ DI
Sbjct  124  TLFTETFGNSLEPYINKEFVEKLRQDPPTREMKIGLLYDI  163


 Score = 32.0 bits (71),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  P++CKEAVS+LM+AAA
Sbjct  93   KDCPDECKEAVSSLMYAAA  111



>gb|KHG09331.1| IST1-like protein [Gossypium arboreum]
Length=663

 Score = 38.9 bits (89),  Expect(3) = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERY N+LD F NK+ VE   S   + ++K  +M DI S
Sbjct  125  IFHERYENSLDVFANKQLVENSASNPSTMERKVMVMHDIAS  165


 Score = 33.1 bits (74),  Expect(3) = 5e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            +++   PEDC+EAVS+LMFAAA
Sbjct  90   QKLSDCPEDCREAVSSLMFAAA  111


 Score = 24.6 bits (52),  Expect(3) = 5e-06, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+SKA E ++ +P  I Q
Sbjct  167  FSIKWDSKAFERRMSEPAVIPQ  188



>ref|XP_011093573.1| PREDICTED: uncharacterized protein LOC105173509 [Sesamum indicum]
Length=647

 Score = 47.4 bits (111),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF +RYGN L+ FVN++FVEK+ +  P+ +K+ + +QDI S
Sbjct  125  IFQQRYGNCLEAFVNQKFVEKVSARHPATEKRLRALQDIAS  165


 Score = 29.6 bits (65),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV++LMFAAA
Sbjct  96   PEECREAVASLMFAAA  111



>ref|XP_010545712.1| PREDICTED: uncharacterized protein LOC104817992 [Tarenaya hassleriana]
Length=384

 Score = 45.8 bits (107),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAE+YGN  + +VN+E +EKL   RPS+++K Q M++I
Sbjct  136  SLFAEKYGNFSESYVNQEIIEKLDHRRPSREEKIQTMREI  175


 Score = 31.2 bits (69),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAVS+L +AAA
Sbjct  105  KECPEECKEAVSSLTYAAA  123



>ref|XP_011001627.1| PREDICTED: uncharacterized protein LOC105108854 [Populus euphratica]
Length=457

 Score = 33.9 bits (76),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+WNSK+LE KL+KPP  +Q
Sbjct  81   FSIEWNSKSLEQKLFKPPPPQQ  102


 Score = 32.0 bits (71),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 7/42 (17%)
 Frame = +1

Query  145  FAERYGNALDCFVNKEFVEKLKSGRPS----KDKKHQLMQDI  258
            F  RYG  L+  VNKEFV+ LK   P     ++ K QLM DI
Sbjct  39   FINRYGPPLEALVNKEFVDMLK---PKYSIIEEMKVQLMHDI  77


 Score = 30.0 bits (66),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K+ PE+CKEAV +L++AAA
Sbjct  6    KECPEECKEAVQSLIYAAA  24



>ref|XP_004503434.1| PREDICTED: serine/arginine-rich splicing factor 4-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503435.1| PREDICTED: serine/arginine-rich splicing factor 4-like isoform 
X2 [Cicer arietinum]
Length=642

 Score = 42.4 bits (98),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYG++L+CFVN EF   L     + ++K  LMQ+I S
Sbjct  125  IFQERYGSSLECFVNPEFAANLNIKSSTLERKVCLMQEIAS  165


 Score = 30.0 bits (66),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+ AVS+LMFAAA
Sbjct  96   PEECRVAVSSLMFAAA  111


 Score = 23.5 bits (49),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I+W+SKA E ++ +  A  Q
Sbjct  167  FSINWDSKAFELRMSRSSAFAQ  188



>ref|XP_007150621.1| hypothetical protein PHAVU_005G167600g [Phaseolus vulgaris]
 gb|ESW22615.1| hypothetical protein PHAVU_005G167600g [Phaseolus vulgaris]
Length=468

 Score = 44.3 bits (103),  Expect(3) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E  T+F  ++GN L+ +++KEFV+KL+   PSK+ K QL++D+
Sbjct  97   LRELRTLFTTKFGNTLEPYISKEFVDKLRQIPPSKEMKIQLLRDL  141


 Score = 26.2 bits (56),  Expect(3) = 8e-06, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P++CKEAV +L++A A
Sbjct  74   PDECKEAVQSLIYATA  89


 Score = 25.0 bits (53),  Expect(3) = 8e-06, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKP  322
            + I+W+SKALE +L+ P
Sbjct  145  FFIEWDSKALEQRLHSP  161



>ref|XP_010417771.1| PREDICTED: uncharacterized protein LOC104703452 [Camelina sativa]
 ref|XP_010417773.1| PREDICTED: uncharacterized protein LOC104703452 [Camelina sativa]
 ref|XP_010417774.1| PREDICTED: uncharacterized protein LOC104703452 [Camelina sativa]
 ref|XP_010417775.1| PREDICTED: uncharacterized protein LOC104703452 [Camelina sativa]
Length=361

 Score = 49.3 bits (116),  Expect(3) = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            ++FAERYGN L+ FVN EFVE+ K+  P K+ K +L+++I
Sbjct  124  SLFAERYGNTLEQFVNPEFVERFKAEPPPKEMKVELLREI  163


 Score = 23.9 bits (50),  Expect(3) = 9e-06, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            P +C+ A+S+L++AAA
Sbjct  96   PGECRVAISSLVYAAA  111


 Score = 22.3 bits (46),  Expect(3) = 9e-06, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (61%), Gaps = 3/23 (13%)
 Frame = +2

Query  275  GIDWNSKALEHKLY---KPPAIE  334
             I W++K+LE +LY    PP  E
Sbjct  168  SIKWDAKSLEQRLYTAATPPHTE  190



>gb|EYU18264.1| hypothetical protein MIMGU_mgv1a003486mg [Erythranthe guttata]
Length=582

 Score = 47.0 bits (110),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
             F +RYG+ L+ FVN++FVE L S  PS +K+ Q++QDI S
Sbjct  125  TFQQRYGHCLEVFVNQKFVENLSSRPPSNEKRLQVLQDIAS  165


 Score = 28.9 bits (63),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV++L++AAA
Sbjct  96   PEECREAVASLIYAAA  111



>ref|XP_007013195.1| Regulator of Vps4 activity in the MVB pathway protein, putative 
[Theobroma cacao]
 gb|EOY30814.1| Regulator of Vps4 activity in the MVB pathway protein, putative 
[Theobroma cacao]
Length=602

 Score = 42.4 bits (98),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+L+ FVNK+ VE   S     +KK ++M DI S
Sbjct  125  IFHERYGNSLELFVNKQLVENSASNPSKMEKKVKVMHDIAS  165


 Score = 33.9 bits (76),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PEDC+EAV++LMFAAA
Sbjct  96   PEDCREAVASLMFAAA  111



>ref|XP_007135690.1| hypothetical protein PHAVU_010G150200g [Phaseolus vulgaris]
 gb|ESW07684.1| hypothetical protein PHAVU_010G150200g [Phaseolus vulgaris]
Length=382

 Score = 42.4 bits (98),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F ++YGN+L+ + NKE VE L+   P+++ K  L+ DI
Sbjct  124  TLFTDKYGNSLEPYANKELVESLRKDPPTREIKIGLLHDI  163


 Score = 30.0 bits (66),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  PE+CKEAVS+LM AAA
Sbjct  93   KDCPEECKEAVSSLMDAAA  111


 Score = 22.7 bits (47),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 7/15 (47%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLY  316
            + I+WN K+L  +LY
Sbjct  167  FSIEWNDKSLRERLY  181



>ref|XP_004242213.1| PREDICTED: IST1-like protein [Solanum lycopersicum]
Length=309

 Score = 42.4 bits (98),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 12/79 (15%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGLGTQVV*  318
            T+  ERYGN+L+  VN +F  KLK      D K QLMQDI +    Y LE+     Q   
Sbjct  124  TMLNERYGNSLESCVNNQFAAKLKPVWHKMDVKLQLMQDIAA---EYGLEWNSKALQ---  177

Query  319  TTCN*ASKLFDKFHVNFMS  375
                   +L+++ H +  S
Sbjct  178  ------QRLYEQEHADVAS  190


 Score = 32.7 bits (73),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PEDCKE V +LMFAAA
Sbjct  93   RECPEDCKEPVGSLMFAAA  111



>ref|XP_009126121.1| PREDICTED: uncharacterized protein LOC103851047 [Brassica rapa]
Length=631

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F E+YG++L  FVN+E VE + S   S +KK +LM+D+ S
Sbjct  125  MFHEKYGDSLSVFVNQELVENMTSKPFSLEKKVKLMEDVAS  165


 Score = 35.8 bits (81),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAAS  113
            ++++ PEDC+EAVS+LMFAAA 
Sbjct  91   KMEECPEDCREAVSSLMFAAAG  112



>emb|CDX75238.1| BnaA01g04640D [Brassica napus]
Length=631

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F E+YG++L  FVN+E VE + S   S +KK +LM+D+ S
Sbjct  125  MFHEKYGDSLSVFVNQELVENMTSKPFSLEKKVKLMEDVAS  165


 Score = 35.4 bits (80),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAAS  113
            ++++ PEDC+EAVS+LMFAAA 
Sbjct  91   KMEECPEDCREAVSSLMFAAAG  112



>gb|KHG29697.1| IST1-like protein [Gossypium arboreum]
Length=666

 Score = 42.0 bits (97),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+L+ FVNK+ VE   S   + +KK ++M DI S
Sbjct  125  IFHERYGNSLELFVNKQLVENSASNSFTMEKKVKVMHDIAS  165


 Score = 32.7 bits (73),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            +++   PEDC+EAVS+LMFAAA
Sbjct  90   QKLSDCPEDCREAVSSLMFAAA  111



>ref|XP_007150620.1| hypothetical protein PHAVU_005G167500g, partial [Phaseolus vulgaris]
 gb|ESW22614.1| hypothetical protein PHAVU_005G167500g, partial [Phaseolus vulgaris]
Length=166

 Score = 42.4 bits (98),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F  ++ N L+ +++KEFV+KL+   PSK+ K QL++D+
Sbjct  102  TLFTSKFENTLETYISKEFVDKLRQVPPSKEMKIQLLRDL  141


 Score = 25.8 bits (55),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKP  322
            + ++W+SKALE +L+ P
Sbjct  145  FCVEWDSKALEQRLHSP  161


 Score = 25.0 bits (53),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAA  107
            +  P+ CKEAV +L++AA
Sbjct  71   RDCPDKCKEAVQSLIYAA  88



>ref|XP_010254132.1| PREDICTED: uncharacterized protein LOC104595213 isoform X1 [Nelumbo 
nucifera]
Length=855

 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            IF E+YG++L+ FVN+EFVEKL     + DKK QLM+ I
Sbjct  125  IFTEKYGSSLEAFVNQEFVEKLAPKPLTMDKKLQLMRKI  163


 Score = 29.3 bits (64),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +LMFAAA
Sbjct  96   PEECREAVPSLMFAAA  111



>gb|KHN39341.1| IST1-like protein [Glycine soja]
Length=344

 Score = 43.9 bits (102),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E++GN+L+  +NKEFVEKL+   P+++ K  L+ DI
Sbjct  86   TLFTEKFGNSLEPCINKEFVEKLRRDPPTREMKIGLLYDI  125


 Score = 29.6 bits (65),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  P++CKEAV +LM+AAA
Sbjct  55   KDCPDECKEAVPSLMYAAA  73



>ref|XP_006356261.1| PREDICTED: uncharacterized protein LOC102584536 [Solanum tuberosum]
Length=309

 Score = 40.8 bits (94),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (53%), Gaps = 3/57 (5%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDSI*VGYRLEFKGLGTQ  309
            T+  ERYGN+L+  VN +F   LK      D K QLMQD+    V Y LE+     Q
Sbjct  124  TMLNERYGNSLESCVNNQFAANLKPVPHKLDVKLQLMQDVA---VEYGLEWNSKALQ  177


 Score = 33.1 bits (74),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PEDCKE V +LMFAAA
Sbjct  93   RECPEDCKEPVGSLMFAAA  111



>ref|XP_006582997.1| PREDICTED: uncharacterized protein LOC102665874 [Glycine max]
Length=382

 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            T+F E++GN+L+  +NKEFVEKL+   P+++ K  L+ DI
Sbjct  124  TLFTEKFGNSLEPCINKEFVEKLRRDPPTREMKIGLLYDI  163


 Score = 29.6 bits (65),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  P++CKEAV +LM+AAA
Sbjct  93   KDCPDECKEAVPSLMYAAA  111



>ref|XP_010254133.1| PREDICTED: uncharacterized protein LOC104595213 isoform X2 [Nelumbo 
nucifera]
Length=767

 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            IF E+YG++L+ FVN+EFVEKL     + DKK QLM+ I
Sbjct  37   IFTEKYGSSLEAFVNQEFVEKLAPKPLTMDKKLQLMRKI  75


 Score = 28.9 bits (63),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+EAV +LMFAAA
Sbjct  8    PEECREAVPSLMFAAA  23



>gb|KFK35790.1| hypothetical protein AALP_AA4G036900 [Arabis alpina]
Length=284

 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
             +F  RYGN++D +VN+E VEKL   +PS++ + Q +Q+I
Sbjct  127  ALFKRRYGNSIDSYVNQELVEKLVWRKPSREVRAQKLQEI  166


 Score = 29.3 bits (64),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAVS+L++A A
Sbjct  96   RECPEECREAVSSLIYATA  114



>ref|XP_009406523.1| PREDICTED: uncharacterized protein LOC103989415 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406524.1| PREDICTED: uncharacterized protein LOC103989415 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406525.1| PREDICTED: uncharacterized protein LOC103989415 [Musa acuminata 
subsp. malaccensis]
Length=458

 Score = 48.1 bits (113),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +FAERYG+ ++ FVN EFVEK+     +++KK QLMQDI
Sbjct  125  VFAERYGSCMESFVNAEFVEKVGKKSFTREKKLQLMQDI  163


 Score = 25.0 bits (53),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            K  P++  EAVSTL++AAA
Sbjct  93   KGCPQEAVEAVSTLIYAAA  111



>ref|XP_003529997.1| PREDICTED: uncharacterized protein LOC100775349 [Glycine max]
Length=735

 Score = 46.2 bits (108),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF +RYG++L+C+VN+EF   L S   + +KK  LMQDI S
Sbjct  125  IFQDRYGSSLECYVNQEFATNLNSKSSTLEKKVHLMQDIAS  165


 Score = 26.9 bits (58),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ +EA+S+LMFAAA
Sbjct  96   PEEVREAISSLMFAAA  111



>gb|KHN20684.1| IST1 like [Glycine soja]
Length=735

 Score = 46.2 bits (108),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF +RYG++L+C+VN+EF   L S   + +KK  LMQDI S
Sbjct  125  IFQDRYGSSLECYVNQEFATNLNSKSSTLEKKVHLMQDIAS  165


 Score = 26.9 bits (58),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ +EA+S+LMFAAA
Sbjct  96   PEEVREAISSLMFAAA  111



>gb|KHN45649.1| IST1 like [Glycine soja]
Length=735

 Score = 46.2 bits (108),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF +RYG++L+C+VN+EF   L S   + +KK  LMQDI S
Sbjct  125  IFQDRYGSSLECYVNQEFATNLNSKSSTLEKKVHLMQDIAS  165


 Score = 26.9 bits (58),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ +EA+S+LMFAAA
Sbjct  96   PEEVREAISSLMFAAA  111



>ref|XP_006587516.1| PREDICTED: uncharacterized protein LOC100820462 [Glycine max]
Length=735

 Score = 46.2 bits (108),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF +RYG++L+C+VN+EF   L S   + +KK  LMQDI S
Sbjct  125  IFQDRYGSSLECYVNQEFATNLNSKSSTLEKKVHLMQDIAS  165


 Score = 26.9 bits (58),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+ +EA+S+LMFAAA
Sbjct  96   PEEVREAISSLMFAAA  111



>emb|CDX68838.1| BnaC01g06150D [Brassica napus]
Length=630

 Score = 37.0 bits (84),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F E+Y ++L  FVN+E VE + S   S +KK +LM+D+ S
Sbjct  125  MFHEKYADSLSVFVNQELVENMTSKPFSLEKKVKLMEDVAS  165


 Score = 35.8 bits (81),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAAS  113
            ++++ PEDC+EAVS+LMFAAA 
Sbjct  91   KMEECPEDCREAVSSLMFAAAG  112



>gb|KFK29843.1| hypothetical protein AALP_AA7G186000, partial [Arabis alpina]
Length=570

 Score = 36.2 bits (82),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            +F ERY ++L  FVN+E VE + S   S +KK  LM+D+
Sbjct  125  MFHERYADSLVLFVNQELVESMSSKPFSLEKKVNLMEDV  163


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  48   EIKQWPEDCKEAVSTLMFAAAS  113
            +I + PEDC+EAVS+LMFAA+ 
Sbjct  91   KIAECPEDCREAVSSLMFAASG  112



>ref|XP_010535999.1| PREDICTED: uncharacterized protein LOC104811108 [Tarenaya hassleriana]
Length=694

 Score = 38.5 bits (88),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F E+YG +L+ FVN+E VE L +   S +KK +LM D+ S
Sbjct  125  MFHEKYGESLELFVNQELVESLSTKPFSLEKKVKLMADVAS  165


 Score = 32.7 bits (73),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAAS  113
            ++I + PEDC+EAVS+LMFAA++
Sbjct  90   QKIGECPEDCREAVSSLMFAASA  112



>ref|XP_009144854.1| PREDICTED: uncharacterized protein LOC103868512 [Brassica rapa]
Length=242

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
             +F  RYG+++D ++N+E VEKL   +PS++ K Q +Q+I
Sbjct  126  ALFTRRYGDSIDAYINQELVEKLVWRKPSREFKVQTLQEI  165


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV +L++AAA
Sbjct  95   RECPEECREAVYSLIYAAA  113



>emb|CDY49897.1| BnaA05g14960D [Brassica napus]
Length=268

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  139  TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
             +F  RYG+++D ++N+E VEKL   +PS++ K Q +Q+I
Sbjct  126  ALFTRRYGDSIDAYINQELVEKLVWRKPSREFKVQTLQEI  165


 Score = 28.1 bits (61),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ PE+C+EAV +L++AAA
Sbjct  95   RECPEECREAVYSLIYAAA  113



>ref|XP_010688190.1| PREDICTED: uncharacterized protein LOC104902188 [Beta vulgaris 
subsp. vulgaris]
Length=646

 Score = 40.0 bits (92),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            +F ERYG++L+ +VN++ VE +    PS +K  QL+++I S
Sbjct  126  LFQERYGSSLEYYVNQKLVENITPRPPSMEKNIQLLEEIAS  166


 Score = 30.8 bits (68),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  45   KEIKQWPEDCKEAVSTLMFAAA  110
            ++++Q PEDC+EAV +L+FAAA
Sbjct  91   QKLRQCPEDCREAVGSLIFAAA  112



>ref|XP_008463380.1| PREDICTED: uncharacterized protein LOC103501548 isoform X2 [Cucumis 
melo]
Length=660

 Score = 38.5 bits (88),  Expect(3) = 5e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  LSEK*TIFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            L E   IF ER+G +L+   N++FVE L S   + +KK QL+QDI
Sbjct  31   LRELRQIFQERFGASLEHLENQKFVENLASKPSTLEKKVQLLQDI  75


 Score = 28.1 bits (61),  Expect(3) = 5e-04, Method: Composition-based stats.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P++C EA+++LMFAAA
Sbjct  5    RECPDECCEAIASLMFAAA  23


 Score = 22.3 bits (46),  Expect(3) = 5e-04, Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 12/22 (55%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+S   E ++  PPA  Q
Sbjct  79   FSIKWDSVGFEKRMSTPPAYAQ  100



>ref|XP_008463379.1| PREDICTED: uncharacterized protein LOC103501548 isoform X1 [Cucumis 
melo]
Length=748

 Score = 37.7 bits (86),  Expect(3) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDI  258
            IF ER+G +L+   N++FVE L S   + +KK QL+QDI
Sbjct  125  IFQERFGASLEHLENQKFVENLASKPSTLEKKVQLLQDI  163


 Score = 28.1 bits (61),  Expect(3) = 7e-04, Method: Composition-based stats.
 Identities = 10/19 (53%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  54   KQWPEDCKEAVSTLMFAAA  110
            ++ P++C EA+++LMFAAA
Sbjct  93   RECPDECCEAIASLMFAAA  111


 Score = 22.7 bits (47),  Expect(3) = 7e-04, Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 12/22 (55%), Gaps = 0/22 (0%)
 Frame = +2

Query  272  WGIDWNSKALEHKLYKPPAIEQ  337
            + I W+S   E ++  PPA  Q
Sbjct  167  FSIKWDSVGFEKRMSTPPAYAQ  188



>ref|XP_003532487.1| PREDICTED: uncharacterized protein LOC100812444 isoform X1 [Glycine 
max]
 gb|KHN16602.1| IST1-like protein [Glycine soja]
Length=798

 Score = 42.0 bits (97),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+++C+VN+EF   L     + + K  LMQ+I S
Sbjct  125  IFQERYGNSMECYVNQEFAANLNFKSSTLENKVCLMQEISS  165


 Score = 27.3 bits (59),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+ AVS+LMF AA
Sbjct  96   PEECRMAVSSLMFGAA  111



>ref|XP_006584836.1| PREDICTED: uncharacterized protein LOC100812444 isoform X2 [Glycine 
max]
Length=759

 Score = 42.0 bits (97),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  142  IFAERYGNALDCFVNKEFVEKLKSGRPSKDKKHQLMQDIDS  264
            IF ERYGN+++C+VN+EF   L     + + K  LMQ+I S
Sbjct  125  IFQERYGNSMECYVNQEFAANLNFKSSTLENKVCLMQEISS  165


 Score = 27.3 bits (59),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  63   PEDCKEAVSTLMFAAA  110
            PE+C+ AVS+LMF AA
Sbjct  96   PEECRMAVSSLMFGAA  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048