BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25246_g1_i1 len=749 path=[3189:0-13 5796:14-23 3213:24-27
3217:28-89 938:90-118 5829:119-123 3311:124-133 3321:134-232
139:233-273 3460:274-412 3598:413-438 3624:439-505 712:506-535
742:536-748]

Length=749
                                                                      Score     E

ref|XP_006361449.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     199   7e-58   
ref|XP_010312544.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    196   2e-57   
ref|XP_010312543.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    196   3e-57   
ref|XP_010312542.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    196   7e-57   
ref|XP_002528712.1|  carboxylic ester hydrolase, putative               196   1e-56   Ricinus communis
ref|XP_009758074.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    194   2e-56   
ref|XP_010654054.1|  PREDICTED: GDSL esterase/lipase At5g03610 is...    194   6e-56   
ref|XP_002283113.1|  PREDICTED: GDSL esterase/lipase At5g03610 is...    194   6e-56   Vitis vinifera
ref|XP_009758073.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    194   7e-56   
ref|XP_009615463.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     193   1e-55   
gb|EYU35463.1|  hypothetical protein MIMGU_mgv1a009464mg                189   2e-54   
ref|XP_006370333.1|  hypothetical protein POPTR_0001s41730g             185   6e-54   
ref|XP_010271722.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     189   6e-54   
ref|XP_008231972.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     188   7e-54   
ref|XP_004149215.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     187   1e-53   
ref|XP_008232021.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     187   1e-53   
ref|XP_002265298.1|  PREDICTED: GDSL esterase/lipase At5g03610          187   2e-53   Vitis vinifera
ref|XP_009348744.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     187   2e-53   
ref|XP_007221261.1|  hypothetical protein PRUPE_ppa020163mg             185   4e-53   
emb|CAN74804.1|  hypothetical protein VITISV_007811                     186   5e-53   Vitis vinifera
gb|KGN59118.1|  hypothetical protein Csa_3G775310                       187   5e-53   
ref|XP_009366645.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     186   7e-53   
ref|XP_007214008.1|  hypothetical protein PRUPE_ppa014794mg             185   1e-52   
ref|XP_010036710.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     186   1e-52   
gb|EYU35464.1|  hypothetical protein MIMGU_mgv1a019688mg                184   2e-52   
ref|XP_009356119.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     185   2e-52   
ref|XP_009374744.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     185   2e-52   
ref|XP_008232019.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     187   3e-52   
ref|XP_010244275.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     184   4e-52   
ref|XP_008391767.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     184   4e-52   
ref|XP_008345711.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     183   4e-52   
emb|CDP20485.1|  unnamed protein product                                184   5e-52   
gb|EYU35461.1|  hypothetical protein MIMGU_mgv1a0091782mg               181   5e-52   
ref|XP_010558202.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    184   6e-52   
ref|XP_004161236.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     182   6e-52   
ref|XP_004303005.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     184   6e-52   
ref|XP_010097639.1|  GDSL esterase/lipase                               180   1e-51   
ref|XP_011044546.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     182   1e-51   
gb|EYU35460.1|  hypothetical protein MIMGU_mgv1a008828mg                182   2e-51   
ref|XP_008241265.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     182   2e-51   
ref|XP_008442825.1|  PREDICTED: GDSL esterase/lipase At5g03610          182   3e-51   
emb|CDX80880.1|  BnaC03g01340D                                          182   3e-51   
ref|XP_007202099.1|  hypothetical protein PRUPE_ppa007574mg             181   5e-51   
ref|XP_010271751.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     181   9e-51   
ref|XP_007214177.1|  hypothetical protein PRUPE_ppa019181mg             179   4e-50   
ref|XP_010271718.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     179   4e-50   
ref|XP_011094379.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     178   7e-50   
ref|XP_006398814.1|  hypothetical protein EUTSA_v10013924mg             178   7e-50   
gb|EYU35459.1|  hypothetical protein MIMGU_mgv1a008682mg                178   9e-50   
ref|XP_009774131.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     177   2e-49   
emb|CDY04891.1|  BnaAnng00730D                                          177   2e-49   
ref|XP_006290027.1|  hypothetical protein CARUB_v10003661mg             176   3e-49   
ref|XP_008231974.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     176   3e-49   
ref|XP_004246526.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     177   3e-49   
gb|KFK24825.1|  hypothetical protein AALP_AA8G030000                    176   4e-49   
gb|KCW89217.1|  hypothetical protein EUGRSUZ_A01521                     176   4e-49   
emb|CDY44377.1|  BnaC02g03000D                                          176   4e-49   
ref|NP_195981.1|  GDSL esterase/lipase                                  176   4e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66568.1|  BnaAnng22470D                                          175   6e-49   
ref|XP_010490852.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     176   7e-49   
ref|XP_009125513.1|  PREDICTED: GDSL esterase/lipase At5g03610          175   1e-48   
ref|XP_006288040.1|  hypothetical protein CARUB_v10001271mg             175   1e-48   
ref|XP_002871047.1|  GDSL-motif lipase/hydrolase family protein         175   1e-48   
ref|XP_009146883.1|  PREDICTED: GDSL esterase/lipase At3g09930          175   1e-48   
ref|XP_010271720.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    175   1e-48   
ref|XP_010423687.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     175   1e-48   
ref|XP_010271719.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    175   1e-48   
ref|XP_004308553.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     173   2e-48   
ref|XP_008231971.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     176   2e-48   
ref|XP_010068920.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     176   2e-48   
ref|XP_006341240.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     174   3e-48   
ref|XP_002315445.2|  hypothetical protein POPTR_0010s24360g             171   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009621488.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     174   4e-48   
gb|KFK24822.1|  hypothetical protein AALP_AA8G029700                    173   5e-48   
ref|XP_010423690.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     173   6e-48   
ref|XP_006407621.1|  hypothetical protein EUTSA_v10022090mg             172   1e-47   
ref|XP_004305350.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     172   2e-47   
ref|XP_008375573.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     172   3e-47   
ref|XP_006485230.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     172   3e-47   
ref|XP_010271726.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     171   3e-47   
gb|KHN37834.1|  GDSL esterase/lipase                                    170   5e-47   
ref|XP_010452241.1|  PREDICTED: GDSL esterase/lipase At5g03610          171   5e-47   
ref|XP_010248424.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     170   8e-47   
ref|XP_011024232.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    170   8e-47   
ref|XP_006398813.1|  hypothetical protein EUTSA_v10013966mg             170   8e-47   
ref|XP_010244363.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     170   8e-47   
ref|XP_011024233.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    170   9e-47   
emb|CDY00894.1|  BnaC05g43060D                                          169   9e-47   
ref|XP_010452240.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     169   1e-46   
ref|XP_009336008.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     169   2e-46   
gb|KDO39252.1|  hypothetical protein CISIN_1g045084mg                   169   2e-46   
ref|XP_002264855.2|  PREDICTED: GDSL esterase/lipase At5g03610          169   2e-46   Vitis vinifera
ref|XP_006481810.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     168   5e-46   
ref|XP_007143812.1|  hypothetical protein PHAVU_007G103600g             168   5e-46   
ref|XP_006589384.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     167   5e-46   
gb|KDO61090.1|  hypothetical protein CISIN_1g019114mg                   167   5e-46   
gb|KHG04194.1|  hypothetical protein F383_29007                         168   6e-46   
ref|XP_008462554.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     167   7e-46   
gb|AGT59515.1|  GDSL esterase/lipase                                    167   7e-46   
gb|KDO37301.1|  hypothetical protein CISIN_1g046266mg                   162   8e-46   
ref|XP_006430253.1|  hypothetical protein CICLE_v10011959mg             168   1e-45   
ref|XP_004143312.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     167   1e-45   
ref|XP_002263024.1|  PREDICTED: GDSL esterase/lipase At5g03610          166   1e-45   Vitis vinifera
ref|XP_010271717.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     166   3e-45   
gb|KDP35844.1|  hypothetical protein JCGZ_10325                         166   3e-45   
ref|XP_010244324.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    166   4e-45   
ref|XP_010244330.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    166   4e-45   
ref|XP_006288070.1|  hypothetical protein CARUB_v10001303mg             166   4e-45   
emb|CAN68334.1|  hypothetical protein VITISV_040539                     166   4e-45   Vitis vinifera
gb|KDP42724.1|  hypothetical protein JCGZ_23664                         166   4e-45   
ref|XP_008462555.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     165   6e-45   
ref|XP_009125512.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     164   8e-45   
ref|XP_007027683.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    165   9e-45   
ref|XP_010464654.1|  PREDICTED: GDSL esterase/lipase At3g09930          164   1e-44   
emb|CDY04890.1|  BnaAnng00720D                                          164   2e-44   
ref|XP_006582696.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     159   2e-44   
ref|XP_010486571.1|  PREDICTED: GDSL esterase/lipase At3g09930-like     163   3e-44   
ref|XP_003591758.1|  GDSL esterase/lipase                               164   3e-44   
ref|XP_010244351.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     163   3e-44   
emb|CDP15393.1|  unnamed protein product                                163   4e-44   
ref|XP_007145313.1|  hypothetical protein PHAVU_007G2286001g            160   5e-44   
ref|XP_007143813.1|  hypothetical protein PHAVU_007G103700g             161   1e-43   
ref|XP_010490847.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     162   1e-43   
gb|AAF04430.1|AC010927_23  unknown protein                              159   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436632.1|  hypothetical protein CICLE_v10033495mg             155   3e-43   
gb|KHM99131.1|  GDSL esterase/lipase                                    160   4e-43   
ref|NP_001242541.1|  uncharacterized protein LOC100800932 precursor     160   4e-43   
ref|XP_002882645.1|  GDSL-motif lipase/hydrolase family protein         160   4e-43   
ref|XP_003535508.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     159   5e-43   
gb|KHN37835.1|  GDSL esterase/lipase                                    159   6e-43   
gb|KCW65213.1|  hypothetical protein EUGRSUZ_G02700                     159   7e-43   
ref|XP_002524979.1|  Anter-specific proline-rich protein APG, put...    156   9e-43   Ricinus communis
ref|XP_010271750.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     159   9e-43   
ref|XP_003591765.1|  GDSL esterase/lipase                               159   1e-42   
ref|XP_006603280.1|  PREDICTED: uncharacterized protein LOC100804858    159   1e-42   
ref|XP_010067146.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     159   1e-42   
ref|XP_006299747.1|  hypothetical protein CARUB_v10015942mg             159   1e-42   
gb|AAO41990.1|  putative lipase acylhydrolase                           159   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44376.1|  BnaC02g03010D                                          159   1e-42   
ref|NP_187604.1|  GDSL esterase/lipase                                  159   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582697.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     154   2e-42   
ref|XP_004143380.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     158   2e-42   
ref|XP_006606770.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     157   3e-42   
ref|XP_010452239.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     158   4e-42   
ref|XP_004156320.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     157   4e-42   
ref|XP_008462556.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    157   4e-42   
ref|XP_004143381.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     157   6e-42   
ref|XP_003591764.1|  GDSL esterase/lipase                               157   6e-42   
ref|XP_010490848.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     156   1e-41   
gb|EPS58551.1|  hypothetical protein M569_16262                         154   1e-41   
gb|AFK49232.1|  unknown                                                 155   2e-41   
ref|XP_003625784.1|  GDSL esterase/lipase                               155   2e-41   
ref|XP_010558997.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    155   3e-41   
ref|XP_010490846.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     155   3e-41   
ref|XP_003591763.1|  GDSL esterase/lipase                               154   5e-41   
ref|XP_010683771.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     155   6e-41   
ref|XP_010038977.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     155   6e-41   
gb|KHN02242.1|  GDSL esterase/lipase                                    152   7e-41   
ref|XP_008462669.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     154   9e-41   
ref|XP_004143379.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     154   1e-40   
ref|XP_006286524.1|  hypothetical protein CARUB_v10001293mg             154   1e-40   
gb|KHN24782.1|  GDSL esterase/lipase                                    153   2e-40   
ref|XP_003521452.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     153   2e-40   
ref|XP_010511744.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     153   2e-40   
ref|XP_010490849.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     153   3e-40   
ref|XP_006851508.1|  hypothetical protein AMTR_s00040p00157200          152   3e-40   
ref|XP_003542597.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     152   4e-40   
ref|XP_006301313.1|  hypothetical protein CARUB_v10021720mg             152   6e-40   
ref|XP_003554424.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     152   7e-40   
ref|XP_004496309.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     150   2e-39   
ref|XP_007162883.1|  hypothetical protein PHAVU_001G188600g             150   2e-39   
ref|XP_010419057.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     145   3e-39   
gb|KGN48250.1|  hypothetical protein Csa_6G452020                       145   3e-39   
ref|XP_004494911.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     150   4e-39   
ref|XP_010423691.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    143   1e-38   
gb|ACU23785.1|  unknown                                                 148   1e-38   Glycine max [soybeans]
ref|XP_010658799.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     147   2e-38   
ref|XP_010490850.1|  PREDICTED: GDSL esterase/lipase At5g03590          146   4e-38   
ref|XP_004156321.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    145   1e-37   
sp|Q9LZS9.2|GDL69_ARATH  RecName: Full=GDSL esterase/lipase At5g0...    145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244335.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    143   7e-37   
ref|XP_011076965.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     143   8e-37   
gb|AFK45458.1|  unknown                                                 139   2e-36   
ref|XP_002264532.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     142   2e-36   Vitis vinifera
emb|CAN68335.1|  hypothetical protein VITISV_040540                     143   4e-36   Vitis vinifera
ref|XP_010271721.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    138   6e-35   
ref|XP_002871046.1|  predicted protein                                  137   1e-34   
gb|KEH42056.1|  GDSL-like lipase/acylhydrolase                          137   2e-34   
ref|XP_004516199.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     136   3e-34   
ref|XP_002888626.1|  hypothetical protein ARALYDRAFT_894537             135   5e-34   
gb|KDP35848.1|  hypothetical protein JCGZ_10329                         132   7e-33   
ref|XP_011024234.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     132   8e-33   
ref|XP_010423688.1|  PREDICTED: GDSL esterase/lipase At5g03600-like     132   8e-33   
emb|CDX79671.1|  BnaC03g20070D                                          132   1e-32   
ref|XP_009133076.1|  PREDICTED: GDSL esterase/lipase At2g36325          132   1e-32   
gb|KEH42057.1|  GDSL-like lipase/acylhydrolase                          131   2e-32   
ref|NP_195980.1|  SGNH hydrolase-type esterase superfamily protein      130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490851.1|  PREDICTED: GDSL esterase/lipase At5g03600          130   6e-32   
ref|XP_010929732.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     130   7e-32   
ref|XP_006378809.1|  hypothetical protein POPTR_0010s24350g             130   8e-32   
ref|XP_008776019.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     129   2e-31   
ref|XP_002879603.1|  hydrolase, acting on ester bonds                   129   2e-31   
emb|CDY52368.1|  BnaA09g15670D                                          127   6e-31   
ref|XP_008245939.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     124   8e-31   
ref|XP_011046597.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     124   9e-31   
ref|XP_009414559.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    127   1e-30   
ref|XP_002316505.2|  hypothetical protein POPTR_0010s24320g             126   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002316455.1|  hypothetical protein POPTR_0010s25480g             122   4e-30   Populus trichocarpa [western balsam poplar]
gb|AAM13047.1|  unknown protein                                         125   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509486.1|  PREDICTED: GDSL esterase/lipase At2g36325          125   5e-30   
ref|NP_001078012.1|  GDSL esterase/lipase                               125   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001780581.1|  predicted protein                                  124   7e-30   
ref|XP_006288126.1|  hypothetical protein CARUB_v10001358mg             124   9e-30   
ref|XP_006388036.1|  hypothetical protein POPTR_0387s00230g             121   1e-29   
emb|CBI35231.3|  unnamed protein product                                124   2e-29   
ref|XP_006293494.1|  hypothetical protein CARUB_v10023515mg             122   5e-29   
ref|XP_011024236.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     121   1e-28   
ref|XP_007221264.1|  hypothetical protein PRUPE_ppa019622mg             115   2e-28   
ref|XP_010505168.1|  PREDICTED: GDSL esterase/lipase At2g36325-like     120   2e-28   
ref|XP_010412897.1|  PREDICTED: GDSL esterase/lipase At2g36325-like     120   3e-28   
gb|KEH42058.1|  GDSL-like lipase/acylhydrolase                          119   6e-28   
emb|CDX95170.1|  BnaC09g17000D                                          119   6e-28   
ref|XP_008791067.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     119   8e-28   
ref|XP_010088766.1|  GDSL esterase/lipase                               118   2e-27   
ref|XP_009414560.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    117   4e-27   
ref|XP_009386743.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    116   1e-26   
gb|AEW07962.1|  hypothetical protein 0_15557_01                         111   1e-26   
ref|NP_195979.1|  GDSL esterase/lipase                                  113   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394104.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    115   1e-26   
ref|XP_003591760.1|  GDSL esterase/lipase                               111   3e-26   
ref|XP_006382790.1|  hypothetical protein POPTR_0005s05460g             114   5e-26   
ref|XP_007221244.1|  hypothetical protein PRUPE_ppa023460mg             111   6e-26   
emb|CDX95179.1|  BnaC09g16910D                                          113   8e-26   
gb|EMT03862.1|  GDSL esterase/lipase                                    113   9e-26   
ref|XP_008232020.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     108   9e-26   
gb|AFG43461.1|  hypothetical protein 0_15557_01                         108   1e-25   
ref|XP_009386744.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    112   2e-25   
ref|XP_007221242.1|  hypothetical protein PRUPE_ppa019084mg             111   2e-25   
ref|XP_002871045.1|  predicted protein                                  110   3e-25   
ref|XP_009113451.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     112   3e-25   
ref|XP_011032560.1|  PREDICTED: GDSL esterase/lipase At3g09930-like     111   4e-25   
ref|XP_002524980.1|  hypothetical protein RCOM_1085850                  107   4e-25   Ricinus communis
gb|AFG43475.1|  hypothetical protein 0_15557_01                         107   5e-25   
gb|EMT06663.1|  GDSL esterase/lipase                                    111   6e-25   
ref|XP_008354861.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     110   7e-25   
gb|EMT25368.1|  GDSL esterase/lipase                                    110   8e-25   
gb|EMT31784.1|  GDSL esterase/lipase                                    109   3e-24   
gb|AFG65479.1|  hypothetical protein 0_7948_01                          105   4e-24   
ref|XP_002450131.1|  hypothetical protein SORBIDRAFT_05g000990          108   6e-24   Sorghum bicolor [broomcorn]
ref|XP_007027684.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    107   9e-24   
gb|EMT25679.1|  GDSL esterase/lipase                                    107   1e-23   
gb|EMT25678.1|  GDSL esterase/lipase                                    106   3e-23   
ref|XP_009394105.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    105   4e-23   
ref|XP_006582700.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     100   6e-23   
ref|XP_002458147.1|  hypothetical protein SORBIDRAFT_03g027670          105   7e-23   Sorghum bicolor [broomcorn]
ref|XP_010236681.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     104   2e-22   
ref|XP_011024330.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    102   3e-22   
ref|XP_004305352.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   99.4    3e-22   
ref|XP_010229887.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     102   4e-22   
gb|EMT31785.1|  GDSL esterase/lipase                                    102   6e-22   
ref|XP_011024329.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...    102   6e-22   
gb|EMT26881.1|  GDSL esterase/lipase                                    102   6e-22   
ref|XP_001770479.1|  predicted protein                                  102   9e-22   
gb|EMT16075.1|  GDSL esterase/lipase                                    101   1e-21   
ref|XP_002457210.1|  hypothetical protein SORBIDRAFT_03g003340          101   1e-21   Sorghum bicolor [broomcorn]
ref|XP_002316403.1|  hypothetical protein POPTR_0010s23670g             100   2e-21   Populus trichocarpa [western balsam poplar]
emb|CDY52306.1|  BnaA09g16180D                                          101   2e-21   
ref|XP_001761795.1|  predicted protein                                  101   2e-21   
ref|XP_004959270.1|  PREDICTED: GDSL esterase/lipase At5g03610-like     100   3e-21   
ref|XP_007221265.1|  hypothetical protein PRUPE_ppa019664mg           99.0    4e-21   
ref|XP_003572998.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   99.8    5e-21   
gb|EMT24907.1|  GDSL esterase/lipase                                  98.6    8e-21   
gb|EMT01321.1|  GDSL esterase/lipase                                  99.0    8e-21   
gb|KDP34472.1|  hypothetical protein JCGZ_12755                       96.7    1e-20   
ref|XP_010228383.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   97.8    2e-20   
ref|XP_006661564.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   98.2    2e-20   
ref|XP_010229455.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   92.8    1e-19   
gb|EEC78136.1|  hypothetical protein OsI_17687                        94.7    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_003576864.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...  95.5    2e-19   
ref|XP_010238533.1|  PREDICTED: GDSL esterase/lipase At5g03610-li...  95.1    3e-19   
ref|NP_001054088.1|  Os04g0650200                                     94.7    3e-19   
emb|CAC09353.1|  H0212B02.8                                           94.7    3e-19   
gb|EMT26216.1|  GDSL esterase/lipase                                  94.7    3e-19   
dbj|BAD46208.1|  GDSL-lipase -like                                    94.4    4e-19   
ref|NP_001063965.1|  Os09g0567800                                     94.4    4e-19   
ref|XP_006653827.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   94.0    6e-19   
ref|XP_001771264.1|  predicted protein                                93.6    7e-19   
tpg|DAA53080.1|  TPA: hypothetical protein ZEAMMB73_339897            93.6    9e-19   
ref|XP_008672155.1|  PREDICTED: uncharacterized protein LOC100193...  93.6    1e-18   
ref|NP_001132275.1|  uncharacterized protein LOC100193711 precursor   93.6    1e-18   
ref|XP_002461987.1|  hypothetical protein SORBIDRAFT_02g011940        93.2    1e-18   
gb|AAQ08995.1|  lipase                                                88.6    1e-18   
gb|KHG21082.1|  GDSL esterase/lipase 1 -like protein                  92.8    1e-18   
gb|EEC85084.1|  hypothetical protein OsI_32442                        92.4    2e-18   
ref|XP_003575705.1|  PREDICTED: GDSL esterase/lipase At3g09930-like   92.0    4e-18   
gb|EEC78137.1|  hypothetical protein OsI_17688                        91.3    4e-18   
emb|CBI35226.3|  unnamed protein product                              90.9    5e-18   
gb|EMT24751.1|  GDSL esterase/lipase                                  91.3    5e-18   
emb|CDM86846.1|  unnamed protein product                              91.3    6e-18   
gb|EMT17621.1|  GDSL esterase/lipase                                  90.9    6e-18   
gb|EMT21493.1|  hypothetical protein F775_01692                       90.1    8e-18   
gb|EEE70258.1|  hypothetical protein OsJ_30392                        90.1    9e-18   
ref|XP_001765587.1|  predicted protein                                90.1    1e-17   
gb|EMT09820.1|  GDSL esterase/lipase                                  89.7    2e-17   
ref|XP_010244339.1|  PREDICTED: GDSL esterase/lipase At3g09930-li...  88.6    3e-17   
ref|XP_007221250.1|  hypothetical protein PRUPE_ppa026385mg           88.2    3e-17   
ref|XP_004958827.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   87.4    5e-17   
ref|XP_001785272.1|  predicted protein                                87.4    7e-17   
ref|XP_004955337.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   87.0    8e-17   
gb|EMT11025.1|  GDSL esterase/lipase                                  87.4    1e-16   
ref|XP_002311020.2|  hypothetical protein POPTR_0008s02310g           84.3    2e-16   
ref|XP_004986176.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   86.3    2e-16   
ref|XP_006290236.1|  hypothetical protein CARUB_v100033700mg          80.9    4e-16   
ref|XP_001785559.1|  predicted protein                                85.9    8e-16   
ref|XP_001753850.1|  predicted protein                                82.8    3e-15   
ref|XP_010029491.1|  PREDICTED: GDSL esterase/lipase 5-like           83.2    3e-15   
ref|XP_010479022.1|  PREDICTED: GDSL esterase/lipase At3g09930-like   81.6    5e-15   
ref|XP_003579391.2|  PREDICTED: GDSL esterase/lipase At5g03610-like   84.0    5e-15   
ref|XP_004958833.1|  PREDICTED: GDSL esterase/lipase At5g03600-like   82.8    7e-15   
ref|XP_002879857.1|  GDSL-motif lipase/hydrolase family protein       82.0    9e-15   
ref|XP_007042987.1|  GDSL-motif lipase 2, putative                    82.0    9e-15   
ref|XP_010029492.1|  PREDICTED: GDSL esterase/lipase 4-like           81.6    1e-14   
gb|AAD25940.1|AF085279_13  hypothetical APG protein                   81.6    1e-14   
ref|NP_181554.1|  GDSL esterase/lipase                                81.3    2e-14   
ref|XP_010230112.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   81.6    2e-14   
ref|XP_007042986.1|  GDSL-motif lipase 2, putative                    81.3    2e-14   
ref|XP_004956206.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   80.9    3e-14   
ref|XP_010040145.1|  PREDICTED: GDSL esterase/lipase 2-like           79.7    6e-14   
ref|XP_007134123.1|  hypothetical protein PHAVU_010G021000g           79.7    8e-14   
ref|XP_010273222.1|  PREDICTED: GDSL esterase/lipase 5-like           79.0    1e-13   
ref|XP_003627417.1|  GDSL esterase/lipase                             79.0    1e-13   
gb|AAQ01574.1|  putative lipase                                       74.7    1e-13   
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  78.6    2e-13   
ref|XP_010446248.1|  PREDICTED: GDSL esterase/lipase At5g63170-like   77.4    2e-13   
ref|XP_010239340.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   78.2    2e-13   
ref|XP_001785127.1|  predicted protein                                78.6    2e-13   
ref|XP_010508889.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   77.8    3e-13   
ref|XP_002461319.1|  hypothetical protein SORBIDRAFT_02g000860        77.8    3e-13   
ref|XP_007042990.1|  GDSL lipase 1, putative                          77.4    4e-13   
gb|ABK21582.1|  unknown                                               77.0    4e-13   
ref|XP_007206827.1|  hypothetical protein PRUPE_ppa026294mg           77.0    4e-13   
ref|XP_006290249.1|  hypothetical protein CARUB_v100033701mg          75.1    5e-13   
ref|XP_004959771.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   76.6    5e-13   
gb|AAQ01571.1|  putative lipase                                       72.8    6e-13   
gb|KHN48853.1|  GDSL esterase/lipase 5                                76.6    6e-13   
ref|NP_001242615.1|  uncharacterized protein LOC100809397 precursor   76.6    7e-13   
emb|CDP21847.1|  unnamed protein product                              76.6    8e-13   
gb|ACU23850.1|  unknown                                               76.3    9e-13   
gb|KHN48854.1|  GDSL esterase/lipase 5                                76.3    1e-12   
ref|XP_003546833.1|  PREDICTED: GDSL esterase/lipase 5-like           76.3    1e-12   
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   76.3    1e-12   
ref|XP_008670498.1|  PREDICTED: GDSL esterase/lipase At5g03600-li...  75.9    1e-12   
ref|XP_008670497.1|  PREDICTED: GDSL esterase/lipase At5g03600-li...  75.9    1e-12   
ref|XP_009136755.1|  PREDICTED: GDSL esterase/lipase At4g16230        75.9    2e-12   
ref|XP_009143233.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   75.5    2e-12   
emb|CDY09704.1|  BnaC07g33570D                                        75.5    2e-12   
ref|XP_004959783.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   75.1    2e-12   
gb|AEZ63357.1|  type III-1 GDSL lipase                                75.5    2e-12   
gb|AEZ63359.1|  type IV-1 GDSL lipase                                 75.1    2e-12   
gb|AEZ63356.1|  type II-1 GDSL lipase                                 75.1    2e-12   
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  75.5    2e-12   
ref|XP_006388571.1|  hypothetical protein POPTR_0154s00260g           75.5    2e-12   
ref|XP_002316752.2|  hypothetical protein POPTR_0011s03130g           74.7    2e-12   
gb|KFK25755.1|  hypothetical protein AALP_AA8G155300                  73.9    3e-12   
ref|XP_009363464.1|  PREDICTED: GDSL esterase/lipase EXL3-like        75.1    3e-12   
ref|XP_009114041.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   73.9    3e-12   
ref|XP_004986974.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   74.7    3e-12   
ref|XP_010445692.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   73.2    3e-12   
gb|KDP40645.1|  hypothetical protein JCGZ_24644                       74.3    4e-12   
ref|XP_010505748.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   74.3    4e-12   
emb|CDO97806.1|  unnamed protein product                              74.3    5e-12   
ref|XP_007227276.1|  hypothetical protein PRUPE_ppa017557mg           74.3    5e-12   
ref|XP_006597500.1|  PREDICTED: GDSL esterase/lipase At1g29670-like   74.3    5e-12   
gb|KHN06930.1|  GDSL esterase/lipase                                  74.3    5e-12   
ref|XP_010508867.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   73.9    6e-12   
ref|XP_004959773.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   73.9    6e-12   
ref|XP_003627418.1|  GDSL esterase/lipase                             73.9    6e-12   
ref|XP_007042989.1|  GDSL-motif lipase 2, putative                    73.9    6e-12   
ref|XP_009141877.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   73.9    6e-12   
ref|XP_002271802.1|  PREDICTED: GDSL esterase/lipase 1                73.9    7e-12   
ref|XP_006435221.1|  hypothetical protein CICLE_v10003119mg           73.6    7e-12   
gb|EYU30038.1|  hypothetical protein MIMGU_mgv1a008151mg              73.9    7e-12   
ref|XP_003618998.1|  GDSL esterase/lipase                             73.6    8e-12   
gb|KDO84924.1|  hypothetical protein CISIN_1g042648mg                 73.6    8e-12   
ref|XP_006473907.1|  PREDICTED: GDSL esterase/lipase EXL3-like        73.6    9e-12   
ref|XP_010478231.1|  PREDICTED: GDSL esterase/lipase At5g63170-like   73.2    9e-12   
ref|XP_010446249.1|  PREDICTED: GDSL esterase/lipase At5g63170        73.2    9e-12   
ref|XP_002964001.1|  hypothetical protein SELMODRAFT_166529           73.2    9e-12   
ref|XP_006387156.1|  hypothetical protein POPTR_1677s00200g           72.8    1e-11   
ref|XP_010029497.1|  PREDICTED: GDSL esterase/lipase 1-like isofo...  73.2    1e-11   
ref|XP_010029495.1|  PREDICTED: GDSL esterase/lipase 1-like isofo...  73.2    1e-11   
ref|XP_009787970.1|  PREDICTED: GDSL esterase/lipase 1-like           73.2    1e-11   
gb|EMT30305.1|  GDSL esterase/lipase                                  73.2    1e-11   
ref|XP_006372529.1|  hypothetical protein POPTR_0017s02500g           72.8    1e-11   
ref|XP_004305775.1|  PREDICTED: GDSL esterase/lipase 4-like           73.2    1e-11   
gb|KCW56420.1|  hypothetical protein EUGRSUZ_I02146                   71.6    1e-11   
gb|KFK36915.1|  hypothetical protein AALP_AA4G189300                  72.8    2e-11   
ref|XP_006342239.1|  PREDICTED: GDSL esterase/lipase EXL3-like        72.8    2e-11   
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  72.8    2e-11   
ref|XP_002438721.1|  hypothetical protein SORBIDRAFT_10g025020        71.2    2e-11   
ref|XP_006597499.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...  72.0    2e-11   
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  72.4    2e-11   
gb|EMT26218.1|  hypothetical protein F775_01997                       72.4    2e-11   
ref|XP_006597498.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...  72.0    2e-11   
gb|AEZ63353.1|  type I-1 GDSL lipase                                  72.4    2e-11   
gb|KDO37386.1|  hypothetical protein CISIN_1g048375mg                 70.5    2e-11   
ref|XP_002533921.1|  zinc finger protein, putative                    72.4    2e-11   
ref|NP_201122.1|  GDSL esterase/lipase                                72.0    2e-11   
ref|XP_010104615.1|  GDSL esterase/lipase 1                           72.8    2e-11   
ref|XP_002866539.1|  hypothetical protein ARALYDRAFT_332543           72.0    3e-11   
ref|XP_010465311.1|  PREDICTED: inactive GDSL esterase/lipase-lik...  72.0    3e-11   
ref|XP_006394305.1|  hypothetical protein EUTSA_v10005274mg           71.6    3e-11   
ref|XP_004141726.1|  PREDICTED: GDSL esterase/lipase 1-like           72.0    3e-11   
ref|XP_002967924.1|  hypothetical protein SELMODRAFT_267148           71.6    3e-11   
ref|XP_010440190.1|  PREDICTED: GDSL esterase/lipase At4g16230-like   72.0    3e-11   
sp|O23470.2|GDL64_ARATH  RecName: Full=GDSL esterase/lipase At4g1...  72.0    3e-11   
ref|XP_004303739.1|  PREDICTED: GDSL esterase/lipase 1-like           71.6    3e-11   
emb|CDM86848.1|  unnamed protein product                              71.2    3e-11   
gb|KDP46098.1|  hypothetical protein JCGZ_06609                       71.6    4e-11   
ref|XP_011038295.1|  PREDICTED: GDSL esterase/lipase 1-like           71.6    4e-11   
ref|XP_006414376.1|  hypothetical protein EUTSA_v10027022mg           71.6    4e-11   
gb|KHN06929.1|  GDSL esterase/lipase                                  71.6    5e-11   
gb|EYU22884.1|  hypothetical protein MIMGU_mgv1a0099262mg             69.7    5e-11   
ref|XP_010658803.1|  PREDICTED: GDSL esterase/lipase At5g03610-like   69.3    5e-11   
ref|XP_006597497.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...  71.2    5e-11   
ref|XP_002862414.1|  predicted protein                                69.7    5e-11   
ref|XP_002988967.1|  hypothetical protein SELMODRAFT_129056           71.2    5e-11   
ref|XP_009351929.1|  PREDICTED: GDSL esterase/lipase At1g29670-like   71.2    5e-11   
ref|XP_010449833.1|  PREDICTED: GDSL esterase/lipase At4g16230-like   71.2    6e-11   
ref|XP_004490678.1|  PREDICTED: GDSL esterase/lipase At2g30310-like   71.2    6e-11   
ref|XP_010534613.1|  PREDICTED: GDSL esterase/lipase At2g40250        70.9    6e-11   
ref|XP_011074698.1|  PREDICTED: GDSL esterase/lipase EXL3-like        70.9    7e-11   
gb|EYU22886.1|  hypothetical protein MIMGU_mgv1a008749mg              70.9    7e-11   
ref|XP_010260395.1|  PREDICTED: GDSL esterase/lipase At5g45950-like   70.9    7e-11   
ref|XP_011038247.1|  PREDICTED: GDSL esterase/lipase 1-like           70.9    8e-11   
gb|EYU19786.1|  hypothetical protein MIMGU_mgv11b014209mg             66.6    8e-11   
ref|XP_009106946.1|  PREDICTED: inactive GDSL esterase/lipase-lik...  70.9    8e-11   
emb|CDY54197.1|  BnaA08g29200D                                        70.9    8e-11   
gb|KHN47369.1|  GDSL esterase/lipase                                  70.9    8e-11   
ref|XP_003542965.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...  70.5    9e-11   
ref|XP_010029490.1|  PREDICTED: GDSL esterase/lipase 1-like           70.5    9e-11   
ref|XP_010434862.1|  PREDICTED: GDSL esterase/lipase At4g16230        70.5    9e-11   
gb|KCW56418.1|  hypothetical protein EUGRSUZ_I02144                   70.5    1e-10   
emb|CBI16914.3|  unnamed protein product                              70.1    1e-10   
ref|XP_009147559.1|  PREDICTED: inactive GDSL esterase/lipase-lik...  70.5    1e-10   
ref|XP_002975076.1|  hypothetical protein SELMODRAFT_174517           70.5    1e-10   
ref|XP_004510557.1|  PREDICTED: GDSL esterase/lipase 5-like           70.5    1e-10   
ref|XP_008243323.1|  PREDICTED: GDSL esterase/lipase 6                70.1    1e-10   
ref|XP_010535268.1|  PREDICTED: GDSL esterase/lipase APG-like         69.3    1e-10   
ref|XP_008672157.1|  PREDICTED: uncharacterized protein LOC100193...  70.1    1e-10   
emb|CDP15854.1|  unnamed protein product                              70.1    1e-10   
ref|XP_006406840.1|  hypothetical protein EUTSA_v10021008mg           70.1    1e-10   
gb|KEH36672.1|  GDSL-like lipase/acylhydrolase                        70.1    1e-10   
ref|XP_009768390.1|  PREDICTED: GDSL esterase/lipase EXL3-like        70.1    1e-10   
gb|EAY75193.1|  hypothetical protein OsI_03085                        70.1    1e-10   
ref|XP_002278481.1|  PREDICTED: GDSL esterase/lipase 7-like           70.1    1e-10   
ref|XP_010517441.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   69.7    1e-10   
ref|XP_010933356.1|  PREDICTED: GDSL esterase/lipase EXL3-like        69.7    2e-10   
emb|CDY30680.1|  BnaC06g10440D                                        70.1    2e-10   
ref|XP_010465312.1|  PREDICTED: GDSL esterase/lipase ESM1-like        70.1    2e-10   
ref|XP_008437733.1|  PREDICTED: GDSL esterase/lipase At5g41890        69.7    2e-10   
ref|XP_006465823.1|  PREDICTED: GDSL esterase/lipase 2-like isofo...  69.7    2e-10   
emb|CAN83203.1|  hypothetical protein VITISV_035686                   69.7    2e-10   
ref|XP_006392726.1|  hypothetical protein EUTSA_v10011556mg           69.7    2e-10   
ref|XP_002870171.1|  hypothetical protein ARALYDRAFT_355138           69.7    2e-10   
ref|XP_008393902.1|  PREDICTED: GDSL esterase/lipase EXL3-like        69.7    2e-10   
gb|KDO45748.1|  hypothetical protein CISIN_1g039308mg                 68.9    2e-10   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like        69.3    2e-10   
ref|XP_006300353.1|  hypothetical protein CARUB_v10021945mg           69.3    2e-10   
ref|XP_008371523.1|  PREDICTED: GDSL esterase/lipase At1g29670-like   68.2    2e-10   
ref|XP_002865215.1|  GDSL-motif lipase/hydrolase family protein       69.3    2e-10   
gb|ABK25389.1|  unknown                                               69.3    2e-10   
ref|XP_009767835.1|  PREDICTED: GDSL esterase/lipase 2-like           69.3    2e-10   
gb|KEH38117.1|  GDSL-like lipase/acylhydrolase                        69.3    2e-10   
ref|XP_007039380.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  69.3    2e-10   
emb|CDP15851.1|  unnamed protein product                              69.3    2e-10   
ref|XP_006282047.1|  hypothetical protein CARUB_v10028290mg           68.9    3e-10   
ref|XP_008462253.1|  PREDICTED: GDSL esterase/lipase 5-like           69.3    3e-10   
emb|CDP00723.1|  unnamed protein product                              69.3    3e-10   
ref|XP_006372506.1|  hypothetical protein POPTR_0017s02280g           69.3    3e-10   
ref|XP_010545663.1|  PREDICTED: GDSL esterase/lipase APG              68.9    3e-10   
ref|XP_004168797.1|  PREDICTED: GDSL esterase/lipase At2g30310-like   68.9    3e-10   
ref|XP_008463828.1|  PREDICTED: GDSL esterase/lipase At2g30310-like   68.9    3e-10   
ref|XP_002533919.1|  zinc finger protein, putative                    69.3    3e-10   
gb|KHN24863.1|  GDSL esterase/lipase                                  68.6    3e-10   
ref|XP_007033879.1|  GDSL-motif lipase 7                              68.9    3e-10   
gb|EYU19434.1|  hypothetical protein MIMGU_mgv1a024192mg              68.9    3e-10   
gb|KCW45448.1|  hypothetical protein EUGRSUZ_L00833                   67.0    3e-10   
ref|XP_009146144.1|  PREDICTED: GDSL esterase/lipase APG              68.9    3e-10   
emb|CDY61480.1|  BnaC03g78280D                                        68.9    3e-10   
emb|CDY30167.1|  BnaC05g36950D                                        68.9    3e-10   
emb|CBI19912.3|  unnamed protein product                              68.2    3e-10   
gb|EYU28037.1|  hypothetical protein MIMGU_mgv1a008421mg              68.9    4e-10   
ref|XP_009627000.1|  PREDICTED: GDSL esterase/lipase At5g41890 is...  68.9    4e-10   
ref|XP_002282047.1|  PREDICTED: GDSL esterase/lipase 7                68.9    4e-10   
ref|XP_010104613.1|  GDSL esterase/lipase 1                           68.9    4e-10   
gb|EMT23390.1|  GDSL esterase/lipase                                  68.9    4e-10   
gb|KGN49979.1|  hypothetical protein Csa_5G148500                     68.9    4e-10   
ref|XP_008358326.1|  PREDICTED: GDSL esterase/lipase At1g29670-like   68.9    4e-10   
ref|XP_004510808.1|  PREDICTED: GDSL esterase/lipase 5-like isofo...  68.6    4e-10   



>ref|XP_006361449.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Solanum tuberosum]
Length=352

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 131/186 (70%), Gaps = 11/186 (6%)
 Frame = +3

Query  9    VGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVT  176
            VGNDYA++    + ++  +    +SI  QL +NL+RIH +GV K+ +TAM+P+GCLP +T
Sbjct  174  VGNDYATFITKNNNNMEDLGNVTKSILSQLELNLRRIHGLGVQKIGITAMEPIGCLPKMT  233

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
             S+ +Y NC E  N++  FHNQML Q +DKLN+QT    F  +DLY+AF +ALNI+ + H
Sbjct  234  ISS-SYENCSEYANSLAIFHNQMLHQIIDKLNNQTSRPIFFTIDLYSAFMTALNIQQN-H  291

Query  357  PGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
            PG S+F  PL PCC+G CG+     KK Y LC +P+++FFWD+ HPSQQGWFAV+SALK 
Sbjct  292  PGNSNFENPLKPCCMGICGD-----KKKYVLCKNPELSFFWDVIHPSQQGWFAVFSALKP  346

Query  537  SLPHLF  554
            SL  L 
Sbjct  347  SLSSLL  352



>ref|XP_010312544.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X3 [Solanum 
lycopersicum]
Length=291

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 11/184 (6%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEFV---ESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++  + + ME+ V   +S+  QL +NL+RIH +GV K+ +T M+P+GCLP +T  
Sbjct  116  GNDYATFITN-NNMEDLVNVTKSMLSQLELNLRRIHGLGVQKIGITTMEPIGCLPKLTI-  173

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +Y NC E  N+I+ FHNQML Q +DKLN+QT    F I+DLY AF ++LNI+ + HPG
Sbjct  174  TSSYENCSEYANSISMFHNQMLHQIIDKLNNQTSKPNFFIIDLYNAFMTSLNIQQN-HPG  232

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             S+F  PL PCC+G CG+     KK Y LC +P+ +FFWD  HPSQQGWFAV+SALK SL
Sbjct  233  NSNFENPLKPCCMGICGD-----KKKYVLCKNPEFSFFWDAIHPSQQGWFAVFSALKPSL  287

Query  543  PHLF  554
              L 
Sbjct  288  SFLL  291



>ref|XP_010312543.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Solanum 
lycopersicum]
Length=315

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 11/184 (6%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEFV---ESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++  + + ME+ V   +S+  QL +NL+RIH +GV K+ +T M+P+GCLP +T  
Sbjct  140  GNDYATFITN-NNMEDLVNVTKSMLSQLELNLRRIHGLGVQKIGITTMEPIGCLPKLTI-  197

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +Y NC E  N+I+ FHNQML Q +DKLN+QT    F I+DLY AF ++LNI+ + HPG
Sbjct  198  TSSYENCSEYANSISMFHNQMLHQIIDKLNNQTSKPNFFIIDLYNAFMTSLNIQQN-HPG  256

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             S+F  PL PCC+G CG+     KK Y LC +P+ +FFWD  HPSQQGWFAV+SALK SL
Sbjct  257  NSNFENPLKPCCMGICGD-----KKKYVLCKNPEFSFFWDAIHPSQQGWFAVFSALKPSL  311

Query  543  PHLF  554
              L 
Sbjct  312  SFLL  315



>ref|XP_010312542.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Solanum 
lycopersicum]
Length=350

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 11/184 (6%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEFV---ESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++  + + ME+ V   +S+  QL +NL+RIH +GV K+ +T M+P+GCLP +T  
Sbjct  175  GNDYATFITN-NNMEDLVNVTKSMLSQLELNLRRIHGLGVQKIGITTMEPIGCLPKLTI-  232

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +Y NC E  N+I+ FHNQML Q +DKLN+QT    F I+DLY AF ++LNI+ + HPG
Sbjct  233  TSSYENCSEYANSISMFHNQMLHQIIDKLNNQTSKPNFFIIDLYNAFMTSLNIQQN-HPG  291

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             S+F  PL PCC+G CG+     KK Y LC +P+ +FFWD  HPSQQGWFAV+SALK SL
Sbjct  292  NSNFENPLKPCCMGICGD-----KKKYVLCKNPEFSFFWDAIHPSQQGWFAVFSALKPSL  346

Query  543  PHLF  554
              L 
Sbjct  347  SFLL  350



>ref|XP_002528712.1| carboxylic ester hydrolase, putative [Ricinus communis]
 gb|EEF33624.1| carboxylic ester hydrolase, putative [Ricinus communis]
Length=356

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 129/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA+Y   +G   G  +F+  +  Q++VNLKRIHE+GV KVAVTA+QPLGCLP  TF+
Sbjct  171  GNDYATYLATNGSAQGFPDFIRKVVNQITVNLKRIHELGVKKVAVTALQPLGCLPRSTFA  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N +   HN ML+Q V KLN++T+ S FVILD+Y+AF +    K D HPG
Sbjct  231  S-SFQQCNGTENELVSLHNLMLQQAVAKLNNETKDSTFVILDIYSAFMTVFKNKGD-HPG  288

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S+F  PL PCC+G     +CG++  +G K Y +CDDP+  FFWD  HP+Q+GW +VY A
Sbjct  289  SSTFQNPLKPCCVGTSTQYSCGDLHENGTKMYTVCDDPEATFFWDTVHPTQEGWRSVYLA  348

Query  528  LKSSLPHL  551
            L+++L  L
Sbjct  349  LQANLQQL  356



>ref|XP_009758074.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Nicotiana 
sylvestris]
Length=333

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 132/191 (69%), Gaps = 11/191 (6%)
 Frame = +3

Query  9    VGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVT  176
             GNDYA++      ++  + +  +SI  QL +NL+RIH +GV KV +TAM+P+GCLP +T
Sbjct  145  AGNDYATFLTKNGNNMKDLGDLTKSIISQLELNLRRIHGLGVSKVGITAMEPIGCLPRMT  204

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
             +  +Y NC ++  +++RFHN++L+Q ++KLN+QT    FVILDLY+AF SALNI+   H
Sbjct  205  -AVSSYENCSDSATSLSRFHNEILQQTIEKLNNQTGKPVFVILDLYSAFMSALNIQQS-H  262

Query  357  PGKSS-FPYPLAPCCLGNCGEVDVSGKKG----YGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            PG SS F  PL PCC+G   E     K+G    Y +C +P+++FFWD+ HPSQQGWFAV+
Sbjct  263  PGNSSNFENPLKPCCMGTSSEYSCGDKRGTTKKYVVCRNPQLSFFWDIIHPSQQGWFAVF  322

Query  522  SALKSSLPHLF  554
            SALK SL  L 
Sbjct  323  SALKPSLRSLL  333



>ref|XP_010654054.1| PREDICTED: GDSL esterase/lipase At5g03610 isoform X2 [Vitis vinifera]
Length=355

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 124/188 (66%), Gaps = 10/188 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y    G    ++ F+  + +QL VNLKR+H MG+ KVAVT+++PLGCLP  T S
Sbjct  166  GNDYGAYLARGGSSQTLQSFILLVVDQLVVNLKRLHGMGMKKVAVTSLEPLGCLPQTTVS  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    FHN +L Q V KLN++T+ SPFVILDLYA+F S    K D H G
Sbjct  226  S-SFQECNGTQNTAVTFHNLLLSQAVTKLNNETKDSPFVILDLYASFMSVFENKAD-HLG  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC+G     +CG VD SG K Y +CDDP+ AFFWD  HP+QQGW AVYSA
Sbjct  284  SSKFENPLKPCCMGISSEYSCGSVDESGAKKYTICDDPESAFFWDTVHPTQQGWNAVYSA  343

Query  528  LKSSLPHL  551
            L+ +L  L
Sbjct  344  LQGTLQQL  351



>ref|XP_002283113.1| PREDICTED: GDSL esterase/lipase At5g03610 isoform X1 [Vitis vinifera]
 emb|CBI30266.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 124/188 (66%), Gaps = 10/188 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y    G    ++ F+  + +QL VNLKR+H MG+ KVAVT+++PLGCLP  T S
Sbjct  169  GNDYGAYLARGGSSQTLQSFILLVVDQLVVNLKRLHGMGMKKVAVTSLEPLGCLPQTTVS  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    FHN +L Q V KLN++T+ SPFVILDLYA+F S    K D H G
Sbjct  229  S-SFQECNGTQNTAVTFHNLLLSQAVTKLNNETKDSPFVILDLYASFMSVFENKAD-HLG  286

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC+G     +CG VD SG K Y +CDDP+ AFFWD  HP+QQGW AVYSA
Sbjct  287  SSKFENPLKPCCMGISSEYSCGSVDESGAKKYTICDDPESAFFWDTVHPTQQGWNAVYSA  346

Query  528  LKSSLPHL  551
            L+ +L  L
Sbjct  347  LQGTLQQL  354



>ref|XP_009758073.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Nicotiana 
sylvestris]
Length=357

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 132/190 (69%), Gaps = 11/190 (6%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++      ++  + +  +SI  QL +NL+RIH +GV KV +TAM+P+GCLP +T 
Sbjct  170  GNDYATFLTKNGNNMKDLGDLTKSIISQLELNLRRIHGLGVSKVGITAMEPIGCLPRMT-  228

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            +  +Y NC ++  +++RFHN++L+Q ++KLN+QT    FVILDLY+AF SALNI+   HP
Sbjct  229  AVSSYENCSDSATSLSRFHNEILQQTIEKLNNQTGKPVFVILDLYSAFMSALNIQQS-HP  287

Query  360  GKSS-FPYPLAPCCLGNCGEVDVSGKKG----YGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G SS F  PL PCC+G   E     K+G    Y +C +P+++FFWD+ HPSQQGWFAV+S
Sbjct  288  GNSSNFENPLKPCCMGTSSEYSCGDKRGTTKKYVVCRNPQLSFFWDIIHPSQQGWFAVFS  347

Query  525  ALKSSLPHLF  554
            ALK SL  L 
Sbjct  348  ALKPSLRSLL  357



>ref|XP_009615463.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nicotiana tomentosiformis]
Length=354

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 131/189 (69%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++      ++  + +  +SI  QL +NL+RIH +GV K+ +TAM+P+GCLP +T 
Sbjct  168  GNDYATFLTKNGNNMDDLGDIAKSIISQLELNLRRIHGLGVSKIGITAMEPIGCLPRMT-  226

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            +  +Y NC ++ N+++RFHN++L Q ++KLN+QT    +VILDLY AF SAL+I+ + HP
Sbjct  227  AASSYENCSDSANSLSRFHNEILHQTIEKLNNQTGKPVYVILDLYNAFISALDIQQN-HP  285

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKG----YGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            G S+F  PL PCCLG   E     KKG    Y LC +P+++FFWD+ HPSQQGWFAV+SA
Sbjct  286  GNSNFENPLKPCCLGTSSEYSCGDKKGMRKNYVLCRNPELSFFWDVIHPSQQGWFAVFSA  345

Query  528  LKSSLPHLF  554
            L  SL  L 
Sbjct  346  LMPSLRSLL  354



>gb|EYU35463.1| hypothetical protein MIMGU_mgv1a009464mg [Erythranthe guttata]
Length=341

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 122/189 (65%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYAS+    G   G++ F+ S+  QLS+NLKRI +MG  KV VTA+QPLGCLP +T S
Sbjct  155  GNDYASFLANGGTNQGLQSFIPSVVNQLSINLKRIQKMGATKVIVTALQPLGCLPRITQS  214

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    +HN +L+Q V KLN++T  S F ILDLY +FT+ +  K D   G
Sbjct  215  S-SFKECNATQNLAVNYHNLLLQQTVAKLNNETNSSTFFILDLYNSFTTVIEQKGDPK-G  272

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            K  F  PL PCC+G     +CG  D  G K Y LC DPK AFFWD +HP+Q GW AVY+ 
Sbjct  273  KLKFETPLKPCCMGISREYSCGSADEKGAKLYTLCSDPKSAFFWDSSHPTQAGWKAVYTI  332

Query  528  LKSSLPHLF  554
            LKSSL  LF
Sbjct  333  LKSSLAQLF  341



>ref|XP_006370333.1| hypothetical protein POPTR_0001s41730g [Populus trichocarpa]
 gb|ERP66902.1| hypothetical protein POPTR_0001s41730g [Populus trichocarpa]
Length=234

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 118/181 (65%), Gaps = 10/181 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G + F+  +  QL  N+KRIH MGV KV VTA+QPLGCLP  TF 
Sbjct  52   GNDYSTYATTNGSPQGWQPFIIEVVNQLVTNMKRIHGMGVNKVVVTALQPLGCLPRSTF-  110

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   N +  FHN +L+Q V KLN++T+ S F ILDLY AF +   I+  ++PG
Sbjct  111  TSSFQQCNGTENELVGFHNLLLQQAVTKLNNETKDSTFAILDLYKAFMAVFKIQ-GKNPG  169

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC G      CG VD +G K Y +CDDP+ AFFWD  HP+Q+GW AVYSA
Sbjct  170  SSKFGNPLKPCCTGISTEYGCGSVDANGVKKYVVCDDPETAFFWDTAHPTQEGWRAVYSA  229

Query  528  L  530
            L
Sbjct  230  L  230



>ref|XP_010271722.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=360

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 124/188 (66%), Gaps = 10/188 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G   G+  F  SI  QL++N+KRIH+MGV KVAVTA++P GCLPA +  
Sbjct  173  GNDYTTYSARNGSTEGLSNFTASIINQLAINMKRIHDMGVKKVAVTAVEPFGCLPANSVL  232

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C+E  N I+ FHN +L+Q V+KLN++T  S F+ILDLY AF S    + D HPG
Sbjct  233  S-SYQQCNETNNKISIFHNLLLQQAVEKLNNETNESTFIILDLYNAFISTFERQKD-HPG  290

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               +  PL PCC+G      CGE D +G   Y +C DP+ AFFWD  HPSQ+GW AV SA
Sbjct  291  SLKYVNPLKPCCVGITTKDLCGEKDENGVAKYTVCQDPESAFFWDDVHPSQEGWHAVSSA  350

Query  528  LKSSLPHL  551
            L++SL  L
Sbjct  351  LQNSLQQL  358



>ref|XP_008231972.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=335

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTG  188
            GNDYA+Y G H        +SI +QL+V+L+RIH +GV K+AVTA+ PLGCLP +T S  
Sbjct  149  GNDYAAYFGNHTEDFAAATKSIIKQLAVDLERIHGLGVRKIAVTAIGPLGCLPRMT-SFL  207

Query  189  NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGK  365
            +Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH  H G 
Sbjct  208  SYQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKH--HQGY  265

Query  366  SSFPY-PLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            S+    PL PCC+G      CG VD SG K Y +CD PK++FFWD  HPSQ GW  VYSA
Sbjct  266  STLQINPLKPCCVGVSKEYPCGSVDESGAKKYIVCDKPKLSFFWDTIHPSQNGWHEVYSA  325

Query  528  LKSSLPHLF  554
            +KSSL  L+
Sbjct  326  IKSSLRQLY  334



>ref|XP_004149215.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
Length=315

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 125/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y    G   G + F+  +  QL VNL+RIH +GVPK+ VTA++PLGCLP+ TF+
Sbjct  127  GNDYSVYQANNGSPQGWQPFITKVVNQLEVNLRRIHGLGVPKIVVTALEPLGCLPSTTFA  186

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---GSPFVILDLYAAFTSALNIKHDQ  353
            + ++  C+   N +  FHN +L+Q V KLN + +    S F++LDLY++F +ALN K DQ
Sbjct  187  S-SFQQCNSTQNQLVNFHNLLLQQSVAKLNSEVKDPSASTFILLDLYSSFMAALNNKADQ  245

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  P+ PCC+G      CG V  +G+K Y +C+DP  AFFWD  HP+Q GW+AV
Sbjct  246  L-GNVKFENPMKPCCVGISSEYACGSVGANGEKKYTICEDPGAAFFWDEVHPTQYGWYAV  304

Query  519  YSALKSSLPHL  551
            YSAL++SL  L
Sbjct  305  YSALQASLKQL  315



>ref|XP_008232021.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=340

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 16/194 (8%)
 Frame = +3

Query  12   GNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTG  188
            GNDYA+Y G H        +SI +QL+V+L+RIH +GV K+AVTA+ PLGCLP +T S  
Sbjct  149  GNDYAAYFGNHTEDFAAATKSIIKQLAVDLERIHGLGVRKIAVTAIGPLGCLPRMT-SFL  207

Query  189  NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGK  365
            +Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH  H G 
Sbjct  208  SYQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKH--HQGY  265

Query  366  SSFPY------PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWF  512
            S+         PL PCC+G     +CG VD SG K Y +CD PK++FFWD  HPSQ GW 
Sbjct  266  STLQINSLQINPLKPCCVGVSKEYSCGSVDESGAKKYIVCDKPKLSFFWDTIHPSQNGWH  325

Query  513  AVYSALKSSLPHLF  554
             VYSA+KSSL  L+
Sbjct  326  EVYSAIKSSLRQLY  339



>ref|XP_002265298.1| PREDICTED: GDSL esterase/lipase At5g03610 [Vitis vinifera]
 emb|CBI35239.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 125/185 (68%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA+Y   +G I  +  F  S+  QLS+N+K IH MGV KVA+ A+QPLGCLP V+  
Sbjct  152  GNDYAAYLAGNGTIQSLPAFTTSLIRQLSLNMKHIHGMGVRKVAIMAIQPLGCLPQVSAL  211

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +YPNC    N+I++FHNQ+L++ V KLN +T+ S ++ +D+Y+AFT+A+    + HPG
Sbjct  212  T-SYPNCSVTGNSISKFHNQILEKSVQKLNKETKDSVYIKVDIYSAFTAAMK-SQEHHPG  269

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL  CC G     +CG+VD +G   Y +C  P  AFFWD  HP+Q GW AV+SA
Sbjct  270  TSKFKDPLKQCCRGVNSAYSCGDVDKNGAYKYVVCKKPNSAFFWDSVHPTQAGWDAVFSA  329

Query  528  LKSSL  542
            LKSSL
Sbjct  330  LKSSL  334



>ref|XP_009348744.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
Length=357

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 128/192 (67%), Gaps = 12/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY +Y   +G + G + F+ S+  Q++VNLKRI+ +GV K+ VTA+QPLGCLP+ 
Sbjct  170  TVAGNDYRTYVATNGSVQGWQPFITSVVNQVTVNLKRIYALGVSKIVVTALQPLGCLPSS  229

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T+ S F+ILDLYA+FTS    K D 
Sbjct  230  T-AAFSFQQCNGTENALVSFHNLLLQQAVAKLNNETKNS-FIILDLYASFTSVFKNKGDL  287

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G     +CG VD SG K Y +C +P+ AFFWD  HP+QQGW AV
Sbjct  288  --GSIKFENPLRPCCIGISSEYSCGSVDESGSKKYTICKNPESAFFWDTAHPTQQGWRAV  345

Query  519  YSALKSSLPHLF  554
            YSAL+++L  L+
Sbjct  346  YSALQATLEELY  357



>ref|XP_007221261.1| hypothetical protein PRUPE_ppa020163mg, partial [Prunus persica]
 gb|EMJ22460.1| hypothetical protein PRUPE_ppa020163mg, partial [Prunus persica]
Length=291

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 129/189 (68%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTG  188
            GNDYA+Y G H        + I +QL+V+L+RI+ +GV K+AVTA+ PLGCLP +T S  
Sbjct  105  GNDYAAYLGNHTEDFAVVTKFIIKQLAVDLERIYGLGVGKIAVTAIGPLGCLPRMT-SFL  163

Query  189  NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGK  365
            +Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH  H G 
Sbjct  164  SYQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKH--HQGY  221

Query  366  SSFPY-PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            S+    PL PCC+G     +CG VD SG K Y +CD PK++FFWD  HPSQ GW  VYSA
Sbjct  222  STLQINPLKPCCVGVSNEYSCGSVDESGAKKYTVCDKPKLSFFWDTIHPSQNGWHEVYSA  281

Query  528  LKSSLPHLF  554
            +KSSL  L+
Sbjct  282  IKSSLRQLY  290



>emb|CAN74804.1| hypothetical protein VITISV_007811 [Vitis vinifera]
Length=339

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA+Y   +G I  +  F  S+  QLS+N+K IH MGV KVA+ A+QPLGCLP V+  
Sbjct  152  GNDYAAYLAGNGTIQSLPAFTTSLIRQLSLNMKHIHGMGVRKVAIMAIQPLGCLPQVSAL  211

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +YPNC    N+I++FHNQ+L++ V KLN +T+ S ++  D+Y+AFT+A+    + HPG
Sbjct  212  T-SYPNCSVTGNSISKFHNQILEKSVQKLNKETKDSVYIKXDIYSAFTAAMK-SQEHHPG  269

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL  CC G     +CG+VD +G   Y +C  P  AFFWD  HP+Q GW AV+SA
Sbjct  270  TSKFKDPLKQCCRGVNSAYSCGDVDKNGAYKYVVCKKPNSAFFWDSVHPTQAGWDAVFSA  329

Query  528  LKSSL  542
            LKSSL
Sbjct  330  LKSSL  334



>gb|KGN59118.1| hypothetical protein Csa_3G775310 [Cucumis sativus]
Length=370

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 125/192 (65%), Gaps = 13/192 (7%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY+ Y    G   G + F+  +  QL VNL+RIH +GVPK+ VTA++PLGCLP+ TF
Sbjct  181  AGNDYSVYQANNGSPQGWQPFITKVVNQLEVNLRRIHGLGVPKIVVTALEPLGCLPSTTF  240

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---GSPFVILDLYAAFTSALNIKHD  350
            ++ ++  C+   N +  FHN +L+Q V KLN + +    S F++LDLY++F +ALN K D
Sbjct  241  AS-SFQQCNSTQNQLVNFHNLLLQQSVAKLNSEVKDPSASTFILLDLYSSFMAALNNKAD  299

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            Q  G   F  P+ PCC+G      CG V  +G+K Y +C+DP  AFFWD  HP+Q GW+A
Sbjct  300  QL-GNVKFENPMKPCCVGISSEYACGSVGANGEKKYTICEDPGAAFFWDEVHPTQYGWYA  358

Query  516  VYSALKSSLPHL  551
            VYSAL++SL  L
Sbjct  359  VYSALQASLKQL  370



>ref|XP_009366645.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
Length=357

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 128/192 (67%), Gaps = 12/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY +Y   +G + G + F+ S+  Q+++NLKRI+ +GV K+ VTA+QPLGCLP+ 
Sbjct  170  TVAGNDYRTYVATNGSVQGWQPFITSVVNQVTMNLKRIYALGVSKIVVTALQPLGCLPSS  229

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T+ S F+ILDLYA+FTS    K D 
Sbjct  230  T-AAFSFQQCNGTENALVSFHNLLLQQAVAKLNNETKNS-FIILDLYASFTSVFKNKGDL  287

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G     +CG VD SG K Y +C +P+ AFFWD  HP+QQGW AV
Sbjct  288  --GSIKFENPLRPCCIGISSEYSCGSVDESGSKKYTICKNPESAFFWDTAHPTQQGWRAV  345

Query  519  YSALKSSLPHLF  554
            YSAL+++L  L+
Sbjct  346  YSALQATLEELY  357



>ref|XP_007214008.1| hypothetical protein PRUPE_ppa014794mg, partial [Prunus persica]
 gb|EMJ15207.1| hypothetical protein PRUPE_ppa014794mg, partial [Prunus persica]
Length=334

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 130/189 (69%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTG  188
            GNDYA+Y G H        +SI +QL+V+L+RI+ +GV K+AVTA+ PLGCLP +T S  
Sbjct  148  GNDYAAYFGNHTEDFAAATKSIIKQLAVDLERIYGLGVGKIAVTAIGPLGCLPRMT-SFL  206

Query  189  NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGK  365
            +Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S F+ILDLY A  SA+ + KH  H G 
Sbjct  207  SYQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFLILDLYNASLSAIMLPKH--HQGY  264

Query  366  SSFPY-PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            S+    PL PCC+G     +CG V+ SG K Y +CD PK++FFWD  HPSQ GW  VYSA
Sbjct  265  STLQINPLKPCCVGVSNEYSCGSVNESGAKKYTVCDKPKLSFFWDTIHPSQNGWHEVYSA  324

Query  528  LKSSLPHLF  554
            +KSSL  L+
Sbjct  325  IKSSLRQLY  333



>ref|XP_010036710.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Eucalyptus grandis]
 gb|KCW48342.1| hypothetical protein EUGRSUZ_K02058 [Eucalyptus grandis]
Length=360

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 125/191 (65%), Gaps = 14/191 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T+ GNDY++Y   +G    M  F+  +  QL+VNLKR++ +G  K+AV A+QPLGCLP  
Sbjct  176  TNSGNDYSAYTARNGSFQDMPAFITKVVSQLTVNLKRVYTLGARKIAVAALQPLGCLPNY  235

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            +++T ++  C++  N++  +HNQ+LKQ VDKLN++T  S F+I+DLYAAFTS       +
Sbjct  236  SYAT-SFQKCNDTVNSLVGYHNQLLKQAVDKLNNETNPSTFLIVDLYAAFTSVF-----E  289

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            +   S+F  PL PCC+G     NCG  D +G K Y +C+DP   FFWDM HP+Q GW AV
Sbjct  290  NTENSTFENPLKPCCVGMSSEYNCGSEDANGTKKYTVCEDPTAFFFWDMVHPTQAGWRAV  349

Query  519  YSALKSSLPHL  551
            YS L  +L  L
Sbjct  350  YSTLGPNLDQL  360



>gb|EYU35464.1| hypothetical protein MIMGU_mgv1a019688mg [Erythranthe guttata]
Length=341

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYAS+    G   G++ F+  +  QLS+NLKRI +MG  KV VTA+QPLGCLP +T 
Sbjct  154  AGNDYASFLANGGTNQGLQSFIPRVINQLSINLKRIQKMGATKVIVTALQPLGCLPRITQ  213

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S+ ++  C+   N    FHN +L+Q V KLN++T  S F ILDLY +FT+ +  K +   
Sbjct  214  SS-SFHQCNATQNLAVNFHNLLLQQSVAKLNNETNSSTFFILDLYNSFTTVIEQKGNPK-  271

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            GK  F  PL PCC+G     +CG  D  G K Y LC DPK AFFWD +HP+Q GW AVY+
Sbjct  272  GKLKFDTPLKPCCMGISREYSCGSTDEKGAKLYTLCSDPKSAFFWDSSHPTQAGWKAVYT  331

Query  525  ALKSSLPHLF  554
             LKSSL   F
Sbjct  332  ILKSSLAQFF  341



>ref|XP_009356119.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
Length=365

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 133/193 (69%), Gaps = 14/193 (7%)
 Frame = +3

Query  12   GNDYASYHGHI----HGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++          + EF +S+ +Q++V+L+RI ++GVPK+AVTA++P+GC+P +T 
Sbjct  174  GNDYATHMVKTGNGSEDLAEFTKSVVKQIAVDLRRIRDLGVPKIAVTAVEPMGCIPRLT-  232

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S  +Y NC E+ N  + FHNQ+L+Q V++LN ++  S FVILDLY AF+SA+N + D+  
Sbjct  233  SFLSYQNCSESLNLASVFHNQVLRQNVEQLNKESNNSAFVILDLYDAFSSAINPQKDRQ-  291

Query  360  GKSSFPY--PLAPCCLG-----NCGEVDVS-GKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            G ++F    PL PCC+G     +CG VD S G K Y +C  P+ +FFWD  HPSQ GW A
Sbjct  292  GNTTFQIDEPLKPCCVGVSSEYSCGSVDESTGAKKYSICSHPERSFFWDTVHPSQNGWHA  351

Query  516  VYSALKSSLPHLF  554
            VYS+LKSSL  L+
Sbjct  352  VYSSLKSSLHQLY  364



>ref|XP_009374744.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
Length=363

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 128/192 (67%), Gaps = 12/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDYA+Y   +G + G + F+ SI  QL+VNLKRI+ +GV KV VTA+QPLGCLP+ 
Sbjct  176  TGPGNDYATYVATNGSVQGWQPFITSIVNQLTVNLKRIYALGVGKVVVTALQPLGCLPSR  235

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            + ++ ++  C+   N +  FHN +L+Q V KLN++T+ S F+I+DLYA+F S    K D 
Sbjct  236  S-ASFSFQQCNGTENALVGFHNLLLRQAVAKLNNETKNS-FIIVDLYASFMSVFKNKGDL  293

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G      CG VD SG K Y +C +P+ AFFWD  HP+QQGW AV
Sbjct  294  --GSIKFENPLRPCCIGINSGYFCGSVDESGAKKYTICKNPESAFFWDTAHPTQQGWRAV  351

Query  519  YSALKSSLPHLF  554
            YSAL+++L  L+
Sbjct  352  YSALQATLEQLY  363



>ref|XP_008232019.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=497

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 130/192 (68%), Gaps = 11/192 (6%)
 Frame = +3

Query  3    TSVGNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             + GNDYA+Y G H        +SI +QL+V+++RIH +GV K+AVTA+ PLGCLP +T 
Sbjct  308  VAAGNDYAAYFGNHTEDFAAATKSIIKQLAVDIERIHGLGVRKIAVTALGPLGCLPRMT-  366

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQH  356
            S  +Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH  H
Sbjct  367  SFLSYQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKH--H  424

Query  357  PGKSSFPY-PLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             G S+    PL PCC+G      CG VD SG K Y +CD PK++FFWD  HPSQ GW  V
Sbjct  425  QGYSTLQINPLKPCCVGVSKEYPCGSVDESGAKKYIVCDKPKLSFFWDTIHPSQNGWHEV  484

Query  519  YSALKSSLPHLF  554
            YSA+KSSL  L+
Sbjct  485  YSAIKSSLRQLY  496



>ref|XP_010244275.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=356

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 125/189 (66%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G   G+  F  SI  QL++NLKRI   GV KVAVTA++P+GCLP    S
Sbjct  169  GNDYTTYMAKNGTAEGLSAFTISIINQLAINLKRIQGQGVKKVAVTAIEPIGCLPQSAAS  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C+E  N    FHN +L+Q V+KLN++T+GS F++LDL+ AF S  N + D HPG
Sbjct  229  S-SYQQCNETNNMAAMFHNLLLQQAVEKLNNETKGSTFMVLDLFNAFMSMFNRQKD-HPG  286

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F   L PCC+G     +CG++D +G K Y +C++P+  FFWD  HPSQ+GW AVYSA
Sbjct  287  IMKFGNLLKPCCVGTSAEYSCGDIDENGVKKYTVCENPESTFFWDDVHPSQEGWHAVYSA  346

Query  528  LKSSLPHLF  554
            L+ SL  L+
Sbjct  347  LQISLDQLY  355



>ref|XP_008391767.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Malus domestica]
Length=357

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 12/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY +Y   +G + G + F+ S+  Q++ NLKRI+ +GV K+ VTA+QPLGCLP+ 
Sbjct  170  TVAGNDYGTYVATNGSVQGWQPFITSVVNQVTXNLKRIYALGVSKIVVTALQPLGCLPSS  229

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T+ S F+ILDLYA+FTS    K D 
Sbjct  230  T-AAFSFQQCNGTENALVSFHNLLLQQAVAKLNNETKNS-FIILDLYASFTSVFKNKGDL  287

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G     +CG +D SG K Y +C +P+ AFFWD  HP+QQGW AV
Sbjct  288  --GSIKFENPLRPCCIGISSEYSCGSMDESGSKKYTICKNPESAFFWDTAHPTQQGWRAV  345

Query  519  YSALKSSLPHLF  554
            YSAL+++L  L+
Sbjct  346  YSALQATLEELY  357



>ref|XP_008345711.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Malus domestica]
Length=321

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 132/193 (68%), Gaps = 14/193 (7%)
 Frame = +3

Query  12   GNDYASYHGHI----HGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++          + EF +S+ +Q++V+L+RI ++GVPK+AVTA++P+GC+P +T 
Sbjct  130  GNDYATHMVKTGNGSEDLAEFTKSVVKQIAVDLRRIRDLGVPKIAVTAVEPMGCIPRLT-  188

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S  +Y NC E+ N  + FHNQ+L+Q V++LN ++  S FVILDLY AF+SA+N + D   
Sbjct  189  SXLSYQNCXESLNLASVFHNQVLRQNVEQLNKESNNSAFVILDLYDAFSSAINPQKDXQ-  247

Query  360  GKSSFPY--PLAPCCLG-----NCGEVDVS-GKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            G ++F    PL PCC+G     +CG VD S G K Y +C  P+ +FFWD  HPSQ GW A
Sbjct  248  GNTTFQIDEPLKPCCVGVSXEYSCGSVDGSTGAKKYSICSHPERSFFWDTVHPSQNGWHA  307

Query  516  VYSALKSSLPHLF  554
            VYS+LKSSL  L+
Sbjct  308  VYSSLKSSLHQLY  320



>emb|CDP20485.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 128/191 (67%), Gaps = 11/191 (6%)
 Frame = +3

Query  9    VGNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYA+Y G     EE   F +SI  QL ++L+RIH +GV +V VTAM PLGCLP  T 
Sbjct  170  AGNDYAAYFGKNGTNEESPVFTKSIMSQLVLDLQRIHGLGVRRVGVTAMHPLGCLPITTA  229

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S  ++ NC EN N + +FHNQML++ ++ LN++     FVILDLY+AF SALN++++ HP
Sbjct  230  SI-SHKNCSENGNWLAKFHNQMLQENIENLNNEAGAPVFVILDLYSAFMSALNLQNN-HP  287

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G S+F   L+PCC+G      CG V+  G + Y +C+D K  FFWD  HPSQQGW AVYS
Sbjct  288  GNSTFEDQLSPCCVGTERGYTCGSVNGVGIEKYIVCEDLKQ-FFWDDIHPSQQGWEAVYS  346

Query  525  ALKSSLPHLFH  557
            ALK SL  L +
Sbjct  347  ALKPSLQSLLN  357



>gb|EYU35461.1| hypothetical protein MIMGU_mgv1a0091782mg, partial [Erythranthe 
guttata]
Length=263

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++    G   G+  F+  +  QLS NLKRI +MG  KV VTA++PLGCLP  T S
Sbjct  77   GNDYGAFLANGGTNQGLRSFIPLVINQLSTNLKRIQKMGATKVIVTALEPLGCLPRTTES  136

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    FHN +L+Q V KLN++T    F ILDLY +FT+ L  K++ H G
Sbjct  137  S-SFKKCNATQNLDVNFHNLLLRQTVAKLNNETNNPTFFILDLYKSFTTVLQRKNN-HKG  194

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            K  F  PL PCC+G     +CG  D +G K Y LC +PK AFFWD +HP+Q GW AVY+ 
Sbjct  195  KLKFETPLKPCCMGISNEFSCGSADENGTKLYKLCSNPKSAFFWDSSHPTQAGWKAVYTI  254

Query  528  LKSSLPHLF  554
            +KSSL  LF
Sbjct  255  VKSSLAQLF  263



>ref|XP_010558202.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g03610-like 
[Tarenaya hassleriana]
Length=357

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 127/188 (68%), Gaps = 11/188 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G I G + F++ + +Q ++NLKRIH +GV K+ V A+QPLGCLP  T +
Sbjct  173  GNDYSAYLARNGSIDGFQTFIKQVVDQTALNLKRIHTLGVRKIVVPALQPLGCLPRTTVA  232

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N +   HN ML+Q V KLN++T+GS F++LDLY AF +       +HPG
Sbjct  233  S-SFQRCNETFNLLVNVHNTMLQQAVAKLNNETKGSTFIVLDLYNAFLTVFK-NRGEHPG  290

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G     NC  V+ +G K Y +CD+PK AFFWD +HP+++GW AVYS 
Sbjct  291  STTFENPLKPCCVGVSSGXNCASVE-NGVKMYTVCDNPKSAFFWDGSHPTEEGWRAVYSV  349

Query  528  LKSSLPHL  551
            L+ +L  +
Sbjct  350  LRENLERI  357



>ref|XP_004161236.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
Length=315

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 123/191 (64%), Gaps = 13/191 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y    G       F+  +  QL VNL+RIH +GVPK+ VTA++PLGCLP+ TF+
Sbjct  127  GNDYSVYQANNGSPQVFPPFITKVVNQLEVNLRRIHGLGVPKIVVTALEPLGCLPSTTFA  186

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---GSPFVILDLYAAFTSALNIKHDQ  353
            + ++  C+   N +  FHN +L+Q V KLN + +    S F++LDLY++F +ALN K DQ
Sbjct  187  S-SFQQCNSTQNQLVNFHNLLLQQSVAKLNSEVKDPSASTFILLDLYSSFMAALNNKADQ  245

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  P+ PCC+G      CG V  +G+K Y +C+DP  AFFWD  HP+Q GW+AV
Sbjct  246  L-GNVKFENPMKPCCVGISSEYACGSVGANGEKKYTICEDPGAAFFWDEVHPTQYGWYAV  304

Query  519  YSALKSSLPHL  551
            YSAL++SL  L
Sbjct  305  YSALQASLKQL  315



>ref|XP_004303005.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Fragaria vesca 
subsp. vesca]
Length=361

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 124/192 (65%), Gaps = 11/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDYA Y   +    G + F+ S+  QLSVNLKR++++GV K+ VTA+QPLGCLP  
Sbjct  173  TLAGNDYAYYLALNNSSEGFKPFITSVVNQLSVNLKRVYDLGVKKIVVTALQPLGCLPGS  232

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T+ S F +LDLY +F S L   +  
Sbjct  233  T-AEFSFQKCNGTQNLLVGFHNLLLQQAVAKLNNETKSS-FFVLDLYTSFMSVLK-NNGN  289

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            H G   F  PL PCC+G     +CG VD SG K Y +CDDP  AFFWD  HP+QQGW AV
Sbjct  290  HLGSIKFENPLKPCCVGISSKYDCGSVDDSGAKKYTICDDPASAFFWDGAHPTQQGWLAV  349

Query  519  YSALKSSLPHLF  554
            YSAL+++L  L+
Sbjct  350  YSALQATLEELY  361



>ref|XP_010097639.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC43582.1| GDSL esterase/lipase [Morus notabilis]
Length=262

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 125/193 (65%), Gaps = 10/193 (5%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY+ Y   +G   G + F+ S+  QL VNLKRIH++GV K+AVTA++PLGCLP  
Sbjct  72   TVAGNDYSFYIYRNGSAEGWQPFITSVVNQLYVNLKRIHDLGVKKIAVTALEPLGCLPRS  131

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T  T ++  C+   N+    HN +L+Q V KLN++ + +PF+ILDLY +F +    K +Q
Sbjct  132  TAVT-SFRQCNGTQNSFVGLHNLLLQQAVAKLNNENKDAPFLILDLYDSFMTVFKNKGNQ  190

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             PG   F  PL PCC+G     +CG VD +G K Y +C+DP+ AFFWD  HP+QQGW AV
Sbjct  191  -PGSIKFENPLKPCCVGTSAEYSCGSVDENGAKMYSICEDPQSAFFWDNVHPTQQGWEAV  249

Query  519  YSALKSSLPHLFH  557
             SAL+++   L +
Sbjct  250  NSALEATFHQLVY  262



>ref|XP_011044546.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Populus euphratica]
Length=358

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 117/181 (65%), Gaps = 10/181 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G + F+  +  QL +N+KRIH MGV KV VTA+QPLGCLP  TF 
Sbjct  176  GNDYSTYATTNGSPQGWQPFIIKVVNQLVMNMKRIHGMGVNKVVVTALQPLGCLPRSTF-  234

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   N++  FHN +L+Q V KLN++T+ S F ILDLY AF  A      ++PG
Sbjct  235  TSSFQQCNGTENDLVGFHNLLLQQAVTKLNNETKDSTFAILDLYKAFMDAFK-SQGKNPG  293

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC G      CG VD +G K Y +CDDP+  FFWD  HP+Q+GW AVYSA
Sbjct  294  SSKFGNPLKPCCTGISTDYGCGSVDANGAKKYVVCDDPESTFFWDTVHPTQEGWRAVYSA  353

Query  528  L  530
            L
Sbjct  354  L  354



>gb|EYU35460.1| hypothetical protein MIMGU_mgv1a008828mg [Erythranthe guttata]
Length=361

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++    G   G++ F+  +  QLS+NLKR+ +MG  KV VTA++PLGCLP +T S
Sbjct  173  GNDYAAFLANGGTNQGLQTFIPIVINQLSLNLKRLQKMGAAKVIVTALEPLGCLPRITLS  232

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    +HN +L+Q V KLN+ T  S F ILDLY +FT+ +  K D   G
Sbjct  233  S-SFQQCNATQNVAVNYHNLLLQQSVAKLNNDTNSSTFFILDLYNSFTTVIEQKGDSQ-G  290

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G     +CG VD  G K Y +C DPK AFFWD +HP++ GW AVY+ 
Sbjct  291  NLKFETPLKPCCMGVSEKYSCGSVDEKGVKMYTVCSDPKTAFFWDSSHPTEAGWHAVYTI  350

Query  528  LKSSLPHLFH  557
            LKSSL  LF 
Sbjct  351  LKSSLGQLFQ  360



>ref|XP_008241265.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=364

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 125/192 (65%), Gaps = 11/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDYA+Y   +G + G + F+ S+  QL+VNLKRI+++GV K+ V A++PLGCLP  
Sbjct  174  TVSGNDYATYVATNGSVQGWQPFITSVVNQLTVNLKRIYDLGVNKIVVIALEPLGCLPRS  233

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T+ S F+ILDLY +FTS    K D 
Sbjct  234  T-AEFSFQKCNGTVNALVGFHNLLLQQAVAKLNNETKSSSFLILDLYTSFTSVFKNKGDL  292

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G      CG +D +G K Y +C +P+  FFWD +HP+QQGW AV
Sbjct  293  --GSIKFENPLKPCCVGVSSGYYCGSLDANGTKKYTICQNPESTFFWDDSHPTQQGWRAV  350

Query  519  YSALKSSLPHLF  554
            YS L+S+L  L+
Sbjct  351  YSTLRSTLEELY  362



>ref|XP_008442825.1| PREDICTED: GDSL esterase/lipase At5g03610 [Cucumis melo]
Length=369

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y    G   G + F+  +  QL VNL+RIH +GVPK+ VTA++PLGCLP+ T +
Sbjct  181  GNDYSVYQATNGSPQGWQPFITKVVNQLEVNLRRIHGLGVPKIVVTALEPLGCLPSTTVA  240

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---GSPFVILDLYAAFTSALNIKHDQ  353
            + ++  C+   N +  FHN +L+Q V KLN + +    S F++LDLY++F +ALN K DQ
Sbjct  241  S-SFQQCNSTQNQLVNFHNLLLQQSVAKLNSEVKDPSASTFILLDLYSSFMAALNNKVDQ  299

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  P+ PCC+G      CG V  +G+K Y +C+DP  AFFWD  HP+Q GW+AV
Sbjct  300  L-GNVKFENPMKPCCVGISSEYACGSVGANGEKKYTICEDPGAAFFWDEVHPTQYGWYAV  358

Query  519  YSALKSSLPHL  551
            YSAL+++L  L
Sbjct  359  YSALQANLKQL  369



>emb|CDX80880.1| BnaC03g01340D [Brassica napus]
Length=360

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 123/189 (65%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        +F   ++ + +Q  VNL+R+H +GV KVAV  +QPLGCLP +TF+
Sbjct  171  GNDYSTFISQNRPASDFPAFIKQVVDQTEVNLRRLHALGVEKVAVPLLQPLGCLPGITFA  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N + R HN +L+Q V KLN++ + S F+ILDLY AF +  N K   +PG
Sbjct  231  S-SFQRCNETQNALVRLHNSLLQQAVIKLNNEIKKSTFIILDLYNAFLTVFNNK-GANPG  288

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G     NCG VD  G K Y +CDDPK AFFWD +HP+++GW +VYS 
Sbjct  289  STTFQSPLKPCCVGVSSEYNCGSVDEKGVKKYMICDDPKSAFFWDGSHPTEEGWRSVYSV  348

Query  528  LKSSLPHLF  554
            L  SL   F
Sbjct  349  LHQSLTASF  357



>ref|XP_007202099.1| hypothetical protein PRUPE_ppa007574mg [Prunus persica]
 gb|EMJ03298.1| hypothetical protein PRUPE_ppa007574mg [Prunus persica]
Length=363

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (65%), Gaps = 11/192 (6%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDYA+Y   +G + G + F+ S+  QL+VNLKRI+++GV K+ V A++PLGCLP  
Sbjct  173  TVSGNDYATYVATNGSVQGWQPFITSVVNQLTVNLKRIYDLGVNKIVVIALEPLGCLPRS  232

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +  ++  C+   N +  FHN +L+Q V KLN++T  S F+ILDLY +FTS    K D 
Sbjct  233  T-AEFSFQKCNGTANALVGFHNLLLQQAVAKLNNETNSSSFLILDLYTSFTSVFKNKGDL  291

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G      CG +D +G K Y +C +P+  FFWD +HP+QQGW AV
Sbjct  292  --GSIKFENPLRPCCVGVSSGYYCGSLDANGAKKYTICQNPESTFFWDDSHPTQQGWRAV  349

Query  519  YSALKSSLPHLF  554
            YS L+S+L  L+
Sbjct  350  YSTLRSTLEELY  361



>ref|XP_010271751.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=355

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 122/189 (65%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGH---IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y        G+  F  SI  QL +N+KRIH+MGV KVAVTA++P+GCLP ++  
Sbjct  167  GNDYITYFAKNVSSEGLSNFTASIISQLVINMKRIHDMGVKKVAVTAIEPIGCLPVISVL  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C+E  N I+ FHN +L+Q V+KLN++T  S F+ILDLY AF S    +  +HPG
Sbjct  227  S-SYQQCNETYNKISIFHNLLLQQAVEKLNNETSESTFMILDLYNAFISIFE-RQKEHPG  284

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G      CG+ D +G   Y +C++P+ AFFWD  HPS +GW A+YS 
Sbjct  285  SLKFGNPLKPCCVGLTRKDLCGDKDENGVPKYIVCENPESAFFWDDVHPSHEGWHAIYST  344

Query  528  LKSSLPHLF  554
            L+ SL  L+
Sbjct  345  LQHSLQQLY  353



>ref|XP_007214177.1| hypothetical protein PRUPE_ppa019181mg, partial [Prunus persica]
 gb|EMJ15376.1| hypothetical protein PRUPE_ppa019181mg, partial [Prunus persica]
Length=349

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 126/191 (66%), Gaps = 12/191 (6%)
 Frame = +3

Query  12   GNDYASYHGH----IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++ G        +  F +SI +QL+V+LKRIH +GV K+AVT ++PLGCLP +T 
Sbjct  160  GNDYAAHFGRPGHDTKDLAMFTKSIIKQLTVDLKRIHNLGVQKIAVTTIEPLGCLPGIT-  218

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S+ +Y NC+E  N  + FHNQ+L Q++++LN + + S FV LDLY AF SA+      H 
Sbjct  219  SSLSYQNCNEFANMASMFHNQILLQKLEELNKEIKNSAFVDLDLYNAFISAVK-PQKHHQ  277

Query  360  GKSSFPY-PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            G S+F    L PCC+G     +CG VD +G K Y +CD+P ++FFWDM HPSQ GW  VY
Sbjct  278  GYSTFQINTLKPCCVGVSNEYSCGSVDQTGAKKYIVCDNPDVSFFWDMVHPSQNGWHEVY  337

Query  522  SALKSSLPHLF  554
            + +K SL  L+
Sbjct  338  ATIKPSLHQLY  348



>ref|XP_010271718.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=355

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 125/193 (65%), Gaps = 12/193 (6%)
 Frame = +3

Query  3    TSVGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            ++ GNDY++Y    +G + G+   +E +  QL++NLKRI+ +GV KV V  + PLGC+P 
Sbjct  166  SAAGNDYSAYLARNNGTLKGLPTLIELVVNQLALNLKRIYSLGVKKVVVNGLHPLGCVPL  225

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
            +T +  +Y  C EN N + RFHN  LKQ V+KLN++T  S F ILDLY+AF S L+ K +
Sbjct  226  IT-ALSSYQKCGENENTLVRFHNLSLKQAVEKLNNETNSSTFRILDLYSAFMSILSKKSN  284

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
               G   F   L PCC+G      CG  + +G   Y +CD+P+ AFFWD+ HP+Q+GW A
Sbjct  285  --TGSLKFSNRLEPCCVGIDSAHACGSTNENGLNMYRVCDNPEAAFFWDLVHPTQEGWCA  342

Query  516  VYSALKSSLPHLF  554
            VYS+L++SL  ++
Sbjct  343  VYSSLQASLEQIY  355



>ref|XP_011094379.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Sesamum indicum]
Length=370

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYA+Y    G I G++ F+  +  QL+++LKRI  +G  KVAVT+++PLGCLP +T 
Sbjct  180  AGNDYAAYVLKDGSIEGLQRFIPQVINQLTLDLKRIKALGATKVAVTSLEPLGCLPRMTQ  239

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
             +G +  C+   N    +HN +L+Q VDKLN++T  S F ILDLY +FTS L  K D   
Sbjct  240  MSG-FQQCNITQNLAVGYHNFLLQQAVDKLNNETRTSTFFILDLYTSFTSVLEQKGDSQ-  297

Query  360  GKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G   F  PL PCC+G      CG +D  G K Y +C DPK AFFWD +HP++ GW AVY+
Sbjct  298  GILKFETPLKPCCMGISTGYWCGSLDDKGAKMYTVCSDPKSAFFWDASHPTEAGWHAVYT  357

Query  525  ALKSSLPH  548
             LKSSL  
Sbjct  358  NLKSSLEQ  365



>ref|XP_006398814.1| hypothetical protein EUTSA_v10013924mg [Eutrema salsugineum]
 gb|ESQ40267.1| hypothetical protein EUTSA_v10013924mg [Eutrema salsugineum]
Length=359

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 122/185 (66%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+R+H +GV K+AV ++QPLGCLP +T +
Sbjct  170  GNDYSTFIAQNRPASEFPGFIKQVVDQTEVNLRRLHALGVKKIAVPSLQPLGCLPGITVA  229

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E+ N + + HN +L+Q V KLN++T+ S F+ILDLY AF +    K   +PG
Sbjct  230  S-SFQRCNESQNALVKLHNSLLQQAVAKLNNETKQSTFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G      CG VD  G K Y +CDDPK AFFWD +HP++ GW +VYS 
Sbjct  288  STTFQNPLKPCCVGVSSEYRCGSVDEKGVKKYVICDDPKSAFFWDRSHPTEAGWRSVYSV  347

Query  528  LKSSL  542
            L+ +L
Sbjct  348  LRETL  352



>gb|EYU35459.1| hypothetical protein MIMGU_mgv1a008682mg [Erythranthe guttata]
Length=365

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 115/191 (60%), Gaps = 10/191 (5%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY +Y    G I G+  F+  +  QLS+NLKR+ +MG  KV VTA++PLGCLP  T 
Sbjct  175  AGNDYGAYLATGGTIQGLPSFIPLVINQLSINLKRLQKMGATKVIVTALEPLGCLPRFT-  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
               +Y  C+   N  T FHN +L+Q V KLN+ T  S F ILDLY +F + L  K +   
Sbjct  234  GLSSYQQCNATRNLATNFHNLLLQQTVAKLNNDTNSSTFFILDLYNSFNTVLEQKGNPQ-  292

Query  360  GKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G   F  PL PCC+G      CG VD  G K Y +C DPK AFFWD +HP++ GW AVY+
Sbjct  293  GDLKFETPLKPCCMGISSEYFCGSVDEKGVKMYTVCSDPKSAFFWDSSHPTEAGWHAVYT  352

Query  525  ALKSSLPHLFH  557
             LKSSL  LF 
Sbjct  353  TLKSSLGQLFQ  363



>ref|XP_009774131.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nicotiana sylvestris]
Length=374

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 124/192 (65%), Gaps = 12/192 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++    G       F+ S+  QL VN++R+HE+G  K+AVTA++PLGCLP  T  
Sbjct  184  GNDYGAFLANGGTPQDFPAFITSVVNQLVVNMRRVHELGAKKIAVTALEPLGCLPQSTVL  243

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+   N    FHN +L+Q V KLN++T+ S FVILDL+ +FT+ L  K    PG
Sbjct  244  S-SFQQCNATENTAVDFHNVLLQQAVAKLNNETKDSTFVILDLFTSFTTVLERKG--VPG  300

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     +CG ++  G+K Y +C+DPK AFFWD  HP++ GW AVY+A
Sbjct  301  STRFETPLKPCCMGISNQYSCGNMNEKGEKMYTVCNDPKSAFFWDRVHPTEAGWRAVYTA  360

Query  528  LKSSLPH-LFHP  560
            L+S+L H LF P
Sbjct  361  LESTLTHKLFLP  372



>emb|CDY04891.1| BnaAnng00730D [Brassica napus]
Length=355

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 123/189 (65%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV  +QPLGCLP +T +
Sbjct  166  GNDYSTFIARNRPNSEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPLLQPLGCLPGITVA  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E+ N + + HN +L+Q V KLND+T+ S F+ +DLY AF +    K   +PG
Sbjct  226  S-SFQRCNESQNALVKLHNSLLQQAVAKLNDETKQSTFITIDLYNAFLTVFKNK-GANPG  283

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G      CG VD  G+K Y +CD+PK AFFWD +HP+++GW +VYS 
Sbjct  284  STTFQSPLKPCCVGVSSEYFCGSVDEKGEKKYVICDNPKAAFFWDGSHPTEEGWRSVYSV  343

Query  528  LKSSLPHLF  554
            L+ SL   F
Sbjct  344  LRESLTASF  352



>ref|XP_006290027.1| hypothetical protein CARUB_v10003661mg, partial [Capsella rubella]
 gb|EOA22925.1| hypothetical protein CARUB_v10003661mg, partial [Capsella rubella]
Length=319

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 116/185 (63%), Gaps = 6/185 (3%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y+   G + G   F++ +  Q+ V+L+RIH +GV K+AV ++QPLGCLP++T  
Sbjct  134  GNDYSYYYIRNGSVAGFPTFIKQVLSQIEVDLRRIHALGVKKIAVASLQPLGCLPSLTVL  193

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHP  359
            + +Y  C+E  N +   HN++L+Q V KLN +T + S FV+LD Y+AF +    K   + 
Sbjct  194  S-SYQRCNEPLNALVVLHNKLLQQVVAKLNSETGKHSSFVLLDYYSAFLAVFK-KKGTNL  251

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
            G   F  PL PCC GNCG VD  G K Y LCDDPK  FFWD  HPSQ+GW +VYS L   
Sbjct  252  GSKKFETPLKPCCKGNCGNVDEKGVKKYSLCDDPKSDFFWDNLHPSQEGWRSVYSLLGKP  311

Query  540  LPHLF  554
            L    
Sbjct  312  LTEFL  316



>ref|XP_008231974.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=337

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 129/192 (67%), Gaps = 14/192 (7%)
 Frame = +3

Query  12   GNDYASYHGH----IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++ G        +  F +SI +QL+V+LKRIH++GV K+AVT ++PLGCLP++T 
Sbjct  148  GNDYAAHFGRPGNDTKDLAMFTKSIIKQLTVDLKRIHDLGVQKIAVTTIEPLGCLPSIT-  206

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQH  356
            S  +Y NC+E  N  + FHNQ+L Q++++LN +T+ S FV LDLY AF SA+   KH  H
Sbjct  207  SFLSYQNCNEFANMASMFHNQILLQKLEELNKETKNSTFVDLDLYNAFISAVKPPKH--H  264

Query  357  PGKSSFPY-PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             G S+F    L PCC+G     +CG VD +G K Y +CD+  ++FFWD  HPSQ GW  V
Sbjct  265  QGYSTFQINTLKPCCVGVSNEYSCGSVDQTGAKKYIVCDNLDVSFFWDTVHPSQNGWHEV  324

Query  519  YSALKSSLPHLF  554
            Y+A+K SL  L+
Sbjct  325  YAAIKPSLRQLY  336



>ref|XP_004246526.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Solanum lycopersicum]
Length=368

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 121/185 (65%), Gaps = 11/185 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y    G +  +  F+ S+  QL VN+KR++++G  K+AVTA++PLGCLP  T  
Sbjct  182  GNDYGAYLANGGTVQDIPAFITSVVNQLVVNMKRVNKLGAKKIAVTALEPLGCLPQSTI-  240

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N     HN +L+Q V+KLN++T GS FVILDL+++F S L  K    PG
Sbjct  241  LNSFQQCNATENIAVDLHNSLLQQAVEKLNNETMGSTFVILDLFSSFNSVLASKG--APG  298

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     +CG ++V G+K Y +C+DPK AFFWD  HP++ GW AVY+ 
Sbjct  299  STRFETPLKPCCMGISNKYSCGSMNVKGEKMYTVCNDPKSAFFWDRVHPTEAGWHAVYTN  358

Query  528  LKSSL  542
            LKS+L
Sbjct  359  LKSTL  363



>gb|KFK24825.1| hypothetical protein AALP_AA8G030000 [Arabis alpina]
Length=358

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RI   GV K+AV ++QPLGCLP  T +
Sbjct  170  GNDYSTFIAQNRPASEFPGFIKQVVDQTEVNLRRIQAFGVKKIAVPSLQPLGCLPGATVA  229

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+++ N + + HN +L+Q V KLN +T+ S F+ILDLY AF +    K   +PG
Sbjct  230  T-SFQRCNDSQNVLVKLHNSLLQQVVVKLNKETKQSTFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCCLG     +CG VD  G K Y +CDDPK AFFWD +HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCLGVSSEYSCGSVDAKGVKKYVICDDPKSAFFWDRSHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>gb|KCW89217.1| hypothetical protein EUGRSUZ_A01521 [Eucalyptus grandis]
Length=365

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 123/192 (64%), Gaps = 15/192 (8%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T+ GNDY++Y   +G    + +F+  +  QL +++KRIH +GV  +A+  +QPLGCLP  
Sbjct  180  TNSGNDYSAYLAKNGSYEDLPQFIIQVVNQLVLDIKRIHSLGVKLIAIAGLQPLGCLPQA  239

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP-FVILDLYAAFTSALNIKHD  350
            T S  ++  C+   N++  FHNQ+L+Q V KLN+QT  SP FV+++LY +F S LN K  
Sbjct  240  TVSD-SFRTCNATANSLVTFHNQLLQQAVAKLNNQTRSSPAFVVVNLYTSFMSVLNGK--  296

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
               G + F  PL PCC G     +CG VD +G+K Y LC DPK  FFWDM HP+Q+GW A
Sbjct  297  ---GSTKFREPLTPCCTGINSSYSCGSVDETGQKQYELCKDPKGMFFWDMVHPTQEGWRA  353

Query  516  VYSALKSSLPHL  551
            V++AL  +L  L
Sbjct  354  VFAALGHNLKQL  365



>emb|CDY44377.1| BnaC02g03000D [Brassica napus]
Length=355

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (66%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV  +QPLGCLP +T +
Sbjct  166  GNDYSTFIAQNRPNSEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPLLQPLGCLPGITVA  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E+ N + + HN +L+Q V KLN++T+ S F+ +DLY AF +    K   +PG
Sbjct  226  S-SFQRCNESQNALVKLHNSLLQQAVAKLNNETKQSTFITIDLYNAFLTVFKNK-GANPG  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G     +CG VD  G+K Y +CD+PK AFFWD +HP+++GW +VYS 
Sbjct  284  STTFQSPLKPCCVGVSSEYSCGSVDEKGEKKYVICDNPKAAFFWDGSHPTEEGWRSVYSV  343

Query  528  LKSSLPHLF  554
            L+ SL   F
Sbjct  344  LRESLTASF  352



>ref|NP_195981.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LZS7.1|GDL71_ARATH RecName: Full=GDSL esterase/lipase At5g03610; AltName: Full=Extracellular 
lipase At5g03610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK26039.1|AF360329_1 unknown protein [Arabidopsis thaliana]
 emb|CAB82926.1| putative protein [Arabidopsis thaliana]
 gb|AAM61667.1| putative lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AED90633.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=359

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP  TF 
Sbjct  170  GNDYSNFIALNRPASEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPFTFV  229

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+E  N +   HN +L+Q V KLN++T+ S F+ILDLY AF +    K   +PG
Sbjct  230  T-SFQRCNETQNALVNLHNNLLQQVVAKLNNETKQSTFIILDLYNAFLTVFKNK-GSNPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CD+PK AFFWD  HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCVGVSREYNCGSVDEKGVKKYIVCDNPKTAFFWDGLHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>emb|CDY66568.1| BnaAnng22470D [Brassica napus]
Length=323

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 126/188 (67%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    TSVGNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY ++      M EF   ++ + +Q  VNL+RIH++GV K+A+ ++QPLGCLP+ 
Sbjct  133  SNAGNDYGTFILQKRPMTEFPGFIKKVVDQTEVNLRRIHKLGVKKIAIASLQPLGCLPSK  192

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S+ ++ +C+ + N + + HN +L++ V KLN++T+ S FVILDLY AF + L  K  +
Sbjct  193  TTSS-SFKHCNASDNALVKLHNTLLRRTVAKLNNETKPSTFVILDLYKAFLTVLKNKRAE  251

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             PG + F  PL PCC+G     +C  VD  G+K Y +C DPK +FFWD+ HP+++GW +V
Sbjct  252  -PGVTRFVNPLKPCCVGITSNDSCSNVDKKGEKKYTICKDPKTSFFWDVFHPTEEGWRSV  310

Query  519  YSALKSSL  542
            YS L+ +L
Sbjct  311  YSVLRENL  318



>ref|XP_010490852.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=359

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 118/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP +T +
Sbjct  170  GNDYSNFIALNRPASEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPLT-A  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+E  N +   HN +L+Q V KLN +T+ S F+ILDLY AF +    K   +PG
Sbjct  229  ASSFQRCNETQNALVNLHNNLLQQAVAKLNSETKQSTFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CDDPK AFFWD  HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCVGVSREYNCGSVDEKGVKKYMVCDDPKTAFFWDGLHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>ref|XP_009125513.1| PREDICTED: GDSL esterase/lipase At5g03610 [Brassica rapa]
Length=355

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 123/189 (65%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV  +QPLGCLP +T +
Sbjct  166  GNDYSTFIARNRPNSEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPLLQPLGCLPGITVA  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E+ N + + HN +L+Q V KLN++T+ S F+ +DLY AF +    K   +PG
Sbjct  226  S-SFQRCNESQNALVKLHNSLLQQAVAKLNNETKQSTFITIDLYNAFLTVFKNK-GANPG  283

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  PL PCC+G      CG VD  G+K Y +CD+PK AFFWD +HP+++GW +VYS 
Sbjct  284  STTFQSPLKPCCVGVSSEYFCGSVDEKGEKKYVICDNPKAAFFWDGSHPTEEGWRSVYSV  343

Query  528  LKSSLPHLF  554
            L+ SL   F
Sbjct  344  LRESLTASF  352



>ref|XP_006288040.1| hypothetical protein CARUB_v10001271mg [Capsella rubella]
 gb|EOA20938.1| hypothetical protein CARUB_v10001271mg [Capsella rubella]
Length=357

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP  T +
Sbjct  168  GNDYSNFIALNRPASEFPGFIKKVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPSTVA  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N +   HN +L+Q V KLN++T+ S F+ILDLY AF +    K   +PG
Sbjct  228  S-SFQRCNETQNALVNLHNNLLQQAVAKLNNETKQSTFIILDLYNAFLTVFKNK-GANPG  285

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CDDPK AFFWD  HP+++GW +VYS 
Sbjct  286  STKFQSPLKPCCVGVSREYNCGSVDEKGVKKYMVCDDPKSAFFWDGLHPTEEGWRSVYSV  345

Query  528  LKSSL  542
            L+ SL
Sbjct  346  LRESL  350



>ref|XP_002871047.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47306.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=359

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 118/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP  TF 
Sbjct  170  GNDYSNFIALNRPASEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPFTF-  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+E  N +   HN +L+Q V KLN++T+ S F+ILDLY AF +    K   +PG
Sbjct  229  VSSFQRCNETQNALVNLHNNLLQQVVAKLNNETKQSTFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CD+PK AFFWD  HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCIGVSRKYNCGSVDEKGVKKYIVCDNPKSAFFWDGLHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>ref|XP_009146883.1| PREDICTED: GDSL esterase/lipase At3g09930 [Brassica rapa]
Length=354

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 126/188 (67%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    TSVGNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY ++      M EF   ++ + +Q  VNL+RIH++GV K+A+ ++QPLGCLP+ 
Sbjct  164  SNAGNDYGTFILQKRPMTEFPGFIKKVVDQTEVNLRRIHKLGVKKIAIASLQPLGCLPSK  223

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S+ ++ +C+ + N + + HN +L++ V KLN++T+ S FVILDLY AF + L  K  +
Sbjct  224  TTSS-SFKHCNASDNALVKLHNTLLRRTVAKLNNETKPSTFVILDLYKAFLTVLKNKRAE  282

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             PG + F  PL PCC+G     +C  VD  G+K Y +C DPK +FFWD+ HP+++GW +V
Sbjct  283  -PGVTRFVNPLKPCCVGITSNDSCSNVDKKGEKKYTICKDPKTSFFWDVFHPTEEGWRSV  341

Query  519  YSALKSSL  542
            YS L+ +L
Sbjct  342  YSVLRENL  349



>ref|XP_010271720.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Nelumbo 
nucifera]
Length=352

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 121/185 (65%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y+   G   G+  F+ S+  Q ++NLKRIH +GV KVAV A+ PLGCLP  T  
Sbjct  166  GNDYGAYNARNGTAQGLPAFIASVVNQTTLNLKRIHGLGVKKVAVIALLPLGCLPQSTVL  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C++  N   RFHN +LKQ V+KLN++T+   F++LDL +AF SA + K+  +  
Sbjct  226  S-SYQQCNKTQNTAVRFHNLLLKQAVEKLNNETKSPTFILLDLNSAFMSAFDKKNSGNL-  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            K  F  PL PCC+G     +CG VD SG K Y +C +PK+AFFWD  HP+Q GW AV  +
Sbjct  284  KFGFGNPLKPCCMGIDASNSCGIVDQSGAKKYKVCKNPKVAFFWDEVHPTQAGWQAVSLS  343

Query  528  LKSSL  542
            LKSSL
Sbjct  344  LKSSL  348



>ref|XP_010423687.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=359

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 118/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP +T  
Sbjct  170  GNDYSNFIALNRPASEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPITVL  229

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N +   HN +L+Q V KLN +T+ S F+ILDLY AF +    K   +PG
Sbjct  230  S-SFQRCNETQNALVNLHNNLLQQAVAKLNSETKQSTFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CDDPK AFFWD  HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCVGVSREYNCGSVDEKGVKKYMVCDDPKSAFFWDGLHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>ref|XP_010271719.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Nelumbo 
nucifera]
Length=353

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 121/185 (65%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y+   G   G+  F+ S+  Q ++NLKRIH +GV KVAV A+ PLGCLP  T  
Sbjct  167  GNDYGAYNARNGTAQGLPAFIASVVNQTTLNLKRIHGLGVKKVAVIALLPLGCLPQSTVL  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C++  N   RFHN +LKQ V+KLN++T+   F++LDL +AF SA + K+  +  
Sbjct  227  S-SYQQCNKTQNTAVRFHNLLLKQAVEKLNNETKSPTFILLDLNSAFMSAFDKKNSGNL-  284

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            K  F  PL PCC+G     +CG VD SG K Y +C +PK+AFFWD  HP+Q GW AV  +
Sbjct  285  KFGFGNPLKPCCMGIDASNSCGIVDQSGAKKYKVCKNPKVAFFWDEVHPTQAGWQAVSLS  344

Query  528  LKSSL  542
            LKSSL
Sbjct  345  LKSSL  349



>ref|XP_004308553.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Fragaria vesca 
subsp. vesca]
Length=303

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 122/191 (64%), Gaps = 14/191 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA+Y     H   +     SI  QL VN+KRI+++GV K+ VTA++P+GCLPAVT  
Sbjct  103  GNDYAAYFLKGNHSQDLPAVSTSIVNQLVVNIKRINDLGVKKILVTAIEPMGCLPAVTSI  162

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKL--NDQTEGSPFVILDLYAAFTSAL-NIKH-D  350
              +Y NC E  N  +RFHNQ+L ++V++L  N  T+ S  VILDLY AF SA+   KH +
Sbjct  163  VSSYQNCSETMNAGSRFHNQILYKKVEELKKNQTTKASTIVILDLYNAFLSAIQQQKHLE  222

Query  351  QHPGKSSF-PYPLAPCCLG-----NCGEVD-VSGKKGYGLCDDPKMAFFWDMTHPSQQGW  509
            Q  G S+    PL PCC+G     +CG VD  SG   Y +C +P  +FFWD  HPSQ GW
Sbjct  223  QDAGNSTTRENPLMPCCVGVSSEYSCGSVDERSGANKYTVCSNPGRSFFWDQEHPSQNGW  282

Query  510  FAVYSALKSSL  542
             AVYSA+KSSL
Sbjct  283  RAVYSAIKSSL  293



>ref|XP_008231971.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=431

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 14/191 (7%)
 Frame = +3

Query  12   GNDYASYHGH----IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GN+YA++ G        +  F +SI +QL+V+LKRIH++GV K+AVT ++PLGCLP++T 
Sbjct  242  GNNYAAHFGRPGNDTKDLAMFTKSIIKQLTVDLKRIHDLGVQKIAVTTIEPLGCLPSIT-  300

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQH  356
            S  +Y NC+E  N  + FHNQ+L Q++++LN +T+ S FV LDLY AF SA+   KH  H
Sbjct  301  SFLSYQNCNEFANMASMFHNQILLQKLEELNKETKNSAFVDLDLYNAFISAVKPPKH--H  358

Query  357  PGKSSFPY-PLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
             G S+F    L PCC+G     +CG VD +G K Y +CD+P ++FFWD  HPSQ GW  V
Sbjct  359  QGYSTFQINTLKPCCVGVSNEYSCGSVDQTGAKKYIVCDNPDVSFFWDTVHPSQNGWHEV  418

Query  519  YSALKSSLPHL  551
            Y+A+K SL  L
Sbjct  419  YAAIKPSLHQL  429



>ref|XP_010068920.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Eucalyptus grandis]
Length=424

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 123/192 (64%), Gaps = 15/192 (8%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T+ GNDY++Y   +G    + +F+  +  QL +++KRIH +GV  +A+  +QPLGCLP  
Sbjct  239  TNSGNDYSAYLAKNGSYEDLPQFIIQVVNQLVLDIKRIHSLGVKLIAIAGLQPLGCLPQA  298

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP-FVILDLYAAFTSALNIKHD  350
            T S  ++  C+   N++  FHNQ+L+Q V KLN+QT  SP FV+++LY +F S LN K  
Sbjct  299  TVSD-SFRTCNATANSLVTFHNQLLQQAVAKLNNQTRSSPAFVVVNLYTSFMSVLNGK--  355

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
               G + F  PL PCC G     +CG VD +G+K Y LC DPK  FFWDM HP+Q+GW A
Sbjct  356  ---GSTKFREPLTPCCTGINSSYSCGSVDETGQKQYELCKDPKGMFFWDMVHPTQEGWRA  412

Query  516  VYSALKSSLPHL  551
            V++AL  +L  L
Sbjct  413  VFAALGHNLKQL  424



>ref|XP_006341240.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Solanum tuberosum]
Length=373

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 120/185 (65%), Gaps = 11/185 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y    G +  +  F+ S+  QL VN+KR++++G  K+AVTA++PLGCLP  T  
Sbjct  187  GNDYGAYLANGGTVQDIPAFITSVVNQLVVNMKRVNKLGAKKIAVTALEPLGCLPQSTI-  245

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N     HN +L+Q V KLN++T GS FVILDL+++F S L  K  Q  G
Sbjct  246  LNSFQQCNATENIAVDLHNSLLQQAVAKLNNETMGSTFVILDLFSSFNSVLASKGVQ--G  303

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     +CG ++V G+K Y +C+DPK AFFWD  HP++ GW AVY+ 
Sbjct  304  STRFETPLKPCCMGISNKYSCGSMNVKGEKMYTVCNDPKSAFFWDTVHPTEAGWHAVYTN  363

Query  528  LKSSL  542
            LKS+L
Sbjct  364  LKSTL  368



>ref|XP_002315445.2| hypothetical protein POPTR_0010s24360g [Populus trichocarpa]
 gb|EEF01616.2| hypothetical protein POPTR_0010s24360g [Populus trichocarpa]
Length=237

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G+   +  F  S+  QLS NLKRI+  GV K+AVTA+QPLGCLP +T +
Sbjct  52   GNDYTTYIQRNGNFQDLPAFTTSLINQLSANLKRINGFGVRKIAVTALQPLGCLPILT-A  110

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y NC E+ N  ++FHNQ L+Q + ++N+++    +  LDLY AF S LN    +  G
Sbjct  111  FSSYQNCSESWNTASKFHNQKLQQAIQRMNNESGKHMYETLDLYTAFMSKLNTA--RLAG  168

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
                   L PCC+G     +CG VD +G K Y +C+ P+++ FWDM HP+Q GW  VYS+
Sbjct  169  NLKLRSFLTPCCVGVTSNYSCGNVDKNGAKTYVVCEKPELSVFWDMVHPAQNGWHQVYSS  228

Query  528  LKSSLPHLF  554
            LKSSL  L+
Sbjct  229  LKSSLHRLY  237



>ref|XP_009621488.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nicotiana tomentosiformis]
Length=375

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 122/192 (64%), Gaps = 12/192 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++    G   G   F+ S+  QL VN++R++  G  K+AVTA++PLGCLP  T  
Sbjct  185  GNDYGAFLANGGTPQGFPAFITSVVNQLVVNMRRVNGFGAKKIAVTALEPLGCLPQSTV-  243

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N    FHN +L+Q V KLN++T+ S FVILDL+++FT+ L  K    PG
Sbjct  244  LNSFQQCNATENTAVDFHNALLQQAVAKLNNETKDSTFVILDLFSSFTTVLERKG--VPG  301

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     +CG ++  G+K Y +C DPK AFFWD  HP++ GW AVY+A
Sbjct  302  STRFETPLKPCCMGISNQYSCGSMNEKGEKMYTVCIDPKSAFFWDRVHPTEAGWRAVYTA  361

Query  528  LKSSLPH-LFHP  560
            L+S+L H LF P
Sbjct  362  LESTLTHKLFLP  373



>gb|KFK24822.1| hypothetical protein AALP_AA8G029700 [Arabis alpina]
Length=352

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G I  +  F++ +  Q  VNL+RIH +GV K+AV ++QPLGCLP   ++
Sbjct  169  GNDYSNYLSQNGSIAALPAFIKQVVYQTEVNLRRIHALGVKKIAVPSLQPLGCLP--RYA  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N + ++HN +L+Q V KLN++T+ + F I D Y AF +    K  ++PG
Sbjct  227  STSFQGCNETFNALVQYHNSLLEQVVAKLNNETKQTAFAIFDYYNAFFTVFKNK-GENPG  285

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               F  PL PCC G+C  VD  G K Y LCDDP  AFFWD  HP+Q+GW +VYS L  +L
Sbjct  286  SRRFETPLKPCCEGSCANVDEKGVKMYTLCDDPTSAFFWDGLHPTQEGWKSVYSVLGKNL  345



>ref|XP_010423690.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=358

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 7/186 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G+  G+ +FV  +  Q+ VNLKRIH +GV KVAV ++QPLGCLP  T  
Sbjct  174  GNDYFTYISDNGYNLGIFQFVRRVINQIEVNLKRIHALGVKKVAVPSLQPLGCLPMYTRG  233

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C++  N +T  HN  L++ V KLN +T+ SPF++LD Y  F + LN K  ++PG
Sbjct  234  S-SYQKCNDIINALTIIHNNALEKVVAKLNKETKNSPFIVLDYYKGFLAVLNNK-GENPG  291

Query  363  KSSFPYPLAPCCLGN--CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
             ++F     PCC G   CG +D +G K Y LCDDP  AFFWD  HP+Q+GW AVYS L +
Sbjct  292  ITNFKSLYEPCCGGKGYCGTLDENGGKNYTLCDDPSSAFFWDEFHPTQEGWKAVYSVLTN  351

Query  537  SLPHLF  554
            +L  L 
Sbjct  352  NLKALL  357



>ref|XP_006407621.1| hypothetical protein EUTSA_v10022090mg, partial [Eutrema salsugineum]
 gb|ESQ49074.1| hypothetical protein EUTSA_v10022090mg, partial [Eutrema salsugineum]
Length=349

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 121/185 (65%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++      M EF   ++ + +Q  VNL+RIH++GV K+A+ ++QPLGCLP+ T  
Sbjct  165  GNDYATFMQQKRPMTEFLGFIKQVVDQTEVNLRRIHKLGVKKIAIASLQPLGCLPSSTAF  224

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+ + N + + HN +L Q V KLN++T+ S FVILDLY AF + L  K  + PG
Sbjct  225  T-SFQRCNASDNALVKLHNTLLHQAVAKLNNETKPSTFVILDLYNAFLTVLTNKRAE-PG  282

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G      C  VD +G + Y +C DPK +FFWD+ HP+++GW +VYS 
Sbjct  283  VTRFVDPLKPCCVGVTSNYTCSNVDKNGVRKYTICQDPKTSFFWDVFHPTEEGWRSVYSL  342

Query  528  LKSSL  542
            L+ +L
Sbjct  343  LRENL  347



>ref|XP_004305350.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 123/201 (61%), Gaps = 23/201 (11%)
 Frame = +3

Query  3    TSVGNDYASY----HGH-----IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPL  155
            T  G+DY SY     GH     +   + F  S+  Q++++LKRIH++GV K+ VTA++P+
Sbjct  169  TVSGDDYESYIFSMEGHTPAYQLQSWKSFSTSVVNQITISLKRIHDLGVKKILVTALEPM  228

Query  156  GCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSAL  335
            GC P  T +  +Y  C+E  N+++R HN +LKQ V KLN+Q + S F+ILDLY +F SAL
Sbjct  229  GCRPTST-AVFSYKKCNETRNSLSRSHNVLLKQAVAKLNNQAKSSSFIILDLYTSFMSAL  287

Query  336  NIKHDQHPGKSSFPYPLAPCCLG-------NCGEV-DVSGKKGYGLCDDPKMAFFWDMTH  491
                 +H G + F   L PCC G        CG + D+ G++ Y +C     AFFWD  H
Sbjct  288  -----KHKGTTKFKDGLKPCCAGVTPDYPYGCGMMADIPGEETYTICKSAAAAFFWDYAH  342

Query  492  PSQQGWFAVYSALKSSLPHLF  554
            P+QQGWFAVYS LK++L  LF
Sbjct  343  PTQQGWFAVYSNLKATLKKLF  363



>ref|XP_008375573.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Malus domestica]
Length=365

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 124/193 (64%), Gaps = 13/193 (7%)
 Frame = +3

Query  12   GNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY ++          + EF +SI +Q++V+L RI ++GV K+A TA++P+GCLP +T 
Sbjct  173  GNDYTTHFVKPGNGSKDLAEFTKSIVKQIAVDLMRIRDLGVRKIAXTALEPMGCLPLLT-  231

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S  +Y NC E  N  + FHNQ+L+Q V++LN +++ S F+ILDLY AF SA+  + D   
Sbjct  232  SFLSYQNCSETLNLASMFHNQVLRQNVEQLNKESKKSAFIILDLYGAFLSAIKPQKDHQA  291

Query  360  GKSSFPY--PLAPCCLG-----NCGEVDVS-GKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            GK       PL PCC+G     +CG VD S G K YG+C +P+ +FFWD  H SQ GW  
Sbjct  292  GKMMVQIDDPLKPCCVGVGSEYSCGSVDESTGAKKYGICSNPERSFFWDTVHLSQNGWND  351

Query  516  VYSALKSSLPHLF  554
            VYS+LKSSL  L+
Sbjct  352  VYSSLKSSLHQLY  364



>ref|XP_006485230.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Citrus sinensis]
Length=365

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 122/187 (65%), Gaps = 12/187 (6%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA+Y    +  + G     +SI  QL++NLK I ++GVPK+AVT+M+P+GCLP ++ 
Sbjct  176  GNDYATYLVKNNSDLQGFPGLTKSIIGQLAMNLKLILDLGVPKIAVTSMEPMGCLPQLS-  234

Query  180  STGNYPNCDENTNNITRFHNQMLKQRV-DKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
            +  +Y NC E+ N+ ++FHNQ+L+Q +    N++++      LDLY AF SAL +K + H
Sbjct  235  AVSSYENCSESLNSASKFHNQLLEQEILQNFNNESKRPVIFTLDLYGAFMSAL-MKKENH  293

Query  357  PGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
             G       L PCC G      CG VD SGKK Y +C++PK++FFWD  HPSQ GW AV+
Sbjct  294  SGNVKLKTSLQPCCAGVSKDYLCGNVDKSGKKRYIVCENPKLSFFWDNIHPSQNGWHAVF  353

Query  522  SALKSSL  542
            S L+SSL
Sbjct  354  SELQSSL  360



>ref|XP_010271726.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=355

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 114/189 (60%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G   G   F  S+  QL++NLKRIH MGV K AV A+ P GCLP  T  
Sbjct  168  GNDYTTYVAMNGSAEGFSTFTASVINQLAINLKRIHGMGVKKFAVIAIPPFGCLPQATIL  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C+E  N I+ +HN  L++ VDKLN++ +GS F+ILDLY AF S    + D HPG
Sbjct  228  S-SYQQCNETINKISIYHNLFLQEAVDKLNNENKGSTFIILDLYNAFISTFKRQKD-HPG  285

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC        CG+ D +G   Y  C++PK AFFWD  H SQ+G  AVYS 
Sbjct  286  SMEFGNPLKPCCESINSKYLCGQTDENGVPMYTACENPKSAFFWDEVHLSQEGCLAVYSL  345

Query  528  LKSSLPHLF  554
            L+ SL  L+
Sbjct  346  LEDSLHQLY  354



>gb|KHN37834.1| GDSL esterase/lipase [Glycine soja]
Length=345

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 120/192 (63%), Gaps = 15/192 (8%)
 Frame = +3

Query  12   GNDY--ASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA---VT  176
            GNDY  A   G I  +  F+ES+ +Q+SVNLKRIH +G+ KVAV  +QP+GCLP    ++
Sbjct  157  GNDYTNALKTGRIIDLPGFMESLVKQMSVNLKRIHSLGIKKVAVGLLQPIGCLPVLNVIS  216

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQ  353
            F T    NC    N I++ HN+ML + V +LN +  + S F+ LDLY +F SA+     +
Sbjct  217  FRT----NCIGLLNVISKDHNKMLLKAVQELNKEAADKSVFMTLDLYNSFLSAIETMQKK  272

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
               KS+   PL PCC GN     CG VD  G K Y LC++PK++FFWD  HPSQ GWFAV
Sbjct  273  RAEKSTLMNPLQPCCEGNNLEDSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAV  332

Query  519  YSALKSSLPHLF  554
            Y+ L+S+L  L 
Sbjct  333  YTILQSTLGQLI  344



>ref|XP_010452241.1| PREDICTED: GDSL esterase/lipase At5g03610 [Camelina sativa]
Length=359

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+++        EF   ++ + +Q  VNL+RIH +GV K+AV ++QPLGCLP  T  
Sbjct  170  GNDYSNFIALNRPASEFPAFIKQVVDQTEVNLRRIHALGVKKIAVPSLQPLGCLPPFTVL  229

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E  N +   HN +L+Q V KLN +T+ S F+ILDLY AF +    K   +PG
Sbjct  230  S-SFQRCNETQNALVNLHNNLLQQVVAKLNSETKQSNFIILDLYNAFLTVFKNK-GANPG  287

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     NCG VD  G K Y +CD+PK AFFWD  HP+++GW +VYS 
Sbjct  288  STRFESPLKPCCVGVSREYNCGSVDEKGVKKYMVCDNPKSAFFWDGLHPTEEGWRSVYSV  347

Query  528  LKSSL  542
            L+ SL
Sbjct  348  LRESL  352



>ref|XP_010248424.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=360

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 125/190 (66%), Gaps = 11/190 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G+ + V S+ +QL++NLKRIHE GV  V VTA+QP+GCLP +T S
Sbjct  172  GNDYSTYFARNGTEEGLPDLVRSVVKQLALNLKRIHETGVKIVVVTALQPVGCLPYLTAS  231

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + ++  C+E+ N   +FHN +L Q V+KLN+++  + + ILDLY+AF S    +   HP 
Sbjct  232  S-SFQRCNESRNAAVKFHNHLLHQAVEKLNNESTVAAYKILDLYSAFMSVFE-RQKGHPE  289

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY-S  524
               F  PL PCC+G     +CG +D S  K Y +C++ + AFFWD+ HP+Q+GW  V  S
Sbjct  290  SLKFDNPLKPCCIGIGVSYSCGSIDESKVKKYTICNNTETAFFWDLFHPTQEGWNVVLRS  349

Query  525  ALKSSLPHLF  554
            AL+SSL  L+
Sbjct  350  ALQSSLHSLY  359



>ref|XP_011024232.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Populus 
euphratica]
Length=350

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G+   +  F  S+  QLS NLKRIH  GV K+AVTA+QPLGCLP +T +
Sbjct  165  GNDYTTYIQRNGNFQDLPAFTTSLINQLSANLKRIHGFGVRKIAVTALQPLGCLPILT-A  223

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y NC E+ N  ++FHNQ L+Q + ++N+++    +  LDLY AF S LN    +  G
Sbjct  224  FSSYQNCSESWNTASKFHNQKLQQAIQRMNNESGKHMYETLDLYTAFMSKLNTA--RLAG  281

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
                   L PCC+G     +CG VD +G K Y +C+ P+++ FWDM HP+Q GW  VYS+
Sbjct  282  NLKLRSFLMPCCVGVTSNYSCGNVDKNGAKTYVVCEKPELSVFWDMVHPAQNGWHQVYSS  341

Query  528  LKSSLPHLF  554
            L+SSL  L+
Sbjct  342  LESSLHRLY  350



>ref|XP_006398813.1| hypothetical protein EUTSA_v10013966mg [Eutrema salsugineum]
 gb|ESQ40266.1| hypothetical protein EUTSA_v10013966mg [Eutrema salsugineum]
Length=353

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY++Y      I  +  F++ + +Q  VNL+RIH  GV K+AV ++QPLGCLP    
Sbjct  170  AGNDYSNYLTLSRSIAELPAFIKQVVDQTEVNLRRIHAFGVEKIAVPSLQPLGCLPLYAS  229

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
              G    C++  N +  +HN +L+Q V KLN++T  S F+I D Y AF +    K +   
Sbjct  230  LQG----CNDTFNALVNYHNTLLQQVVAKLNNETNHSTFIIFDFYNAFLTIFKTKGENSG  285

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
            G   F  PL PCC G+C  VD  G+K Y LCDDPK AFFWD  HP+QQGW +VYS L  +
Sbjct  286  GSRRFETPLKPCCEGSCAHVDDKGEKKYRLCDDPKSAFFWDGLHPTQQGWESVYSVLGKN  345

Query  540  L  542
            L
Sbjct  346  L  346



>ref|XP_010244363.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=362

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 122/193 (63%), Gaps = 14/193 (7%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDYA+Y   +G   G+  F+ ++  QL++NLKRI+ MGV  + VT +QPLGCLP  T 
Sbjct  175  VGNDYAAYLTRNGTAEGLPAFIATVVNQLALNLKRINVMGVKTIVVTGLQPLGCLPQRTV  234

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
             T ++  C+E  N    FHNQ+L+Q VDK N++++ S F+ILDLY +F + LN      P
Sbjct  235  FT-SFQQCNETDNAGVIFHNQLLQQVVDKFNNESKDSSFLILDLYRSFKTILN--QTALP  291

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G   F   L PCC+G     +CG  D +G K Y +C +PK AFFWDM HP+Q+GW AV  
Sbjct  292  GNMKFDDLLKPCCMGVNSSFSCGSKDENGVKMYTVCKNPKTAFFWDMFHPTQEGWKAVRL  351

Query  525  ALKSSLPHLFHPQ  563
             L+S   +LF P+
Sbjct  352  LLES---YLFPPK  361



>ref|XP_011024233.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Populus 
euphratica]
Length=347

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G+   +  F  S+  QLS NLKRIH  GV K+AVTA+QPLGCLP +T +
Sbjct  162  GNDYTTYIQRNGNFQDLPAFTTSLINQLSANLKRIHGFGVRKIAVTALQPLGCLPILT-A  220

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y NC E+ N  ++FHNQ L+Q + ++N+++    +  LDLY AF S LN    +  G
Sbjct  221  FSSYQNCSESWNTASKFHNQKLQQAIQRMNNESGKHMYETLDLYTAFMSKLNTA--RLAG  278

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
                   L PCC+G     +CG VD +G K Y +C+ P+++ FWDM HP+Q GW  VYS+
Sbjct  279  NLKLRSFLMPCCVGVTSNYSCGNVDKNGAKTYVVCEKPELSVFWDMVHPAQNGWHQVYSS  338

Query  528  LKSSLPHLF  554
            L+SSL  L+
Sbjct  339  LESSLHRLY  347



>emb|CDY00894.1| BnaC05g43060D [Brassica napus]
Length=323

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 124/188 (66%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    TSVGNDYASYHGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY ++      M EF   ++ + +Q  VNL+RIH++GV K+A+ ++QPLGCLP+ 
Sbjct  133  SNAGNDYGTFILQKRLMTEFPGFIKQVVDQTEVNLRRIHKLGVKKIAIASLQPLGCLPSK  192

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S+ ++ +C+ + N + + HN +L++ V KLN+ T+ S FVILDLY AF + L  K  +
Sbjct  193  TTSS-SFKHCNASDNALVKLHNILLRRAVAKLNNVTKPSTFVILDLYKAFLTVLKNKRAK  251

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G + F  PL PCC+G     +C  VD  G+K Y +C DPK +FFWD+ HP+++GW +V
Sbjct  252  T-GVTRFVNPLKPCCVGITSNDSCSNVDKKGEKKYTICKDPKTSFFWDVFHPTEEGWRSV  310

Query  519  YSALKSSL  542
            YS L+ +L
Sbjct  311  YSVLRENL  318



>ref|XP_010452240.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=355

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 119/186 (64%), Gaps = 7/186 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +G+   + +FV  +  Q+ VNLKRIH +GV KVAV ++QPLGCLP  T  
Sbjct  171  GNDYFTHISDNGYDLSIFQFVRRVINQIEVNLKRIHALGVKKVAVPSLQPLGCLPMYTRG  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C++  N +T  HN  L++ V +LN +T+ SPF+ LD Y AF + LN K  ++PG
Sbjct  231  F-SYQKCNDVINALTIVHNNALQKVVARLNKETKNSPFIYLDYYKAFLAVLNNK-GENPG  288

Query  363  KSSFPYPLAPCCLGN--CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
             ++F  P  PCC G   CG +D +G K Y LCDDP  AFFWD  HP+Q+GW AVYS L +
Sbjct  289  ITNFKIPYEPCCGGKGYCGTLDENGGKNYTLCDDPSSAFFWDEFHPTQEGWKAVYSVLTN  348

Query  537  SLPHLF  554
            +L  L 
Sbjct  349  NLKALL  354



>ref|XP_009336008.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
 ref|XP_009336021.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Pyrus x bretschneideri]
Length=364

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 125/193 (65%), Gaps = 14/193 (7%)
 Frame = +3

Query  12   GNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY ++          + EF +SI +Q++V+L  I ++GV K+AVTA++P+GCLP +T 
Sbjct  173  GNDYTTHFVKPGNGSKDLAEFTKSIVKQIAVDLMSIRDLGVRKIAVTALEPMGCLPLLT-  231

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S  +Y NC E  N  + FHNQ+L+Q +++LN ++  S FVILDLY AF SA+  + D H 
Sbjct  232  SFLSYQNCSETLNLASMFHNQVLRQNMEQLNKESNKSAFVILDLYGAFLSAIKPQKD-HQ  290

Query  360  GKSSFPY--PLAPCCLG-----NCGEVDVS-GKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            GK +     PL PCC+G     +CG VD S G K YG+C +P+ +FFWD  H SQ GW A
Sbjct  291  GKMTVQIDDPLKPCCVGVSSEYSCGSVDESTGAKKYGICSNPERSFFWDTVHLSQNGWHA  350

Query  516  VYSALKSSLPHLF  554
            VY +LKSSL  L+
Sbjct  351  VYCSLKSSLHQLY  363



>gb|KDO39252.1| hypothetical protein CISIN_1g045084mg [Citrus sinensis]
Length=365

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 123/187 (66%), Gaps = 12/187 (6%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA+Y    +  + G     ++I  QL++NLK I ++GVPK+AVT+M+P+GCLP ++ 
Sbjct  176  GNDYATYLVKNNSDLQGFPGLTKAIIGQLAMNLKLILDLGVPKIAVTSMEPMGCLPQLS-  234

Query  180  STGNYPNCDENTNNITRFHNQMLKQRV-DKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
            +  +Y NC E+ N+ ++FHNQ+L+Q +    N++++      LDLY+AF SAL +K + H
Sbjct  235  AVYSYKNCSESLNSASKFHNQLLQQEILQTFNNESKRPVIFTLDLYSAFMSAL-MKKENH  293

Query  357  PGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
             G       L PCC+G      CG  D SGKK Y +C++PK++FFWD  HPSQ GW AV+
Sbjct  294  SGNVELKTSLQPCCVGVSKDYLCGNADKSGKKRYIVCENPKLSFFWDNIHPSQNGWHAVF  353

Query  522  SALKSSL  542
            S L+SSL
Sbjct  354  SELQSSL  360



>ref|XP_002264855.2| PREDICTED: GDSL esterase/lipase At5g03610 [Vitis vinifera]
 emb|CBI35233.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 121/192 (63%), Gaps = 11/192 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y    G + G+  F+ S+ +QL ++L+RIH++GVPKV V  +QPLGCLP  T  
Sbjct  154  GNDYNAYIARGGSLLGLPAFIVSVVKQLGLDLQRIHDLGVPKVVVMGIQPLGCLPQFT-K  212

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C+E  N  + FHN +L   V++L  +     FV+LD+Y AF SA+  KH+   G
Sbjct  213  EYSYEKCNETGNLASLFHNLLLTAVVEELKLENGEPEFVMLDMYNAFMSAMK-KHEDETG  271

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S     L PCC G     +CG+V+ +G+K Y +C DPKMAFFWD  HP+Q GW A+YS 
Sbjct  272  TSELKDTLRPCCAGITSEDSCGDVE-NGEKKYNVCIDPKMAFFWDSFHPTQAGWHAIYSV  330

Query  528  LKSSLPHLFHPQ  563
            LKSS+ +LF  +
Sbjct  331  LKSSIANLFQTE  342



>ref|XP_006481810.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Citrus sinensis]
Length=346

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 123/192 (64%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY++Y   +G   G + F+  +  QL++N+KRIH +GV K+ V ++ PLGCLP  
Sbjct  160  SAAGNDYSTYVAVNGSAEGFQPFITKVVNQLTLNMKRIHGLGVRKILVPSLPPLGCLPQS  219

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S  ++  C+E  N+++ FHN +L+Q V KLN++T+ S FVILDL+ AF +       +
Sbjct  220  T-SKLSFQQCNETENSLSGFHNLLLQQAVAKLNNETQDSAFVILDLFGAFMTTF-----K  273

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            + G S    PL PCC+G     +CG VD +G K Y +C  P+ +FFWD  HPSQ+GW +V
Sbjct  274  NKGSSKTENPLKPCCVGIGKDSSCGSVDDNGVKLYTVCAKPEASFFWDGVHPSQEGWQSV  333

Query  519  YSALKSSLPHLF  554
            YSALK  L  ++
Sbjct  334  YSALKPKLLQIY  345



>ref|XP_007143812.1| hypothetical protein PHAVU_007G103600g [Phaseolus vulgaris]
 gb|ESW15806.1| hypothetical protein PHAVU_007G103600g [Phaseolus vulgaris]
Length=346

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 116/187 (62%), Gaps = 8/187 (4%)
 Frame = +3

Query  12   GNDY--ASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY  A   G    +  F ES+ EQ+SVNL RIH +G+ KVAV  +QP+GCLPA+T  +
Sbjct  160  GNDYTNALKTGRFFDLPAFTESLVEQISVNLNRIHSLGINKVAVGLLQPIGCLPALTLIS  219

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGK  365
                +C    N+I++ HN+ L + + KLN+QT+ S F+ LDLY +F S +     +    
Sbjct  220  FR-TDCIGLLNSISKDHNKKLLEAIQKLNNQTDNSVFITLDLYNSFLSTIETMQKKRAEN  278

Query  366  SSFPYPLAPCC----LGN-CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            S+   PL PCC    LG+ CG VD  G+K Y LC++PK++FFWD  HPSQ GW AVY  L
Sbjct  279  STLMNPLQPCCDVKNLGDSCGSVDDKGEKKYSLCENPKVSFFWDNVHPSQNGWSAVYRML  338

Query  531  KSSLPHL  551
            + SL  L
Sbjct  339  QPSLAQL  345



>ref|XP_006589384.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=345

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 119/192 (62%), Gaps = 15/192 (8%)
 Frame = +3

Query  12   GNDY--ASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA---VT  176
            GNDY  A   G I  +  F+ES+ +Q+SVNLKRI  +G+ KVAV  +QP+GCLP    ++
Sbjct  157  GNDYTNALKTGRIIDLPGFMESLVKQMSVNLKRIRSLGIKKVAVGLLQPIGCLPVLNVIS  216

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQ  353
            F T    NC    N I++ HN+ML + V +LN +  + S F+ LDLY +F SA+     +
Sbjct  217  FRT----NCIGLLNVISKDHNKMLLKAVQELNKEAADKSVFITLDLYNSFLSAIETMQKK  272

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
               KS+   PL PCC GN     CG +D  G K Y LC++PK++FFWD  HPSQ GWFAV
Sbjct  273  RAEKSTLMNPLQPCCEGNNLEDSCGSLDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAV  332

Query  519  YSALKSSLPHLF  554
            Y+ L+S+L  L 
Sbjct  333  YTILQSTLGQLI  344



>gb|KDO61090.1| hypothetical protein CISIN_1g019114mg [Citrus sinensis]
Length=346

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 123/192 (64%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY++Y   +G   G + F+  +  QL++N+KRIH +GV K+ V ++ PLGCLP  
Sbjct  160  SAAGNDYSTYVAVNGSAEGFQPFITKVVNQLTLNMKRIHGLGVRKILVPSLPPLGCLPQS  219

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S  ++  C+E  N+++ FHN +L+Q V KLN++T+ S FVILDL+ AF +       +
Sbjct  220  T-SKLSFQQCNETENSLSGFHNLLLQQAVAKLNNETKDSAFVILDLFGAFMTTF-----K  273

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            + G S    PL PCC+G     +CG VD +G K Y +C  P+ +FFWD  HPSQ+GW +V
Sbjct  274  NKGSSKTENPLMPCCVGIGKDSSCGSVDDNGVKLYTVCAKPEASFFWDGVHPSQEGWQSV  333

Query  519  YSALKSSLPHLF  554
            YSALK  L  ++
Sbjct  334  YSALKPKLQQIY  345



>gb|KHG04194.1| hypothetical protein F383_29007 [Gossypium arboreum]
Length=354

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 12/191 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G   F+  +  Q+ VNLKRIH +GV K+A +A+QPLGCLP  T +
Sbjct  166  GNDYSNYIATNGSTAGFPVFIGRVVNQMKVNLKRIHNLGVRKIAASALQPLGCLPRST-A  224

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+E+ N +   HNQ+L Q V+ LN +T  S F +LD+Y AF +  N K   H  
Sbjct  225  QFSFEQCNESENALVGLHNQLLAQAVNDLNKETNSSSFFVLDIYNAFWNVFNQKQ-AHQV  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS-  524
              +F  P  PCC+G     +CG VD +G K Y LC +PK  FFWD  HP++QGW AVYS 
Sbjct  284  SPTFVNPFEPCCVGVSAAFSCGSVDENGVKQYTLCSNPKSKFFWDTVHPTEQGWRAVYST  343

Query  525  -ALKSSLPHLF  554
             AL+SSL   +
Sbjct  344  PALQSSLKQFW  354



>ref|XP_008462554.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis melo]
Length=349

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 114/189 (60%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G I G    +E + +Q+SVNL+RIH  GV K+++TA+ PL C+P +T  
Sbjct  163  GNDYSYYLSTNGPIQGFIPLIEKVVKQISVNLRRIHSFGVKKISITALGPLQCVPEITAL  222

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   + +  FHN +L + VD+LN +T   PF IL+L+ AF+S +  K +   G
Sbjct  223  T-DFKECNSTLSQLVDFHNFLLTRAVDELNKETNDYPFFILNLHDAFSSVIQNKGNPQ-G  280

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G     NCG VD  G K Y LCDDP  AFFWD  HP+QQGWFA  + 
Sbjct  281  NIKFENPLKPCCIGINPEYNCGSVDKDGNKKYVLCDDPNSAFFWDGVHPTQQGWFAALTI  340

Query  528  LKSSLPHLF  554
            L S     F
Sbjct  341  LLSKFKQHF  349



>gb|AGT59515.1| GDSL esterase/lipase [Gossypium hirsutum]
Length=354

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 12/191 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G   F+  +  Q+ VNLKRIH +GV K+A +A+QPLGCLP  T +
Sbjct  166  GNDYSNYIATNGSTAGFPVFIGRVVNQMKVNLKRIHNLGVRKIAASALQPLGCLPRST-A  224

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+E+ N +   HNQ+L Q V+ LN +T  S F +LD+Y AF +  N K   H  
Sbjct  225  QFSFEQCNESENALVGLHNQLLAQAVNDLNKETNSSSFFVLDIYNAFWNVFNQKQ-AHQV  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS-  524
              +F  P  PCC+G     +CG VD +G K Y LC +PK  FFWD  HP++QGW AVYS 
Sbjct  284  SPTFVNPFEPCCVGVSAAFSCGSVDENGVKQYTLCSNPKSKFFWDTVHPTEQGWRAVYST  343

Query  525  -ALKSSLPHLF  554
             AL+SSL   +
Sbjct  344  PALQSSLKQFW  354



>gb|KDO37301.1| hypothetical protein CISIN_1g046266mg, partial [Citrus sinensis]
Length=174

 Score =   162 bits (410),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 113/171 (66%), Gaps = 8/171 (5%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G     +SI  QL++NLK I ++GVPK+AVT+M+P+GCLP ++ +  +Y NC E+ N+ +
Sbjct  1    GFPGLTKSIIGQLAMNLKLILDLGVPKIAVTSMEPMGCLPQLS-AVSSYENCSESLNSAS  59

Query  228  RFHNQMLKQRV-DKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG  404
            +FHNQ+L+Q +    N++++      LDLY AF SAL +K + H G       L PCC G
Sbjct  60   KFHNQLLEQEILQNFNNESKRPVIFTLDLYGAFMSAL-MKKENHSGNVKLKTSLQPCCAG  118

Query  405  N-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
                  CG VD SGKK Y +C++PK++FFWD  HPSQ GW AV+S L+SSL
Sbjct  119  VSKDYLCGNVDKSGKKRYIVCENPKLSFFWDNIHPSQNGWHAVFSELQSSL  169



>ref|XP_006430253.1| hypothetical protein CICLE_v10011959mg [Citrus clementina]
 gb|ESR43493.1| hypothetical protein CICLE_v10011959mg [Citrus clementina]
Length=381

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 123/192 (64%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY++Y   +G   G + F+  +  QL++N+KRIH +GV K+ V ++ PLGCLP  
Sbjct  195  SAAGNDYSTYVAVNGSAEGFQPFITKVVNQLTLNMKRIHGLGVRKILVPSLPPLGCLPQS  254

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S  ++  C+E  N+++ FHN +L+Q V KLN++T+ S FVILDL+ AF +       +
Sbjct  255  T-SKLSFQQCNETENSLSGFHNLLLQQAVAKLNNETKDSAFVILDLFGAFMTTF-----K  308

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            + G S    PL PCC+G     +CG VD +G K Y +C  P+ +FFWD  HPSQ+GW +V
Sbjct  309  NKGSSKTENPLMPCCVGIGKDSSCGSVDDNGVKLYTVCAKPEASFFWDGVHPSQEGWQSV  368

Query  519  YSALKSSLPHLF  554
            YSALK  L  ++
Sbjct  369  YSALKPKLQQIY  380



>ref|XP_004143312.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
 ref|XP_004156259.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
 gb|KGN48249.1| hypothetical protein Csa_6G452010 [Cucumis sativus]
Length=352

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 112/189 (59%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G I G    +E + +Q+SVNLKRIH  GV K+ +TA+ PL C+P VT  
Sbjct  166  GNDYSYYLSQNGPIQGFIPLIEKVVKQISVNLKRIHSFGVKKIGITALGPLHCVPEVTVL  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   + +  FHN +LKQ VD+LN +T   PF IL+L+ AF S +  K     G
Sbjct  226  T-DFKECNSTLSQLVDFHNHLLKQAVDELNKETNDLPFFILNLHDAFLSIIQNKGIPQ-G  283

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G     NCG VD  G K Y LCDDP  AFFWD  HP+Q+GW A  + 
Sbjct  284  NIKFETPLKPCCIGINPQYNCGSVDKDGNKKYVLCDDPNSAFFWDGVHPTQRGWIAALTI  343

Query  528  LKSSLPHLF  554
            L S+    F
Sbjct  344  LLSNFKQHF  352



>ref|XP_002263024.1| PREDICTED: GDSL esterase/lipase At5g03610 [Vitis vinifera]
 emb|CBI35225.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 117/184 (64%), Gaps = 11/184 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G   G+  F +S+ +QL +NL+RI  +GV K+AV  +QPLGCLP+ T S
Sbjct  156  GNDYTAYLARNGTTEGLSAFTKSMIKQLGLNLQRIQGLGVRKIAVMNIQPLGCLPSETIS  215

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
               Y NC  + N++  FHNQ+L++ V+KLN++++ S FVIL++Y AF SAL  K    PG
Sbjct  216  DL-YKNCSTSGNSVALFHNQVLEKTVEKLNNKSKESVFVILNMYKAFLSALK-KQASQPG  273

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC        CG  +  GK+ Y +C++P   FFWD  HPSQ GW AVY A
Sbjct  274  TLKFKDPLRPCCEAVSTGYKCGNTE-HGKRMYVVCNNPNSTFFWDDVHPSQAGWRAVYLA  332

Query  528  LKSS  539
            LKSS
Sbjct  333  LKSS  336



>ref|XP_010271717.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=355

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 121/192 (63%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY++Y   +G + G+   + S+  QL+ NLKRIH +GV  V V  +QP+GC P +
Sbjct  165  SAAGNDYSAYLSRNGTLEGLPALIISVVNQLASNLKRIHSLGVKNVVVNGLQPIGCAPYI  224

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S+ +   C+E  N + + HN +L Q V+KLN +T GS + I++LY+AFT+ LN     
Sbjct  225  TASSSSRQKCNETVNILVKLHNLLLNQAVNKLNSETNGSTYKIINLYSAFTTVLN-----  279

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            + G  +F  PL  CC G      CG  + +G + Y +C++ + AFFWD  HP+QQGW AV
Sbjct  280  NTGNQTFTNPLQQCCKGKNSTYTCGNTE-NGVEMYTVCENREAAFFWDDVHPTQQGWSAV  338

Query  519  YSALKSSLPHLF  554
            +SAL++SL  L+
Sbjct  339  FSALQASLHQLY  350



>gb|KDP35844.1| hypothetical protein JCGZ_10325 [Jatropha curcas]
Length=358

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 121/192 (63%), Gaps = 13/192 (7%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY +Y   +G +  + +F  SI +QLS NLKRI+ +GV K+AVT +QP+GCLPA   
Sbjct  170  AGNDYNTYLYKNGDLKDLPKFTASIIKQLSENLKRINGLGVQKIAVTGLQPVGCLPAFAA  229

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP--FVILDLYAAFTSALNIKHDQ  353
            S+ +Y NC E+ N  ++ HNQMLKQ V KLN+ T      F ILDL++AF  A N     
Sbjct  230  SS-SYQNCSESWNRASKLHNQMLKQEVQKLNNDTHSQKHVFEILDLFSAFMHAFN--KTL  286

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            +P   +    L PCC G     +CG++D +G   Y +C++P+++ FWD+ HPSQ GW+ V
Sbjct  287  YPESLNSESSLKPCCEGVTSDSSCGDIDKNGTIKYVICNNPEVSIFWDIVHPSQNGWYQV  346

Query  519  YSALKSSLPHLF  554
            Y  LKSSL  L+
Sbjct  347  YLTLKSSLHKLY  358



>ref|XP_010244324.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Nelumbo 
nucifera]
Length=362

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 13/190 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y+   G   G+  F+ S+  QL +N+KRIHEMGV KVAVT +QPLGCLP  T  
Sbjct  176  GNDYGAYNARSGTAQGLPAFMASVVNQLKLNVKRIHEMGVKKVAVTTLQPLGCLPQNTLL  235

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            +  Y +C+   N    FHN +LKQ V +LN++ + S F +LDL++AF S    K     G
Sbjct  236  S-YYRHCNATQNMAVNFHNFLLKQAVQQLNNEVKNSTF-LLDLHSAFMSVF--KKRNSSG  291

Query  363  KSSFPYPLAPCCLG-----NCGEVD-VSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
               F  PL PCC+G     +CG  D +SGKK Y +C  PK AFFWD+ HPSQ GW AV  
Sbjct  292  NVKFSNPLQPCCVGMDASNSCGSTDQLSGKKKYRVCKHPKAAFFWDLLHPSQAGWHAVSL  351

Query  525  ALKSSLPHLF  554
             L SS   L+
Sbjct  352  VLHSSFNKLY  361



>ref|XP_010244330.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Nelumbo 
nucifera]
Length=357

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 13/190 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y+   G   G+  F+ S+  QL +N+KRIHEMGV KVAVT +QPLGCLP  T  
Sbjct  171  GNDYGAYNARSGTAQGLPAFMASVVNQLKLNVKRIHEMGVKKVAVTTLQPLGCLPQNTLL  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            +  Y +C+   N    FHN +LKQ V +LN++ + S F +LDL++AF S    K     G
Sbjct  231  S-YYRHCNATQNMAVNFHNFLLKQAVQQLNNEVKNSTF-LLDLHSAFMSVF--KKRNSSG  286

Query  363  KSSFPYPLAPCCLG-----NCGEVD-VSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
               F  PL PCC+G     +CG  D +SGKK Y +C  PK AFFWD+ HPSQ GW AV  
Sbjct  287  NVKFSNPLQPCCVGMDASNSCGSTDQLSGKKKYRVCKHPKAAFFWDLLHPSQAGWHAVSL  346

Query  525  ALKSSLPHLF  554
             L SS   L+
Sbjct  347  VLHSSFNKLY  356



>ref|XP_006288070.1| hypothetical protein CARUB_v10001303mg [Capsella rubella]
 gb|EOA20968.1| hypothetical protein CARUB_v10001303mg [Capsella rubella]
Length=350

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 117/184 (64%), Gaps = 6/184 (3%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +G    + + V+ +  Q+ VNL+RIH +GV K+A+ ++QPLGCLP  T  
Sbjct  167  GNDYFTHIVDNGISLSIFQIVKRVINQIEVNLRRIHALGVKKIAIPSLQPLGCLPMYTRG  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS-PFVILDLYAAFTSALNIKHDQHP  359
            + +Y  C++  N +T  HN  L++ V KLN +T+ S  FV+LD Y AF + LN K  ++P
Sbjct  227  S-SYQKCNDIINALTIIHNSALQKVVAKLNKETKQSTAFVVLDYYKAFLTVLNNK-GENP  284

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
            G ++F     PCC G CG VD++G K Y LCDDP  AFFWD  HP QQGW AVYS L  +
Sbjct  285  GITNFKTLYKPCCEGECGSVDMNGVKNYTLCDDPNSAFFWDEFHPGQQGWNAVYSVLTKN  344

Query  540  LPHL  551
            L  L
Sbjct  345  LRAL  348



>emb|CAN68334.1| hypothetical protein VITISV_040539 [Vitis vinifera]
Length=353

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 117/185 (63%), Gaps = 11/185 (6%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY +Y   +G   G+  F +S+ +QL +NL+RI  +GV K+AV  +QPLGCLP+ T 
Sbjct  165  AGNDYTAYLARNGTTEGLSAFTKSMIKQLGLNLQRIQGLGVRKIAVMNIQPLGCLPSETI  224

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S   Y NC  + N+++ FHNQ+L++ V+KLN++++ S FVIL++Y AF SAL  K    P
Sbjct  225  SY-LYKNCSTSGNSVSLFHNQVLEKTVEKLNNKSKESVFVILNMYKAFLSALK-KQASQP  282

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G   F  PL PCC        CG  +  GK  Y +C++P   FFWD  HPSQ GW AVY 
Sbjct  283  GTLKFKDPLRPCCEAVSTGYKCGNTE-HGKGMYVVCNNPNSTFFWDDVHPSQAGWRAVYL  341

Query  525  ALKSS  539
            ALKSS
Sbjct  342  ALKSS  346



>gb|KDP42724.1| hypothetical protein JCGZ_23664 [Jatropha curcas]
Length=354

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 120/197 (61%), Gaps = 21/197 (11%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY++Y     G+  G+ +F+  + +QL++N+KRI+E+GV +VAV  + PLGCLP  T 
Sbjct  162  GNDYSTYLIDHGGNTDGIMDFINKVVDQLALNMKRIYELGVRRVAVNELAPLGCLPQSTM  221

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS--------PFVILDLYAAFTSAL  335
              G++  CDE  N +  +HN +L+  V KLN++T            FV LDLY AF + L
Sbjct  222  D-GSFKECDETRNGLVSYHNMVLETLVAKLNNETNAKLNQTANRDAFVTLDLYVAFKNVL  280

Query  336  NIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
            N   +Q  G + F  PL PCC G     +CG+V V GKK Y +CD+P  AFFWD  HP+Q
Sbjct  281  N--GEQPAGTTKFATPLIPCCKGTNSTYSCGDV-VDGKKMYTICDNPDAAFFWDYVHPTQ  337

Query  501  QGWFAVYSALKSSLPHL  551
            +GW  +Y A++S L  L
Sbjct  338  EGWRTLYMAMQSDLHKL  354



>ref|XP_008462555.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis melo]
Length=347

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 119/190 (63%), Gaps = 13/190 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G + G + F+ S+  Q+SVNLKRI+++GV KV V  + P+GC P  T  
Sbjct  160  GNDYSFYFTNNGSLEGFKPFIFSVVNQISVNLKRIYKLGVKKVVVLGLGPVGCYPKPT--  217

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSP-FVILDLYAAFTSALNIKHDQH  356
              ++  C++  ++I  FHN +LKQ V+KLN +T EGSP F IL++Y    S +  K ++ 
Sbjct  218  APSFKKCNKTMDSIAVFHNTLLKQAVEKLNYETKEGSPNFFILNMYDTVLSIIKNKENRK  277

Query  357  PGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
             G ++F  PL PCC G     +CG VD  G K Y LC  P +A FWD  HP+Q GWFA +
Sbjct  278  -GGATFKTPLKPCCFGVNSNFSCGSVDERGNKMYTLCKRPDLALFWDAVHPTQNGWFATF  336

Query  522  SALKSSLPHL  551
            S+ KS+L H+
Sbjct  337  SSFKSTLKHI  346



>ref|XP_009125512.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Brassica rapa]
Length=349

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 111/180 (62%), Gaps = 8/180 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +  I  +  F++ + +Q  +NL+R+H +G+ K+A+ ++ PLGCLP  T  
Sbjct  168  GNDYSNYLALNRSIAALPIFIKQVVDQTELNLRRLHALGLEKIAIPSLPPLGCLPLYTSP  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
             G    C++  N +  +HN +L+Q V KLN++T  S F I+D Y AF + L  K  + PG
Sbjct  228  QG----CNDTFNALVNYHNSLLEQVVAKLNNETRQSTFAIIDFYNAFMAILKNK-GESPG  282

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               F  PL PCC G+CG VD  G   Y LCDDP+ AFFWD  HP+QQGW  +YS L  +L
Sbjct  283  SERFETPLKPCCEGSCGNVDEKGANKYTLCDDPESAFFWDGLHPTQQGWKFIYSVLGKAL  342



>ref|XP_007027683.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08185.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=362

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 117/199 (59%), Gaps = 21/199 (11%)
 Frame = +3

Query  12   GNDYASYHGH------------IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPL  155
            GNDY++Y               I G   F+ES+  QL+VNL+RIH +GV K+AV+A+QPL
Sbjct  165  GNDYSAYIARNGSAAGQVDLKDIKGFPAFIESVVSQLTVNLERIHGLGVRKIAVSALQPL  224

Query  156  GCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSAL  335
            GCLP  T +  ++  C+   N +   HNQ+L Q V+ LN +T  +  ++LDLY AF +  
Sbjct  225  GCLPQST-AQFSFEQCNATENTLVNLHNQLLVQAVNNLNKKTNSTSVIVLDLYDAFWTVF  283

Query  336  NIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
            N K + H    +F  P  PCC+G     +CG VD  G K Y LC +PK  FFWD  HP+Q
Sbjct  284  NQK-EAHQVSPTFENPFQPCCVGVTAGFSCGSVDEHGVKKYTLCSNPKSKFFWDTVHPTQ  342

Query  501  QGWFAVYS--ALKSSLPHL  551
            +GW AVYS  A ++S+  L
Sbjct  343  EGWQAVYSTPAFQNSIKQL  361



>ref|XP_010464654.1| PREDICTED: GDSL esterase/lipase At3g09930 [Camelina sativa]
Length=354

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++      + E   F++ +  Q+ VN +RIH++GV K+A+T+MQPLGCLP++T  
Sbjct  167  GNDYATFMALKRPLTELPAFMQQVVGQIEVNARRIHKLGVKKIAITSMQPLGCLPSITV-  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C+   N  T  HN +L + V +LN +T+ S FV++D Y AF +    K  + PG
Sbjct  226  FASYQRCNATDNIATNLHNYLLHKAVARLNSETKPSTFVVIDHYNAFLTVFKNKGPE-PG  284

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             + F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HP+++GW +VYS 
Sbjct  285  VTRFGKPLEPCCVGIDSNHDCSNVDEKGEKKYTICEDPKGAFFWDVFHPTEEGWRSVYSV  344

Query  528  LKSSLPHLF  554
            L  SL  ++
Sbjct  345  LHKSLKDVW  353



>emb|CDY04890.1| BnaAnng00720D [Brassica napus]
Length=348

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 111/180 (62%), Gaps = 8/180 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +  I  +  F++ + +Q  +NL+R+H +G+ K+A+ ++ PLGCLP  T  
Sbjct  167  GNDYSNYLALNRSIAALPIFIKQVVDQTELNLRRLHALGLEKIAIPSLPPLGCLPLYTSP  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
             G    C++  N +  +HN +L+Q V  LN++T  S F I+D Y AF + L  K  + PG
Sbjct  227  QG----CNDTFNALVNYHNSLLQQVVANLNNETMQSTFAIIDFYNAFVAILKNK-GESPG  281

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               F  PL PCC G+CG VD  G   Y LCDDP+ AFFWD  HP+QQGW ++YS L  +L
Sbjct  282  SKRFETPLKPCCEGSCGNVDEKGANKYTLCDDPEAAFFWDGLHPTQQGWESIYSVLGKAL  341



>ref|XP_006582696.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=197

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA---VTFSTGNYPNCDENTNNITR  230
            F+ES+ +Q+SVNLKRIH +G+ KVAV  +QP+GCLP    ++F T    NC    N I++
Sbjct  37   FMESLVKQMSVNLKRIHSLGIKKVAVGLLQPIGCLPVLNVISFRT----NCIGLLNVISK  92

Query  231  FHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN  407
             HN+ML + V +LN +  + S F+ LDLY +F SA+     +   KS+   PL PCC GN
Sbjct  93   DHNKMLLKAVQELNKEAADKSVFITLDLYNSFLSAIETMQKKRAEKSTLMNPLQPCCEGN  152

Query  408  -----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
                 CG VD  G K Y LC++PK++FFWD  HPSQ GWFAVY+
Sbjct  153  NLEDSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAVYT  196



>ref|XP_010486571.1| PREDICTED: GDSL esterase/lipase At3g09930-like [Camelina sativa]
 ref|XP_010486572.1| PREDICTED: GDSL esterase/lipase At3g09930-like [Camelina sativa]
 ref|XP_010486573.1| PREDICTED: GDSL esterase/lipase At3g09930-like [Camelina sativa]
 ref|XP_010486575.1| PREDICTED: GDSL esterase/lipase At3g09930-like [Camelina sativa]
Length=354

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 120/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  9    VGNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYA++      + E   F++ +  Q+  N +RIH++GV K+A+T+MQPLGCLP++T 
Sbjct  166  AGNDYATFMALKRPLTELPAFMQQVVGQIEANARRIHKLGVKKIAITSMQPLGCLPSITV  225

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
             T ++  C+   N  T  HN +L + V +LN++T+ S FV+LD Y AF +    K  + P
Sbjct  226  FT-SFQRCNATDNISTNLHNYLLHKAVARLNNETKPSTFVVLDHYNAFLTVFKNKGPE-P  283

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G + F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HP+++GW +VYS
Sbjct  284  GVTRFGNPLEPCCVGIDSNHDCSNVDEKGEKKYTVCEDPKGAFFWDIFHPTEEGWRSVYS  343

Query  525  ALKSSLPHLF  554
             L  SL  ++
Sbjct  344  VLHKSLTEVW  353



>ref|XP_003591758.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES62009.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=364

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 116/192 (60%), Gaps = 9/192 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++   +G    +  F ES+ +Q+S+NLKRIHE+G+ K+A+  ++P+GC+P +T  
Sbjct  172  GNDYATFVLKNGSFQDIFVFTESLIKQMSLNLKRIHELGINKIAIGLLEPIGCVPMITMR  231

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  CDE +N +++ H+QML Q V +LN Q   S F+ LDLY +F S +     +   
Sbjct  232  S-SYEKCDETSNLVSQNHSQMLLQIVQQLNKQMGKSVFMTLDLYNSFLSVIAKMQKRRAE  290

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S+   PL PCC G      CG VD  G + Y +C+  + + FWD  HPSQ GW+ VY  
Sbjct  291  NSTVMNPLQPCCKGEDLKYFCGSVDNKGARKYSVCEKLESSLFWDTVHPSQNGWYEVYLM  350

Query  528  LKSSLPHLFHPQ  563
            L+SSL  L   +
Sbjct  351  LQSSLGQLIQEK  362



>ref|XP_010244351.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=356

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  15   NDYASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNY  194
            N YAS +G   G+  F+ S+  QL++NLKRI+ MGV  + VTA+ PL CLP  T S+ ++
Sbjct  173  NAYASRNGTAEGLPAFISSVVNQLALNLKRINVMGVKTIIVTALPPLDCLPLRTLSS-SF  231

Query  195  PNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSF  374
              C E  N    FHNQ+L+Q VDKLN+Q++ S F+ LDLY +F + LN +     G   F
Sbjct  232  QQCSETDNAGVIFHNQLLQQAVDKLNNQSKDSTFLTLDLYRSFKTILN-QTALPAGNMKF  290

Query  375  PYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
              PL PCC+G     +CG  D +G + Y +C +PK AFFWDM HP+Q+GW AV   L S 
Sbjct  291  DDPLKPCCMGVNSSYSCGSKDENGVRMYTVCKNPKTAFFWDMFHPTQEGWKAVRLLLDS-  349

Query  540  LPHLFHPQ  563
              +LF P+
Sbjct  350  --YLFPPK  355



>emb|CDP15393.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 113/191 (59%), Gaps = 10/191 (5%)
 Frame = +3

Query  3    TSVGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY +Y+   G   G+  F  S+  QL+VNLKR+H +G  ++AV A++PLGCLP  
Sbjct  172  TVAGNDYGAYNAKGGTAKGLPAFTTSLISQLAVNLKRLHGLGARRIAVAALEPLGCLPRS  231

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T  + ++  C+   N    FHN +L Q V KLN+++  S   +LDLY  FT+ L  K D 
Sbjct  232  TVLS-SFQQCNVTQNTAVNFHNLLLNQAVSKLNNESRDSACHVLDLYTTFTTLLENKGDV  290

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G   F  PL PCC+G     +CG VD  G+K Y +C+D K AFFWD  HP+Q GW AV
Sbjct  291  S-GTLKFETPLKPCCMGLSTAYSCGSVDDKGRKMYTVCNDAKSAFFWDGVHPTQAGWHAV  349

Query  519  YSALKSSLPHL  551
              ALK +L  +
Sbjct  350  SMALKPTLQQI  360



>ref|XP_007145313.1| hypothetical protein PHAVU_007G2286001g, partial [Phaseolus vulgaris]
 gb|ESW17307.1| hypothetical protein PHAVU_007G2286001g, partial [Phaseolus vulgaris]
Length=262

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 110/185 (59%), Gaps = 15/185 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G + G   F+ S+  Q + NL RI  +GV K+ V  +QPLGCLP  T S
Sbjct  76   GNDYNFYLARNGSLQGFPSFIASVVNQTATNLLRIQSLGVKKIVVGGLQPLGCLPGTTAS  135

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG-SPFVILDLYAAFTSALNIKHDQHP  359
            +  +  C+   N++   HN +L Q V KLN QT+  SP +ILDLY +F S LN      P
Sbjct  136  SS-FQKCNSTFNDLVVLHNNLLNQAVTKLNQQTKNQSPIIILDLYDSFISVLN-----QP  189

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
              ++    L PCC+G     +CG VD +  K Y +CDDPK +FFWD+ HP+Q GW AVY+
Sbjct  190  STNNIKDELKPCCVGISSEFSCGSVDENNVKKYKVCDDPKSSFFWDLLHPTQAGWQAVYN  249

Query  525  ALKSS  539
             L+++
Sbjct  250  KLQTT  254



>ref|XP_007143813.1| hypothetical protein PHAVU_007G103700g [Phaseolus vulgaris]
 gb|ESW15807.1| hypothetical protein PHAVU_007G103700g [Phaseolus vulgaris]
Length=345

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 115/191 (60%), Gaps = 10/191 (5%)
 Frame = +3

Query  6    SVGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            + GNDYA++     G I  ++ F  S+ +Q+S+NL+R+H +G+ K+AV  ++P+GC+P +
Sbjct  151  AAGNDYATFLQRKQGSIQNIQAFTTSLIQQMSLNLRRLHSLGINKIAVGLLEPIGCMPLI  210

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T +T +Y  C E  N I++ H+QML Q V +LN +     FV LDLY +F S L      
Sbjct  211  TMAT-SYDKCLEPFNFISQNHSQMLLQTVQELNKELGKPVFVTLDLYNSFLSVLATMQKS  269

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
                 +   PL PCC G      CG VD  GKK YGLC  P+++FFW+  H SQ GW+ V
Sbjct  270  RSEDPTLMNPLQPCCEGVSMEYYCGSVDERGKKKYGLCQKPEVSFFWEGVHLSQNGWYRV  329

Query  519  YSALKSSLPHL  551
            Y+ L SSL +L
Sbjct  330  YTMLYSSLLNL  340



>ref|XP_010490847.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=357

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 116/186 (62%), Gaps = 7/186 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +G+   + +FV  +  Q+ VNLKRIH +GV KVAV ++QPLGCLP  T  
Sbjct  173  GNDYFTHISDNGYDLSIFQFVRRVINQIEVNLKRIHALGVKKVAVPSLQPLGCLPMYTRG  232

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C++  N +T  HN  L++ V +LN +T+ SPF+ LD Y AF + LN K  ++PG
Sbjct  233  F-SYQKCNDVINALTIVHNNALQRVVARLNKETKQSPFIYLDYYKAFLAVLNNK-GENPG  290

Query  363  KSSFPYPLAPCCLGN--CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
             ++F  P  PCC G   CG +D +G K Y LC+D   AFFWD  HP+Q+GW AVY  L +
Sbjct  291  ITNFKIPYEPCCGGKGYCGTLDENGGKNYTLCEDRSSAFFWDEFHPTQEGWKAVYWVLTN  350

Query  537  SLPHLF  554
             L  L 
Sbjct  351  DLKALL  356



>gb|AAF04430.1|AC010927_23 unknown protein [Arabidopsis thaliana]
Length=270

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++      + E   F++ + +Q++VN  RIH++GV K+ + +MQPLGCLP++T  
Sbjct  83   GNDYATFLALKRPLTELPAFMKQVVDQIAVNAMRIHKLGVNKIVIPSMQPLGCLPSITV-  141

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N  T  HN +L + + +LN++T+ S FV+LD Y AF +    K  + PG
Sbjct  142  FNSFQRCNATDNASTNLHNYLLHKAIARLNNETKPSTFVVLDHYNAFLTVFKNKGPE-PG  200

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HPS++GW +VYS 
Sbjct  201  VSRFGNPLKPCCVGVNSSYDCSNVDEKGEKKYIICEDPKAAFFWDIFHPSEEGWRSVYSV  260

Query  528  LKSSLPHLF  554
            L   L  ++
Sbjct  261  LHKHLKAIW  269



>ref|XP_006436632.1| hypothetical protein CICLE_v10033495mg [Citrus clementina]
 gb|ESR49872.1| hypothetical protein CICLE_v10033495mg [Citrus clementina]
Length=160

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = +3

Query  90   VNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRV-DK  266
            +NLK I ++GVPK+AVT+M+P+GCLP ++ +  +Y NC E+ N+ ++FHNQ+L+Q +   
Sbjct  1    MNLKLILDLGVPKIAVTSMEPMGCLPQLS-AVSSYENCSESLNSASKFHNQLLEQEILQN  59

Query  267  LNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN-----CGEVDVSG  431
             N++++      LDLY AF SAL +K + H G       L PCC G      CG VD SG
Sbjct  60   FNNESKRPVIFTLDLYGAFMSAL-MKKENHSGNVKLKTSLQPCCAGVSKDYLCGNVDKSG  118

Query  432  KKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
            KK Y +C++PK++FFWD  HPSQ GW AV+S L+SSL
Sbjct  119  KKRYIVCENPKLSFFWDNIHPSQNGWHAVFSELQSSL  155



>gb|KHM99131.1| GDSL esterase/lipase [Glycine soja]
Length=359

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 16/186 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G I G   F+ S+  Q + NL RI  +GV K+ V  +QPLGCLP+ T +
Sbjct  172  GNDYNFYLATNGSIEGFPAFIASVVNQTATNLLRIKSLGVRKIVVGGLQPLGCLPSST-A  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT--EGSPFVILDLYAAFTSALNIKHDQH  356
            T ++  C+  +N++   HN +L Q V KLN QT  + S F++LDL+  FTS LN     H
Sbjct  231  TSSFQQCNSTSNDLVVLHNNLLNQAVTKLNQQTNKDNSTFIVLDLFDTFTSVLN-----H  285

Query  357  PGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            P  ++   PL PCC+G      CG+VD +  K Y +CD PK AFFWD  HP+Q GW AVY
Sbjct  286  PSTNNIKDPLKPCCVGLSSQDFCGKVDENNVKQYKVCDSPKSAFFWDNLHPTQAGWEAVY  345

Query  522  SALKSS  539
              L+ +
Sbjct  346  KKLQKT  351



>ref|NP_001242541.1| uncharacterized protein LOC100800932 precursor [Glycine max]
 gb|ACU20402.1| unknown [Glycine max]
Length=359

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 16/186 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G I G   F+ S+  Q + NL RI  +GV K+ V  +QPLGCLP+ T +
Sbjct  172  GNDYNFYLATNGSIEGFPAFIASVVNQTATNLLRIKSLGVRKIVVGGLQPLGCLPSST-A  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT--EGSPFVILDLYAAFTSALNIKHDQH  356
            T ++  C+  +N++   HN +L Q V KLN QT  + S F++LDL+  FTS LN     H
Sbjct  231  TSSFQQCNSTSNDLVVLHNNLLNQAVTKLNQQTNKDNSTFIVLDLFDTFTSVLN-----H  285

Query  357  PGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            P  ++   PL PCC+G      CG+VD +  K Y +CD PK AFFWD  HP+Q GW AVY
Sbjct  286  PSTNNIKDPLKPCCVGLSSQDFCGKVDENNVKQYKVCDSPKSAFFWDNLHPTQAGWEAVY  345

Query  522  SALKSS  539
              L+ +
Sbjct  346  KKLQKT  351



>ref|XP_002882645.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH58904.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=354

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 118/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYAS+      + E   F++ + +Q++VN  RIH++GV K+ + +MQPLGCLP++T  
Sbjct  167  GNDYASFLALKRPLTELPAFMKQVVDQIAVNAMRIHKLGVNKILIPSMQPLGCLPSITVF  226

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   N  T+ HN +L + V ++N++T+ S FV+LD Y AF +    K  + PG
Sbjct  227  T-SFQRCNATDNASTKLHNYLLHKAVARINNETKPSTFVVLDHYNAFLTVFKNKGPE-PG  284

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HP+++GW +VYS 
Sbjct  285  VMRFGNPLKPCCVGVNSNFDCSNVDEKGEKKYTICEDPKAAFFWDIFHPTEEGWRSVYSV  344

Query  528  LKSSL  542
            L  +L
Sbjct  345  LHKTL  349



>ref|XP_003535508.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=340

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 115/191 (60%), Gaps = 10/191 (5%)
 Frame = +3

Query  6    SVGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            + GNDYA++    HG I  M  F   +  Q+S+NL+RIH +G+ K+AV  ++P+GC+P +
Sbjct  151  AAGNDYATFLLRQHGSIQDMPVFTTILIRQMSLNLRRIHSLGINKIAVGLLEPIGCMPLL  210

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T ++ +Y  C E  N I++ H+QML Q V +LN +     FV LDLY +F S ++    +
Sbjct  211  TVAS-SYEKCLEPFNLISQNHSQMLLQIVQELNKELGKPVFVTLDLYNSFLSVISTMQKR  269

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            H    +   PL PCC G     +CG VD  G+K Y LC  P+++FFW+  H SQ GW+AV
Sbjct  270  HSENPTLMNPLQPCCEGVSMEYSCGSVDEKGEKKYCLCKKPELSFFWEGVHLSQNGWYAV  329

Query  519  YSALKSSLPHL  551
            Y  L SSL  L
Sbjct  330  YMMLYSSLSKL  340



>gb|KHN37835.1| GDSL esterase/lipase, partial [Glycine soja]
Length=322

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 115/191 (60%), Gaps = 10/191 (5%)
 Frame = +3

Query  6    SVGNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            + GNDYA++    HG I  M  F   +  Q+S+NL+RIH +G+ K+AV  ++P+GC+P +
Sbjct  133  AAGNDYATFLLRQHGSIQDMPVFTTILIRQMSLNLRRIHSLGINKIAVGLLEPIGCMPLL  192

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T ++ +Y  C E  N I++ H+QML Q V +LN +     FV LDLY +F S ++    +
Sbjct  193  TVAS-SYEKCLEPFNLISQNHSQMLLQIVQELNKELGKPVFVTLDLYNSFLSVISTMQKR  251

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            H    +   PL PCC G     +CG VD  G+K Y LC  P+++FFW+  H SQ GW+AV
Sbjct  252  HSENPTLMNPLQPCCEGVSMEYSCGSVDEKGEKKYCLCKKPELSFFWEGVHLSQNGWYAV  311

Query  519  YSALKSSLPHL  551
            Y  L SSL  L
Sbjct  312  YMMLYSSLSKL  322



>gb|KCW65213.1| hypothetical protein EUGRSUZ_G02700 [Eucalyptus grandis]
Length=334

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 118/199 (59%), Gaps = 20/199 (10%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYA++   +G+   +  F+ S+ +QL  NLKRI  +GV K+AVTA++PLGCLP +T 
Sbjct  139  AGNDYAAFTMKNGNQEELPSFITSVIDQLVYNLKRIKGLGVGKIAVTALEPLGCLPQIT-  197

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---------TEGSPFVILDLYAAFTSA  332
            +  ++ NC  N N+ITR HN  L++ + +L            +  S  VILDL++AF SA
Sbjct  198  AVSSFKNCSSNWNSITRLHNHQLRRSLQELKKNESMMGPSSPSSSSALVILDLHSAFVSA  257

Query  333  LNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPS  497
            LN+   Q    S    PL PCC+G     +CG +   G K Y LC+ P+ +FFWD  HPS
Sbjct  258  LNVLRHQSGNLSE--NPLKPCCVGVTEGYSCGNIGDKGVKNYALCNHPETSFFWDNIHPS  315

Query  498  QQGWFAVYSALKSSLPHLF  554
            Q GW AVYS L SSL  L 
Sbjct  316  QNGWHAVYSFLHSSLHRLL  334



>ref|XP_002524979.1| Anter-specific proline-rich protein APG, putative [Ricinus communis]
 gb|EEF37386.1| Anter-specific proline-rich protein APG, putative [Ricinus communis]
Length=241

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 113/192 (59%), Gaps = 10/192 (5%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY+ Y   +G +  M  F   +  QL+ NLK+IHE+GV K+AV  + P GC P  
Sbjct  50   STSGNDYSFYLRQNGTLQDMSNFTRRLINQLAKNLKQIHELGVQKIAVAGIGPAGCFPQQ  109

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S+  Y  C+EN N+ + FHN +LK+ + KLN +   S F+ LD Y+ F SA+N +H  
Sbjct  110  TASSS-YKICNENFNSASEFHNDVLKRALRKLNYENRKSVFIFLDFYSTFKSAIN-QHKH  167

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G      PL PCC G      CG+V  +G++ Y +C  P+++FFWD  HPSQ GW +V
Sbjct  168  SSGNMDCKNPLRPCCDGVTSQNGCGQVHENGERKYVVCKHPELSFFWDSVHPSQNGWHSV  227

Query  519  YSALKSSLPHLF  554
            Y +L  +L  L 
Sbjct  228  YLSLHPTLRELL  239



>ref|XP_010271750.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Nelumbo nucifera]
Length=365

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 109/189 (58%), Gaps = 11/189 (6%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA Y       +E   F+  +  Q ++N+KRIH MGV KVAV A++PLGCLP     
Sbjct  180  GNDYA-YSARNDTQQELLAFIAKVVNQTALNIKRIHGMGVKKVAVIAIEPLGCLPRFAVL  238

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            + +Y  C+   N     HN +LK  V KLN +T+   F++LDLY AF S    K +    
Sbjct  239  S-SYKKCNITGNAAANLHNHLLKLAVRKLNKETKSPTFIVLDLYRAFMSVFK-KRNSGNL  296

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
            K SF  PL PCC+G     +CG +D SG K Y +C +PK AFFWD  HP+Q GW AV   
Sbjct  297  KFSFHNPLKPCCVGIGTSNSCGSIDQSGAKKYKVCKNPKAAFFWDEVHPTQAGWQAVSLV  356

Query  528  LKSSLPHLF  554
            LKSSL  L 
Sbjct  357  LKSSLNQLL  365



>ref|XP_003591765.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES62016.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=350

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +  I  ++ F  S+  QLS+N++RIH +G+ KVA+  ++P+GCLP +T  
Sbjct  160  GNDYTAFLVNNRSITEIKSFTTSLINQLSINVQRIHNLGINKVAIGLLEPIGCLPEITLV  219

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG-SPFVILDLYAAFTSALNIKHDQHP  359
            T  + +C +  N ++  HN++L Q V +LN Q  G S +V LDLY AF S +     +H 
Sbjct  220  TF-HLSCVDLLNLVSEDHNKLLLQTVLQLNQQQVGKSVYVTLDLYNAFLSTIKTMQKKHD  278

Query  360  GKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
              S+   PL  CC G+     CG+VD +G+K Y LC+ PK++FFWD  HPSQ GW AVY+
Sbjct  279  ENSTLMNPLKSCCEGDGLTNTCGKVDDNGEKKYSLCEKPKLSFFWDNVHPSQNGWHAVYT  338

Query  525  ALKSSLPHL  551
             L+SSL  L
Sbjct  339  LLQSSLHQL  347



>ref|XP_006603280.1| PREDICTED: uncharacterized protein LOC100804858 [Glycine max]
Length=379

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = +3

Query  60   FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHN  239
            F+ES+ +Q+SVNLKR+H +G+ KVAV  +QP+GC P +        NC    N I++ HN
Sbjct  209  FMESLVKQMSVNLKRLHSLGIKKVAVGLLQPIGCFPGLNV-IFCRTNCIGLLNVISKDHN  267

Query  240  QMLKQRVDKLNDQTE-GSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN---  407
            +ML + V +LN +    S F+ LDLY +F SA+     +   KS+   PL PCC GN   
Sbjct  268  KMLLKAVQELNKEAAVKSVFITLDLYNSFLSAIETMQKKRAEKSTLMNPLQPCCEGNKLE  327

Query  408  --CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSLPHLF  554
              CG VD  G K Y LC++PK++FFWD  HPSQ GWFAVY+ L+S+L  L 
Sbjct  328  DSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAVYTILQSTLGQLI  378



>ref|XP_010067146.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Eucalyptus grandis]
Length=357

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 118/199 (59%), Gaps = 20/199 (10%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDYA++   +G+   +  F+ S+ +QL  NLKRI  +GV K+AVTA++PLGCLP +T 
Sbjct  162  AGNDYAAFTMKNGNQEELPSFITSVIDQLVYNLKRIKGLGVGKIAVTALEPLGCLPQIT-  220

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---------TEGSPFVILDLYAAFTSA  332
            +  ++ NC  N N+ITR HN  L++ + +L            +  S  VILDL++AF SA
Sbjct  221  AVSSFKNCSSNWNSITRLHNHQLRRSLQELKKNESMMGPSSPSSSSALVILDLHSAFVSA  280

Query  333  LNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPS  497
            LN+   Q    S    PL PCC+G     +CG +   G K Y LC+ P+ +FFWD  HPS
Sbjct  281  LNVLRHQSGNLSE--NPLKPCCVGVTEGYSCGNIGDKGVKNYALCNHPETSFFWDNIHPS  338

Query  498  QQGWFAVYSALKSSLPHLF  554
            Q GW AVYS L SSL  L 
Sbjct  339  QNGWHAVYSFLHSSLHRLL  357



>ref|XP_006299747.1| hypothetical protein CARUB_v10015942mg [Capsella rubella]
 gb|EOA32645.1| hypothetical protein CARUB_v10015942mg [Capsella rubella]
Length=352

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 117/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++      + E   F++ + +Q+ VN +RI+++GV K+A+T+MQPLGCLP+VT  
Sbjct  165  GNDYGTFIALQRPLTELPAFIKQVVDQIEVNARRIYKLGVKKIAITSMQPLGCLPSVTVF  224

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T ++  C+   N  T  HN  L + + +LN +T+ S FV++D Y AF +    K  + PG
Sbjct  225  T-SFQRCNATDNISTNLHNFFLHKAISRLNSETKPSTFVVIDHYNAFLTVFKNKGSE-PG  282

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F  PL PCC+G     +C  VD   +K Y +C+DPK AFFWD+ HPS++GW +VYS 
Sbjct  283  AMRFGNPLEPCCVGIDSKHDCSNVDEKSEKKYKVCEDPKGAFFWDIFHPSEEGWRSVYSV  342

Query  528  LKSSLPHLF  554
            L  SL  ++
Sbjct  343  LHKSLKDVW  351



>gb|AAO41990.1| putative lipase acylhydrolase [Arabidopsis thaliana]
Length=354

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++      + E   F++ + +Q++VN  RIH++GV K+ + +MQPLGCLP++T  
Sbjct  167  GNDYATFLALKRPLTELPAFMKQVVDQIAVNAMRIHKLGVNKIVIPSMQPLGCLPSITV-  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N  T  HN +L + + +LN++T+ S FV+LD Y AF +    K  + PG
Sbjct  226  FNSFQRCNATDNASTNLHNYLLHKAIARLNNETKQSTFVVLDHYNAFLTVFKNKGPE-PG  284

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HPS++GW +VYS 
Sbjct  285  VSRFGNPLKPCCVGVNSSYDCSNVDEKGEKKYIICEDPKAAFFWDIFHPSEEGWRSVYSV  344

Query  528  LKSSLPHLF  554
            L   L  ++
Sbjct  345  LHKHLKAIW  353



>emb|CDY44376.1| BnaC02g03010D [Brassica napus]
Length=349

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 108/181 (60%), Gaps = 8/181 (4%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY++Y   +  I  +  F++ + +Q  +NL+R+H +G+ K+A+ ++ PLGCLP  T 
Sbjct  167  AGNDYSNYLALNRSIAALPIFIKQVVDQTELNLRRLHALGLEKIAIPSLPPLGCLPLYTS  226

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
              G    C++  N +  +HN +L+Q V  LN++   S F ++D Y AF + L  K  + P
Sbjct  227  PQG----CNDTFNALVNYHNSLLEQVVANLNNEARQSTFAVIDFYNAFMAILTNK-GESP  281

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
            G   F  PL PCC G+CG VD  G   Y LCDDP+ AFFWD  HP+QQGW  +YS    +
Sbjct  282  GSKRFETPLKPCCEGSCGNVDEKGANKYTLCDDPESAFFWDGLHPTQQGWKFIYSVFGKA  341

Query  540  L  542
            L
Sbjct  342  L  342



>ref|NP_187604.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SF94.1|GDL50_ARATH RecName: Full=GDSL esterase/lipase At3g09930; AltName: Full=Extracellular 
lipase At3g09930; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF23243.1|AC015985_1 putative lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AEE74837.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=354

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEE---FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYA++      + E   F++ + +Q++VN  RIH++GV K+ + +MQPLGCLP++T  
Sbjct  167  GNDYATFLALKRPLTELPAFMKQVVDQIAVNAMRIHKLGVNKIVIPSMQPLGCLPSITV-  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N  T  HN +L + + +LN++T+ S FV+LD Y AF +    K  + PG
Sbjct  226  FNSFQRCNATDNASTNLHNYLLHKAIARLNNETKPSTFVVLDHYNAFLTVFKNKGPE-PG  284

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             S F  PL PCC+G     +C  VD  G+K Y +C+DPK AFFWD+ HPS++GW +VYS 
Sbjct  285  VSRFGNPLKPCCVGVNSSYDCSNVDEKGEKKYIICEDPKAAFFWDIFHPSEEGWRSVYSV  344

Query  528  LKSSLPHLF  554
            L   L  ++
Sbjct  345  LHKHLKAIW  353



>ref|XP_006582697.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=197

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 105/164 (64%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA---VTFSTGNYPNCDENTNNITR  230
            F+ES+ +Q+SVNLKRIH +G+ KVAV  +QP+GCLP    ++F T    NC    N I++
Sbjct  37   FMESLVKQMSVNLKRIHSLGIKKVAVGLLQPIGCLPVLNVISFRT----NCIGLLNVISK  92

Query  231  FHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN  407
             HN+ML + V +LN +  + S F+ LDLY +F SA+     +   KS+   PL P C GN
Sbjct  93   DHNKMLLKAVQELNKEAADKSVFMTLDLYNSFLSAIETMQKKRAEKSTLMNPLQPRCEGN  152

Query  408  -----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
                 CG VD  G K Y LC++PK++FFWD  HPSQ GWFAVY+
Sbjct  153  NLEDSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAVYT  196



>ref|XP_004143380.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
Length=334

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 119/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G   G++ FV S+  Q+SVNLKRI+++GV K+ V  + P+GC P+ T  
Sbjct  147  GNDYSFYLATNGSPEGVKPFVISVVNQISVNLKRIYKLGVKKIVVVGLGPVGCYPSPT--  204

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE--GSP-FVILDLYAAFTSALNIKHDQ  353
              ++  C+E  N++  FHN +LKQ V+KLN +T+  GSP F IL++Y    S +  K + 
Sbjct  205  APSFKKCNETMNSLAVFHNTLLKQAVEKLNSETKLGGSPNFFILNMYDTVLSIIKNKGNP  264

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G ++F  PL PCC G     +CG VD  G K Y LC  P +A FWD  HP+Q+GWFA 
Sbjct  265  KVG-ATFQTPLKPCCFGVSSNFSCGSVDEHGNKMYTLCKRPDLALFWDTVHPTQKGWFAT  323

Query  519  YSALKSSLPHL  551
            +++L S+L  +
Sbjct  324  FNSLISTLKRI  334



>ref|XP_006606770.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=327

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 106/171 (62%), Gaps = 7/171 (4%)
 Frame = +3

Query  60   FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHN  239
            F+ES+ +Q+SVNLKRIH +G+ KVAV  +QP+GC P +        NC    N I++ HN
Sbjct  157  FMESLVKQMSVNLKRIHSLGIKKVAVGLLQPIGCFPVLNVIFCRT-NCIGLLNVISKDHN  215

Query  240  QMLKQRVDKLNDQTE-GSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN---  407
            +ML + V + N +    S F+ LDLY +F SA+     +   KS+   PL PCC GN   
Sbjct  216  KMLLKAVQEPNKEAAVKSVFITLDLYNSFLSAIETMQKKRAEKSTLMNPLQPCCEGNKLE  275

Query  408  --CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSLPHLF  554
              CG VD  G K Y LC++PK++FFWD  HPSQ GWFAVY+ L+S+L  L 
Sbjct  276  DSCGSVDDEGSKKYSLCENPKLSFFWDTLHPSQNGWFAVYTILQSTLGQLI  326



>ref|XP_010452239.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=352

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 107/177 (60%), Gaps = 6/177 (3%)
 Frame = +3

Query  12   GNDYASY---HGHIH-GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY +Y   HG +  G+  F++ +  Q  VNL+RIH +GV KVA+  +QPLGCLP    
Sbjct  171  GNDYLTYVAEHGGVDLGIFIFMKQVIHQTEVNLRRIHALGVKKVAIPLLQPLGCLPLFA-  229

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
               +Y  C++  N     HN  LK+ V  LN +T+ S F+++D Y AF +  N K ++ P
Sbjct  230  KASSYQKCNDIINAFVIIHNNELKKVVANLNKETKQSTFMVIDYYNAFLTVFNNKGEK-P  288

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            G   F  P   CC G CG VD +G+K Y LCDDP  +FFWD  HP+Q+GW +VYS L
Sbjct  289  GSQKFETPYKACCGGLCGSVDKNGQKNYTLCDDPMSSFFWDGLHPTQEGWKSVYSVL  345



>ref|XP_004156320.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
 gb|KGN48252.1| hypothetical protein Csa_6G452040 [Cucumis sativus]
Length=351

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 119/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G   G++ FV S+  Q+SVNLKRI+++GV K+ V  + P+GC P+ T  
Sbjct  164  GNDYSFYLATNGSPEGVKPFVISVVNQISVNLKRIYKLGVKKIVVVGLGPVGCYPSPT--  221

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE--GSP-FVILDLYAAFTSALNIKHDQ  353
              ++  C+E  N++  FHN +LKQ V+KLN +T+  GSP F IL++Y    S +  K + 
Sbjct  222  APSFKKCNETMNSLAVFHNTLLKQAVEKLNSETKLGGSPNFFILNMYDTVLSIIKNKGNP  281

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G ++F  PL PCC G     +CG VD  G K Y LC  P +A FWD  HP+Q+GWFA 
Sbjct  282  KVG-ATFQTPLKPCCFGVSSNFSCGSVDEHGNKMYTLCKRPDLALFWDTVHPTQKGWFAT  340

Query  519  YSALKSSLPHL  551
            +++L S+L  +
Sbjct  341  FNSLISTLKRI  351



>ref|XP_008462556.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Cucumis 
melo]
Length=350

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 118/194 (61%), Gaps = 18/194 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G + G + F+ S+ +Q+  NLKRIH +GV KV VT + PLGCLP  T +
Sbjct  161  GNDYSFYLARNGSLQGFKGFMISVVDQIIWNLKRIHSLGVKKVIVTGLAPLGCLPHFT-N  219

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP------FVILDLYAAFTSALNIK  344
            + ++  C+ + N++  FHN +L Q + KLN+    +       F ILD+YA+F S +   
Sbjct  220  SSSFTQCNSDINSLVTFHNLLLNQSISKLNNNNNETTTKNNTNFFILDMYASFMSII-FG  278

Query  345  HDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGW  509
            + +  GK   P  L PCC G     +CG VD  G K + LC+DPK AFFWD  HP+QQGW
Sbjct  279  NPKQGGKK--PLLLKPCCFGVSDAFSCGSVDEKGNKKFSLCEDPKSAFFWDSLHPTQQGW  336

Query  510  FAVYSALKSSLPHL  551
            FA +SAL+  L +L
Sbjct  337  FAAFSALQFILKNL  350



>ref|XP_004143381.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
 ref|XP_004156319.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g03610-like 
[Cucumis sativus]
 gb|KGN48253.1| hypothetical protein Csa_6G452050 [Cucumis sativus]
Length=351

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 117/193 (61%), Gaps = 17/193 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G + G + F+ S+ +Q+  NLKR+H +GV KV VT + PLGCLP  T +
Sbjct  163  GNDYSFYLARNGSLQGFKGFMISVVDQIMWNLKRVHSLGVKKVVVTGLAPLGCLPHFT-N  221

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP-----FVILDLYAAFTSALNIKH  347
            + ++  C+ + N++  FHN +L Q + KLN+  E +      F ILD+YA+F S +    
Sbjct  222  SSSFTQCNSDINSLVTFHNLLLNQSISKLNNNNETTTKNNTNFFILDMYASFMSIIFGNP  281

Query  348  DQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWF  512
             Q   K   P  L PCC G     +CG VD  G K + LC+DPK AFFWD  HP+QQGWF
Sbjct  282  KQGGEK---PLLLKPCCFGVSDGFSCGSVDEKGNKKFSLCEDPKSAFFWDSFHPTQQGWF  338

Query  513  AVYSALKSSLPHL  551
            A +S L+S L +L
Sbjct  339  AAFSTLQSILKNL  351



>ref|XP_003591764.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES62015.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=352

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 118/196 (60%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLP--  167
            T+ GNDY ++   +  I  ++ F  ++  QLS+N++RIH +G+ KVA+  ++PLGCLP  
Sbjct  160  TAAGNDYEAFIVNNKSIIEIKSFTTTLINQLSINVQRIHNLGINKVAIALLEPLGCLPRI  219

Query  168  -AVTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIK  344
             AVTF    + +C +  N ++  HN++L Q V +LN Q     +V LDLY AF S +   
Sbjct  220  NAVTF----HLSCVDLLNLVSENHNKLLLQTVLQLNQQVGKPVYVTLDLYNAFLSIIKTL  275

Query  345  HDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGW  509
              +    S+   PL  CC+G     NCG VD  G+K Y +C+ P+++FFWD  HPSQ GW
Sbjct  276  QKKRDENSTLMNPLKACCVGDGLKNNCGSVDDKGEKKYSVCEKPELSFFWDGVHPSQNGW  335

Query  510  FAVYSALKSSLPHLFH  557
             AVY+ L+SSL  L H
Sbjct  336  QAVYTLLQSSLGQLNH  351



>ref|XP_010490848.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=347

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 5/176 (3%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   HG   G+  F++ +  Q  VNL+RIH +GV KVA+  +QPLGCLP     
Sbjct  167  GNDYLTYVSEHGVDLGIFIFMKRVIHQTEVNLRRIHALGVKKVAIPLLQPLGCLPLFA-K  225

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C +  N     HN  LK+ V  LN +T+ S F+++D Y AF +    K ++ PG
Sbjct  226  DSSYQKCSDIINAFVIIHNNELKKVVANLNKETKQSTFMVIDYYNAFLTVFKNKGEK-PG  284

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
               F  P   CC G CG VD +G+K Y LCDDP  +FFWD  HP+Q+GW +VYS L
Sbjct  285  SQRFETPYKACCGGLCGSVDKNGQKNYTLCDDPTSSFFWDGLHPTQEGWKSVYSVL  340



>gb|EPS58551.1| hypothetical protein M569_16262, partial [Genlisea aurea]
Length=259

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 112/192 (58%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            T  GNDY+ Y    G +  ++ F+ S+  QL VNLKRI  +G  K+ V  +QPLGCLP  
Sbjct  74   TLSGNDYSFYLANGGSVSEIKNFIPSVVNQLVVNLKRIQRLGARKIVVGGLQPLGCLPRA  133

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T + G Y  C E  N    +HN +L Q V++LN   +G  F++LDLY AF +A++     
Sbjct  134  TIANG-YKQCIEIDNAAVGYHNLLLSQAVEELNSAAKGPRFLLLDLYQAFQTAID-----  187

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            + G+  F  PL PCC+G     +CG V  +G + Y +C+DP  +FFWD  HP++ GW  V
Sbjct  188  NRGEVKFGSPLTPCCIGIGSGNSCGTVAENGTELYAVCEDPSASFFWDNYHPTESGWKTV  247

Query  519  YSALKSSLPHLF  554
            +  +K+S+   F
Sbjct  248  FGLVKNSVHQFF  259



>gb|AFK49232.1| unknown [Medicago truncatula]
Length=355

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 17/185 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G + G+  F+ES+  Q   N+ RI  +GV KV V  +QP+GCLP++T S
Sbjct  167  GNDYTRYTVTNGSVEGLPSFIESLINQTITNIIRIKGLGVKKVIVNNLQPIGCLPSMTTS  226

Query  183  TGNYPNCDENTNNITRF-HNQMLKQRVDKLNDQTE--GSPFVILDLYAAFTSALNIKHDQ  353
            T ++  C+E +NN+  F HN +L Q V KLN QT+    PF+IL+LY +F S LN     
Sbjct  227  T-SFKQCNETSNNLLAFYHNILLTQAVTKLNQQTKHHSKPFLILNLYDSFMSVLN-----  280

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            HP   +    L PCC+G      CG VD +  K Y +C+ PK AFFWD+ HP++ GW AV
Sbjct  281  HPSTHNIRDELRPCCVGVSSKYFCGSVDENNVKKYLVCEKPKSAFFWDLVHPTEAGWHAV  340

Query  519  YSALK  533
            Y+ L+
Sbjct  341  YNKLR  345



>ref|XP_003625784.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82002.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=355

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 17/185 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G + G+  F+ES+  Q   N+ RI  +GV KV V  +QP+GCLP++T S
Sbjct  167  GNDYTRYTVTNGSVEGLPSFIESLINQTITNIIRIKGLGVKKVIVNNLQPIGCLPSMTTS  226

Query  183  TGNYPNCDENTNNITRF-HNQMLKQRVDKLNDQTE--GSPFVILDLYAAFTSALNIKHDQ  353
            T ++  C+E +NN+  F HN +L Q V KLN QT+    PF+IL+LY +F S LN     
Sbjct  227  T-SFKQCNETSNNLLAFYHNILLTQAVTKLNQQTKHHSKPFLILNLYDSFMSVLN-----  280

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            HP   +    L PCC+G      CG VD +  K Y +C+ PK AFFWD+ HP++ GW AV
Sbjct  281  HPSTHNIRDELRPCCVGVSSKYFCGSVDENNVKKYLVCEKPKSAFFWDLVHPTEAGWHAV  340

Query  519  YSALK  533
            Y+ L+
Sbjct  341  YNKLR  345



>ref|XP_010558997.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g36325-like 
[Tarenaya hassleriana]
Length=359

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 112/191 (59%), Gaps = 16/191 (8%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY +Y    +    G+E F   I  Q+ +++  +  +GV KVA+ AMQPLGCLP  + 
Sbjct  174  GNDYFTYLTLNNVTQQGIETFTRRIINQMILDITTVQNLGVRKVAIAAMQPLGCLPVAST  233

Query  180  STGN--YPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            +TG   +  C+E  N I +FHN +L Q + KLN +   + F++LD+Y AF + L  K+  
Sbjct  234  ATGKSGFRWCNETYNVIAKFHNTLLSQALIKLNQEKNDTVFIMLDIYKAFWTVL--KNKG  291

Query  354  HPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              G SSFP PL  CC+       CGEVD  G + + LC DPK  FFWD  HPSQQGW ++
Sbjct  292  VRGISSFPNPLERCCVTTKKGYKCGEVDKRGVRTFELCKDPKSFFFWDDLHPSQQGWRSI  351

Query  519  YSALKSSLPHL  551
            YS L   LP L
Sbjct  352  YSVL---LPDL  359



>ref|XP_010490846.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=357

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 113/186 (61%), Gaps = 7/186 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +G+   + EF+  +  Q+ VNL+RIH +GV K+AV ++QP+GCLP  T  
Sbjct  168  GNDYFTHITENGYGLSIFEFMRRVINQIEVNLRRIHALGVKKIAVPSLQPIGCLPMYTKG  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C++  N +T  HN  L++ V +LN +TE SPF+I+D Y  F   +N  + + PG
Sbjct  228  L-SYRRCNDTINALTIEHNNALQRVVTRLNRETEQSPFIIIDYYKGFFDVIN-NNGEIPG  285

Query  363  KSSFPYPLAPCC--LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
               F     PCC   G CG V  +G+K Y LCDDP   F+WD  HP+Q+GW AVYS L +
Sbjct  286  FPKFKSLYVPCCGITGYCGTVHENGEKNYTLCDDPSSNFYWDEFHPTQEGWKAVYSVLTN  345

Query  537  SLPHLF  554
            +L  L 
Sbjct  346  NLKALL  351



>ref|XP_003591763.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES62014.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=351

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 111/192 (58%), Gaps = 10/192 (5%)
 Frame = +3

Query  3    TSVGNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            ++ GNDY  +         G+ +F  S+ +QLS+NLKRI  +G+ K+A+  ++P+GCLP 
Sbjct  156  SAAGNDYLKFFVKNGRSTKGVSKFTASLVKQLSLNLKRIQSLGINKIAIVLLEPIGCLPI  215

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             T +T +Y  C+   N +   HN +L Q V++LN +   S FV LDL+ +F S +     
Sbjct  216  ATENT-SYEKCNGTLNTVAMNHNHLLLQAVEELNKEIGKSVFVTLDLFNSFLSTIASMQR  274

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
             H   S+   PL PCC+G      CG VD  G K Y +CD P ++F+W+  HPSQ GW A
Sbjct  275  NHEANSTLMNPLQPCCVGVSSSYYCGSVDEKGAKKYSVCDKPGLSFYWNNFHPSQNGWHA  334

Query  516  VYSALKSSLPHL  551
            VY  ++SSL  +
Sbjct  335  VYKRVQSSLRKI  346



>ref|XP_010683771.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 15/194 (8%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY++Y    G I G + F+  +  QL V+++RI+ +GV K++VTA+QPLGCLP    
Sbjct  173  VGNDYSAYLSRGGTIQGFQTFIPQVVNQLVVDIQRIYNLGVKKISVTALQPLGCLPRNLV  232

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---GSPFVILDLYAAFTSALNIKHD  350
            +      C++  N    FHN +L+Q + +LN+QT    GSP VI+DLY AF S    + +
Sbjct  233  N----DQCNDTFNQAVVFHNLLLQQAITRLNNQTTNDHGSPIVIIDLYTAFFSIFQGREN  288

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
                 S F   +  CC G      CG VD  G K Y +C +P+  FFWD  HP+Q GW A
Sbjct  289  NQGNNSKFDNTMKSCCTGISENYTCGSVDEKGNKMYKVCQNPESFFFWDEVHPTQAGWEA  348

Query  516  VYSALKSSLPHLFH  557
            +  AL+++L  L H
Sbjct  349  LSLALQANLEELQH  362



>ref|XP_010038977.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Eucalyptus grandis]
 gb|KCW48343.1| hypothetical protein EUGRSUZ_K02059 [Eucalyptus grandis]
Length=366

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 110/189 (58%), Gaps = 16/189 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   HG   G+ +F++ +  QL VN+KR+H +GV KVAVT++  LGC+P +T  
Sbjct  182  GNDYYTYLAKHGVSFGLLDFIDKVVNQLVVNMKRVHSLGVRKVAVTSLPALGCVPQITSG  241

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +Y +C++  N +   HN  L+  VDKLN++T    F+++DLY  F   +         
Sbjct  242  T-SYQSCNDTVNALVMLHNLNLQVAVDKLNNETSPFTFIMIDLYKPFKWVIE-------N  293

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++F  P  PCC+G      CG VD  G K Y +C+DP   FFWD  HP+Q GW AVY  
Sbjct  294  TTTFRNPFKPCCMGVSSEYLCGNVDADGTKKYTVCEDPSTHFFWDTVHPTQAGWGAVYWN  353

Query  528  LKSSLPHLF  554
            L  SL H F
Sbjct  354  LLPSLIHNF  362



>gb|KHN02242.1| GDSL esterase/lipase [Glycine soja]
Length=275

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 111/195 (57%), Gaps = 19/195 (10%)
 Frame = +3

Query  12   GNDYASYH--GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY  Y       G+  FV S+  Q   NL RI  +GV K+ V A+QPLGCLP  T +T
Sbjct  87   GNDYGRYMLTNGSQGLPSFVASVVNQTRSNLIRIKGLGVKKIVVGALQPLGCLPQET-AT  145

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLND----QTEGSPFVILDLYAAFTSALNIKHDQ  353
             ++  C+  +N +   HN +L Q V KLN     +   S FVIL+L+ +F S LN     
Sbjct  146  SSFQRCNATSNALVLLHNSLLNQAVTKLNQLETTKDRYSTFVILNLFDSFMSVLN-----  200

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            HP   +    L PCC+G     +CG VD +  K Y +CDDPK AFFWD+ HP+Q GW AV
Sbjct  201  HPSTHNIRNKLTPCCVGVSSGYSCGSVDKNNVKKYRVCDDPKSAFFWDLVHPTQAGWHAV  260

Query  519  YSALKS--SLPHLFH  557
            Y+ L++  +L H+ +
Sbjct  261  YNKLRTMNALQHILY  275



>ref|XP_008462669.1| PREDICTED: GDSL esterase/lipase At5g03610-like, partial [Cucumis 
melo]
Length=352

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 108/201 (54%), Gaps = 25/201 (12%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G   G++ F+ S+  Q+ ++LKRI  +GV K+ VT + PLGCLP  T +
Sbjct  153  GNDYSFYLATNGSAQGLKPFINSVVNQVMIDLKRIKRLGVKKIVVTGLGPLGCLPIFT-A  211

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS----------------PFVILDLY  314
              ++  C++  N+  +FHN +LKQ VDKLN Q                       ILD+Y
Sbjct  212  PFSFKQCNQTINSFVQFHNFLLKQAVDKLNKQITNQQHSYSSSSSSSSSSSSKIFILDVY  271

Query  315  AAFTSALNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFW  479
             AF S +  +     G   F  PL PCC G     NCG VD  G K + LC+DPK AFFW
Sbjct  272  DAFLSLIQGRGSGRVGLLKFKTPLKPCCFGVSSGFNCGSVDEKGNKKFVLCNDPKSAFFW  331

Query  480  DMTHPSQQGWFAVYSALKSSL  542
            D  HP+Q GW   +S+  S L
Sbjct  332  DSVHPTQTGWSLAFSSFTSIL  352



>ref|XP_004143379.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cucumis sativus]
Length=355

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 107/195 (55%), Gaps = 19/195 (10%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G   G++ F+ S+  Q+ V+L+RI  +GV K+ VT + PLGCLP  T +
Sbjct  162  GNDYSFYLATNGSAQGLKPFINSVVNQIMVDLRRIRRLGVKKIVVTGLGPLGCLPIFT-A  220

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS----------PFVILDLYAAFTSA  332
              ++  C++  N+  +FHN +LKQ VDKLN Q                 ILD+Y AF S 
Sbjct  221  PFSFKQCNQTINSFVQFHNFLLKQAVDKLNKQITKQQHYSSSSSSSKIFILDVYDAFLSI  280

Query  333  LNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPS  497
            +  +     G   F  PL PCC G      CG VD  G K + LC+DPK AFFWD  HP+
Sbjct  281  IQGRGSGRVGLLKFKTPLKPCCFGVSSEFECGSVDEQGNKKFVLCNDPKSAFFWDSVHPT  340

Query  498  QQGWFAVYSALKSSL  542
            Q GW   +S+  S L
Sbjct  341  QTGWAHAFSSFTSFL  355



>ref|XP_006286524.1| hypothetical protein CARUB_v10001293mg [Capsella rubella]
 gb|EOA19422.1| hypothetical protein CARUB_v10001293mg [Capsella rubella]
Length=351

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 105/176 (60%), Gaps = 8/176 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   HG   G+ + +  +  Q  VN++RIH +GV KVA+  +QPLGCLP     
Sbjct  174  GNDYLTYVAKHGINIGIIQSMTQVIHQTKVNMRRIHALGVKKVAIPLLQPLGCLPFF---  230

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
                  C+ N N +   HN  L++ V  LN +T+ S F+++D Y AF +A N K  ++PG
Sbjct  231  -AKDQKCNPNINTLVFVHNSALREVVANLNKETKQSAFMVIDYYNAFLTAFNSK-GENPG  288

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
               F  P   CC G CG V  +G+K Y LCD+P  AFFWD  HP+Q+GW +VYSAL
Sbjct  289  SKRFETPYKACCGGLCGSVYKNGQKNYTLCDNPTSAFFWDGLHPTQEGWKSVYSAL  344



>gb|KHN24782.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 110/189 (58%), Gaps = 15/189 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G I G   F+ S+  Q + NL  I  +GV K+ V  +QPLGCLP+ T +
Sbjct  170  GNDYNFYLATNGSIEGFPSFIASVVNQTATNLLHIQRLGVRKIVVGGLQPLGCLPSST-A  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHP  359
              ++  C+   N++   HN++L Q V KLN ++ + S F++LDL+  F S LN     HP
Sbjct  229  LSSFQQCNSTFNDLIGLHNKLLNQAVTKLNQKSKDNSTFIVLDLFDTFMSVLN-----HP  283

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
              ++   PL PCC+G      CG VD    K Y +CD PK AFFWD+ HP+Q GW AVY+
Sbjct  284  STNNIKDPLKPCCVGLSSQDFCGSVDERNVKQYKVCDSPKSAFFWDLLHPTQAGWHAVYN  343

Query  525  ALKSSLPHL  551
             L+++   L
Sbjct  344  KLQTTTSAL  352



>ref|XP_003521452.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
 gb|KHN18752.1| GDSL esterase/lipase [Glycine soja]
Length=350

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 113/193 (59%), Gaps = 17/193 (9%)
 Frame = +3

Query  12   GNDYASYH--GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY  Y       G+  FV S+  Q + NL RI  +GV K+AV A+QPLGCLP  T +T
Sbjct  164  GNDYGRYMLTNGSQGLPSFVASVVNQTANNLIRIKGLGVKKIAVGALQPLGCLPPQT-AT  222

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLNDQT--EGSPFVILDLYAAFTSALNIKHDQHP  359
             ++  C+  +N +   HN +L Q V KLN +   E S FVIL+L+ +F S LN     +P
Sbjct  223  TSFQRCNATSNALVLLHNSLLNQAVTKLNQEITKERSSFVILNLFDSFMSVLN-----NP  277

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
               +    L PCC+G     +CG VD +  K Y +CDDPK AFFWD+ HP+Q GW AVY+
Sbjct  278  STHNIRNKLTPCCVGVSTNYSCGSVDKNNVKKYRVCDDPKSAFFWDLVHPTQAGWHAVYN  337

Query  525  ALKS--SLPHLFH  557
             L++   L H+ +
Sbjct  338  KLRTMNDLQHILY  350



>ref|XP_010511744.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=353

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 106/180 (59%), Gaps = 5/180 (3%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G   G   +++ +  Q  VNL+RIH +GV K+A+  + PLGCLP V+  
Sbjct  169  GNDYITYIAGNGTKPGFVAYMKQVINQTEVNLRRIHALGVKKIAIPLLHPLGCLPVVS-K  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++ +C +  N     HN +L+  V KLN +TE S F+++D Y AF + L  K  + PG
Sbjct  228  GSSFADCKKFVNLAVIIHNNLLQTVVAKLNKETEHSTFMVIDYYNAFLTVLKNK-GEIPG  286

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             + F  PL  CC G CG VD  G K Y LCDDP   FFWD  HP+Q+GW +VY+    +L
Sbjct  287  ITRFETPLKECCGGVCGVVDEKGVKNYTLCDDPTSTFFWDGLHPTQEGWKSVYTVFGKNL  346



>ref|XP_010490849.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=357

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 112/186 (60%), Gaps = 7/186 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +G+   + EF+  +  Q+ VNL+RIH +GV  +AV  +QPLGCLP  T  
Sbjct  168  GNDYFTHITDNGYGLSIFEFMRRVINQIEVNLRRIHALGVKTIAVPTLQPLGCLPMYTKG  227

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y  C +  N +T  HN  L++ V +LN +TE SPF+++D + AF   ++  + Q PG
Sbjct  228  L-SYRRCSDIINALTIVHNNALRRVVARLNRETEQSPFIVIDYFKAFFDVID-NNGQIPG  285

Query  363  KSSFPYPLAPCC--LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
              +F     PCC   G CG V  +G+K Y LCDDP   F+WD  HPS++GW AVYS L +
Sbjct  286  VKNFTSLYVPCCGITGYCGTVHENGEKNYTLCDDPSSNFYWDGFHPSEEGWKAVYSVLTN  345

Query  537  SLPHLF  554
            +L  L 
Sbjct  346  NLKALL  351



>ref|XP_006851508.1| hypothetical protein AMTR_s00040p00157200 [Amborella trichopoda]
 gb|ERN13089.1| hypothetical protein AMTR_s00040p00157200 [Amborella trichopoda]
Length=344

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 110/189 (58%), Gaps = 14/189 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G++ F+ ++ +QLS+NL+R+  +GV K+AVT M+PLGCLP+ T  
Sbjct  159  GNDYSAYLERNGSAEGLQPFIIAVVKQLSLNLQRLQGLGVKKIAVTTMEPLGCLPSST-Q  217

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP-FVILDLYAAFTSALNIKHDQHP  359
              +Y  C+E  N  T FHN +L+Q V  LN +   S   VI DL+ +F S L        
Sbjct  218  VLSYKQCNETQNAATSFHNLLLEQEVQNLNKEANNSSNIVIFDLFNSFNSVLKTPS----  273

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G+  F   L PCC G      CG +D SG+  Y +C +P+  FFWD  HP+Q  W A+ S
Sbjct  274  GQGKFVDSLRPCCDGFTVTDRCGSIDKSGRATYNICSNPETTFFWDSVHPTQSAWAAIVS  333

Query  525  ALKSSLPHL  551
             L+ S+  L
Sbjct  334  YLRPSVEAL  342



>ref|XP_003542597.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=357

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 109/189 (58%), Gaps = 15/189 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G I G   F+ S+  Q   NL  I  +GV K+ V  +QPLGCLP+ T +
Sbjct  170  GNDYNFYLATNGSIEGFPSFIASVVNQTVTNLLHIQRLGVRKIVVGGLQPLGCLPSST-A  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHP  359
              ++  C+   N++   HN++L Q V KLN ++ + S F++LDL+  F S LN     HP
Sbjct  229  LSSFQQCNSTFNDLIGLHNKLLNQAVTKLNQKSKDNSTFIVLDLFDTFMSVLN-----HP  283

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
              ++   PL PCC+G      CG VD    K Y +CD PK AFFWD+ HP+Q GW AVY+
Sbjct  284  STNNIKDPLKPCCVGLSSQDFCGSVDERNVKQYKVCDSPKSAFFWDLLHPTQAGWHAVYN  343

Query  525  ALKSSLPHL  551
             L+++   L
Sbjct  344  KLQTTTSAL  352



>ref|XP_006301313.1| hypothetical protein CARUB_v10021720mg [Capsella rubella]
 gb|EOA34211.1| hypothetical protein CARUB_v10021720mg [Capsella rubella]
Length=352

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 108/182 (59%), Gaps = 8/182 (4%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY +Y      +  G   +++ + +Q  VNL+RIH +GV K+A+  +QPLGC+P V  
Sbjct  167  GNDYITYILGNGTNKPGFITYMKQVIDQTEVNLRRIHALGVKKIAIPLLQPLGCVPVV--  224

Query  180  STGNY-PNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
            S G+   +C +  N     HN +L+  V KLN +T+ S F+++D Y AF +    K  + 
Sbjct  225  SKGSLVADCKDRINVAVIIHNNLLQSVVAKLNKETKDSTFMVIDYYNAFLTVFKNK-GET  283

Query  357  PGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
            PG + F  PL  CC G CG VD  G K Y LCDDP  AFFWD  HP+Q+GW +VY+ L  
Sbjct  284  PGSTKFETPLKECCGGICGAVDEKGVKNYTLCDDPTSAFFWDGLHPTQEGWKSVYAVLGK  343

Query  537  SL  542
            +L
Sbjct  344  NL  345



>ref|XP_003554424.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Glycine max]
Length=352

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 111/195 (57%), Gaps = 19/195 (10%)
 Frame = +3

Query  12   GNDYASYH--GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY  Y       G+  FV S+  Q   NL RI  +GV K+ V A+QPLGCLP  T +T
Sbjct  164  GNDYGRYMLTNGSQGLPSFVASVVNQTRSNLIRIKGLGVKKIVVGALQPLGCLPQET-AT  222

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLND----QTEGSPFVILDLYAAFTSALNIKHDQ  353
             ++  C+  +N +   HN +L Q V KLN     +   S FVIL+L+ +F S LN     
Sbjct  223  SSFQRCNATSNALVLLHNSLLNQAVTKLNQLETTKDRYSTFVILNLFDSFMSVLN-----  277

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
            HP   +    L PCC+G     +CG VD +  K Y +CDDPK AFFWD+ HP+Q GW AV
Sbjct  278  HPSTHNIRNKLTPCCVGVSSGYSCGSVDKNNVKKYRVCDDPKSAFFWDLVHPTQAGWHAV  337

Query  519  YSALKS--SLPHLFH  557
            Y+ L++  +L H+ +
Sbjct  338  YNKLRTMNALQHILY  352



>ref|XP_004496309.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cicer arietinum]
Length=348

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 112/189 (59%), Gaps = 9/189 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++   +  +  ++ F ES+  Q+S+N++RIH++G+ K+A+  + P+GCLP++   
Sbjct  160  GNDYTAFLVNNRTLTEIKSFTESLINQISINIQRIHKLGINKIAIGLLGPIGCLPSINRV  219

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T +   C +  N I   HN++L Q V +LN +   + F  LDLY AF S +     +H  
Sbjct  220  TFHLA-CVDILNKIPENHNKILLQNVSQLNQRVGKTVFGTLDLYNAFLSTIETMKKKHEE  278

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
              S   PL  CC G      CG+VD SG+  Y LCD P+++FFWD  HP+Q GW AVY+ 
Sbjct  279  DPSLMNPLEQCCKGEDLAQTCGKVDDSGEVKYSLCDKPELSFFWDNVHPTQNGWHAVYTL  338

Query  528  LKSSLPHLF  554
            L+SSL  L 
Sbjct  339  LQSSLHQLI  347



>ref|XP_007162883.1| hypothetical protein PHAVU_001G188600g [Phaseolus vulgaris]
 gb|ESW34877.1| hypothetical protein PHAVU_001G188600g [Phaseolus vulgaris]
Length=356

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 112/183 (61%), Gaps = 15/183 (8%)
 Frame = +3

Query  12   GNDYASYH--GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY+ +       G+  FV S+  Q  +N+ R+ E+GV K+ V  +QPLGCLP +T +T
Sbjct  172  GNDYSHFTQTNGSQGLASFVASVVNQTVMNMIRMREVGVKKIVVGTLQPLGCLPEITAAT  231

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHDQHPG  362
             ++  C+E  N     HN +L Q V KLN QT + S F+IL+L+ +F S LN     HP 
Sbjct  232  -SFQRCNETNNAFVLLHNTLLSQAVTKLNQQTKDRSTFLILNLFDSFMSVLN-----HPS  285

Query  363  KSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
             ++    L PCC+G     +CG V+ + +K Y +CDDPK AFFWD+ HP+Q GW AVY+ 
Sbjct  286  TNNIRDGLKPCCVGVSSKYSCGSVENNVRK-YRVCDDPKSAFFWDLVHPTQAGWHAVYNK  344

Query  528  LKS  536
            L++
Sbjct  345  LRT  347



>ref|XP_010419057.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Camelina sativa]
Length=165

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 2/160 (1%)
 Frame = +3

Query  63   VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQ  242
            ++ +  Q  VNL+RIH +GV K+A+  + PLGCLP V+  + ++ +C +  N     HN 
Sbjct  1    MKQVINQAEVNLRRIHALGVKKIAIPLLHPLGCLPVVSKGS-SFADCKKLVNLAVIIHNN  59

Query  243  MLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGNCGEVD  422
            +L+  V KLN +TE S F+++D Y AF + L  K  + PG + F  PL  CC G CG VD
Sbjct  60   LLQTVVAKLNKETEHSTFMVIDYYNAFLTVLKNK-GETPGITRFETPLKECCGGVCGVVD  118

Query  423  VSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
              G K Y LCDDP   FFWD  HP Q+GW +VY+ L  +L
Sbjct  119  EKGVKNYTLCDDPTSTFFWDGLHPIQEGWKSVYAVLGKNL  158



>gb|KGN48250.1| hypothetical protein Csa_6G452020 [Cucumis sativus]
Length=190

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 99/180 (55%), Gaps = 16/180 (9%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G++ F+ S+  Q+ V+L+RI  +GV K+ VT + PLGCLP  T +  ++  C++  N+  
Sbjct  12   GLKPFINSVVNQIMVDLRRIRRLGVKKIVVTGLGPLGCLPIFT-APFSFKQCNQTINSFV  70

Query  228  RFHNQMLKQRVDKLNDQTEGS----------PFVILDLYAAFTSALNIKHDQHPGKSSFP  377
            +FHN +LKQ VDKLN Q                 ILD+Y AF S +  +     G   F 
Sbjct  71   QFHNFLLKQAVDKLNKQITKQQHYSSSSSSSKIFILDVYDAFLSIIQGRGSGRVGLLKFK  130

Query  378  YPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             PL PCC G      CG VD  G K + LC+DPK AFFWD  HP+Q GW   +S+  S L
Sbjct  131  TPLKPCCFGVSSEFECGSVDEQGNKKFVLCNDPKSAFFWDSVHPTQTGWAHAFSSFTSFL  190



>ref|XP_004494911.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cicer arietinum]
Length=396

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 107/183 (58%), Gaps = 16/183 (9%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y+   G + G   FV S+  Q  +NL RI E+GV KV ++ +QP+GCLP  T  
Sbjct  169  GNDYTFYNVKNGSVQGFPSFVASLINQTVINLIRIKELGVKKVIMSGLQPIGCLPQQTAG  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE--GSPFVILDLYAAFTSALNIKHDQH  356
            T ++  C+E +N I   HN +L+Q ++KLN QT    SPF+ L+L+  F S LN     H
Sbjct  229  T-SFKQCNETSNTILASHNNLLRQAINKLNQQTNDTSSPFLFLNLHDTFMSVLN-----H  282

Query  357  PGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            P   +    L PCC+G      CG VD    K Y +C++PK AFFWD  HP++ GW AVY
Sbjct  283  PTTFNIKDKLKPCCVGVSNEYFCGSVDEKNVKKYLVCEEPKSAFFWDSVHPTEAGWHAVY  342

Query  522  SAL  530
            + +
Sbjct  343  NKM  345



>ref|XP_010423691.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Camelina 
sativa]
Length=161

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 94/156 (60%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQ  242
            ++ I  Q  VNL+RIH +GV KVA+  +QPLGC+P +     +Y  C++  N +   HN 
Sbjct  1    MKQILHQTEVNLRRIHALGVQKVAIPLLQPLGCIPLIA-KDSSYQKCNDIINALVIIHNN  59

Query  243  MLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGNCGEVD  422
             LK  V  LN +T+ S F+++D Y AF +    K ++ PG   F  P   CC G CG VD
Sbjct  60   ELKNVVANLNKETKQSTFMVIDYYNAFLTVFKNKGEK-PGSQRFETPYKACCGGLCGSVD  118

Query  423  VSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
             +G+K Y LCDD   +FFWD  HP+Q+GW +VYS L
Sbjct  119  KNGQKNYTLCDDSTSSFFWDGLHPTQEGWKSVYSVL  154



>gb|ACU23785.1| unknown [Glycine max]
Length=357

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 107/189 (57%), Gaps = 15/189 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G I     F+ S+  Q   NL  I  +GV K+ V  +QPLGCLP+ T +
Sbjct  170  GNDYNFYLATNGSIEDFPSFIASVVNQTVTNLLHIQRLGVRKIVVGGIQPLGCLPSST-A  228

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ-TEGSPFVILDLYAAFTSALNIKHDQHP  359
              ++  C+   N++   HN++L Q V KLN +  + S F++LDL+  F S LN     HP
Sbjct  229  LSSFQQCNSTFNDLIGLHNKLLNQAVTKLNQKGKDNSTFIVLDLFDTFMSVLN-----HP  283

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
              ++   PL PCC+G      CG VD    K Y +CD PK AFFWD+ HP+Q GW AVY+
Sbjct  284  STNNIKDPLKPCCVGLSSQDFCGSVDERNVKQYKVCDSPKSAFFWDLLHPTQAGWHAVYN  343

Query  525  ALKSSLPHL  551
             L+++   L
Sbjct  344  KLQTTTSAL  352



>ref|XP_010658799.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Vitis vinifera]
Length=336

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 112/192 (58%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY  Y    G + G+  F+ S+  QL  +L+RIH++GVP+VA+  +QPLGCLP  
Sbjct  151  SASGNDYGIYLARGGSLEGLPAFIVSVVNQLGSDLQRIHDLGVPRVAIMGIQPLGCLPQF  210

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T    +Y  C+   N +  FHN +L   V++L  +   S FV+L +Y AF SA+  K + 
Sbjct  211  T-KEYSYEKCNSTGNLVALFHNLLLTTMVEELKPE---SKFVVLLMYDAFISAMK-KFEN  265

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
                S    PL PCC G      CG+V  +G+K Y +C  PK+AFFWD  HP+Q GW A+
Sbjct  266  ETETSKSKNPLRPCCTGITSEYRCGDVK-NGEKKYNVCRVPKLAFFWDSFHPTQAGWDAI  324

Query  519  YSALKSSLPHLF  554
             S L SS+  LF
Sbjct  325  VSELGSSIVSLF  336



>ref|XP_010490850.1| PREDICTED: GDSL esterase/lipase At5g03590 [Camelina sativa]
Length=298

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 112/184 (61%), Gaps = 13/184 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G+DY  +   + ++     FVE I E +  +L  ++ +    + VT++ PLGCLP VT +
Sbjct  114  GSDYYGFIDQNPNMAAYPAFVEFIVEDIQYSLGIMNGLKFKNIGVTSLHPLGCLPRVTVA  173

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ----TEGSPFVILDLYAAFTSALNIKHD  350
            + ++ +C+E+ N++ R HN+ LK+ V KLN +    T+G  FVI+DL+ AF   L  K  
Sbjct  174  S-SFRSCNESYNDLVRLHNESLKKVVAKLNKEDKFRTKGDRFVIVDLHKAFMVNLEKK--  230

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
               G + F  PL PCC G+C  VD+ G K Y LC+DPK AFFWD  +P+Q+GW ++YS L
Sbjct  231  ---GSNKFKTPLKPCCEGDCARVDMKGAKKYTLCNDPKSAFFWDEINPTQEGWRSIYSVL  287

Query  531  KSSL  542
              SL
Sbjct  288  GKSL  291



>ref|XP_004156321.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g03610-like 
[Cucumis sativus]
Length=358

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 107/198 (54%), Gaps = 22/198 (11%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY+ Y   +G   G++ F+ S+  Q+ V+L+RI  +GV K+ VT + PLGCLP  T +
Sbjct  162  GNDYSFYLATNGSAQGLKPFINSVVNQIMVDLRRIRRLGVKKIVVTGLGPLGCLPIFT-A  220

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTE---------GSPFVILDLYAAFTSAL  335
              ++  C++  N+  +FHN +LKQ VDKLN Q            S   ILD+Y AF S +
Sbjct  221  PFSFKQCNQTINSFVQFHNFLLKQAVDKLNKQITKHQHYSSSSSSKIFILDVYDAFLSII  280

Query  336  NIKHDQHPGKS----SFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMT  488
              +             F  PL PCC G      CG VD  G K + LC+DPK AFFWD  
Sbjct  281  QGRGSGSGSGRVGLLKFKTPLKPCCXGVSSEFECGSVDEQGNKKFVLCNDPKSAFFWDSV  340

Query  489  HPSQQGWFAVYSALKSSL  542
            HP+Q GW   +S+  S L
Sbjct  341  HPTQTGWAHAFSSFTSFL  358



>sp|Q9LZS9.2|GDL69_ARATH RecName: Full=GDSL esterase/lipase At5g03590; AltName: Full=Extracellular 
lipase At5g03590; Flags: Precursor [Arabidopsis 
thaliana]
Length=344

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 13/184 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G DY  +   + ++     FVE I E +  +L  ++ +    +AVT++ PLGCLP VT +
Sbjct  161  GTDYYGFIDQNPNMAAYPAFVEFIVEDIQYSLGIMNGLKFKNIAVTSLHPLGCLPRVTVA  220

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ----TEGSPFVILDLYAAFTSALNIKHD  350
            + ++ +C+E+ +++ R HN+ LK+ V KLN +    T+G  FVI+DL+ AF + L  K  
Sbjct  221  S-SFRSCNESYSDLVRLHNESLKKAVAKLNKEDKFRTKGDRFVIVDLHKAFMTILEKK--  277

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
               G   F  PL PCC G+C  +D+ G K Y LC+DPK AFFWD  +P+Q+GW ++YS L
Sbjct  278  ---GNKRFKSPLKPCCEGDCARMDMKGAKKYTLCNDPKSAFFWDEINPTQEGWRSIYSLL  334

Query  531  KSSL  542
              SL
Sbjct  335  GKSL  338



>ref|XP_010244335.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X3 [Nelumbo 
nucifera]
Length=344

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 104/187 (56%), Gaps = 25/187 (13%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGN  191
            GNDY +Y+                 S   +RIHEMGV KVAVT +QPLGCLP  T  +  
Sbjct  176  GNDYGAYNAR---------------SGTAQRIHEMGVKKVAVTTLQPLGCLPQNTLLS-Y  219

Query  192  YPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSS  371
            Y +C+   N    FHN +LKQ V +LN++ + S F +LDL++AF S    K     G   
Sbjct  220  YRHCNATQNMAVNFHNFLLKQAVQQLNNEVKNSTF-LLDLHSAFMSVF--KKRNSSGNVK  276

Query  372  FPYPLAPCCLG-----NCGEVD-VSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALK  533
            F  PL PCC+G     +CG  D +SGKK Y +C  PK AFFWD+ HPSQ GW AV   L 
Sbjct  277  FSNPLQPCCVGMDASNSCGSTDQLSGKKKYRVCKHPKAAFFWDLLHPSQAGWHAVSLVLH  336

Query  534  SSLPHLF  554
            SS   L+
Sbjct  337  SSFNKLY  343



>ref|XP_011076965.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Sesamum indicum]
Length=320

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 106/184 (58%), Gaps = 19/184 (10%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   HG   G+ E   S+ EQL +N++RI +  + K+A+T ++PLGCLP  + +
Sbjct  152  GNDYSTYLARHGSFQGLPELKRSVIEQLVLNVRRIKDFEIKKIAITGIEPLGCLPRNS-A  210

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y NC+   NN ++ HN +L+Q +  LN +T    F  LDLY AF SAL I   + PG
Sbjct  211  ASSYRNCNAEENNFSQSHNILLQQHIWALNYETAAPVFKYLDLYDAFISALKIDQ-KSPG  269

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
            +                 VD +G K Y +C +   +F+WD  HPS +GW AVYSALK SL
Sbjct  270  RRRL--------------VDNNGVKKYVVCKNRSHSFYWDSIHPSDKGWRAVYSALKRSL  315

Query  543  PHLF  554
            P L 
Sbjct  316  PSLL  319



>gb|AFK45458.1| unknown [Lotus japonicus]
Length=217

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 110/187 (59%), Gaps = 18/187 (10%)
 Frame = +3

Query  3    TSVGNDYASY--HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVT  176
            +++GNDY  Y  HG I G + FV+S+  Q++ NL RI ++GV K+ VT++ P GC+PA+ 
Sbjct  30   SALGNDYFDYLKHGSIWGFKSFVDSLVNQMTTNLIRIQKLGVKKIVVTSLPPFGCIPAI-  88

Query  177  FSTGNYP--NCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKH  347
              +G  P   C    N I   HN++L Q + KLN +T +G+ FV LDLY +F S +N   
Sbjct  89   --SGFNPLKRCLNIINIIPIAHNKLLNQSITKLNQETIDGATFVFLDLYDSFMSVIN---  143

Query  348  DQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWF  512
               P  ++       CCLG      CG VD + +K Y +C++P+   FWD  HP+Q GW 
Sbjct  144  --DPSTNNITEYYTACCLGVSSKYVCGSVDENNEKQYKVCENPESTMFWDPIHPTQAGWH  201

Query  513  AVYSALK  533
            AVY+ L+
Sbjct  202  AVYNNLQ  208



>ref|XP_002264532.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Vitis vinifera]
Length=333

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 111/193 (58%), Gaps = 19/193 (10%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ G DY  Y    G + G   F+ S+  QL ++L+RIH++GVP+VAV  MQPLGCLP  
Sbjct  151  SASGMDYRIYLARRGSLRGFPAFIISVVNQLGLDLQRIHDLGVPQVAVMGMQPLGCLPE-  209

Query  174  TFSTG-NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             F+ G +Y  C+   N    +HN +L   V KL  +   S FV+LD+Y AF SA+  K +
Sbjct  210  -FTRGYSYEKCNSTGNFAALYHNLLL---VKKLKPE---SKFVVLDMYNAFMSAMK-KFE  261

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
                 S    PL PCC G      CG+V+   KK Y +C  PK+AFFWD  HP+Q GW A
Sbjct  262  NKTETSELKNPLRPCCTGITSEYRCGDVENKEKK-YNVCRVPKLAFFWDSFHPTQAGWDA  320

Query  516  VYSALKSSLPHLF  554
            + S L SS+  LF
Sbjct  321  IVSELGSSIISLF  333



>emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera]
Length=435

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 109/188 (58%), Gaps = 14/188 (7%)
 Frame = +3

Query  3    TSVGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            ++ GNDY  Y    G + G+  F+ S+  QL  +L+RIH++GVP+VA+  +QPLGCLP  
Sbjct  180  SASGNDYGIYLARGGSLEGLPAFIVSVVNQLGSDLQRIHDLGVPRVAIMGIQPLGCLPQF  239

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T    +Y  C+   N +  FHN +L   V++L  +   S F +L +Y AF SA+  K + 
Sbjct  240  T-KEYSYEXCNSTGNLVALFHNLLLTTMVEELKPE---SKFXVLXMYDAFISAMK-KFEN  294

Query  354  HPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
                S    PL PCC G      CG+V  +G+K Y +C  PK+AFFWD  HP+Q GW A+
Sbjct  295  ETETSKSKXPLRPCCTGITSEYRCGDVK-NGEKKYNVCRVPKLAFFWDSFHPTQAGWDAI  353

Query  519  YSALKSSL  542
             S L SS+
Sbjct  354  VSELGSSI  361



>ref|XP_010271721.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X3 [Nelumbo 
nucifera]
Length=327

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = +3

Query  126  KVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVIL  305
            KVAV A+ PLGCLP  T  + +Y  C++  N   RFHN +LKQ V+KLN++T+   F++L
Sbjct  182  KVAVIALLPLGCLPQSTVLS-SYQQCNKTQNTAVRFHNLLLKQAVEKLNNETKSPTFILL  240

Query  306  DLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMA  470
            DL +AF SA + K+  +  K  F  PL PCC+G     +CG VD SG K Y +C +PK+A
Sbjct  241  DLNSAFMSAFDKKNSGNL-KFGFGNPLKPCCMGIDASNSCGIVDQSGAKKYKVCKNPKVA  299

Query  471  FFWDMTHPSQQGWFAVYSALKSSL  542
            FFWD  HP+Q GW AV  +LKSSL
Sbjct  300  FFWDEVHPTQAGWQAVSLSLKSSL  323



>ref|XP_002871046.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47305.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 108/188 (57%), Gaps = 14/188 (7%)
 Frame = +3

Query  12   GNDYASYHGH---IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G DY  Y        G++  VE + + L VN+  +  +   K+AVT++QP+GCLP+ T S
Sbjct  139  GGDYIYYIDQNRPAAGLKAIVEKVVDNLHVNMIILSGLLFKKIAVTSLQPIGCLPSYT-S  197

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT----EGSPFVILDLYAAFTSALNIKHD  350
              ++ +C+E+ + +   HN++LKQ V KLN+Q+    +G  F I+D++ AF + L     
Sbjct  198  ASSFKSCNESQSALVELHNKLLKQVVAKLNEQSRVMKKGQHFFIIDIHNAFMTVL-----  252

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            ++ G   F  P+  CC G CG     G+K Y LCDDPK +FFWD  HP+Q+GW ++YS L
Sbjct  253  KNKGNKRFKNPMKSCCEGYCGRSS-DGEKLYTLCDDPKSSFFWDEVHPTQEGWRSIYSVL  311

Query  531  KSSLPHLF  554
               L    
Sbjct  312  GKPLTEFL  319



>gb|KEH42056.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=348

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             GNDY  Y   +G + G   F+ S+ +Q + +L  +  +G  ++ V A+QPLGCLP  T 
Sbjct  162  AGNDYNHYLATNGSLPGFPSFIASVVKQTTTDLIHLQSLGFKRIVVGALQPLGCLPQTT-  220

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG-SPFVILDLYAAFTSALNIKHDQH  356
            +  ++  C+   N++   HN +L Q V KLN +T+  + F ILD++ +F S LN     H
Sbjct  221  AESSFQRCNSTFNDLVALHNNLLNQSVAKLNQETKDHTTFTILDIFDSFASVLN-----H  275

Query  357  PGKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            P   +    L PCC G     NCG VD +  K Y +C++P+ +FFWD  HP+Q GW AVY
Sbjct  276  PASHNIKDHLKPCCAGVSSQYNCGSVDENNVKKYLVCENPESSFFWDGLHPTQAGWNAVY  335

Query  522  SALKSSLPH  548
            + L+    H
Sbjct  336  NELEKKGLH  344



>ref|XP_004516199.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Cicer arietinum]
Length=338

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 102/183 (56%), Gaps = 14/183 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G + G   F+ S+ +Q++ +L  +  +G  K+ V  +QPLGCLP  T  
Sbjct  152  GNDYNFYLATNGSLPGFPSFIASLVKQITTDLINLQTLGFKKIVVGGLQPLGCLPQTTAP  211

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ-TEGSPFVILDLYAAFTSALNIKHDQHP  359
            T ++  C+   NN+   HN +L Q V KLN Q  + + F ILD++ +F S LN   +   
Sbjct  212  T-SFQRCNSTFNNLVALHNNLLNQSVTKLNQQFKDHTTFAILDIFDSFVSVLNHTSNHKN  270

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
             K      L PCC G     NCG VD +  K Y +C++P+  FFWD+ HP+Q GW AVY 
Sbjct  271  IKER----LKPCCFGVSSKYNCGSVDENNVKKYLVCENPESNFFWDLLHPTQAGWNAVYD  326

Query  525  ALK  533
             LK
Sbjct  327  ELK  329



>ref|XP_002888626.1| hypothetical protein ARALYDRAFT_894537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64885.1| hypothetical protein ARALYDRAFT_894537 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 9/160 (6%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVT--  176
            GNDY +Y   +G I G+  F + I  Q  VNL+RIH +GV K+A++ + PLGC+P ++  
Sbjct  149  GNDYITYLSKNGSILGIPAFTKKIINQTEVNLRRIHALGVKKIAISLLHPLGCIPFISKG  208

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
            FS     +C    N +  +HN +L+  V KLN +TE S FV++D Y AF +    K  + 
Sbjct  209  FSV---KDCKTIINALVIYHNNLLQTLVAKLNKETEHSTFVVIDYYNAFLTVFKNK-GEI  264

Query  357  PGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFF  476
            PG + F  PL  CC G CG VD  G+K Y LCD+PK AFF
Sbjct  265  PGSTRFETPLKECCGGFCGVVDEKGQKNYTLCDEPKSAFF  304



>gb|KDP35848.1| hypothetical protein JCGZ_10329 [Jatropha curcas]
Length=337

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 110/184 (60%), Gaps = 9/184 (5%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDYAS+   +G +  M      + +QL  +++ I  +GV K+AV  M P GC+P  T  
Sbjct  158  GNDYASHMQKNGSVQEMPSLTRRVVDQLVKDIQHIQSLGVAKIAVVGMGPSGCVPQAT-D  216

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              +Y +C+E+ N+ ++FHNQML+Q +  LN  ++   F+ LDLY++F +A++    +   
Sbjct  217  KISYNSCNEDLNSASKFHNQMLQQALTDLNKDSKKPTFMYLDLYSSFETAMDAL-KRSAE  275

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               +  PL PCC     E++ +G++ + +C  P++AF+WD  HPSQ GW +VY ALK +L
Sbjct  276  IMEYKNPLKPCC---SLEIN-NGERKFIICKHPELAFYWDDVHPSQNGWHSVYLALKPTL  331

Query  543  PHLF  554
              L 
Sbjct  332  KELL  335



>ref|XP_011024234.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Populus euphratica]
Length=336

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 103/181 (57%), Gaps = 10/181 (6%)
 Frame = +3

Query  15   NDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            NDY+ Y     G   G+  F E +  QL+V+L+RI+ +GV KV V  +  +GCLP     
Sbjct  155  NDYSFYSAAKKGSNDGLPAFTEGLVNQLAVDLQRINRLGVKKVVVATLPVIGCLPLHIIP  214

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQHP  359
              +Y NCDE +N   + HNQ+L++ V KLN D    + FVILDLY A  SA++ +  Q  
Sbjct  215  PNSYQNCDEESNKNAKIHNQVLQKAVGKLNTDDGNKNTFVILDLYNAMVSAID-QFRQDA  273

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
              +    PL PCC     E   S +   GLC +PK +FF+D+ HPS  GW A+YS L+ S
Sbjct  274  ANTEHKNPLQPCC-SKTVEYICSAE---GLCSNPKSSFFFDLAHPSDNGWNAIYSFLQGS  329

Query  540  L  542
            L
Sbjct  330  L  330



>ref|XP_010423688.1| PREDICTED: GDSL esterase/lipase At5g03600-like [Camelina sativa]
Length=323

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 109/185 (59%), Gaps = 15/185 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G DY  Y   +    GM+  VE + + L VN+  +  +   KVAVT++QP+GCLP+ T S
Sbjct  139  GGDYIYYIDENRPAAGMKALVEEVVDHLHVNMIVLSGLLFKKVAVTSLQPIGCLPSYT-S  197

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT----EGSPFVILDLYAAFTSALNIKHD  350
              ++ +C+E+ + +   HN++L+Q V KLN+Q+    +G  + I+D++ AF + L  K  
Sbjct  198  ASSFKSCNESQSALVELHNKLLRQVVAKLNEQSRVMKKGQHYFIIDIHHAFMTVLKNK--  255

Query  351  QHPGKSSFPYPL-APCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               G   F  P+   CC G CG   + G+K Y LCDDPK  FFWD  HP+Q+GW ++YS 
Sbjct  256  ---GSKRFKTPMMKSCCEGFCGR-SMDGEKLYTLCDDPKSFFFWDEVHPTQEGWRSIYSV  311

Query  528  LKSSL  542
            L + L
Sbjct  312  LGNPL  316



>emb|CDX79671.1| BnaC03g20070D [Brassica napus]
Length=351

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 105/182 (58%), Gaps = 15/182 (8%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            +GNDY  Y+   G   G    +  +T+Q+ +++KRI ++GV KV V    P  C+P  + 
Sbjct  172  IGNDYIKYNIFNGTSQGRPALIRRVTKQILLDVKRIKDLGVRKVFVVLSPPHNCVPLYST  231

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S G    C+  +N +T+ HN ++++ + KLND+     F++LD Y AF +    K+   P
Sbjct  232  SKG----CN-TSNPLTKLHNSLIREGLRKLNDENNEKSFLMLDFYKAFMTIF--KYRGVP  284

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G S+F  PL  CC G     +CG+VD+ G++ Y +C DPK  FFWD  H + +GW +V+S
Sbjct  285  GVSTFSEPLKACCEGRKGGNSCGDVDIYGRRLYSVCKDPKSFFFWDNVHITDEGWRSVFS  344

Query  525  AL  530
             L
Sbjct  345  LL  346



>ref|XP_009133076.1| PREDICTED: GDSL esterase/lipase At2g36325 [Brassica rapa]
 emb|CDX84564.1| BnaA03g16660D [Brassica napus]
Length=351

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 105/182 (58%), Gaps = 15/182 (8%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            +GNDY  Y+   G   G    +  +T+Q+ +++KRI ++GV KV V    P  C+P  + 
Sbjct  172  IGNDYIKYNIFNGTSQGRPALIRRVTKQILLDVKRIKDLGVRKVFVVLSPPHNCVPLYST  231

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            S G    C+  +N +T+ HN ++++ + KLND+     F++LD Y AF +    K+   P
Sbjct  232  SKG----CN-TSNPLTKLHNSLIREGLRKLNDENNEKSFLMLDFYKAFMTIF--KYRGVP  284

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G S+F  PL  CC G     +CG+VD+ G++ Y +C DPK  FFWD  H + +GW +V+S
Sbjct  285  GVSTFSEPLKACCEGRKGGNSCGDVDIYGRRLYSVCKDPKSFFFWDNVHITDEGWRSVFS  344

Query  525  AL  530
             L
Sbjct  345  LL  346



>gb|KEH42057.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=359

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 105/189 (56%), Gaps = 21/189 (11%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEF---VESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            GNDY  Y    G   G   F   +ES+ EQ + NL  +  +G  ++ V A+QPLGCLP  
Sbjct  168  GNDYNYYLKTGGAFLGFPSFPSFIESVIEQTTTNLIHLQSLGFERIVVGALQPLGCLPQA  227

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT-EGSPFVILDLYAAFTSALNIKHD  350
            T  T ++ +C+   N++   HN +L Q V KLN +T + + F ILD++ +F S LN    
Sbjct  228  TAET-SFQSCNSTFNDLVALHNNLLNQSVTKLNQETNDHTTFTILDIFDSFKSVLN----  282

Query  351  QHPGKSSFPYPLAPCCLG-----NCGEVD---VSGKKGYGLCDDPKMAFFWDMTHPSQQG  506
             HP   +    L PCC+G      CG VD   ++  K Y +C++P+  FFWD  HP+Q G
Sbjct  283  -HPSSHNIKERLKPCCVGVSSEYKCGSVDYKNLNKVKKYLVCENPESTFFWDQLHPTQAG  341

Query  507  WFAVYSALK  533
            W AVY+ L+
Sbjct  342  WNAVYNELE  350



>ref|NP_195980.1| SGNH hydrolase-type esterase superfamily protein [Arabidopsis 
thaliana]
 sp|Q9LZS8.1|GDL70_ARATH RecName: Full=GDSL esterase/lipase At5g03600 [Arabidopsis thaliana]
 emb|CAB82925.1| putative protein [Arabidopsis thaliana]
 gb|AED90632.1| SGNH hydrolase-type esterase superfamily protein [Arabidopsis 
thaliana]
Length=322

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = +3

Query  12   GNDYASYHGH---IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G DY  Y        G++  VE + + L VN+  +  +   K+AVT++QP+GCLP+ T S
Sbjct  139  GGDYIYYIDQNRPAAGLKALVEKVVDNLRVNMIVLGGLLFKKIAVTSLQPIGCLPSYT-S  197

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT----EGSPFVILDLYAAFTSALNIKHD  350
              ++ +C+E+ + +   HN++LK+ V KLN+Q+    +   F I+D++ AF + +     
Sbjct  198  ASSFKSCNESQSALVELHNKLLKKVVAKLNEQSRVMKKEQHFFIIDIHNAFMTVM-----  252

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            ++ G   F  P+  CC G CG     G K Y LCDDPK  FFWD  HP+Q+GW ++YS L
Sbjct  253  KNKGSKRFKNPMKSCCEGYCGRSS-DGGKLYTLCDDPKSFFFWDAVHPTQEGWRSIYSVL  311

Query  531  KSSL  542
             + L
Sbjct  312  GNPL  315



>ref|XP_010490851.1| PREDICTED: GDSL esterase/lipase At5g03600 [Camelina sativa]
Length=346

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 103/170 (61%), Gaps = 12/170 (7%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            GM+  VE + + L VN+  +  +   KVAVT++QP+GCLP  T S  ++ +C+E+ + + 
Sbjct  177  GMKALVEEVVDHLHVNMIVLSGLLFKKVAVTSLQPIGCLPTYT-SASSFKSCNESQSALV  235

Query  228  RFHNQMLKQRVDKLNDQT----EGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPL-AP  392
              HN++L+Q V KLN+Q+    +G  + I+D++ AF + L     ++ G   F  P+   
Sbjct  236  ELHNKLLRQVVAKLNEQSRVMKKGQHYFIIDIHHAFMTVL-----KNKGSKRFKTPMMKS  290

Query  393  CCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
            CC G CG   + G K Y LCDDPK  FFWD  HP+Q+GW ++YS L + L
Sbjct  291  CCEGFCGR-SMDGDKLYTLCDDPKSFFFWDEVHPTQEGWKSIYSVLGNPL  339



>ref|XP_010929732.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Elaeis guineensis]
Length=359

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 98/189 (52%), Gaps = 14/189 (7%)
 Frame = +3

Query  12   GNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y    G      +FV  + +QL   LKRIH++GV KV VT + P+GC P +T  
Sbjct  175  GNDYKYYKETKGSDTATLDFVNRLFQQLKTELKRIHDIGVRKVLVTNLHPVGCTPYMTRV  234

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T NY  CD   +   + HNQML+  + +LN     + F  LDL+ AF S +N    Q  G
Sbjct  235  T-NYTKCDSTIHFEGQAHNQMLETLIKELNGAGTNT-FFSLDLFTAFDSIIN----QVKG  288

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F   L PCC GN     C + D +G K Y LC +P   F+WD  HPSQ GW A +  
Sbjct  289  APKFENILKPCCDGNDNTSTCAQTDENGMKKYSLCSNPDTHFYWDWLHPSQAGWAAAFEY  348

Query  528  LKSSLPHLF  554
            LK ++    
Sbjct  349  LKPAIRRFL  357



>ref|XP_006378809.1| hypothetical protein POPTR_0010s24350g [Populus trichocarpa]
 gb|ERP56606.1| hypothetical protein POPTR_0010s24350g [Populus trichocarpa]
Length=336

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (55%), Gaps = 10/181 (6%)
 Frame = +3

Query  15   NDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            NDY+ Y     G   G+  F E +  QL+ +L+RI+ +GV KV V  +  +GCLP     
Sbjct  155  NDYSFYSAAKKGSNDGLPAFTEGLVNQLAADLQRINRLGVKKVVVATLPVVGCLPLHIIP  214

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQHP  359
              +Y  CDE +N   + HNQ L++ V+K+N D    S FVILDLY A  SA++ +  Q  
Sbjct  215  PNSYQKCDEESNKNAKIHNQALQKAVEKMNTDDGNKSTFVILDLYNAMVSAID-QFRQDA  273

Query  360  GKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSS  539
              +    PL PCC      +        GLC +PK +FF+D+ HPS  GW A+YS L+ S
Sbjct  274  ANTEHKNPLQPCCSKTVEHI----CSAEGLCSNPKSSFFFDLAHPSDNGWNAIYSFLQGS  329

Query  540  L  542
            L
Sbjct  330  L  330



>ref|XP_008776019.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Phoenix dactylifera]
Length=370

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 101/190 (53%), Gaps = 13/190 (7%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   HG   G+ +F++ +TEQL+++LKRIH++GV KV VT + P+GC P +T  
Sbjct  183  GNDYVRYDDIHGAT-GIFDFIDLVTEQLALDLKRIHDLGVSKVVVTKLHPVGCSPFLT-R  240

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSP-FVILDLYAAFTSALNIKHDQHP  359
              NY  C    N     HNQ L   +  ++ + + +  F +LDL  AF+S LN    +  
Sbjct  241  KYNYTKCSTEGNLGANIHNQWLGVAIKNISSEEDVTKTFHMLDLNTAFSSLLN--QVELE  298

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G   F +   PCC       NCG +D  G K Y LC DP   F+WD  HP+Q  W AV+ 
Sbjct  299  GAKKFKHVHRPCCESKTNETNCGNLDTKGIKQYTLCHDPNSYFYWDDVHPTQAAWAAVFK  358

Query  525  ALKSSLPHLF  554
             LK  L    
Sbjct  359  YLKPELRQFL  368



>ref|XP_002879603.1| hydrolase, acting on ester bonds [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55862.1| hydrolase, acting on ester bonds [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 102/184 (55%), Gaps = 17/184 (9%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY +Y+   G   G    +  + +Q+ +++KRI + GV KV V    P  CLP +  
Sbjct  174  VGNDYLTYNRRNGTEQGRPALIRRVVKQILLDVKRIKDFGVRKVLVALSPPQKCLPLLVT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---TEGSPFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+    +   F++ DLY AF +    K+ 
Sbjct  234  PKG----CDTNDTS-THLHNSLLRKGLIKLNDKKINNDDKSFLMFDLYNAFVTIF--KNK  286

Query  351  QHPGKSSFPYPLAPCCLG----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              PG S FP PL  CC      +CG++ +SGKK Y LC+DPK  FFWD  H + QGW +V
Sbjct  287  GVPGVSVFPDPLKACCATKRGTSCGDISLSGKKLYSLCEDPKSFFFWDNVHITDQGWRSV  346

Query  519  YSAL  530
            +S L
Sbjct  347  FSLL  350



>emb|CDY52368.1| BnaA09g15670D [Brassica napus]
Length=315

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 12/180 (7%)
 Frame = +3

Query  12   GNDYASYHGHIHGMEEFVESITE---QLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY ++    H ++  +  IT+   Q+ VNL+RIH +G+ K+AV ++QPLG +P   F+
Sbjct  140  GNDYLNFLSTRHSLDAILSLITQVVNQIEVNLRRIHSLGIKKIAVPSLQPLGYIPY--FA  197

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
             G +P   +  N +   HN +L + V KLN++T  S F I+D   AF + +N K  + P 
Sbjct  198  KG-FPFIKDAVNFLVGHHNDLLHEVVAKLNNETNHSAFTIIDYNNAFLTVINNK-GEIPD  255

Query  363  KSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               F  P   C      ++DV+  K   LCDDP+ AFFWD  HP+Q+GW +VY+ L+ ++
Sbjct  256  ILLFETPFIECF-----QIDVNEFKNSTLCDDPRSAFFWDGLHPTQEGWKSVYTVLRKNI  310



>ref|XP_008245939.1| PREDICTED: GDSL esterase/lipase At5g03610-like, partial [Prunus 
mume]
Length=201

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 92/133 (69%), Gaps = 10/133 (8%)
 Frame = +3

Query  66   ESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQM  245
            +SI +QL+V+L+RIH +GV K+AVTA+ PLGCLP +T S  +Y NC E  N ++ FHNQ+
Sbjct  7    KSIIKQLAVDLERIHGLGVRKIAVTAIGPLGCLPRMT-SFLSYQNCSEVANLVSIFHNQI  65

Query  246  LKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGKSSFPY-PLAPCCLGN----  407
            L+Q+V++LN +T+ S FVILDLY A  SA+ + KH  H G S+    PL PCC+G     
Sbjct  66   LRQKVEELNKETKKSSFVILDLYNASLSAIMLPKH--HQGYSTLQINPLKPCCVGVSKEY  123

Query  408  -CGEVDVSGKKGY  443
             CG VD SG K Y
Sbjct  124  PCGSVDESGAKKY  136



>ref|XP_011046597.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Populus euphratica]
Length=197

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 94/166 (57%), Gaps = 6/166 (4%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  F E +  QL+ +L+RI+ +GV KV    +  LGCLP        Y NCDE  N   
Sbjct  31   GLPAFTEGLVNQLAADLQRINRLGVKKVVAATLPLLGCLPIHMIPPNTYQNCDEEYNKNA  90

Query  228  RFHNQMLKQRVDKLND-QTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG  404
            + +NQ+L++ V+KLN      S FVILDLY A  SA++ +  Q+   ++   PL PCC  
Sbjct  91   KIYNQLLQKAVEKLNTGDGNKSTFVILDLYNAMVSAID-QFRQNAANTACKNPLQPCC-S  148

Query  405  NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
               E   S +   GLC  PK +FF+D+ HPS  GW A+YS L+ SL
Sbjct  149  KTVEYICSAE---GLCSSPKSSFFFDLAHPSDNGWNAIYSFLQGSL  191



>ref|XP_009414559.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 104/192 (54%), Gaps = 27/192 (14%)
 Frame = +3

Query  12   GNDYA-------SYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY         Y  H+HG   F+  +  QL V+LKR+  +GVPKV VT + P+GC+P+
Sbjct  170  GNDYQFLSQLDPDYLHHLHG---FMHRLFAQLKVDLKRLSHIGVPKVIVTNLHPIGCIPS  226

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG---SPFVILDLYAAFTSALNI  341
             T  T NY  C  N ++    HN+    RVD+L  +  G   + F+ LD+  AF   LN+
Sbjct  227  YTRPT-NYTACYSNVSSAVAEHNR----RVDELMQELGGGSDTTFLSLDVNTAF---LNV  278

Query  342  KHDQHPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQG  506
             H +  G     +PL PCC+       CGE+D  G + YG+C  P+  F+WD  HP+Q G
Sbjct  279  LH-RAKGAKEIKHPLVPCCVSRSNTTECGEIDAKGNRLYGVCRRPEEHFYWDSVHPTQAG  337

Query  507  WFAVYSALKSSL  542
            W A +  L+ SL
Sbjct  338  WAAAFEFLRPSL  349



>ref|XP_002316505.2| hypothetical protein POPTR_0010s24320g [Populus trichocarpa]
 gb|EEF02676.2| hypothetical protein POPTR_0010s24320g [Populus trichocarpa]
Length=337

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 10/182 (5%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY+ Y     G   G+  F E +  QL+ +L+RI  +GV K+ V  +  LGCLP    
Sbjct  155  GNDYSLYSAAKKGSNDGLPAFTEGLVRQLAADLQRIAHLGVKKIVVATLPLLGCLPVHII  214

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQH  356
               +Y NCDE +N     HNQ+L++ V+KL  D      FVILDLY A  SA++ +  Q+
Sbjct  215  PPNSYQNCDEESNKNAMIHNQLLQKAVEKLKTDDGNKCTFVILDLYNAMVSAID-QFRQN  273

Query  357  PGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
               S +  PL PCC      VD       G+C +P+ +FF+D+ HPS  GW A++S L+ 
Sbjct  274  AANSEYKNPLQPCC---SKIVDYMCSV-EGVCTNPESSFFFDLGHPSDNGWNAIFSFLQG  329

Query  537  SL  542
            SL
Sbjct  330  SL  331



>ref|XP_002316455.1| hypothetical protein POPTR_0010s25480g [Populus trichocarpa]
 gb|EEF02626.1| hypothetical protein POPTR_0010s25480g [Populus trichocarpa]
Length=198

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 95/167 (57%), Gaps = 7/167 (4%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  F E +  QL+ +L+RI+ +GV KV    +  LGCLP        Y NCDE  N   
Sbjct  31   GLPAFTEGLVNQLAADLQRINLLGVKKVVAATLPLLGCLPIHIIPPNTYQNCDEEYNKNA  90

Query  228  RFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG  404
            + HNQ+L++ ++KLN D    S FVILDLY A  SA++ +  Q+   ++   PL PCC  
Sbjct  91   KIHNQLLQKALEKLNTDDGNKSTFVILDLYNAMVSAID-QFRQNAANTACKNPLQPCC-S  148

Query  405  NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQG-WFAVYSALKSSL  542
               E   S +   GLC  PK +FF+D+ HPS  G W A+YS L+ SL
Sbjct  149  KTVEYICSAE---GLCSSPKSSFFFDLAHPSDNGAWNAIYSFLQGSL  192



>gb|AAM13047.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91330.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95367.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 17/184 (9%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            +GNDY +Y   +G   G       + +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  174  IGNDYLTYDRRNGSEEGRSALTRKVVKQILLDVKRIKDLGVRKVLVALSPPQKCLPKLVT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---TEGSPFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+        F+ LDLY AF +    K+ 
Sbjct  234  PKG----CDTNDTS-TYLHNSLLRKGLIKLNDKEINNNDKSFMTLDLYNAFVTIF--KNK  286

Query  351  QHPGKSSFPYPLAPCCLGN----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
               G S+FP P   CC       CG+  +SGKK Y LCDDPK  FFWD  H S QGW +V
Sbjct  287  GVSGVSTFPDPFKACCATKRGTFCGDRSLSGKKLYTLCDDPKSFFFWDNVHISDQGWRSV  346

Query  519  YSAL  530
            +S L
Sbjct  347  FSLL  350



>ref|XP_010509486.1| PREDICTED: GDSL esterase/lipase At2g36325 [Camelina sativa]
Length=357

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 102/184 (55%), Gaps = 16/184 (9%)
 Frame = +3

Query  9    VGNDYASYHGH---IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY +Y+G      G   F+  + +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  174  VGNDYLTYNGRNGSEKGRPAFIRRVVKQILLDVKRIKDLGVRKVLVALSPPQKCLPKLAT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---TEGSPFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+   +  + F++ DLY AF +    K+ 
Sbjct  234  PKGG---CDTNDTS-TYLHNSLLREGLIKLNDKMIKSNDNSFLVFDLYNAFVTIF--KNK  287

Query  351  QHPGKSSFPYPLAPCCL----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              PG S FP PL  CC      +CG+V + G+K + LC DPK  FFWD  H + Q W ++
Sbjct  288  GVPGVSRFPEPLKSCCPTERGKSCGDVGIHGEKLFTLCKDPKSFFFWDNVHITDQAWRSI  347

Query  519  YSAL  530
            +S L
Sbjct  348  FSLL  351



>ref|NP_001078012.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RWJ4.2|GDL45_ARATH RecName: Full=GDSL esterase/lipase At2g36325; AltName: Full=Extracellular 
lipase At2g36325; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEC09233.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=356

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 17/184 (9%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            +GNDY +Y   +G   G       + +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  174  IGNDYLTYDRRNGSEEGRSALTRKVVKQILLDVKRIKDLGVRKVLVALSPPQKCLPKLVT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQ---TEGSPFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+        F+ LDLY AF +    K+ 
Sbjct  234  PKG----CDTNDTS-TYLHNSLLRKGLIKLNDKEINNNDKSFMTLDLYNAFVTIF--KNK  286

Query  351  QHPGKSSFPYPLAPCCLGN----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
               G S+FP P   CC       CG+  +SGKK Y LCDDPK  FFWD  H S QGW +V
Sbjct  287  GVSGVSTFPDPFKACCATKRGTFCGDRSLSGKKLYTLCDDPKSFFFWDNVHISDQGWRSV  346

Query  519  YSAL  530
            +S L
Sbjct  347  FSLL  350



>ref|XP_001780581.1| predicted protein [Physcomitrella patens]
 gb|EDQ54675.1| predicted protein [Physcomitrella patens]
Length=323

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 101/183 (55%), Gaps = 14/183 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y      I G+  F + + +++   ++R++++G     +  MQP+GCLP+ T  
Sbjct  128  GNDYGAYLVKGNPISGLPMFQKLVVDEMVRQIERLNKLGFKTFYINNMQPVGCLPSSTRP  187

Query  183  TGNYPNCDENTNNITRF-HNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
            T N   C+E T++I    HN +L+  V  L  +   S F +LD Y+AF + L    +   
Sbjct  188  TFN--ECNEVTDSIMSVPHNSLLETAVADLKQRLPASTFSLLDHYSAFNTVLRTPANS--  243

Query  360  GKSSFPYPLAPCCLG------NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
            G     +PL PCCLG      +CGEV  +GK  + +CDDPK +FFWD  HPSQ GW AV 
Sbjct  244  GTRLSAHPLVPCCLGEGNATRSCGEVAPNGKAMFTVCDDPKKSFFWDTIHPSQSGWTAVT  303

Query  522  SAL  530
              L
Sbjct  304  KLL  306



>ref|XP_006288126.1| hypothetical protein CARUB_v10001358mg [Capsella rubella]
 gb|EOA21024.1| hypothetical protein CARUB_v10001358mg [Capsella rubella]
Length=340

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = +3

Query  12   GNDYASYHGH---IHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            G DY  Y        G++E VE + + L VN+  +  +   KVAVT++QP+GCLP+ T S
Sbjct  157  GGDYIYYIDQNRPAAGLKELVEQVVDYLHVNMIILSGLLFKKVAVTSLQPIGCLPSYT-S  215

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT----EGSPFVILDLYAAFTSALNIKHD  350
            + ++  C+E+ + + + HN++LK+ V KLN+Q+    +G  + I+D++ AF + L     
Sbjct  216  SSSFKRCNESQSAMVQLHNKLLKKVVVKLNEQSRVQKKGQHYYIIDIHHAFMTVL-----  270

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            ++ G   F   +  CC G CG +D  G+K Y LCDDPK  FFWD  HP+Q+GW +VYS L
Sbjct  271  ENKGSKRFKNRMKSCCDGYCGRLD-EGEKLYTLCDDPKSFFFWDEVHPTQEGWRSVYSVL  329

Query  531  KSSL  542
            ++ L
Sbjct  330  ENPL  333



>ref|XP_006388036.1| hypothetical protein POPTR_0387s00230g [Populus trichocarpa]
 gb|ERP46950.1| hypothetical protein POPTR_0387s00230g [Populus trichocarpa]
Length=223

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 97/173 (56%), Gaps = 9/173 (5%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  F E +  QL+ +L+RI+ +GV KV    +  LGCLP        Y NCDE  N   
Sbjct  57   GLPAFTEGLVNQLAADLQRINLLGVKKVVAATLPLLGCLPIHIIPPNTYQNCDEEYNKNA  116

Query  228  RFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG  404
            + HNQ+L++ V+KLN D    S FVILDLY A  SA++ +  Q+   ++   PL PCC  
Sbjct  117  KIHNQLLQKAVEKLNTDDGNKSTFVILDLYNAMVSAID-QFRQNATNTACKNPLQPCC-S  174

Query  405  NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQG-WFAVYSALKSSLPHLFHP  560
               E   S +   GLC  PK +FF+D+ HPS  G W  +YS L+ +L   FHP
Sbjct  175  KTVEYICSAE---GLCSSPKSSFFFDLAHPSDNGAWNVIYSFLQVNLR--FHP  222



>emb|CBI35231.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 93/158 (59%), Gaps = 16/158 (10%)
 Frame = +3

Query  99   KRIHEMGVPKVAVTAMQPLGCLPAVTFSTG-NYPNCDENTNNITRFHNQMLKQRVDKLND  275
            +RIH++GVP+VAV  MQPLGCLP   F+ G +Y  C+   N    +HN +L   V KL  
Sbjct  213  QRIHDLGVPQVAVMGMQPLGCLPE--FTRGYSYEKCNSTGNFAALYHNLLL---VKKLKP  267

Query  276  QTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG-----NCGEVDVSGKKG  440
            +   S FV+LD+Y AF SA+  K +     S    PL PCC G      CG+V+   KK 
Sbjct  268  E---SKFVVLDMYNAFMSAMK-KFENKTETSELKNPLRPCCTGITSEYRCGDVENKEKK-  322

Query  441  YGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSLPHLF  554
            Y +C  PK+AFFWD  HP+Q GW A+ S L SS+  LF
Sbjct  323  YNVCRVPKLAFFWDSFHPTQAGWDAIVSELGSSIISLF  360



>ref|XP_006293494.1| hypothetical protein CARUB_v10023515mg [Capsella rubella]
 gb|EOA26392.1| hypothetical protein CARUB_v10023515mg [Capsella rubella]
Length=355

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = +3

Query  9    VGNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY +Y   +G   G    +  + +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  173  VGNDYLTYDRRNGSEQGRPALIRRVVKQILLDVKRIKDLGVRKVLVALSPPQKCLPLLAT  232

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQT---EGSPFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+        F++ DL+ AF +    K+ 
Sbjct  233  PRG----CDTNDTS-TNLHNSLLREGLTKLNDEKINKNAKSFIMFDLHNAFATIF--KNK  285

Query  351  QHPGKSSFPYPLAPCCL----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              PG S+F  PL  CC      +CG+V ++G+K Y LC DPK  FFWD  H + QGW +V
Sbjct  286  GVPGVSTFLEPLKACCPTKRGKSCGDVGLNGEKLYSLCKDPKSFFFWDNVHITDQGWRSV  345

Query  519  YSAL  530
            +S L
Sbjct  346  FSLL  349



>ref|XP_011024236.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Populus euphratica]
Length=337

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 99/182 (54%), Gaps = 10/182 (5%)
 Frame = +3

Query  12   GNDYASY----HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
             NDY+ Y     G   G+  F E +  QL+ +L+R+  +GV  + V  +  LGCLP    
Sbjct  155  ANDYSLYSAAKKGSNDGLPAFTEGLVNQLAADLQRLAHLGVKNIVVATLPLLGCLPVHII  214

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLN-DQTEGSPFVILDLYAAFTSALNIKHDQH  356
               +Y NCDE +N     HNQ+L++ V+KL  D      FVILDLY A  SA++ +  Q+
Sbjct  215  PPNSYQNCDEESNENAMIHNQLLRKAVEKLKTDDGNKCTFVILDLYNAMVSAID-QFRQN  273

Query  357  PGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKS  536
               + +  PL PCC      VD       G+C +P+ +FF+D+ HPS  GW A++S L+ 
Sbjct  274  AANTEYKNPLQPCC---SKIVDYMCSV-EGVCTNPESSFFFDLGHPSDNGWNAIFSFLRG  329

Query  537  SL  542
            SL
Sbjct  330  SL  331



>ref|XP_007221264.1| hypothetical protein PRUPE_ppa019622mg, partial [Prunus persica]
 gb|EMJ22463.1| hypothetical protein PRUPE_ppa019622mg, partial [Prunus persica]
Length=124

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 85/133 (64%), Gaps = 20/133 (15%)
 Frame = +3

Query  60   FVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHN  239
            F + I +QL+V+LKRIH++GV K+AVT ++PLGCLP +T S  N  NC+E  N  + +HN
Sbjct  5    FTKFIIKQLTVDLKRIHDLGVQKIAVTTIEPLGCLPGITSSLSN-QNCNEFANMASMYHN  63

Query  240  QMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLG-----  404
            Q+L Q++++LN +T+ S F+ LDLY AF SA+N               L PCC+G     
Sbjct  64   QILLQKLEELNKETKNSAFIDLDLYNAFMSAIN--------------TLKPCCVGVSNEY  109

Query  405  NCGEVDVSGKKGY  443
            +CG +D +G K Y
Sbjct  110  SCGTLDQTGAKKY  122



>ref|XP_010505168.1| PREDICTED: GDSL esterase/lipase At2g36325-like [Camelina sativa]
Length=357

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 99/184 (54%), Gaps = 16/184 (9%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY +Y+   G   G    +    +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  174  VGNDYLTYNRRNGSEQGRRALIRRAVKQILLDVKRIKDLGVRKVLVALSPPQKCLPKLAT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS---PFVILDLYAAFTSALNIKHD  350
              G    CD N  + T  HN +L++ + KLND+   S    F++ DLY AF +    K+ 
Sbjct  234  PKGG---CDTNDTS-TYLHNSLLREGLIKLNDKKINSNDNSFLVFDLYNAFVTIF--KNK  287

Query  351  QHPGKSSFPYPLAPCCL----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              PG S+FP PL  CC      +CG+V + G+K + LC DPK  FFWD  H + Q W +V
Sbjct  288  GVPGVSTFPEPLKACCPTERGKSCGDVGIHGEKLFTLCKDPKSFFFWDNVHITDQAWRSV  347

Query  519  YSAL  530
            +  L
Sbjct  348  FFLL  351



>ref|XP_010412897.1| PREDICTED: GDSL esterase/lipase At2g36325-like [Camelina sativa]
Length=357

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 99/184 (54%), Gaps = 16/184 (9%)
 Frame = +3

Query  9    VGNDYASYH---GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            VGNDY +Y+   G   G    +  + +Q+ +++KRI ++GV KV V    P  CLP +  
Sbjct  174  VGNDYLTYNRRNGSEQGRPALIRRVVKQILLDVKRIKDLGVRKVLVALSPPQKCLPKLAT  233

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGS---PFVILDLYAAFTSALNIKHD  350
              G    CD   +  T  HN +L++ + KLND+   S    F++ DLY AF +    K+ 
Sbjct  234  PKGG---CD-TYDTSTYLHNSLLREGLIKLNDKKINSNDNSFLVFDLYNAFVTIF--KNK  287

Query  351  QHPGKSSFPYPLAPCCL----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAV  518
              PG S FP PL  CC      +CG+V + G+K + LC DPK  FFWD  H + Q W +V
Sbjct  288  GVPGVSRFPEPLKACCPTERGKSCGDVGIHGEKLFTLCKDPKSFFFWDNVHITDQAWRSV  347

Query  519  YSAL  530
            +S L
Sbjct  348  FSLL  351



>gb|KEH42058.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=323

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 99/189 (52%), Gaps = 16/189 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y    G + G   F+ES+ +Q + NL  +  +G  ++ V  +QPLGCLP  T +
Sbjct  137  GNDYYDYMAIDGSLSGFPSFIESVIKQTTTNLIHLQSLGFKRIVVGDLQPLGCLPQAT-A  195

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG-SPFVILDLYAAFTSALNIKHDQHP  359
              ++ +C+   N++    N ++KQ + KLN +T+  + F IL L+ +F S LN     HP
Sbjct  196  QNSFQSCNSTFNDLVALRNNLMKQSITKLNQETKDHTTFTILGLFDSFRSVLN-----HP  250

Query  360  GKSSFPYPLAPCCLG-----NCGEVDVS-GKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
               +    L PCC+G       G VD       Y +C++ +  FFWD  HP+Q GW  VY
Sbjct  251  SSHNIKERLKPCCIGVSDEYTYGSVDSEHTTNKYLVCENLESTFFWDQLHPTQAGWNDVY  310

Query  522  SALKSSLPH  548
            + L+    H
Sbjct  311  NELEKRGLH  319



>emb|CDX95170.1| BnaC09g17000D [Brassica napus]
Length=340

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +3

Query  12   GNDYASYHGHIH--GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            GNDY  +        +  F+  +  Q+ VNL+RIH +G+ K+AV ++QPLG +P   F+ 
Sbjct  166  GNDYLYFLSTRSPAAILSFITQVVNQIEVNLRRIHSLGIKKIAVPSLQPLGYIPH--FAK  223

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGK  365
            G+ P      N +   HN +L + V KLN++T  S F I+D   AF + +N K  + P  
Sbjct  224  GS-PLIKAAVNFLVGHHNNLLHEVVAKLNNETNHSAFTIIDYNNAFLTVINNK-GEIPDI  281

Query  366  SSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
              F  P   C      ++DV+  K   LCDDP+ AFFWD  HP+Q+GW +VY+ L+ ++
Sbjct  282  LVFKTPSIECF-----QIDVNEFKNSTLCDDPRSAFFWDGLHPTQEGWKSVYTVLRKNI  335



>ref|XP_008791067.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Phoenix dactylifera]
Length=359

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY  Y   +G   G  +F   + + L  +LKRI   GVPKV VT + P+GC P +T  
Sbjct  175  GNDYKYYKETNGSDAGALDFANRLFQLLKSDLKRIQGAGVPKVLVTNLHPVGCTPYMTKV  234

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
            T N+  CD       + HNQ L+  + +LN       F  LDL+ +F S +N    Q  G
Sbjct  235  T-NHTKCDSTALGEAQAHNQKLEILIKELNG-ARTKTFFSLDLFTSFNSIIN----QVKG  288

Query  363  KSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               F   L PCC GN     C + D +G K Y LC +P   F+WD  HP+Q  W AV+  
Sbjct  289  APKFESILKPCCDGNDNSSTCAQTDDNGMKKYSLCSNPDSHFYWDWLHPTQAAWAAVFEY  348

Query  528  LKSSL  542
            LK +L
Sbjct  349  LKPAL  353



>ref|XP_010088766.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB36949.1| GDSL esterase/lipase [Morus notabilis]
Length=430

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 94/155 (61%), Gaps = 14/155 (9%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVE---SITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAV  173
            GNDYA+Y    G  + ME+      SI  QL VNLKRIH +GVPK+AVTA+QPLGCLP  
Sbjct  156  GNDYAAYIYKEGVNNNMEDLANVTMSIVNQLVVNLKRIHNLGVPKIAVTALQPLGCLPPF  215

Query  174  TFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQ  353
            T S  +Y NC +  N+++  HN++LKQ +   ++Q+E +  ++LDL+  F  A  +KH+ 
Sbjct  216  T-SPTSYRNCSKIWNSVSDSHNEILKQILQNSSNQSEKNVVLVLDLHKTFMYAFKMKHEN  274

Query  354  HPGKSSFPY--PLAPCCLG-----NCGEVDVSGKK  437
              G  +     PL PCC+G     +CG VD   ++
Sbjct  275  VTGNLTLGIDNPLKPCCVGISNGHSCGSVDGRSRR  309



>ref|XP_009414560.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 91/162 (56%), Gaps = 17/162 (10%)
 Frame = +3

Query  81   QLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRV  260
             L V+LKR+  +GVPKV VT + P+GC+P+ T  T NY  C  N ++    HN+    RV
Sbjct  185  HLKVDLKRLSHIGVPKVIVTNLHPIGCIPSYTRPT-NYTACYSNVSSAVAEHNR----RV  239

Query  261  DKLNDQTEG---SPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN-----CGE  416
            D+L  +  G   + F+ LD+  AF   LN+ H +  G     +PL PCC+       CGE
Sbjct  240  DELMQELGGGSDTTFLSLDVNTAF---LNVLH-RAKGAKEIKHPLVPCCVSRSNTTECGE  295

Query  417  VDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
            +D  G + YG+C  P+  F+WD  HP+Q GW A +  L+ SL
Sbjct  296  IDAKGNRLYGVCRRPEEHFYWDSVHPTQAGWAAAFEFLRPSL  337



>ref|XP_009386743.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 97/192 (51%), Gaps = 14/192 (7%)
 Frame = +3

Query  12   GNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY  +      ++  +  F++ +  QL  +LKR   +GVPKV VT + P+ C+P  T 
Sbjct  166  GNDYMHFSQLDPNYLLHLYRFMDRLFAQLKADLKRFDRIGVPKVVVTNLHPIQCIPYYTR  225

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
             T NY  C  N +     HN+ + + V++L+  +  + F+ LD+  AF++ L     Q  
Sbjct  226  QT-NYTICPANISAAVADHNRRVDRLVEELDGGSNTTTFLSLDVNTAFSNVLR----QVN  280

Query  360  GKSSFPYPLAPCC-----LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
            G  +  Y L PCC        C +VD  G K Y +C  P+  F+WD  HP+Q GW A + 
Sbjct  281  GAETIKYLLVPCCESSSGTAACSQVDAQGNKLYRVCRHPEEHFYWDSAHPTQAGWAAAFQ  340

Query  525  ALKSSLPHLFHP  560
             L+ SL     P
Sbjct  341  YLEPSLRSFLLP  352



>gb|AEW07962.1| hypothetical protein 0_15557_01, partial [Pinus radiata]
 gb|AFG43460.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43462.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43463.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43464.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
Length=137

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 9/145 (6%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  FVES+ +QLS +L R++ +G  + A+T M+PLGCLP+ T    ++ +C+   N + 
Sbjct  1    GVPSFVESLIKQLSADLVRLYNLGFRRFAITDMEPLGCLPSFTVDN-SHASCNATLNILA  59

Query  228  RFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN  407
             +HN +L++ V+ +      + FVILD Y+   +       QH GK  F  PL PCC G 
Sbjct  60   VYHNSLLQEAVEGIRKGRADATFVILDQYSDTMAVF-----QH-GK--FRKPLKPCCSGE  111

Query  408  CGEVDVSGKKGYGLCDDPKMAFFWD  482
            CG  D +GK  Y +C  P++AF+WD
Sbjct  112  CGVTDSAGKALYSVCTHPELAFYWD  136



>ref|NP_195979.1| GDSL esterase/lipase [Arabidopsis thaliana]
 emb|CAB82924.1| putative protein [Arabidopsis thaliana]
 gb|AED90631.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=231

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 9/118 (8%)
 Frame = +3

Query  201  CDENTNNITRFHNQMLKQRVDKLNDQ----TEGSPFVILDLYAAFTSALNIKHDQHPGKS  368
            C+E+ +++ R HN+ LK+ V KLN +    T+G  FVI+DL+ AF + L  K     G  
Sbjct  112  CNESYSDLVRLHNESLKKAVAKLNKEDKFRTKGDRFVIVDLHKAFMTILEKK-----GNK  166

Query  369  SFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             F  PL PCC G+C  +D+ G K Y LC+DPK AFFWD  +P+Q+GW ++YS L  SL
Sbjct  167  RFKSPLKPCCEGDCARMDMKGAKKYTLCNDPKSAFFWDEINPTQEGWRSIYSLLGKSL  224



>ref|XP_009394104.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 99/192 (52%), Gaps = 27/192 (14%)
 Frame = +3

Query  12   GNDYA-------SYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY         Y  H+HG   F+  +  QL V+LKR+  +GVP+V VT + P+GC+P 
Sbjct  170  GNDYQFLSELDPDYLHHLHG---FMHRLFAQLKVDLKRLSHIGVPEVIVTNLHPIGCVPY  226

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG---SPFVILDLYAAFTSALNI  341
             T  T  Y  C  N ++    HN+    RVD+L  +  G   + F+ LD+  AF   LN+
Sbjct  227  YTRPT-KYTACYSNVSSAVAEHNR----RVDELMQELGGGSDTTFLSLDVNTAF---LNV  278

Query  342  KHDQHPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQG  506
             H +  G     +PL PCC        CGE+D  G + Y +C  P+   +WD  HP+Q G
Sbjct  279  LH-RAKGAKEIKHPLVPCCESRSNTTECGEIDAEGNRLYRVCRRPEEHLYWDSVHPTQAG  337

Query  507  WFAVYSALKSSL  542
            W A +  L+ SL
Sbjct  338  WAAAFEFLRPSL  349



>ref|XP_003591760.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES62011.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=178

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 96/189 (51%), Gaps = 33/189 (17%)
 Frame = +3

Query  3    TSVGNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            ++ GNDY  +     G    +  F  S+  QLS NL+RI  +G+ K+A+  ++P+GCLP 
Sbjct  15   SAAGNDYLKFFVTNGGSTKDVPRFTASLVNQLSSNLRRIQSLGINKIAIGLLEPIGCLPM  74

Query  171  VTFS-TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKH  347
            VT + T +Y  C++N N     HN +L Q V++LN +   S FV LDLY +F S + +  
Sbjct  75   VTETETPSYEKCNDNFNLFAMNHNYLLLQAVEELNKEMGKSVFVTLDLYTSFLSIIALMQ  134

Query  348  DQHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
                G               CG V         +CD P+++FFW      + GWFAVY  
Sbjct  135  KNPNGMF-------------CGSV---------VCDKPELSFFW------ENGWFAVYQM  166

Query  528  LKSSLPHLF  554
            ++S+L   F
Sbjct  167  VQSNLKRKF  175



>ref|XP_006382790.1| hypothetical protein POPTR_0005s05460g [Populus trichocarpa]
 gb|ERP60587.1| hypothetical protein POPTR_0005s05460g [Populus trichocarpa]
Length=343

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = +3

Query  9    VGNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVT  176
             GNDY   +    G I  +      + +QL  N+K IHE+GV K+A+    P GC P + 
Sbjct  157  AGNDYTYLYLNQSGPIKDVHALAGRVVDQLVKNVKEIHELGVKKIAILGSPPRGCWPQL-  215

Query  177  FSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQH  356
             +     NC+   N  +RFHNQ+L + +  + +++E + FV LDLY A   AL     ++
Sbjct  216  -NPRPRTNCNATWNEESRFHNQLLTEALKNV-EESEKNAFVFLDLYKAMDLAL----QKN  269

Query  357  PGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVY  521
               S +  PL PCC G      CG  D  G + + +C  P+ +FFWD  HPSQ G  A++
Sbjct  270  KENSDYENPLEPCCDGVSDEYWCGMKDQKGAEMFTVCRQPESSFFWDKVHPSQNGVHAIF  329

Query  522  SALKSSLPHLF  554
              L  SL  L 
Sbjct  330  LDLIPSLERLL  340



>ref|XP_007221244.1| hypothetical protein PRUPE_ppa023460mg, partial [Prunus persica]
 gb|EMJ22443.1| hypothetical protein PRUPE_ppa023460mg, partial [Prunus persica]
Length=200

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 3/116 (3%)
 Frame = +3

Query  12   GNDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTG  188
            GNDYA+Y G H        +SI +QL+V+L+RIH + V K+AVTA+ PLGCLP +T S  
Sbjct  86   GNDYAAYLGNHTEDFAVVTKSIIKQLAVDLERIHGLRVRKIAVTAIGPLGCLPRMT-SFL  144

Query  189  NYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQ  353
            +Y NC E  + ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH Q
Sbjct  145  SYQNCSEVASLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKHYQ  200



>emb|CDX95179.1| BnaC09g16910D [Brassica napus]
Length=338

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 98/191 (51%), Gaps = 22/191 (12%)
 Frame = +3

Query  12   GNDYASYH-------GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY ++          + G + F+  +  Q  +NL++IH +GV K+A+ ++ PL  +P 
Sbjct  162  GNDYITFILANLKDPAKLLGFKTFISQVVNQTELNLRKIHTLGVKKIAIPSLTPLWYIPK  221

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
            +  S+           ++  FHN +L++ V KLN +   S F I+D Y  F +  N    
Sbjct  222  IANSS---LIIKVIVQDLVEFHNGLLQKSVVKLNKENNHSAFTIIDYYNTFLTIFN-NTG  277

Query  351  QHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            + PG  +F     PC LG+ G+V          CDDPK AFFWD  HP+Q+GW AVY  L
Sbjct  278  ETPGIPTFQNISIPC-LGDDGKV----------CDDPKSAFFWDGIHPTQEGWKAVYKVL  326

Query  531  KSSLPHLFHPQ  563
            + ++     P+
Sbjct  327  RHNITAALMPK  337



>gb|EMT03862.1| GDSL esterase/lipase [Aegilops tauschii]
Length=369

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 99/198 (50%), Gaps = 28/198 (14%)
 Frame = +3

Query  12   GNDYAS-------YHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY S       +      ++ ++ ++T ++  N+ ++ ++GV KV V  M P+GC P 
Sbjct  177  GNDYMSGADVKNSFLSSFDDIDTYIGNVTTEIVKNVVQLQKLGVKKVLVNNMHPIGCTPM  236

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             T ST NY  CD   N     HN+ LKQ + K N+        +LDLY AFT  +N    
Sbjct  237  RT-STNNYTTCDLLANYAASVHNKNLKQLMGKKNNA------YMLDLYTAFTDIIN----  285

Query  351  QHPGKSS-----FPYPLAPCC-----LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
              PG+ S     F   LAPCC      G CG+ D +G+  Y LC++P   F+WD  HP+ 
Sbjct  286  HAPGEGSDQSNMFNNNLAPCCEGFYDTGFCGQQDDTGEPLYELCENPNQLFYWDEVHPTH  345

Query  501  QGWFAVYSALKSSLPHLF  554
             GW AV  AL+  L    
Sbjct  346  AGWKAVMKALEQPLKEFL  363



>ref|XP_008232020.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Prunus mume]
Length=118

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 9/116 (8%)
 Frame = +3

Query  225  TRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQHPGKSSFPY-PLAPCC  398
            + FHN++L Q++++LN +T+ S FV LDLY AF SA+   KH  H G S+F    L PCC
Sbjct  3    SMFHNEILLQKLEELNKETKNSAFVDLDLYNAFISAVKPPKH--HQGYSTFHINTLKPCC  60

Query  399  LG-----NCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSLPHL  551
            +G     +CG VD +G K Y +CD+P ++FFWD  HPSQ GW  VY+A+K SL  L
Sbjct  61   VGVSNEYSCGSVDQTGAKKYIVCDNPDVSFFWDTVHPSQNGWHEVYAAIKPSLHQL  116



>gb|AFG43461.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43465.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43466.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43467.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43468.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43469.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43470.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43471.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43472.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43473.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43474.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
 gb|AFG43476.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
Length=137

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  FVES+ +QLS +L R++ +G  + A+T M+PLGCLP+ T    ++ +C+   N + 
Sbjct  1    GVPSFVESLIKQLSADLVRLYNLGFRRFAITDMEPLGCLPSFTVDN-SHASCNATLNILA  59

Query  228  RFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN  407
             +HN +L++ V+ +      + FVILD Y+   +       QH GK  F   L PCC G 
Sbjct  60   VYHNSLLQEAVEGIRKGRADATFVILDQYSDTMAVF-----QH-GK--FRKALKPCCSGE  111

Query  408  CGEVDVSGKKGYGLCDDPKMAFFWD  482
            CG  D +GK  Y +C  P++AF+WD
Sbjct  112  CGVTDSAGKALYSVCTHPELAFYWD  136



>ref|XP_009386744.1| PREDICTED: GDSL esterase/lipase At5g03610-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=351

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 96/192 (50%), Gaps = 18/192 (9%)
 Frame = +3

Query  12   GNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDY  +      ++  +  F++ +  QL  +LKR   +GVPKV VT + P+ C+P  T 
Sbjct  166  GNDYMHFSQLDPNYLLHLYRFMDRLFAQLKADLKRFDRIGVPKVVVTNLHPIQCIPYYTR  225

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHP  359
             T NY  C  N +     HN+ + + V++L+  +  + F+ LD+  AF++ L        
Sbjct  226  QT-NYTICPANISAAVADHNRRVDRLVEELDGGSNTTTFLSLDVNTAFSNVLR-------  277

Query  360  GKSSFPYPLAPCC-----LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYS  524
             + +  Y L PCC        C +VD  G K Y +C  P+  F+WD  HP+Q GW A + 
Sbjct  278  -QETIKYLLVPCCESSSGTAACSQVDAQGNKLYRVCRHPEEHFYWDSAHPTQAGWAAAFQ  336

Query  525  ALKSSLPHLFHP  560
             L+ SL     P
Sbjct  337  YLEPSLRSFLLP  348



>ref|XP_007221242.1| hypothetical protein PRUPE_ppa019084mg, partial [Prunus persica]
 gb|EMJ22441.1| hypothetical protein PRUPE_ppa019084mg, partial [Prunus persica]
Length=256

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  15   NDYASYHG-HIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGN  191
            NDYA+Y G H        +SI +QL+V+L+RIH + V K+AVTA+ PLGCLP +T S  +
Sbjct  143  NDYAAYFGNHTEDFAVVTKSIIKQLAVDLERIHGLRVRKIAVTAIGPLGCLPRMT-SFLS  201

Query  192  YPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNI-KHDQ  353
            Y NC E  N ++ FHNQ+L+Q+V++LN +T+ S FVILDLY A  SA+ + KH Q
Sbjct  202  YQNCSEVANLVSIFHNQILRQKVEELNKETKKSSFVILDLYNASLSAIMLPKHYQ  256



>ref|XP_002871045.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47304.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=231

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 9/118 (8%)
 Frame = +3

Query  201  CDENTNNITRFHNQMLKQRVDKLNDQ----TEGSPFVILDLYAAFTSALNIKHDQHPGKS  368
            C+E+ +++ R HN+ LK+ V KLN +    T+G  FVI+DL+ AF + L  K     G  
Sbjct  112  CNESYSDLVRLHNEGLKKVVAKLNKEDKFRTKGDRFVIVDLHKAFMAVLEKK-----GSK  166

Query  369  SFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             F  PL PCC G+C  +D+ G K Y LC+DPK AFFWD  +P+Q+ W ++YS L  SL
Sbjct  167  RFKTPLKPCCEGDCARMDMKGAKKYTLCNDPKSAFFWDEINPTQEVWRSIYSLLGKSL  224



>ref|XP_009113451.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Brassica rapa]
Length=343

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 96/192 (50%), Gaps = 24/192 (13%)
 Frame = +3

Query  12   GNDYASY--------HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLP  167
            GNDY +          G     + F+  +  Q  VNL+RIH +GV K+A+ ++ PL  +P
Sbjct  167  GNDYITLVRAYPNDPIGLYGAFKPFIRKVVNQTEVNLRRIHTLGVKKIAIPSLTPLWYIP  226

Query  168  AVTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKH  347
            A+     NY +      ++  +HN +L++ V KLN +   S F I+D Y  F +  N   
Sbjct  227  AL----ANYTSVAGIVQDLVEYHNALLQKSVAKLNKENNHSAFTIIDYYNTFLAIFN-NT  281

Query  348  DQHPGKSSFPYPLAPCCLGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSA  527
               PG  +F     PC LG+ G+V          CDD K AFFWD  HP+Q+GW +VY  
Sbjct  282  GGIPGIPTFQNISIPC-LGDDGKV----------CDDRKSAFFWDGIHPTQEGWKSVYKV  330

Query  528  LKSSLPHLFHPQ  563
            L+ ++     P+
Sbjct  331  LRHNITAALMPK  342



>ref|XP_011032560.1| PREDICTED: GDSL esterase/lipase At3g09930-like [Populus euphratica]
Length=309

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 99/193 (51%), Gaps = 16/193 (8%)
 Frame = +3

Query  3    TSVGNDYASYH----GHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            +  GNDY   +    G I  + +    + +QL  N+K IHE+GV K+A+    P GC P 
Sbjct  121  SDAGNDYTYLYLNQSGTIKDVHDLAGRVVDQLVKNVKEIHELGVKKIAILGSPPRGCWPQ  180

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
            +  +     NC+   N  +RFHNQ+L   +  + ++++ + FV LDLY A   AL     
Sbjct  181  L--NPRPRTNCNGTWNEESRFHNQLLTAALRNV-EESKKNAFVFLDLYKAMDLAL----Q  233

Query  351  QHPGKSSFPYPLAPCCLGN-----CGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFA  515
            ++   S++  PL PCC G      CG  D  G + + +C  P+ +FFWD  HPSQ G  A
Sbjct  234  KNKENSNYGNPLEPCCDGVTDAYWCGMKDQKGAEMFTVCRHPESSFFWDKVHPSQNGVHA  293

Query  516  VYSALKSSLPHLF  554
            ++  L  SL  L 
Sbjct  294  IFLDLIPSLERLL  306



>ref|XP_002524980.1| hypothetical protein RCOM_1085850 [Ricinus communis]
 gb|EEF37387.1| hypothetical protein RCOM_1085850 [Ricinus communis]
Length=164

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY +Y   +G +  M  F  S+ +QLS NLKRIH +GV KVAVT++QP+GCLP +  S
Sbjct  33   GNDYNTYLYKNGALEDMSNFTASLIKQLSTNLKRIHGLGVQKVAVTSLQPIGCLPELAAS  92

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEG-SPFVILDLYAAFTSALN  338
            +  Y NC E+ N  + FHN +L+Q V KLN++++    + ILDLY+AF SA +
Sbjct  93   SS-YQNCSESLNAASEFHNLILQQAVQKLNNESQKHVVYEILDLYSAFMSAFS  144



>gb|AFG43475.1| hypothetical protein 0_15557_01, partial [Pinus taeda]
Length=137

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 84/145 (58%), Gaps = 9/145 (6%)
 Frame = +3

Query  48   GMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNIT  227
            G+  FVES+ +QLS +L R + +G  + A+T M+PLGCLP+ T    ++ +C+   N + 
Sbjct  1    GVPSFVESLIKQLSADLVRSYNLGFRRFAITDMEPLGCLPSFTVDN-SHASCNATLNILA  59

Query  228  RFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGN  407
             +HN +L++ V+ +      + FVILD Y+   +       QH GK  F   L PCC G 
Sbjct  60   VYHNSLLQEAVEGIRKGRADATFVILDQYSDTMAVF-----QH-GK--FRKALKPCCSGE  111

Query  408  CGEVDVSGKKGYGLCDDPKMAFFWD  482
            CG  D +GK  Y +C  P++AF+WD
Sbjct  112  CGVTDSAGKALYSVCTHPELAFYWD  136



>gb|EMT06663.1| GDSL esterase/lipase [Aegilops tauschii]
Length=367

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 97/194 (50%), Gaps = 28/194 (14%)
 Frame = +3

Query  12   GNDYAS-------YHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY S       ++     ++ +V ++  ++  N+ ++  +GV KV V  + P+GC P 
Sbjct  175  GNDYMSDSDIETGFYTSFDDLDTYVGNVATEILDNVAQLQMLGVRKVIVNNLHPIGCTPL  234

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             T S+ NY  CD   N     HN+ LKQ +++ ++        ILDLY AFT  +N    
Sbjct  235  HT-SSNNYTTCDLLGNYGASVHNKYLKQMLEERDN------VHILDLYTAFTDIIN----  283

Query  351  QHPGKSS-----FPYPLAPCCL-----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
              PG  S     F   L PCC      G CGE   SGK+ Y LCD P   F+WD THP+ 
Sbjct  284  HAPGGGSAESKNFKGKLTPCCESTYKGGYCGERSNSGKRLYDLCDTPDRMFYWDQTHPTH  343

Query  501  QGWFAVYSALKSSL  542
             GW AV  AL+  L
Sbjct  344  AGWEAVMKALQQPL  357



>ref|XP_008354861.1| PREDICTED: GDSL esterase/lipase At5g03610-like [Malus domestica]
Length=299

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = +3

Query  12   GNDYASYHGHI----HGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTF  179
            GNDYA++          + EF +S+ +Q++V+L+RI ++GVPK+AVTA++P+GC+P +T 
Sbjct  174  GNDYATHMVKTGNGSEDLAEFTKSVVKQIAVDLRRIRDLGVPKIAVTAVEPMGCIPRLT-  232

Query  180  STGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFT  326
            S  +Y NC E+ N  + FHNQ+L+Q V++LN ++  S FVILDLY AF+
Sbjct  233  SLLSYQNCSESLNLASVFHNQVLRQNVEQLNKESNNSAFVILDLYDAFS  281



>gb|EMT25368.1| GDSL esterase/lipase [Aegilops tauschii]
Length=367

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 99/194 (51%), Gaps = 28/194 (14%)
 Frame = +3

Query  12   GNDYAS-------YHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY S       ++     ++ ++ ++  ++  N+ ++  +GV KV V  + P+GC P 
Sbjct  175  GNDYMSDSDFETGFYTSFDDLDTYIGNVATEILDNVAQLQMLGVRKVLVNNLHPIGCTPL  234

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             T S+ NY  CD   N     HN+ LKQ +D+ ++        ILDLY AFT  +N    
Sbjct  235  HT-SSNNYTTCDLLGNYGASVHNKYLKQMLDERDN------VHILDLYTAFTDIVN----  283

Query  351  QHPGKSS-----FPYPLAPCCL-----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
              PG  S     F   L+PCC      G CGE   SGK+ Y LC++P   F+WD THP+ 
Sbjct  284  HAPGGGSDQSKDFKGKLSPCCESTDEGGFCGERSHSGKRLYDLCENPDKTFYWDQTHPTH  343

Query  501  QGWFAVYSALKSSL  542
             GW AV  AL+  L
Sbjct  344  AGWEAVMMALQQPL  357



>gb|EMT31784.1| GDSL esterase/lipase [Aegilops tauschii]
Length=367

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 98/194 (51%), Gaps = 28/194 (14%)
 Frame = +3

Query  12   GNDYAS-------YHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPA  170
            GNDY S       ++     ++ +V ++  ++  N+ ++  +GV KV V  + P+GC P 
Sbjct  175  GNDYMSDSDIETGFYTSFDDLDTYVGNVATEILDNVAQLQMLGVRKVLVNNLHPIGCTPL  234

Query  171  VTFSTGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHD  350
             T S+ NY  CD   N     HN+ LKQ +++ ++        ILDLY AFT+ +N    
Sbjct  235  HT-SSNNYTTCDLLGNYGASVHNKYLKQMLEERDN------VHILDLYTAFTNIIN----  283

Query  351  QHPGKSS-----FPYPLAPCCL-----GNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQ  500
              PG  S     F   L PCC      G CGE   SGK+ Y LC+ P   F+WD THP+ 
Sbjct  284  HAPGGGSAESKNFKGKLTPCCESAYKGGYCGERSHSGKRLYDLCETPDKMFYWDQTHPTH  343

Query  501  QGWFAVYSALKSSL  542
             GW AV  AL+  L
Sbjct  344  AGWEAVMKALQQPL  357



>gb|AFG65479.1| hypothetical protein 0_7948_01, partial [Pinus taeda]
 gb|AFG65480.1| hypothetical protein 0_7948_01, partial [Pinus taeda]
Length=151

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 5/153 (3%)
 Frame = +3

Query  84   LSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFSTGNYPNCDENTNNITRFHNQMLKQRVD  263
            LS +L R++ +G  + AVT M P+GCLPAVT    +Y  C+   N +  +HN +L  R+ 
Sbjct  1    LSDDLVRLYNIGFRRFAVTNMAPMGCLPAVTIQ-NSYTRCNSTLNTLAIYHNSLLLGRLQ  59

Query  264  KLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGKSSFPYPLAPCCLGNCGEVDVSGKKGY  443
             L      + FV+LD Y+   S   I++    G  +   PL PCC G CG  D +GK  +
Sbjct  60   MLRFSRADATFVLLDQYS--DSLTIIRNPNLYG--NLQEPLKPCCTGWCGYKDQAGKPVF  115

Query  444  GLCDDPKMAFFWDMTHPSQQGWFAVYSALKSSL  542
             +C  P+  FFWD+ HP+Q  W A+ +  +  L
Sbjct  116  SVCSHPESHFFWDIVHPTQAAWEALMTLFEPPL  148



>ref|XP_002450131.1| hypothetical protein SORBIDRAFT_05g000990 [Sorghum bicolor]
 gb|EES09119.1| hypothetical protein SORBIDRAFT_05g000990 [Sorghum bicolor]
Length=345

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 22/188 (12%)
 Frame = +3

Query  6    SVGNDYASYHGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFST  185
            S G+DY+        ++ ++E +T+ +   +KR+  MGV KV V +M PLGC P     +
Sbjct  172  SNGHDYSHASDTTSQLDAYIEDVTDGIVEGVKRLQGMGVSKVVVNSMPPLGCSPWRARQS  231

Query  186  GNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPGK  365
              Y  CD+  N +   HN +L++++D L D       ++LDLY+ F +          G 
Sbjct  232  VGYAQCDDVGNTVATTHNTLLRRKLDGLQD------VLVLDLYSTFDTLAR----SMSGS  281

Query  366  SSFPYPLAPCC-----LGNCGEVDVSGKKGYGLCDDPKMAFFWDMTHPSQQGWFAVYSAL  530
            +       PCC        CG+VD +G+  Y +C +P  +F+WD  +P+Q GW AV   L
Sbjct  282  T-------PCCDTSEHKAYCGQVDGNGRAQYTVCANPDKSFYWDNENPTQAGWEAVMDRL  334

Query  531  KSSLPHLF  554
            ++++ +  
Sbjct  335  QANIQNFL  342



>ref|XP_007027684.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY08186.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
Length=290

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = +3

Query  12   GNDYASY---HGHIHGMEEFVESITEQLSVNLKRIHEMGVPKVAVTAMQPLGCLPAVTFS  182
            GNDY++Y   +G   G   F+ES+  QL+VNL+RIH +GV K+AV+A+QPLGCLP  T +
Sbjct  165  GNDYSAYIARNGSAAGFPAFIESVVSQLTVNLERIHGLGVRKIAVSALQPLGCLPQST-A  223

Query  183  TGNYPNCDENTNNITRFHNQMLKQRVDKLNDQTEGSPFVILDLYAAFTSALNIKHDQHPG  362
              ++  C+   N +   HNQ+L Q V+ LN +T  +  ++LDLY AF +  N K + H  
Sbjct  224  QFSFEQCNATENTLVNLHNQLLVQAVNNLNKKTNSTSVIVLDLYDAFWTVFNQK-EAHQV  282

Query  363  KSSFPYPL  386
              +F  P 
Sbjct  283  SPTFENPF  290



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1284566944336