BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25237_g1_i2 len=1459 path=[3529:0-321 572:322-352 601:353-389
5092:390-393 173:394-399 179:400-435 681:436-472 718:473-503
749:504-513 759:514-693 939:694-809 1055:810-828 1074:829-869
1115:870-924 1170:925-995 1241:996-1031 1277:1032-1077
1323:1078-1122 1367:1123-1169 144:1170-1458]

Length=1459
                                                                      Score     E

gb|AIW09148.1|  progesterone 5-beta-reductase 6                         518   1e-178   
ref|XP_006478688.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    478   1e-162   
ref|XP_006443046.1|  hypothetical protein CICLE_v10020613mg             477   2e-162   
ref|XP_006443045.1|  hypothetical protein CICLE_v10020568mg             476   6e-162   
ref|XP_006478687.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    474   2e-161   
ref|XP_006372881.1|  hypothetical protein POPTR_0017s05940g             474   2e-161   
ref|XP_006443047.1|  hypothetical protein CICLE_v10023804mg             474   4e-161   
ref|XP_011037153.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    473   4e-161   
gb|KHN02917.1|  Hypothetical protein glysoja_009783                     468   4e-159   
ref|XP_003529541.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    468   4e-159   
ref|XP_011037089.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    468   5e-159   
ref|XP_007154348.1|  hypothetical protein PHAVU_003G111200g             468   7e-159   
gb|AHA84141.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase               464   2e-157   
ref|XP_007154725.1|  hypothetical protein PHAVU_003G142200g             464   2e-157   
ref|XP_006372880.1|  hypothetical protein POPTR_0017s05930g             463   7e-157   
ref|XP_003609735.1|  hypothetical protein MTR_4g121570                  461   3e-156   
gb|ABK96577.1|  unknown                                                 461   5e-156   Populus trichocarpa x Populus deltoides
ref|XP_010649532.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    460   1e-155   
gb|KDO36187.1|  hypothetical protein CISIN_1g037566mg                   456   2e-154   
ref|XP_007022522.1|  NAD(P)-binding Rossmann-fold superfamily pro...    456   5e-154   
ref|XP_007154349.1|  hypothetical protein PHAVU_003G111300g             455   7e-154   
ref|XP_002276159.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    455   8e-154   Vitis vinifera
ref|XP_003607179.1|  hypothetical protein MTR_4g073090                  445   7e-150   
ref|XP_010098784.1|  hypothetical protein L484_000585                   442   7e-149   
ref|XP_003609737.1|  hypothetical protein MTR_4g121590                  431   1e-144   
ref|XP_004508264.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    431   2e-144   
ref|XP_010671934.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    424   7e-142   
ref|XP_010671660.1|  PREDICTED: iridoid synthase-like                   422   7e-141   
ref|XP_010259353.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    414   1e-137   
gb|KDO47323.1|  hypothetical protein CISIN_1g0426562mg                  315   4e-101   
gb|ABR16709.1|  unknown                                                 317   2e-99    Picea sitchensis
gb|ABK24388.1|  unknown                                                 315   5e-99    Picea sitchensis
gb|ABK24243.1|  unknown                                                 313   4e-98    Picea sitchensis
gb|ABR16676.1|  unknown                                                 313   5e-98    Picea sitchensis
ref|XP_006847874.1|  hypothetical protein AMTR_s00029p00093020          292   3e-90    
ref|XP_002518657.1|  conserved hypothetical protein                     290   2e-89    Ricinus communis
ref|XP_010271744.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    288   8e-89    
ref|XP_007042587.1|  Progesterone 5-beta-reductase, putative isof...    286   9e-88    
ref|XP_007042586.1|  Progesterone 5-beta-reductase, putative isof...    286   2e-87    
gb|AIW09147.1|  progesterone 5-beta-reductase 5                         283   6e-87    
gb|AIW09146.1|  progesterone 5-beta-reductase 4                         283   1e-86    
gb|AHA82033.1|  iridoid synthase                                        282   3e-86    
ref|XP_004289734.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    282   3e-86    
sp|K7WDL7.1|IRIS_CATRO  RecName: Full=Iridoid synthase                  281   4e-86    
gb|KHG08322.1|  Uncharacterized protein F383_14595                      281   9e-86    
ref|XP_006420622.1|  hypothetical protein CICLE_v10006945mg             280   1e-85    
ref|XP_006472268.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    280   3e-85    
ref|XP_006472267.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    279   3e-85    
emb|CDP01225.1|  unnamed protein product                                277   1e-84    
ref|XP_007223008.1|  hypothetical protein PRUPE_ppa006816mg             278   1e-84    
gb|AFN22088.1|  putative progesterone 5-beta-reductase                  278   1e-84    
gb|AFZ41790.1|  putative progesterone 5-beta-reductase                  277   2e-84    
gb|AFW16644.1|  putative progesterone 5beta-reductase                   277   3e-84    
ref|XP_001754205.1|  predicted protein                                  276   5e-84    
gb|AFZ42259.1|  putative progesterone 5-beta-reductase                  276   6e-84    
ref|XP_006471285.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    276   6e-84    
ref|XP_006432523.1|  hypothetical protein CICLE_v10001412mg             276   6e-84    
ref|XP_006432524.1|  hypothetical protein CICLE_v10001422mg             276   7e-84    
ref|XP_006432526.1|  hypothetical protein CICLE_v10001422mg             276   8e-84    
gb|AFZ42258.1|  putative progesterone 5-beta-reductase                  275   1e-83    
ref|XP_008351978.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    275   2e-83    
ref|XP_010905261.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    275   2e-83    
gb|AGT29342.1|  putative progesterone 5-beta reductase                  275   2e-83    
ref|XP_010520747.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    274   2e-83    
ref|XP_006433105.1|  hypothetical protein CICLE_v10001393mg             275   2e-83    
gb|ADK13080.1|  putative progesterone 5-beta-reductase                  274   3e-83    
gb|AFZ41795.1|  putative progesterone 5-beta-reductase                  274   4e-83    
ref|XP_002302422.2|  hypothetical protein POPTR_0002s12170g             274   4e-83    Populus trichocarpa [western balsam poplar]
ref|XP_003638459.1|  Progesterone 5-beta-reductase                      274   4e-83    
ref|XP_004300685.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    274   4e-83    
gb|KDO81569.1|  hypothetical protein CISIN_1g0159921mg                  273   4e-83    
ref|XP_006433601.1|  hypothetical protein CICLE_v10001445mg             273   5e-83    
ref|XP_006432519.1|  hypothetical protein CICLE_v10001420mg             273   6e-83    
ref|XP_006471279.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   6e-83    
ref|XP_009599751.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   6e-83    
gb|KDP41649.1|  hypothetical protein JCGZ_16056                         273   7e-83    
ref|XP_008377976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   7e-83    
gb|ABD33275.2|  progesterone 5-beta-reductase, putative                 273   8e-83    Medicago truncatula
ref|XP_004152001.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   8e-83    
gb|KDO81568.1|  hypothetical protein CISIN_1g0159921mg                  273   1e-82    
ref|XP_010111562.1|  hypothetical protein L484_011348                   273   1e-82    
gb|KDO81567.1|  hypothetical protein CISIN_1g0159921mg                  273   1e-82    
emb|CDY08911.1|  BnaC08g11410D                                          272   1e-82    
ref|XP_011017142.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    272   2e-82    
ref|XP_011017141.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    272   2e-82    
ref|XP_003589112.1|  hypothetical protein MTR_1g018610                  273   3e-82    
gb|AFW16645.1|  putative progesterone 5beta-reductase                   271   3e-82    
ref|XP_006471280.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    271   3e-82    
ref|XP_006472269.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    271   3e-82    
gb|ABD33273.2|  VEP1 , putative                                         272   4e-82    Medicago truncatula
gb|AES59361.2|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    271   4e-82    
gb|AHZ44505.1|  putative progesterone 5 beta-reductase                  271   5e-82    
ref|XP_010939097.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   5e-82    
ref|XP_006450012.1|  hypothetical protein CICLE_v10013989mg             271   6e-82    
ref|XP_003598452.1|  Progesterone 5-beta-reductase                      271   6e-82    
gb|AEX31541.1|  putative steroid 5beta-reductase                        270   8e-82    
ref|XP_008220298.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    270   8e-82    
ref|XP_006471790.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    271   8e-82    
gb|AEY82379.1|  putative progesterone 5-beta-reductase                  270   9e-82    
ref|XP_006471792.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    270   1e-81    
gb|AGL96526.1|  putative progesterone 5-beta-reductase                  270   1e-81    
ref|XP_006433602.1|  hypothetical protein CICLE_v10001370mg             270   1e-81    
ref|XP_008790634.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    270   1e-81    
ref|XP_003589110.1|  hypothetical protein MTR_1g018590                  270   1e-81    
gb|ADG56544.1|  progesterone 5-beta-reductase                           270   1e-81    
ref|XP_008220361.1|  PREDICTED: uncharacterized protein LOC103320460    281   1e-81    
ref|XP_011069776.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    270   1e-81    
ref|XP_007018551.1|  NAD(P)-binding Rossmann-fold superfamily pro...    270   1e-81    
gb|ADG56542.1|  progesterone 5-beta-reductase                           270   2e-81    
gb|AEZ01594.1|  progesterone 5-beta-reductase                           270   2e-81    
ref|XP_009360365.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   2e-81    
gb|ADG46023.1|  progesterone 5-beta-reductase                           269   2e-81    
ref|XP_006495229.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   3e-81    
ref|NP_001266103.1|  putative steroid 5beta-reductase                   269   3e-81    
ref|XP_006489807.1|  PREDICTED: uncharacterized protein LOC102610524    280   3e-81    
gb|AFK42748.1|  unknown                                                 269   3e-81    
ref|XP_002272271.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   3e-81    Vitis vinifera
gb|ADG41743.1|  putative progesterone 5 beta-reductase                  269   3e-81    
ref|XP_009360382.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   3e-81    
ref|XP_009771311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   3e-81    
ref|NP_001078438.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase          269   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109253.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   4e-81    
ref|XP_011028990.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   4e-81    
gb|AEZ01593.1|  progesterone 5-beta-reductase                           269   4e-81    
ref|XP_010448593.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    268   4e-81    
ref|XP_007136737.1|  hypothetical protein PHAVU_009G070100g             268   4e-81    
gb|AEO36945.1|  progesterone 5beta-reductase                            268   4e-81    
ref|NP_194153.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase             268   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285152.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    268   4e-81    Vitis vinifera
ref|XP_008790041.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   5e-81    
gb|AGN74845.1|  putative enone 5-beta-reductase                         268   5e-81    
gb|AEO36946.1|  progesterone 5beta-reductase                            268   5e-81    
ref|XP_002510123.1|  conserved hypothetical protein                     268   6e-81    Ricinus communis
gb|AHZ44506.1|  putative progesterone 5 beta-reductase                  268   6e-81    
ref|XP_003638458.1|  Progesterone 5-beta-reductase                      268   6e-81    
ref|XP_009396895.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    268   7e-81    
gb|AIA58905.1|  putative progesterone 5-beta-reductase                  268   7e-81    
ref|XP_006433107.1|  hypothetical protein CICLE_v10001388mg             268   8e-81    
ref|XP_006665039.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    268   8e-81    
gb|AGT29341.1|  putative progesterone 5-beta reductase                  268   8e-81    
ref|XP_007223026.1|  hypothetical protein PRUPE_ppa006894mg             268   1e-80    
gb|ADG56540.1|  progesterone 5-beta-reductase                           267   1e-80    
gb|AHI88613.1|  putative steroid 5-beta-reductase                       268   1e-80    
ref|XP_006433101.1|  hypothetical protein CICLE_v10001374mg             268   1e-80    
gb|ADG56539.1|  progesterone 5-beta-reductase                           267   1e-80    
gb|AFZ41789.1|  putative progesterone 5-beta-reductase                  267   1e-80    
ref|XP_003636813.1|  Progesterone 5-beta-reductase                      267   1e-80    
gb|AEX31544.1|  putative steroid 5beta-reductase                        267   2e-80    
ref|XP_010673631.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    267   2e-80    
ref|XP_003525919.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    267   2e-80    
ref|XP_006353962.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    267   2e-80    
gb|ADG56545.1|  progesterone 5-beta-reductase                           267   2e-80    
gb|ADG56543.1|  progesterone 5-beta-reductase                           267   2e-80    
ref|XP_006367946.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   3e-80    
ref|XP_008393755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   3e-80    
dbj|BAH47641.1|  progesterone 5beta reductase-B                         266   3e-80    Nicotiana tabacum [American tobacco]
ref|XP_008393756.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   3e-80    
ref|XP_010277137.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   3e-80    
ref|XP_009137807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   3e-80    
ref|XP_006471787.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   4e-80    
ref|XP_006432505.1|  hypothetical protein CICLE_v10001414mg             266   4e-80    
ref|XP_010521424.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   4e-80    
gb|AAO63776.1|  unknown                                                 266   4e-80    Populus tremuloides
gb|AHZ44508.1|  putative progesterone 5 beta-reductase                  266   4e-80    
gb|ADG56546.1|  progesterone 5-beta-reductase                           266   6e-80    
ref|XP_007223050.1|  hypothetical protein PRUPE_ppa006944mg             265   7e-80    
ref|XP_008447374.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    265   7e-80    
emb|CDY03474.1|  BnaC01g16080D                                          265   8e-80    
ref|XP_010059860.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    265   8e-80    
gb|AFZ41796.1|  putative progesterone 5-beta-reductase                  265   9e-80    
ref|XP_009354120.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    265   1e-79    
gb|AEY82380.1|  putative progesterone 5-beta-reductase                  265   1e-79    
ref|XP_008356369.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    265   1e-79    
gb|AEO36947.1|  progesterone 5beta-reductase                            265   2e-79    
ref|XP_002869731.1|  hypothetical protein ARALYDRAFT_914168             264   2e-79    
gb|EPS65468.1|  progesterone 5-beta-reductase                           264   2e-79    
gb|AEO36948.1|  progesterone 5beta-reductase                            264   2e-79    
ref|XP_004248770.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    264   2e-79    
ref|XP_008360976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    264   2e-79    
ref|XP_006387765.1|  hypothetical protein POPTR_0602s00210g             264   2e-79    
gb|ABK96579.1|  unknown                                                 264   2e-79    Populus trichocarpa x Populus deltoides
emb|CDP01226.1|  unnamed protein product                                263   2e-79    
ref|XP_004499012.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    264   3e-79    
gb|AHZ44504.1|  putative progesterone 5 beta-reductase                  263   3e-79    
ref|XP_006387764.1|  hypothetical protein POPTR_0602s00200g             265   4e-79    
gb|AFK45113.1|  unknown                                                 263   4e-79    
gb|ADG46028.1|  putative progesterone 5-beta-reductase                  263   4e-79    
gb|ADG56538.1|  progesterone 5-beta-reductase                           263   5e-79    
gb|AHI88616.2|  progesterone 5-beta-reductase                           263   5e-79    
ref|XP_007226426.1|  hypothetical protein PRUPE_ppa023813mg             263   5e-79    
ref|XP_006283899.1|  hypothetical protein CARUB_v10005016mg             262   1e-78    
ref|XP_009360316.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    262   1e-78    
emb|CDM86919.1|  unnamed protein product                                263   1e-78    
ref|XP_009360311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    262   1e-78    
ref|XP_006284965.1|  hypothetical protein CARUB_v10006268mg             262   1e-78    
ref|XP_006413460.1|  hypothetical protein EUTSA_v10025425mg             262   2e-78    
ref|XP_006374843.1|  hypothetical protein POPTR_0014s01960g             261   2e-78    
gb|AHI88614.1|  putative progesterone 5-beta-reductase                  261   2e-78    
ref|XP_010530504.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    261   2e-78    
dbj|BAK04809.1|  predicted protein                                      262   2e-78    
gb|AIW09144.1|  progesterone 5-beta-reductase 2                         261   2e-78    
gb|EYU37596.1|  hypothetical protein MIMGU_mgv1a007982mg                261   3e-78    
ref|XP_010092100.1|  hypothetical protein L484_001148                   256   3e-78    
dbj|BAJ93442.1|  predicted protein                                      261   3e-78    
ref|XP_009406008.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    261   3e-78    
ref|XP_002991994.1|  hypothetical protein SELMODRAFT_186462             259   8e-78    
gb|AHZ44509.1|  putative progesterone 5 beta-reductase                  259   1e-77    
ref|XP_003636810.1|  Progesterone 5-beta-reductase                      270   1e-77    
ref|XP_011042197.1|  PREDICTED: uncharacterized protein LOC105137942    270   2e-77    
ref|XP_006387422.1|  hypothetical protein POPTR_1058s00200g             259   2e-77    
ref|XP_011092523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    259   2e-77    
ref|XP_006374842.1|  hypothetical protein POPTR_0014s01950g             259   2e-77    
ref|XP_010099074.1|  hypothetical protein L484_011508                   258   3e-77    
ref|XP_011016706.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    258   3e-77    
ref|XP_004501803.1|  PREDICTED: uncharacterized protein LOC101510608    269   4e-77    
gb|AGM16376.1|  putative progesterone 5-beta-reductase                  258   5e-77    
gb|AIW09143.1|  progesterone 5-beta-reductase 1                         258   6e-77    
gb|AEX31542.1|  putative steroid 5beta-reductase                        257   1e-76    
gb|AHZ44507.1|  putative progesterone 5 beta-reductase                  257   1e-76    
ref|XP_002969677.1|  hypothetical protein SELMODRAFT_92604              256   2e-76    
emb|CAN63254.1|  hypothetical protein VITISV_028488                     269   3e-76    Vitis vinifera
ref|XP_002981288.1|  hypothetical protein SELMODRAFT_444825             256   4e-76    
ref|XP_002989828.1|  hypothetical protein SELMODRAFT_160458             254   4e-76    
ref|XP_002465092.1|  hypothetical protein SORBIDRAFT_01g031950          255   5e-76    Sorghum bicolor [broomcorn]
emb|CDM86889.1|  unnamed protein product                                255   6e-76    
gb|AIW09145.1|  progesterone 5-beta-reductase 3                         255   6e-76    
ref|XP_010905259.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    256   6e-76    
gb|EAY90583.1|  hypothetical protein OsI_12184                          255   7e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_010905260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    255   8e-76    
ref|XP_002960184.1|  hypothetical protein SELMODRAFT_74145              254   1e-75    
ref|XP_011017140.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    254   1e-75    
ref|XP_011088171.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    254   2e-75    
ref|XP_011022580.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    254   2e-75    
ref|XP_004983958.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    254   2e-75    
ref|NP_001050440.1|  Os03g0436400                                       254   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386483.1|  hypothetical protein POPTR_0002s12150g             253   3e-75    
gb|EYU37597.1|  hypothetical protein MIMGU_mgv11b006498mg               253   3e-75    
tpg|DAA45880.1|  TPA: hypothetical protein ZEAMMB73_620077              253   3e-75    
ref|XP_003562377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    253   3e-75    
ref|XP_002304533.1|  hypothetical protein POPTR_0003s13440g             253   4e-75    Populus trichocarpa [western balsam poplar]
gb|ABD33272.2|  hypothetical protein MtrDRAFT_AC158501g31v2             252   4e-75    Medicago truncatula
ref|XP_008236416.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(...    253   4e-75    
ref|XP_002967521.1|  hypothetical protein SELMODRAFT_86439              253   4e-75    
ref|XP_010556421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    253   5e-75    
ref|XP_011088182.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    253   5e-75    
ref|XP_011029002.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    253   5e-75    
ref|XP_011088183.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    253   6e-75    
ref|XP_010556422.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    252   7e-75    
ref|XP_007201077.1|  hypothetical protein PRUPE_ppa006872mg             252   1e-74    
emb|CDO97253.1|  unnamed protein product                                251   1e-74    
ref|XP_008657260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    252   1e-74    
gb|ABK96780.1|  unknown                                                 251   1e-74    Populus trichocarpa x Populus deltoides
ref|XP_002449263.1|  hypothetical protein SORBIDRAFT_05g006930          252   2e-74    Sorghum bicolor [broomcorn]
gb|ACZ66261.1|  progesterone 5beta-reductase 2                          251   2e-74    Digitalis purpurea
gb|ADG46029.1|  putative progesterone 5-beta-reductase                  251   2e-74    
ref|XP_002989827.1|  hypothetical protein SELMODRAFT_235888             250   2e-74    
ref|XP_010687527.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    250   4e-74    
ref|XP_009771310.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    250   5e-74    
ref|XP_009762620.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    250   6e-74    
ref|XP_009593701.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    250   6e-74    
ref|XP_011088173.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    249   9e-74    
gb|AFW97632.1|  putative progesterone 5-beta-reductase                  249   1e-73    
ref|XP_002991996.1|  hypothetical protein SELMODRAFT_448626             249   1e-73    
gb|ABK95134.1|  unknown                                                 248   2e-73    Populus trichocarpa [western balsam poplar]
gb|ADG46022.1|  progesterone 5-beta-reductase                           248   2e-73    
ref|XP_007222999.1|  hypothetical protein PRUPE_ppa006780mg             248   3e-73    
ref|XP_006374844.1|  hypothetical protein POPTR_0014s01970g             247   9e-73    
ref|XP_006366601.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    246   1e-72    
ref|NP_001167740.1|  hypothetical protein                               246   2e-72    Zea mays [maize]
gb|AGT29344.1|  putative progesterone 5-beta reductase 1_2              245   3e-72    
gb|AFZ41791.1|  putative progesterone 5-beta-reductase                  244   7e-72    
gb|AAU88205.1|  progesterone 5-beta-reductase                           244   1e-71    Digitalis thapsi
gb|AFZ42257.2|  putative progesterone 5-beta-reductase                  244   1e-71    
gb|ADG46027.1|  putative progesterone 5-beta-reductase                  244   1e-71    
ref|XP_002991995.1|  hypothetical protein SELMODRAFT_448625             243   1e-71    
gb|AFD96485.1|  putative enone 5-beta-reductase                         243   1e-71    
emb|CDX92623.1|  BnaC07g38810D                                          243   2e-71    
gb|AAU88203.1|  progesterone 5-beta-reductase                           243   3e-71    Digitalis purpurea subsp. heywoodii
gb|AAS93802.1|  progesterone 5-beta-reductase                           243   4e-71    Digitalis grandiflora
ref|XP_003589109.1|  hypothetical protein MTR_1g018580                  242   4e-71    
gb|ABF51668.1|  progesterone 5-beta-reductase                           242   4e-71    
gb|ABB36654.1|  progesterone 5beta-reductase                            242   5e-71    
gb|AAS93803.1|  progesterone 5-beta-reductase                           242   6e-71    
ref|XP_008367783.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    241   7e-71    
gb|AEW67077.1|  putative progesterone 5-beta-reductase                  241   9e-71    
ref|XP_004299763.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    241   9e-71    
ref|XP_006432520.1|  hypothetical protein CICLE_v10003925mg             242   1e-70    
pdb|2V6F|A  Chain A, Structure Of Progesterone 5beta-Reductase Fr...    241   1e-70    
gb|AAU88204.1|  progesterone 5-beta-reductase                           241   1e-70    
gb|ABA77555.1|  progesterone 5-beta-reductase                           241   1e-70    
gb|ABA77554.1|  progesterone 5-beta-reductase                           241   1e-70    
gb|AAU95076.1|  progesterone 5 beta reductase                           241   1e-70    
gb|ABB72433.1|  progesterone 5-beta-reductase                           241   2e-70    
gb|AGN74846.1|  putative enone 5-beta-reductase                         241   2e-70    
ref|XP_006372879.1|  hypothetical protein POPTR_0017s05920g             235   2e-70    
gb|AEW67079.1|  putative progesterone 5-beta-reductase                  241   2e-70    
gb|ABB36652.1|  progesterone 5beta-reductase                            240   2e-70    
emb|CAD87012.1|  putative progesterone 5-beta-reductase                 240   2e-70    
gb|ABA77559.1|  progesterone 5-beta-reductase                           240   2e-70    
gb|AEW67076.1|  putative progesterone 5-beta-reductase                  240   3e-70    
gb|ABA77558.1|  progesterone 5-beta-reductase                           240   4e-70    
gb|ABA77560.1|  progesterone 5-beta-reductase                           240   4e-70    
emb|CAC80137.1|  progesterone 5-beta-reductase                          240   4e-70    
gb|ABA77556.1|  progesterone 5-beta-reductase                           239   5e-70    
gb|AIF73578.1|  progesterone 5-beta-reductase                           239   6e-70    
gb|AEW67078.1|  putative progesterone 5-beta-reductase                  239   6e-70    
sp|Q6PQJ9.1|5BPOR_DIGLA  RecName: Full=3-oxo-Delta(4,5)-steroid 5...    238   2e-69    
gb|ADL28122.1|  putative progesterone 5-beta-reductase 2                238   3e-69    
gb|AAS93805.1|  putative progesterone 5-beta-reductase                  237   4e-69    
gb|ABB36651.1|  progesterone 5beta-reductase                            237   6e-69    
ref|XP_006339461.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    236   1e-68    
gb|ABA77557.1|  progesterone 5-beta-reductase                           234   4e-68    
gb|AHC23071.1|  putative progesterone 5beta-reductase                   233   5e-68    
ref|XP_009137433.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    234   6e-68    
emb|CDY10994.1|  BnaA03g46530D                                          234   7e-68    
gb|AHC23070.1|  putative progesterone 5beta-reductase                   233   9e-68    
ref|XP_002960090.1|  hypothetical protein SELMODRAFT_74346              233   1e-67    
gb|AHC23069.1|  putative progesterone 5beta-reductase                   232   2e-67    
ref|XP_002967522.1|  hypothetical protein SELMODRAFT_86462              232   2e-67    
gb|ABB36653.1|  progesterone 5beta-reductase                            232   3e-67    
ref|XP_006374846.1|  hypothetical protein POPTR_0014s01980g             230   6e-67    
ref|XP_006374845.1|  hypothetical protein POPTR_0014s01980g             230   7e-67    
ref|XP_009394340.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    232   7e-67    
ref|XP_004983959.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    229   7e-66    
emb|CBI22490.3|  unnamed protein product                                226   1e-65    
ref|XP_004229838.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    228   2e-65    
ref|XP_009394339.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   7e-65    
gb|AGO01041.1|  putative progesterone 5-beta-reductase                  226   9e-65    
gb|EMT09140.1|  hypothetical protein F775_25898                         224   1e-64    
gb|EMT17902.1|  hypothetical protein F775_30194                         224   2e-64    
ref|XP_002984047.1|  hypothetical protein SELMODRAFT_234421             223   7e-64    
dbj|BAP31603.1|  nucleoside-diphosphate sugar epimerase                 221   3e-63    
gb|KHN21407.1|  Hypothetical protein glysoja_042470                     218   1e-62    
emb|CAA68126.1|  unnamed protein product                                220   1e-62    
ref|WP_034744697.1|  NAD-dependent dehydratase                          218   4e-62    
dbj|BAH57049.1|  AT4G24220                                              217   8e-62    
gb|KDO53351.1|  hypothetical protein CISIN_1g045430mg                   214   2e-61    
ref|XP_002960183.1|  hypothetical protein SELMODRAFT_402259             215   5e-61    
ref|WP_034798529.1|  NAD-dependent dehydratase                          214   8e-61    
ref|XP_004983960.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    214   8e-61    
ref|WP_034966200.1|  NAD-dependent dehydratase                          214   1e-60    
ref|XP_006386996.1|  hypothetical protein POPTR_2318s00200g             206   2e-60    
gb|KDO47326.1|  hypothetical protein CISIN_1g0282581mg                  208   2e-60    
ref|XP_010099073.1|  hypothetical protein L484_011507                   212   2e-60    
gb|KDP44462.1|  hypothetical protein JCGZ_16295                         209   6e-60    
ref|NP_001140307.1|  uncharacterized protein LOC100272352               209   1e-59    
ref|WP_034972791.1|  NAD-dependent dehydratase                          211   1e-59    
ref|NP_001060201.2|  Os07g0601600                                       211   3e-59    
ref|XP_007136738.1|  hypothetical protein PHAVU_009G070100g             207   6e-59    
gb|KDO53787.1|  hypothetical protein CISIN_1g024207mg                   206   1e-58    
ref|WP_024519292.1|  NAD-dependent dehydratase                          208   2e-58    
ref|XP_006432518.1|  hypothetical protein CICLE_v10003867mg             207   2e-58    
ref|WP_039368364.1|  NAD-dependent dehydratase                          207   5e-58    
ref|WP_034698178.1|  NAD-dependent dehydratase                          205   2e-57    
ref|WP_012924975.1|  NAD dependent epimerase/dehydratase                204   5e-57    
ref|WP_034730311.1|  NAD-dependent dehydratase                          203   1e-56    
ref|WP_027385181.1|  NAD-dependent dehydratase                          202   2e-56    
ref|WP_027580789.1|  NAD-dependent dehydratase                          202   4e-56    
ref|WP_029283676.1|  NAD-dependent dehydratase                          201   8e-56    
ref|WP_031425945.1|  NAD-dependent dehydratase                          201   9e-56    
ref|WP_037204462.1|  NAD-dependent dehydratase                          201   1e-55    
ref|WP_035225966.1|  NAD-dependent dehydratase                          200   2e-55    
ref|XP_011069777.1|  PREDICTED: iridoid synthase-like                   199   5e-55    
ref|WP_019598553.1|  hypothetical protein                               198   7e-55    
ref|WP_027133570.1|  NAD-dependent dehydratase                          198   8e-55    
ref|WP_010253428.1|  NAD dependent epimerase/dehydratase                198   8e-55    
ref|XP_011037154.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    191   1e-54    
ref|WP_028168001.1|  NAD-dependent dehydratase                          198   1e-54    
gb|ACE96889.1|  putative protein                                        196   1e-54    
ref|WP_032630623.1|  NAD-dependent dehydratase                          198   1e-54    
gb|ACE96881.1|  putative protein                                        196   1e-54    
ref|WP_027676555.1|  NAD-dependent dehydratase                          197   2e-54    
gb|EMS51064.1|  hypothetical protein TRIUR3_03279                       197   2e-54    
ref|WP_019366346.1|  NAD dependent epimerase/dehydratase                197   2e-54    
ref|WP_034711243.1|  NAD-dependent dehydratase                          197   3e-54    
ref|WP_026991925.1|  NAD-dependent dehydratase                          197   4e-54    
ref|WP_010795227.1|  hypothetical protein                               196   5e-54    
ref|WP_017277479.1|  hypothetical protein                               196   7e-54    
gb|EMS53364.1|  hypothetical protein TRIUR3_02028                       195   7e-54    
gb|ACE96904.1|  putative protein                                        193   9e-54    
ref|WP_037157291.1|  NAD-dependent dehydratase                          195   1e-53    
ref|WP_026629196.1|  NAD-dependent dehydratase                          195   2e-53    
ref|XP_006848213.1|  hypothetical protein AMTR_s00029p00242940          196   2e-53    
gb|ACE96903.1|  putative protein                                        192   3e-53    
ref|WP_025996786.1|  NAD-dependent dehydratase                          194   3e-53    
ref|WP_032406024.1|  NAD-dependent dehydratase                          194   3e-53    
ref|WP_027495300.1|  NAD-dependent dehydratase                          193   6e-53    
ref|WP_032400492.1|  NAD-dependent dehydratase                          193   7e-53    
ref|WP_007963504.1|  NAD dependent epimerase/dehydratase                193   7e-53    
ref|WP_032367139.1|  NAD-dependent dehydratase                          193   7e-53    
ref|WP_029585848.1|  NAD-dependent dehydratase                          193   9e-53    
ref|WP_032392463.1|  NAD-dependent dehydratase                          193   9e-53    
ref|WP_008508672.1|  NAD dependent epimerase/dehydratase                192   1e-52    
ref|WP_029242516.1|  NAD-dependent dehydratase                          192   2e-52    
ref|WP_004882898.1|  aldo/keto reductase                                192   2e-52    
ref|WP_032387564.1|  NAD-dependent dehydratase                          192   2e-52    
ref|WP_024695207.1|  NAD-dependent dehydratase                          192   2e-52    
ref|WP_018984402.1|  NAD dependent epimerase/dehydratase                192   2e-52    
ref|WP_022559177.1|  hypothetical protein                               192   2e-52    
ref|WP_010503124.1|  oxidoreductase                                     192   2e-52    
ref|WP_007971235.1|  NAD dependent epimerase/dehydratase                192   2e-52    
ref|WP_025145635.1|  NAD-dependent dehydratase                          192   2e-52    
ref|WP_032405204.1|  NAD-dependent dehydratase                          192   2e-52    
ref|WP_005916734.1|  MULTISPECIES: hypothetical protein                 192   3e-52    
ref|WP_037196072.1|  NAD-dependent dehydratase                          192   3e-52    
ref|WP_032369532.1|  NAD-dependent dehydratase                          192   3e-52    
ref|WP_024646917.1|  NAD-dependent dehydratase                          191   3e-52    
ref|WP_008237267.1|  NAD dependent epimerase/dehydratase                191   3e-52    
ref|WP_032374766.1|  NAD-dependent dehydratase                          191   3e-52    
gb|AHG41456.1|  NAD dependent epimerase/dehydratase                     191   3e-52    
ref|WP_020715716.1|  hypothetical protein                               191   3e-52    
ref|WP_037171041.1|  NAD-dependent dehydratase                          191   4e-52    
ref|WP_036169086.1|  NAD-dependent dehydratase                          191   4e-52    
ref|WP_032383332.1|  NAD-dependent dehydratase                          191   4e-52    
ref|XP_006651421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    190   5e-52    
gb|EMS53363.1|  hypothetical protein TRIUR3_02025                       187   5e-52    
ref|WP_011051320.1|  NAD dependent epimerase/dehydratase                192   5e-52    
ref|WP_024648964.1|  NAD-dependent dehydratase                          191   5e-52    
ref|WP_015463169.1|  MULTISPECIES: hypothetical protein                 191   5e-52    
ref|WP_002989268.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    191   5e-52    
ref|WP_039577579.1|  NAD-dependent dehydratase                          191   5e-52    
ref|WP_024684766.1|  NAD-dependent dehydratase                          191   6e-52    
ref|WP_023904087.1|  hypothetical protein                               191   6e-52    
ref|WP_017638618.1|  NAD dependent epimerase/dehydratase                191   6e-52    
ref|WP_039586834.1|  NAD-dependent dehydratase                          190   7e-52    
ref|WP_033483167.1|  NAD-dependent dehydratase                          190   7e-52    
ref|WP_035559068.1|  NAD-dependent dehydratase                          190   8e-52    
ref|WP_024665792.1|  NAD-dependent dehydratase                          190   8e-52    
gb|EGH80549.1|  hypothetical protein PSYAP_28451                        190   9e-52    
ref|WP_032396718.1|  NAD-dependent dehydratase                          190   1e-51    
ref|WP_024673174.1|  NAD-dependent dehydratase                          190   1e-51    
ref|WP_018918183.1|  NAD dependent epimerase/dehydratase                190   1e-51    
dbj|GAD10412.1|  hypothetical protein GFGA_1d0521                       192   1e-51    
ref|WP_032384829.1|  NAD-dependent dehydratase                          190   1e-51    
ref|WP_024663724.1|  NAD-dependent dehydratase                          190   1e-51    
ref|WP_005929774.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    190   1e-51    
ref|WP_024682617.1|  NAD-dependent dehydratase                          189   2e-51    
ref|WP_024959832.1|  NAD-dependent dehydratase                          189   2e-51    
ref|WP_006449597.1|  NAD dependent epimerase/dehydratase                189   2e-51    
ref|WP_037437673.1|  NAD-dependent dehydratase                          189   2e-51    
ref|WP_039527127.1|  NAD-dependent dehydratase                          189   2e-51    
ref|WP_016902584.1|  NAD dependent epimerase/dehydratase                189   2e-51    
ref|WP_003420804.1|  hypothetical protein                               189   2e-51    
ref|WP_039521715.1|  NAD-dependent dehydratase                          189   2e-51    
ref|WP_034880753.1|  NAD-dependent dehydratase                          189   3e-51    
ref|WP_007281813.1|  oxidoreductase                                     189   3e-51    
ref|WP_026539437.1|  NAD-dependent dehydratase                          189   3e-51    
ref|WP_027904734.1|  NAD-dependent dehydratase                          189   3e-51    
ref|XP_007207642.1|  hypothetical protein PRUPE_ppa021134mg             189   4e-51    
ref|WP_039514425.1|  NAD-dependent dehydratase                          188   4e-51    
ref|WP_019666865.1|  hypothetical protein                               188   5e-51    
ref|WP_039108418.1|  NAD-dependent dehydratase                          188   5e-51    
ref|WP_032390275.1|  NAD-dependent dehydratase                          188   5e-51    
ref|WP_028277124.1|  NAD-dependent dehydratase                          188   5e-51    
ref|WP_037184070.1|  NAD-dependent dehydratase                          188   5e-51    
ref|WP_013790753.1|  NAD dependent epimerase/dehydratase                188   5e-51    
ref|WP_015073026.1|  oxidoreductase                                     188   6e-51    
ref|WP_010599935.1|  NAD dependent epimerase/dehydratase                188   6e-51    
ref|WP_027601512.1|  MULTISPECIES: NAD-dependent dehydratase            188   6e-51    
ref|WP_027909552.1|  NAD-dependent dehydratase                          187   7e-51    
ref|WP_028623205.1|  NAD-dependent dehydratase                          187   7e-51    
gb|KGK58255.1|  NAD-dependent dehydratase                               187   7e-51    
ref|WP_003410201.1|  NAD dependent epimerase/dehydratase                187   8e-51    
gb|EGH45552.1|  hypothetical protein PSYPI_25914                        187   8e-51    
ref|WP_002802208.1|  hypothetical protein                               187   8e-51    
gb|KGE52268.1|  NAD-dependent dehydratase                               187   9e-51    
ref|WP_037112116.1|  NAD-dependent dehydratase                          187   9e-51    
ref|WP_032661559.1|  NAD-dependent dehydratase                          187   9e-51    
ref|WP_003416428.1|  NAD dependent epimerase/dehydratase                187   1e-50    
ref|WP_032383748.1|  NAD-dependent dehydratase                          187   1e-50    
ref|WP_005892996.1|  NAD dependent epimerase/dehydratase                187   1e-50    
ref|WP_031597429.1|  NAD-dependent dehydratase                          187   1e-50    
ref|WP_024691865.1|  NAD-dependent dehydratase                          187   1e-50    
ref|WP_004417900.1|  Progesterone 5-beta-reductase-like protein (...    187   1e-50    
ref|WP_038698809.1|  NAD-dependent dehydratase                          187   1e-50    
ref|WP_037158936.1|  NAD-dependent dehydratase                          187   1e-50    
ref|WP_010433763.1|  NAD dependent epimerase/dehydratase                187   1e-50    
ref|WP_020112379.1|  MULTISPECIES: hypothetical protein                 187   1e-50    
ref|WP_016568052.1|  Progesterone 5-beta-reductase-like protein         187   1e-50    
ref|WP_035687562.1|  NAD-dependent dehydratase                          187   1e-50    
gb|EGH32106.1|  hypothetical protein PSYJA_25350                        187   1e-50    
ref|WP_026386982.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_015885059.1|  NAD dependent epimerase/dehydratase                187   2e-50    
ref|WP_032377495.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_025661354.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_024938681.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_008710903.1|  putative uncharacterized protein                   187   2e-50    
ref|WP_005757221.1|  NAD dependent epimerase/dehydratase                187   2e-50    
ref|WP_031422845.1|  NAD-dependent dehydratase                          187   2e-50    
ref|XP_002467669.1|  hypothetical protein SORBIDRAFT_01g031940          187   2e-50    
ref|WP_003434169.1|  hypothetical protein                               186   2e-50    
ref|WP_008229594.1|  NAD dependent epimerase/dehydratase                187   2e-50    
ref|WP_016774737.1|  NAD dependent epimerase/dehydratase                186   2e-50    
ref|WP_027864241.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_019947727.1|  hypothetical protein                               186   2e-50    
ref|WP_033190320.1|  NAD-dependent dehydratase                          187   2e-50    
ref|WP_024641985.1|  NAD-dependent dehydratase                          186   2e-50    
ref|WP_011347453.1|  NAD dependent epimerase/dehydratase                186   2e-50    
ref|WP_014090247.1|  NAD dependent epimerase/dehydratase                186   2e-50    
ref|WP_017156613.1|  NAD dependent epimerase/dehydratase                186   2e-50    



>gb|AIW09148.1| progesterone 5-beta-reductase 6 [Catharanthus roseus]
Length=380

 Score =   518 bits (1335),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 250/379 (66%), Positives = 321/379 (85%), Gaps = 5/379 (1%)
 Frame = -2

Query  1407  MGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEY  1228
             M +EN +++VAL++G TGMVGVA+ EALK+P  LGGPWKVYG ARRPLP+WFPSS LD +
Sbjct  1     MAEENSNESVALIVGVTGMVGVALAEALKKPAVLGGPWKVYGVARRPLPTWFPSSLLDNF  60

Query  1227  MTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdss  1048
             +TFDALN ++TH+ LS  S+E+THVFW+ALQ+ E E  NI LNSTML NVL SL +  +S
Sbjct  61    LTFDALNTQETHQKLSPFSSEITHVFWVALQIGENEGININLNSTMLKNVLNSLRNCSNS  120

Query  1047  slSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
              L HVT+QTGTKQYMGPIFDP L +DK+IPHE PF+EDYPR+PFPNFYYALED+++ YA 
Sbjct  121   KLKHVTLQTGTKQYMGPIFDPIL-SDKLIPHEPPFREDYPRIPFPNFYYALEDILSSYAH  179

Query  867   TNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSD  688
             +  F++SIHRSS+IIG S+ S++NSLL+LCVYA+ICK KG+ FR+PGN+Y+WEHF D SD
Sbjct  180   S--FTYSIHRSSVIIGVSTRSLYNSLLSLCVYASICKYKGWEFRFPGNKYSWEHFWDFSD  237

Query  687   ARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             +R+LA+QQIWA VT+KAKNQAFNCTNGDVF+WK++W+L C++FELEF+ F+E     FD+
Sbjct  238   SRVLADQQIWASVTDKAKNQAFNCTNGDVFSWKSMWKLLCEIFELEFLPFDEK--VRFDL  295

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
              EFMKDKG IW  IV+K+ LF+T+MEE+TC+ ALQ +L F+F+HVCSMNKSKE GF G+A
Sbjct  296   VEFMKDKGGIWDEIVEKYGLFKTKMEEVTCFEALQLILHFEFEHVCSMNKSKEFGFFGFA  355

Query  327   DTLKSIRVWVQKLREMKII  271
             +TL+SI+ WV+K+R+M I+
Sbjct  356   NTLESIKFWVEKMRQMNIL  374



>ref|XP_006478688.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
 gb|KDO47327.1| hypothetical protein CISIN_1g016723mg [Citrus sinensis]
Length=384

 Score =   478 bits (1230),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/376 (63%), Positives = 297/376 (79%), Gaps = 5/376 (1%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDAL  1210
             S +VAL++G TG+ G+++ EALK PT  G PWKVYGAARR  P WFP++ +D Y+TFDAL
Sbjct  12    SSSVALIVGVTGISGLSLAEALKNPTTQGSPWKVYGAARRSPPGWFPTALVDRYITFDAL  71

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl--SH  1036
             +  DT   LS IS E+TH+FWL LQV E EE NI  NSTML NVL +L  S +      H
Sbjct  72    DSADTALKLSLISQEITHLFWLPLQVQESEEVNIFKNSTMLKNVLSALVDSSNGRSCLRH  131

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsf  856
             V + TGTK YMGPIFDPSLA  +++P++ PFKED PRLPFPNFYYALED+ A Y+     
Sbjct  132   VALLTGTKHYMGPIFDPSLA-GRLMPYDVPFKEDSPRLPFPNFYYALEDVAASYSPA--I  188

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HRSS+IIGAS  S++NSLLTL VYATICK +G PFRY GN+YTWEHF D+SD+RLL
Sbjct  189   TYSVHRSSVIIGASPRSLYNSLLTLAVYATICKHQGLPFRYFGNKYTWEHFFDVSDSRLL  248

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQQIWA  T+KAKNQAFNCTNGDVF WK++W+L  ++F++EFV F++  +++FD+ E M
Sbjct  249   AEQQIWAATTDKAKNQAFNCTNGDVFMWKSLWKLLSEIFDVEFVPFDDEKNEKFDVVEMM  308

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K+KGEIW  IV+KH L++T++EEITC+ A++ VL F+FQHV SMNKS+E GF G+ DT+K
Sbjct  309   KEKGEIWDEIVEKHGLYKTKLEEITCFEAMKLVLHFEFQHVSSMNKSREFGFFGFVDTMK  368

Query  315   SIRVWVQKLREMKIIP  268
             SIR+WV KLREMKIIP
Sbjct  369   SIRMWVGKLREMKIIP  384



>ref|XP_006443046.1| hypothetical protein CICLE_v10020613mg [Citrus clementina]
 gb|ESR56286.1| hypothetical protein CICLE_v10020613mg [Citrus clementina]
Length=380

 Score =   477 bits (1227),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 299/380 (79%), Gaps = 5/380 (1%)
 Frame = -2

Query  1401  QENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMT  1222
             ++   K+VAL+IG TG+ G+++ EALK PT  G PWKVYGAARRP P WFP++ +D Y+T
Sbjct  4     RDQNPKSVALIIGVTGISGLSLAEALKNPTTPGSPWKVYGAARRPPPGWFPTALVDRYIT  63

Query  1221  FDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl  1042
             FDAL+  DT   LS IS E+TH+FW+ LQV E EE NI  NSTML NVL  L SS+S   
Sbjct  64    FDALDSADTALKLSLISQEITHLFWVPLQVQESEEVNIFKNSTMLKNVLSVLVSSNSGRS  123

Query  1041  --SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
                HV + TGTK YMGPIFDPSLA  +++P+E PFKED PRLPFPNFYY LED+ A Y+ 
Sbjct  124   CLRHVALLTGTKHYMGPIFDPSLA-GQLMPYEVPFKEDSPRLPFPNFYYELEDVAASYSP  182

Query  867   TNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSD  688
                 ++S+HRSS+IIG S  S++NSLLTL VYATICK +G PFRY GN+YTWEHF D+SD
Sbjct  183   A--ITYSVHRSSVIIGTSPRSLYNSLLTLAVYATICKYQGLPFRYFGNKYTWEHFFDVSD  240

Query  687   ARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             +RLLAEQQIWA  T+KAKNQAFNCTNGDVF WK++W+L  ++F++EFV F++  +++FD+
Sbjct  241   SRLLAEQQIWAATTDKAKNQAFNCTNGDVFMWKSLWKLLSEIFDVEFVPFDDEKNEKFDV  300

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
              E MK+KGEIW  IV+KH L++T++EEITC+ A++ VL F+FQHV SMNKS+E GF G+ 
Sbjct  301   VEMMKEKGEIWDEIVEKHGLYKTKLEEITCFEAMKLVLHFEFQHVSSMNKSREFGFFGFV  360

Query  327   DTLKSIRVWVQKLREMKIIP  268
             DT+KSIR+WV KLREMKIIP
Sbjct  361   DTMKSIRMWVGKLREMKIIP  380



>ref|XP_006443045.1| hypothetical protein CICLE_v10020568mg [Citrus clementina]
 gb|ESR56285.1| hypothetical protein CICLE_v10020568mg [Citrus clementina]
Length=384

 Score =   476 bits (1225),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 296/376 (79%), Gaps = 5/376 (1%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDAL  1210
             S +VAL++G TG+ G+++ EALK PT  G PWKVYGAARR  P WFP++ +D Y+TFDAL
Sbjct  12    SSSVALIVGVTGISGLSLAEALKNPTTQGSPWKVYGAARRSPPGWFPTALVDRYITFDAL  71

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl--SH  1036
             +  DT   LS IS E+TH+FWL LQV E EE NI  NSTML NVL +L  S +      H
Sbjct  72    DSADTALKLSLISQEITHLFWLPLQVQESEEVNIFKNSTMLKNVLSALVDSSNGRSCLRH  131

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsf  856
             V + TGTK YMGPIFDPSLA  +++P++ PFKED PRLPFPNFYYALED+ A Y+     
Sbjct  132   VALLTGTKHYMGPIFDPSLA-GRLMPYDVPFKEDSPRLPFPNFYYALEDVAASYSPA--I  188

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HRSS+IIGAS  S++NSLLTL VYATICK +G PFRY GN+YTWEHF D+SD+RLL
Sbjct  189   TYSVHRSSVIIGASPRSLYNSLLTLAVYATICKHQGLPFRYFGNKYTWEHFFDVSDSRLL  248

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQQIWA  T+KAKNQAFNCTN DVF WK++W+L  ++F++EFV F++  +++FD+ E M
Sbjct  249   AEQQIWAATTDKAKNQAFNCTNSDVFMWKSLWKLLSEIFDVEFVPFDDEKNEKFDVVEMM  308

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K+KGEIW  IV+KH L++T++EEITC+ A++ VL F+FQHV SMNKS+E GF G+ DT+K
Sbjct  309   KEKGEIWDEIVEKHGLYKTKLEEITCFEAMKLVLHFEFQHVSSMNKSREFGFFGFVDTMK  368

Query  315   SIRVWVQKLREMKIIP  268
             SIR+WV KLREMKIIP
Sbjct  369   SIRMWVGKLREMKIIP  384



>ref|XP_006478687.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=380

 Score =   474 bits (1221),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 298/380 (78%), Gaps = 5/380 (1%)
 Frame = -2

Query  1401  QENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMT  1222
             ++   K+VAL+IG TG+ G+++ EALK PT  G PWKVYGAARRP P WFP++ +D Y+T
Sbjct  4     RDQNPKSVALIIGVTGISGLSLAEALKNPTTPGSPWKVYGAARRPPPGWFPTALVDRYIT  63

Query  1221  FDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl  1042
             FDAL+  DT   LS IS E+TH+FW+ LQV E EE NI  NSTML NVL  L SS+S   
Sbjct  64    FDALDSADTALKLSLISQEITHLFWVPLQVQESEEVNIFKNSTMLKNVLSVLVSSNSGRS  123

Query  1041  --SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
                HV + TGTK YMGPIFDPSLA  +++P+E PFKED PRLPFPNFYY LED+ A Y+ 
Sbjct  124   CLRHVALLTGTKHYMGPIFDPSLA-GQLMPYEVPFKEDSPRLPFPNFYYELEDVAASYSP  182

Query  867   TNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSD  688
                 ++S+HRSS+IIG S  S++NSLLTL VYATICK +G PFRY GN+YTWEHF D+SD
Sbjct  183   A--ITYSVHRSSVIIGTSPRSLYNSLLTLAVYATICKYQGLPFRYFGNKYTWEHFFDVSD  240

Query  687   ARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             +RLLAEQQIWA  T+KAKNQAFNCTN DVF WK++W+L  ++F++EFV F++  +++FD+
Sbjct  241   SRLLAEQQIWAATTDKAKNQAFNCTNSDVFMWKSLWKLLSEIFDVEFVPFDDEKNEKFDV  300

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
              E MK+KGEIW  IV+KH L++T++EEITC+ A++ VL F+FQHV SMNKS+E GF G+ 
Sbjct  301   VEMMKEKGEIWDEIVEKHGLYKTKLEEITCFEAMKLVLHFEFQHVSSMNKSREFGFFGFV  360

Query  327   DTLKSIRVWVQKLREMKIIP  268
             DT+KSIR+WV KLREMKIIP
Sbjct  361   DTMKSIRMWVGKLREMKIIP  380



>ref|XP_006372881.1| hypothetical protein POPTR_0017s05940g [Populus trichocarpa]
 gb|ERP50678.1| hypothetical protein POPTR_0017s05940g [Populus trichocarpa]
Length=372

 Score =   474 bits (1220),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 238/371 (64%), Positives = 295/371 (80%), Gaps = 4/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VAL++G TGMVG ++ EALKQPT  G PWKVYG ARRPLPSWFPSS +D +++ DAL+ E
Sbjct  6     VALIVGVTGMVGFSLAEALKQPTTQGSPWKVYGVARRPLPSWFPSSLIDCFLSLDALDHE  65

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   L  +++E+THVFW++ ++ + EE NI +NSTML NVL +L S+  S L HVT+ T
Sbjct  66    DTKNKLFPVAHEITHVFWISRKLRDSEEVNISMNSTMLANVLNALKSAFPSRLRHVTLLT  125

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPIFDPSL   +++  E PFKED  RLP+PNFYYALEDLV  Y  +   + S+H
Sbjct  126   GTKHYMGPIFDPSL-RGQLVHQEPPFKEDLGRLPYPNFYYALEDLVVSYLPS--ITHSVH  182

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSIIIGASS S+ N+LLTL VYATIC+ +G PF YPGN+Y WEHFCDMSDAR+LAEQQI
Sbjct  183   RSSIIIGASSRSLNNTLLTLSVYATICRYQGLPFLYPGNKYIWEHFCDMSDARVLAEQQI  242

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VTE AKNQAFNCTNGDVF WK++W + C++F++EFVA+EEN D++FD    MK KG+
Sbjct  243   WAAVTEGAKNQAFNCTNGDVFTWKSLWGVLCEVFDVEFVAYEEN-DEKFDCLAMMKGKGK  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K  LF+T+ME+ITC+ AL  VL F FQHVCSMNKS+E GFLG+ADTLKSI +W
Sbjct  302   VWDEIVEKFGLFKTKMEDITCFEALNVVLHFGFQHVCSMNKSRESGFLGFADTLKSIPMW  361

Query  300   VQKLREMKIIP  268
             V +LR+MKIIP
Sbjct  362   VGRLRDMKIIP  372



>ref|XP_006443047.1| hypothetical protein CICLE_v10023804mg [Citrus clementina]
 ref|XP_006478771.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
 gb|ESR56287.1| hypothetical protein CICLE_v10023804mg [Citrus clementina]
Length=383

 Score =   474 bits (1219),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 240/377 (64%), Positives = 294/377 (78%), Gaps = 8/377 (2%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQ-PTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDA  1213
             S +VAL+IG TGM G+++ EALK  PT  GGPWKVYG ARRP PSWFPSS +D Y+TFDA
Sbjct  12    SSSVALIIGVTGMAGLSLAEALKNNPTIPGGPWKVYGTARRPPPSWFPSSHVDHYITFDA  71

Query  1212  LNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds--sslS  1039
             L+  DT + LS IS EVTH+FW+  Q  + EE NI  NSTM  NV+  +  S+   S L 
Sbjct  72    LDSTDTTQKLSSISQEVTHLFWVMFQRLKSEEINISNNSTMFKNVMSVVVDSNKGRSRLR  131

Query  1038  HVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNs  859
             HVT+  GTK YMGP+FDPSL   ++I H+ PFKED  RLPFPNFYYA+ED+ A Y+    
Sbjct  132   HVTLLMGTKHYMGPVFDPSLV-GQLIGHDPPFKEDSLRLPFPNFYYAVEDIAASYSPA--  188

Query  858   fsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
              ++S+HRSSIIIGASS S+ NSLLTL VYATIC+ +G PFRY GN+YTWEHFCDMSD+R+
Sbjct  189   VTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLGNKYTWEHFCDMSDSRV  248

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             LAEQQIWA  T++AKNQAFNCTNGDVF WK++W+L  ++F++EFV F+E   ++FD  E 
Sbjct  249   LAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEK--EKFDAVEM  306

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK+KGEIW  IV+KH L++T+MEEITC+ AL TVL  QFQHV SMNKS+E GF G+ADT+
Sbjct  307   MKEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFADTM  366

Query  318   KSIRVWVQKLREMKIIP  268
             KSIR WV+KLREMKIIP
Sbjct  367   KSIRTWVKKLREMKIIP  383



>ref|XP_011037153.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=377

 Score =   473 bits (1218),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/370 (64%), Positives = 293/370 (79%), Gaps = 4/370 (1%)
 Frame = -2

Query  1377  ALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFED  1198
             AL++G TGMVG ++ EALKQPT  GGPWKVYG ARRPLPSWFPSS +D +++ DAL+ ED
Sbjct  12    ALIVGVTGMVGFSLAEALKQPTTPGGPWKVYGVARRPLPSWFPSSLIDCFLSLDALDHED  71

Query  1197  THKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTG  1018
             T   L  +++E+THVFW++ ++ + EE NI  NSTML NVL ++  +    L HVT+ TG
Sbjct  72    TKNKLFPVAHEITHVFWISRELHDSEEVNISTNSTMLANVLNAIKPAAPPRLRHVTLLTG  131

Query  1017  TKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsihr  838
             TK YMGPI DPSL  + ++  E PFKED  RLP+PNFYYALEDLVA Y  +   + S+HR
Sbjct  132   TKHYMGPIHDPSLRGE-LVHQEPPFKEDLGRLPYPNFYYALEDLVASYLPS--ITHSVHR  188

Query  837   ssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQIW  658
             SSIIIGASS S+ N+LLTL VYATIC+ +G PFRYPGN+YTWEHFCDMSDAR+LAEQQIW
Sbjct  189   SSIIIGASSRSLHNTLLTLSVYATICRYQGLPFRYPGNKYTWEHFCDMSDARVLAEQQIW  248

Query  657   AGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGEI  478
             A VTE AKNQAFNCTNGDVF WK++W + C++F++EFVAFEE+ D++FD    MK KG++
Sbjct  249   AAVTEGAKNQAFNCTNGDVFTWKSLWGVLCEVFDVEFVAFEES-DEKFDWLGMMKGKGKV  307

Query  477   WGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVWV  298
             W  IV+K  LF T++E+ITC+ AL  VL F FQHVCSMNKS+E GFLGYADTLKSI +WV
Sbjct  308   WDEIVEKFGLFETKIEDITCFEALDVVLHFGFQHVCSMNKSRESGFLGYADTLKSIPMWV  367

Query  297   QKLREMKIIP  268
              +LR+MKIIP
Sbjct  368   GRLRDMKIIP  377



>gb|KHN02917.1| Hypothetical protein glysoja_009783 [Glycine soja]
Length=374

 Score =   468 bits (1205),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 292/372 (78%), Gaps = 5/372 (1%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +VAL++G TG+ G+++ E LK+P  LGGPWKVYGAARRP PSWF  S +D ++TFDA + 
Sbjct  6     SVALIVGVTGLTGLSLAETLKKPNCLGGPWKVYGAARRPPPSWFSPSMVDHFITFDAEDS  65

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              DT   LS I++EVTH+FW+  Q+   EE N  +N TML N+L +L SS +S L+HVT+Q
Sbjct  66    SDTRAKLSPIAHEVTHLFWVTFQIHADEEYNATVNKTMLLNLLTALKSSTTSRLAHVTVQ  125

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsi  844
             TGTK YMGP+FDP  +T ++I H+ PF E+ PRLP+PNFYYALEDLVA YA +   ++S+
Sbjct  126   TGTKHYMGPVFDPVHST-QLIGHQPPFDENMPRLPYPNFYYALEDLVASYAPS--LTYSV  182

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HRSSIIIGASS SV+N+LLTL  YA IC+  G  FRYPG RYTWEHFCDM+DA +LA+Q 
Sbjct  183   HRSSIIIGASSRSVYNALLTLATYAVICRHVGLAFRYPGTRYTWEHFCDMTDAGVLAQQH  242

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA VT  AKNQAFNCTNGDVFAWKT+W+L  ++F++EFVAF+E+   +FD+AE M DKG
Sbjct  243   VWAAVTPNAKNQAFNCTNGDVFAWKTVWKLLAELFDVEFVAFDES--HKFDLAELMHDKG  300

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV K+ L  T++EEITCY ALQTVL F+FQHV +MNKS+E GF G+ DTLKSIR 
Sbjct  301   SVWEEIVAKYELHNTKLEEITCYEALQTVLHFKFQHVSAMNKSREHGFFGHVDTLKSIRF  360

Query  303   WVQKLREMKIIP  268
             WV+KLR+MKI+P
Sbjct  361   WVKKLRQMKIMP  372



>ref|XP_003529541.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Glycine 
max]
Length=374

 Score =   468 bits (1205),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 293/372 (79%), Gaps = 5/372 (1%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +VAL++G TG+ G+++ E LK+P  LGGPWKVYGAARRP PSWF  S +D ++TFDA + 
Sbjct  6     SVALIVGVTGLTGLSLAETLKKPNCLGGPWKVYGAARRPPPSWFSPSMVDHFITFDAEDS  65

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              DT   LS I++EVTH+FW+  Q+   EE N  +N TML N+L +L SS +S L+HVT+Q
Sbjct  66    SDTRAKLSPIAHEVTHLFWVTFQIHADEEYNATVNKTMLLNLLTALKSSTTSRLAHVTVQ  125

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsi  844
             TGTK YMGP+FDP  +T ++I H+ PF E+ PRLP+PNFYYALEDLVA YA +   ++S+
Sbjct  126   TGTKHYMGPVFDPVHST-QLIGHQPPFDENMPRLPYPNFYYALEDLVASYAPS--LTYSV  182

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HRSSIIIGASS SV+N+LLTL  YA IC+  G  FRYPG RYTWEHFCDM+DA +LA+Q 
Sbjct  183   HRSSIIIGASSRSVYNALLTLATYAVICRHVGLAFRYPGTRYTWEHFCDMTDAGVLAQQH  242

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA VT  AKNQAFNCTNGDVFAWKT+W+L  ++F++EFVAF+E+   +FD+AE M DKG
Sbjct  243   VWAAVTPNAKNQAFNCTNGDVFAWKTVWKLLAELFDVEFVAFDES--HKFDLAELMHDKG  300

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV+K+ L  T++EEITCY ALQTVL F+FQHV +MNKS+E GF G+ DTLKSIR 
Sbjct  301   SVWEEIVEKYELHNTKLEEITCYEALQTVLHFKFQHVSAMNKSREHGFFGHVDTLKSIRF  360

Query  303   WVQKLREMKIIP  268
             WV+KLR+MKI+P
Sbjct  361   WVKKLRQMKIMP  372



>ref|XP_011037089.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=377

 Score =   468 bits (1205),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 240/381 (63%), Positives = 297/381 (78%), Gaps = 5/381 (1%)
 Frame = -2

Query  1407  MGQENCSKA-VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDE  1231
             M +EN S A VAL++G TG+ G ++ EAL++PT  G PWKVYG ARRPLP WFP+  +D 
Sbjct  1     MEKENSSDASVALIVGITGLAGFSLAEALQKPTTPGRPWKVYGIARRPLPRWFPAFLVDG  60

Query  1230  YMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds  1051
             +++ DAL+  DT   LS +S+E+THVFW+++Q    EE NI +NSTML NVL +L S+  
Sbjct  61    FVSLDALDRADTANKLSPVSHEITHVFWVSMQHHGNEEVNISMNSTMLANVLNALKSTAP  120

Query  1050  sslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYA  871
             S L HVT+ TGTK YMGPI DPSL  + ++  E PFKED  RLP+PNFYYALEDLVA Y 
Sbjct  121   SRLRHVTLLTGTKHYMGPIHDPSLRGE-LVHQEPPFKEDLGRLPYPNFYYALEDLVASYL  179

Query  870   ETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMS  691
              +   + S+HRSSI+IGASS S+ N+LLTL VYATIC+ +G PFRYPGN+YTWEHFCDMS
Sbjct  180   PS--ITHSVHRSSIVIGASSRSLNNTLLTLSVYATICRYQGLPFRYPGNKYTWEHFCDMS  237

Query  690   DARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFD  511
             DAR+LAEQQIWA VTE AKNQAFNCTNGDVF WK+ W + C++F++EFVAFEEN D++FD
Sbjct  238   DARVLAEQQIWAAVTEGAKNQAFNCTNGDVFTWKSFWGVLCEVFDVEFVAFEEN-DEKFD  296

Query  510   IAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGY  331
                 MK KG++W  IV+K  LF T++E+ITC+ AL  VL F FQHVCSMNKS+E GFLGY
Sbjct  297   WLGMMKGKGKVWDEIVEKFGLFETKIEDITCFEALDVVLHFGFQHVCSMNKSRESGFLGY  356

Query  330   ADTLKSIRVWVQKLREMKIIP  268
             ADTLKSI +WV +LR+MKIIP
Sbjct  357   ADTLKSIPMWVGRLRDMKIIP  377



>ref|XP_007154348.1| hypothetical protein PHAVU_003G111200g [Phaseolus vulgaris]
 gb|ESW26342.1| hypothetical protein PHAVU_003G111200g [Phaseolus vulgaris]
Length=379

 Score =   468 bits (1204),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 289/371 (78%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV G TGM G+++ +ALKQP   GGPWKVYGAARRP PSWFP S +D ++TFDA++  
Sbjct  7     VALVAGVTGMAGLSLAQALKQPNCPGGPWKVYGAARRPPPSWFPPSTVDHFITFDAVDSS  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   LS I++EVTH+FW++LQV   EE N+R N TML NVL  L S  SS L+HVT+QT
Sbjct  67    DTRAKLSPIASEVTHLFWVSLQVGADEEANVRGNETMLLNVLSVLKSCTSSKLTHVTLQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPIFDP L+T ++I H+ PF E+  RLP+PNFYYALEDLVA YA +   ++S+H
Sbjct  127   GTKHYMGPIFDPLLST-QLIAHDPPFNENMARLPYPNFYYALEDLVASYAPS--LTYSVH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSII+GASS S++N LLTL  YA IC+  G  FRYPG +YTWEHFCDM+DA +LA+Q +
Sbjct  184   RSSIIVGASSRSIYNFLLTLATYAAICRHVGLAFRYPGTKYTWEHFCDMTDAGVLAQQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT +AKNQAFNCTNGDVF WK+IW+LF ++F++EFVAF+E  D   D+ E M+DKG 
Sbjct  244   WAAVTPEAKNQAFNCTNGDVFTWKSIWKLFSELFDVEFVAFDETQD--LDLVEVMRDKGS  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L  T +EEITCY A Q VLRFQFQHV SMNKS+E GF G+ DT KSIR W
Sbjct  302   VWKEIVEKYELENTILEEITCYEAFQAVLRFQFQHVSSMNKSREYGFFGHVDTFKSIRFW  361

Query  300   VQKLREMKIIP  268
             V+KL++MKIIP
Sbjct  362   VEKLKQMKIIP  372



>gb|AHA84141.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase [Phaseolus vulgaris]
Length=379

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 233/371 (63%), Positives = 289/371 (78%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV G TGM G+++ +ALKQP   GGPWKVYGAARRP PSWFP S +D ++TFDA++  
Sbjct  7     VALVAGVTGMAGLSLAQALKQPNCPGGPWKVYGAARRPPPSWFPPSTVDHFITFDAVDSS  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   LS I++EVTH+FW++LQV   EE N+R N TML NVL  L S  SS L+HVT+QT
Sbjct  67    DTRAKLSPIASEVTHLFWVSLQVGADEEANVRGNETMLLNVLSVLKSCTSSKLTHVTLQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPIFDP L+T ++I H+ PF E+  RLP+PNFYYALEDLVA YA +   ++S+H
Sbjct  127   GTKHYMGPIFDPLLST-QLIAHDPPFNENMARLPYPNFYYALEDLVASYAPS--LTYSVH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSII+GASS S++N LLTL  YA IC+  G  FR+PG +YTWEHFCDM+DA +LA+Q +
Sbjct  184   RSSIIVGASSRSIYNFLLTLATYAAICRHVGMAFRFPGTKYTWEHFCDMTDAGVLAQQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT +AKNQAFNCTNGDVF WK+IW+LF ++F++EFVAF+E  D   D+ E M+DKG 
Sbjct  244   WATVTPEAKNQAFNCTNGDVFTWKSIWKLFFELFDVEFVAFDETQD--LDLVEVMRDKGS  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L  T +EEITCY A Q VLRFQFQHV SMNKS+E GF G+ DT KSIR W
Sbjct  302   VWKEIVEKYELENTILEEITCYEAFQAVLRFQFQHVSSMNKSREYGFFGHVDTFKSIRFW  361

Query  300   VQKLREMKIIP  268
             V+KL++MKIIP
Sbjct  362   VEKLKQMKIIP  372



>ref|XP_007154725.1| hypothetical protein PHAVU_003G142200g [Phaseolus vulgaris]
 gb|ESW26719.1| hypothetical protein PHAVU_003G142200g [Phaseolus vulgaris]
Length=379

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/371 (62%), Positives = 290/371 (78%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV G TGM G+++ +ALKQP   GGPWKVYGAARRP PSWFP S +D ++TFDA++  
Sbjct  7     VALVAGVTGMAGLSLAQALKQPNCPGGPWKVYGAARRPPPSWFPPSTVDHFITFDAVDSS  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   LS I++EVTH+FW++LQV   EE N+R+N TML NVL  L S  SS L+HVT+QT
Sbjct  67    DTRAKLSPIASEVTHLFWVSLQVRVDEEANVRVNETMLFNVLSVLKSCTSSKLTHVTLQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPIFDP L+T ++I H+ PF E+  RLP+PNFYYALEDLVA YA +   ++S+H
Sbjct  127   GTKHYMGPIFDPLLST-QLISHDPPFNENMARLPYPNFYYALEDLVASYAPS--LTYSVH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSII+GASS S++NSL+TL  YA IC+  G  FRYPG +YTWEHFCDM+DA +LA+Q +
Sbjct  184   RSSIIVGASSRSIYNSLVTLATYAAICRHVGLAFRYPGTKYTWEHFCDMTDAGVLAQQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT +AKNQAFNCTNGDVF WK++W+LF ++F++EFVA +E  D   D+ E M+DKG 
Sbjct  244   WAAVTPEAKNQAFNCTNGDVFTWKSVWKLFSELFDVEFVALDETQD--LDLVEVMRDKGS  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L  T +EEITCY A+Q VL F+FQHV SMNKS+E GF G+ DT KSIR W
Sbjct  302   VWKEIVEKYELENTILEEITCYEAVQAVLGFKFQHVSSMNKSREYGFFGHVDTFKSIRFW  361

Query  300   VQKLREMKIIP  268
             V+KL++MKIIP
Sbjct  362   VEKLKQMKIIP  372



>ref|XP_006372880.1| hypothetical protein POPTR_0017s05930g [Populus trichocarpa]
 gb|ERP50677.1| hypothetical protein POPTR_0017s05930g [Populus trichocarpa]
Length=377

 Score =   463 bits (1191),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 238/381 (62%), Positives = 296/381 (78%), Gaps = 5/381 (1%)
 Frame = -2

Query  1407  MGQENCSKA-VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDE  1231
             M +EN S A VAL++G TG+ G ++ EAL++PT  G PWKVYG ARRPLP WFP+  +D 
Sbjct  1     MKKENSSDASVALIVGITGLAGFSLAEALQKPTTPGRPWKVYGIARRPLPIWFPAFLVDG  60

Query  1230  YMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds  1051
             +++ DAL+  DT   LS +++E+THVFW+++Q    EE NI +NSTML NVL +L S+  
Sbjct  61    FISLDALDCADTANKLSPVAHEITHVFWVSMQHHGNEEVNISMNSTMLANVLNALKSTAP  120

Query  1050  sslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYA  871
             S L HVT+ TGTK YMGPIFDPSL   +++  E PFKED  RLP+PNFYYALEDLVA Y 
Sbjct  121   SRLRHVTLLTGTKHYMGPIFDPSL-RGQLVHQEPPFKEDLGRLPYPNFYYALEDLVASYL  179

Query  870   ETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMS  691
              +   + S+HRSSIIIGASS S+ N+LLTL VYA IC+ +G PFRYPGN+YTWEHFCDMS
Sbjct  180   PS--ITHSVHRSSIIIGASSRSLNNTLLTLSVYAIICRYQGLPFRYPGNKYTWEHFCDMS  237

Query  690   DARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFD  511
             DAR+LAEQQIWA VTE AKNQAFNCTNGDVF WK++W + C++F++EFVAFEEN +K FD
Sbjct  238   DARVLAEQQIWAAVTEGAKNQAFNCTNGDVFTWKSLWGVLCEVFDVEFVAFEENEEK-FD  296

Query  510   IAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGY  331
                 +K KG++W  IV+K  LF T+ME+ITC+ AL   L F FQHVCSMNKS+E GFLG+
Sbjct  297   WLGMIKGKGKVWDEIVEKFGLFETKMEDITCFEALNVGLHFGFQHVCSMNKSRESGFLGF  356

Query  330   ADTLKSIRVWVQKLREMKIIP  268
             ADTLKSI +WV +LR+MKIIP
Sbjct  357   ADTLKSIPMWVGRLRDMKIIP  377



>ref|XP_003609735.1| hypothetical protein MTR_4g121570 [Medicago truncatula]
 gb|AES91932.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09151.1| progesterone 5-beta-reductase 3 [Medicago truncatula]
Length=376

 Score =   461 bits (1186),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 230/371 (62%), Positives = 290/371 (78%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV+G TGMVG+++ EALKQP  LGGPWKVYG AR     WFPSS LD ++TFDA+N  
Sbjct  7     VALVVGVTGMVGLSLAEALKQPDCLGGPWKVYGGARHSPDEWFPSSILDGFITFDAVNSA  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DTH  L  I+NEVTH+FW+  Q  E EE NI +N +ML NV+  L SS SS L+H+T+QT
Sbjct  67    DTHAKLLPIANEVTHIFWVTFQFVEDEEVNITVNKSMLHNVVTVLKSSPSSPLTHITVQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPI+DP + ++K+I HE PF E+ PRLP+PNFYY LEDLVA Y  T S ++SIH
Sbjct  127   GTKHYMGPIYDP-VRSNKLICHEPPFNENMPRLPYPNFYYTLEDLVASY--TPSITYSIH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSS+IIGASS S  N+++ L  YA IC+  G PFRYPGNRYTWEHFCDMSDA +LA+Q +
Sbjct  184   RSSLIIGASSRSAINAMMMLATYAAICRHVGLPFRYPGNRYTWEHFCDMSDAGVLAKQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WAGVT+KAKNQAFNCTNGD+F WK++W L  ++F++EFV  ++   +EFDI E M+DKGE
Sbjct  244   WAGVTKKAKNQAFNCTNGDIFTWKSMWMLLSEVFDVEFVELDDK--EEFDIIELMRDKGE  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L +T+++EI C+ A+  V+RF+FQHV SMNKSK+ GFL YADT KSI++W
Sbjct  302   VWDLIVEKYGLHKTKLKEIACFEAMVPVVRFEFQHVSSMNKSKDYGFLEYADTFKSIKLW  361

Query  300   VQKLREMKIIP  268
             V KLREMK+IP
Sbjct  362   VAKLREMKLIP  372



>gb|ABK96577.1| unknown [Populus trichocarpa x Populus deltoides]
Length=377

 Score =   461 bits (1185),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 238/381 (62%), Positives = 296/381 (78%), Gaps = 5/381 (1%)
 Frame = -2

Query  1407  MGQENCSKA-VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDE  1231
             M +EN S A VAL++G TG+ G ++ EAL++PT  G PWKVYG ARRPLP WFP+  +D 
Sbjct  1     MEKENSSDASVALIVGITGLAGFSLAEALQKPTTPGRPWKVYGIARRPLPRWFPAFLVDG  60

Query  1230  YMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds  1051
             +++ DAL+  DT   LS +++E+THVFW+++Q    EE NI +NSTML NVL +L S+  
Sbjct  61    FISLDALDCADTANKLSPVAHEITHVFWVSMQHHGNEEVNISMNSTMLANVLNALKSTAP  120

Query  1050  sslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYA  871
             S L HVT+ TGTK YMGPIFDPSL   +++  E PFKED  RLP PNFYYALEDLVA Y 
Sbjct  121   SRLRHVTLLTGTKHYMGPIFDPSL-RGQLVHQEPPFKEDLGRLPCPNFYYALEDLVASYL  179

Query  870   ETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMS  691
              +   + S+HRSSIIIGASS S  ++LLTL VYATIC+ +G PFRYPGN+YTWEHFCDMS
Sbjct  180   PS--ITHSVHRSSIIIGASSRSPNDTLLTLSVYATICRYQGLPFRYPGNKYTWEHFCDMS  237

Query  690   DARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFD  511
             DAR+LAEQQIWA VTE AKNQAFNCTNGDVF WK++W + C++F++EFVAFEEN D++FD
Sbjct  238   DARVLAEQQIWAAVTEGAKNQAFNCTNGDVFTWKSLWGVLCEVFDVEFVAFEEN-DEKFD  296

Query  510   IAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGY  331
                 +K KG++W  IV+K  LF T+ME+ITC+ AL   L F FQHVCSMNKS+E GFLG+
Sbjct  297   WLGMIKGKGKVWDEIVEKFGLFETKMEDITCFEALNVGLHFGFQHVCSMNKSRESGFLGF  356

Query  330   ADTLKSIRVWVQKLREMKIIP  268
             ADTLKSI +WV +LR+MKIIP
Sbjct  357   ADTLKSIPMWVGRLRDMKIIP  377



>ref|XP_010649532.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=379

 Score =   460 bits (1183),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 298/380 (78%), Gaps = 5/380 (1%)
 Frame = -2

Query  1407  MGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEY  1228
             M  E    +VAL++G TGMVG+++ EALK+P ALGGPWKVYGAARRP P+WFP+S +D+Y
Sbjct  1     MDSETSHGSVALIVGVTGMVGLSLAEALKKPRALGGPWKVYGAARRPKPTWFPTSNVDDY  60

Query  1227  MTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdss  1048
             + FDA+N +DT   LS IS+EVTHVFW+A+QV E EE N+ +N+ ML NVL  L S  SS
Sbjct  61    IAFDAVNPDDTRAKLSPISHEVTHVFWVAIQVRETEELNVTVNAAMLSNVLGVLKSVPSS  120

Query  1047  slSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
              L H+T+QTGT+ Y+GP+ DP+ +     P E PF+ED  RLPFPNFYYALEDL+A Y+ 
Sbjct  121   RLRHLTLQTGTQHYIGPLHDPNHSGQLPCP-ETPFREDSARLPFPNFYYALEDLIASYSP  179

Query  867   TNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSD  688
             +   S+SIHRSSII+GASS S +N+LLTL  YA ICK +  PFRYPG RYTWEHFCDMSD
Sbjct  180   S--LSYSIHRSSIILGASSRSAYNALLTLAAYAAICKHESLPFRYPGTRYTWEHFCDMSD  237

Query  687   ARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             ARLLAEQQIWAGV+EKAKNQAFNC NGDVF WK++W++ C++F++EFV F+E+  +EFD 
Sbjct  238   ARLLAEQQIWAGVSEKAKNQAFNCVNGDVFTWKSMWKVVCEVFDVEFVEFDES--QEFDF  295

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
                M  KG++W  IVKK+ L+ T++EEITC+ AL+TVL  +FQHVCSMNKS+  G+ G+ 
Sbjct  296   VGMMSGKGKVWESIVKKYGLYETKLEEITCFAALKTVLHMEFQHVCSMNKSRNFGWFGHV  355

Query  327   DTLKSIRVWVQKLREMKIIP  268
             DTL+S+  WV++LR MKIIP
Sbjct  356   DTLQSVGTWVERLRVMKIIP  375



>gb|KDO36187.1| hypothetical protein CISIN_1g037566mg [Citrus sinensis]
Length=360

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 284/365 (78%), Gaps = 8/365 (2%)
 Frame = -2

Query  1353  MVGVAMVEALKQ-PTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFEDTHKSLSK  1177
             M G+++ EALK  PT  GGPWKVYG ARRP PSWFPSS +D Y+TFDAL+  DT + LS 
Sbjct  1     MAGLSLAEALKNNPTIPGGPWKVYGTARRPPPSWFPSSHVDHYITFDALDSTDTTQKLSS  60

Query  1176  ISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds--sslSHVTIQTGTKQYM  1003
             IS EVTH+FW+  Q  + EE NI  NSTM  NV+  +  S+   S L HVT+  GTK YM
Sbjct  61    ISQEVTHLFWVMFQRLKSEEINISNNSTMFKNVMSVVVDSNKGRSRLRHVTLLMGTKHYM  120

Query  1002  GPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsihrssiiI  823
             GP+FDPSL   ++I H+ PFKED  RLPFPNFYYA+ED+ A Y+     ++S+HRSSIII
Sbjct  121   GPVFDPSLV-GQLIGHDPPFKEDSLRLPFPNFYYAVEDIAASYSPA--VTYSVHRSSIII  177

Query  822   GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQIWAGVTE  643
             GASS S+ NSLLTL VYATIC+ +G PFRY GN+YTWEHFCDMSD+R+LAEQQIWA  T+
Sbjct  178   GASSRSLNNSLLTLAVYATICRHQGLPFRYLGNKYTWEHFCDMSDSRVLAEQQIWAATTD  237

Query  642   KAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGEIWGGIV  463
             +AKNQAFNCTNGDVF WK++W+L  ++F++EFV F+E   ++FD  E MK+KGEIW  IV
Sbjct  238   RAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEK--EKFDAVEMMKEKGEIWDEIV  295

Query  462   KKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVWVQKLRE  283
             +KH L++T+MEEITC+ AL TVL  QFQHV SMNKS+E GF G+ADT+KSIR WV+KLRE
Sbjct  296   EKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFADTMKSIRTWVKKLRE  355

Query  282   MKIIP  268
             MKIIP
Sbjct  356   MKIIP  360



>ref|XP_007022522.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY14047.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=387

 Score =   456 bits (1173),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 233/362 (64%), Positives = 286/362 (79%), Gaps = 6/362 (2%)
 Frame = -2

Query  1350  VGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFEDTHKSLSKIS  1171
             +    +EALK+PTALGGPWKVYG ARR  PSWFPS+F+D Y++FDA N +DT K+LS IS
Sbjct  31    ISYNFLEALKKPTALGGPWKVYGTARRSKPSWFPSTFVDHYISFDASNLDDTIKNLSPIS  90

Query  1170  NEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTGTKQYMGPIF  991
             NEVTHVFW+A+QV E EE N+ +NS ML NVL  L S  S  L  VT+QTGTKQYMGPIF
Sbjct  91    NEVTHVFWVAIQVCENEEANVSINSAMLKNVLDVLKSGTSPRLCRVTLQTGTKQYMGPIF  150

Query  990   DPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsihrssiiIGASS  811
             D SL   +++PH+ PF+ED PRLP+PNFYYALEDL+A Y  T SFS+S+HRSSIIIGASS
Sbjct  151   DTSLGI-QLLPHDPPFQEDMPRLPYPNFYYALEDLLASY--TPSFSYSVHRSSIIIGASS  207

Query  810   LSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQIWAGVTEKAKN  631
              SV+NSLL L VYA ICK +G PFR+PGNRYTWEHFCD SDAR+LAEQ IWA V+EKAKN
Sbjct  208   RSVYNSLLCLAVYANICKNQGLPFRFPGNRYTWEHFCDASDARVLAEQHIWAAVSEKAKN  267

Query  630   QAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGEIWGGIVKKHR  451
             QAFNCTNGDVF WK+ W+    +F ++FV F+  G ++FD+ E MK    +W  IV+ + 
Sbjct  268   QAFNCTNGDVFTWKSFWKELSKVFNVQFVQFD--GKEKFDVVEIMKKNASVWDQIVEDNG  325

Query  450   LFRTRMEE-ITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVWVQKLREMKI  274
             LFRT++E+ IT + AL+TVL F+FQHV SM KS++ GF GYADTL+SI +WV++L+EMKI
Sbjct  326   LFRTKIEDMITSFDALKTVLNFEFQHVSSMTKSRDFGFFGYADTLRSIEMWVRRLQEMKI  385

Query  273   IP  268
             IP
Sbjct  386   IP  387



>ref|XP_007154349.1| hypothetical protein PHAVU_003G111300g [Phaseolus vulgaris]
 gb|ESW26343.1| hypothetical protein PHAVU_003G111300g [Phaseolus vulgaris]
Length=376

 Score =   455 bits (1171),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 226/371 (61%), Positives = 289/371 (78%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV+G TG+ G+++V+ALKQP + GGPWKVYGAARR  P WFP S +D +++FDA++  
Sbjct  7     VALVVGVTGLTGLSLVQALKQPNSPGGPWKVYGAARRTPPRWFPPSTIDHFISFDAMDSS  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   L  I+ EVTH+FW+  Q+   EE NIR+N TML NVL +L S +SS L+HVT+QT
Sbjct  67    DTRAKLFPIATEVTHLFWITFQIHAEEEVNIRVNKTMLLNVLTALKSCNSSKLAHVTLQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPIFDP L + ++I H+ PF+E+  RLP+PNFYYALEDLVA YA +   ++S+H
Sbjct  127   GTKHYMGPIFDP-LHSTQLISHDPPFRENMARLPYPNFYYALEDLVASYAPS--LTYSVH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSIIIGASS SV N+L TL  YA IC+  G  FRYPG +YTWEHFCDM+DA +LA+Q +
Sbjct  184   RSSIIIGASSRSVHNALFTLAAYALICRHTGLAFRYPGTKYTWEHFCDMTDAGVLAQQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT +AKNQAFNCTNGDVF WK+IW+L  ++F++EFVAF+E   +  D+ E M+DKG 
Sbjct  244   WAAVTPEAKNQAFNCTNGDVFTWKSIWKLLSELFDVEFVAFDET--QALDLVEVMRDKGT  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L +T +E+ITCY ALQTVL F+FQHV SMNKS+E GF G+ DT KSI+ W
Sbjct  302   VWKEIVEKYELEKTILEDITCYEALQTVLHFEFQHVSSMNKSREYGFGGHVDTFKSIKFW  361

Query  300   VQKLREMKIIP  268
             V+KLR+MKIIP
Sbjct  362   VEKLRQMKIIP  372



>ref|XP_002276159.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=376

 Score =   455 bits (1170),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 236/372 (63%), Positives = 296/372 (80%), Gaps = 5/372 (1%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +VAL++G TGM G+++ EALK+P+A G PWKVYGAARRP P+WFP S +D YMTFDA+  
Sbjct  10    SVALIVGVTGMAGLSLAEALKKPSASGSPWKVYGAARRPQPTWFPISIVDHYMTFDAVCS  69

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
             +DT   LS ISNEVTHVFW+A+QV E EE NI +N+ ML NVL    S+ SS L HVT+Q
Sbjct  70    DDTRAKLSPISNEVTHVFWVAIQVRETEELNITVNAAMLSNVLEVFKSAPSSRLQHVTLQ  129

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsi  844
             TGTK YMGPIF P  +     P E PF+ED+PRLPFPNFYYALEDL+A  + T SF++S+
Sbjct  130   TGTKHYMGPIFYPEKSKQLTAP-ETPFREDFPRLPFPNFYYALEDLLA--SHTPSFTYSV  186

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HRSSIIIGASS S +N+LLTL VYA ICK +G PFRYPG RYTW+HFCDMSDAR+LAEQQ
Sbjct  187   HRSSIIIGASSRSTYNALLTLAVYAAICKHEGLPFRYPGTRYTWDHFCDMSDARVLAEQQ  246

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             IWA V+EKAKNQAFNC NGD+F WK++W++ C++FE+EFV F+E+  +EFD    M +KG
Sbjct  247   IWAAVSEKAKNQAFNCVNGDIFTWKSMWKVVCEVFEVEFVEFDES--QEFDFVGMMSEKG  304

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
             ++W  IVKKH L+ +++EEITC+ AL+ VL F+FQHVCSMNKS+  G+ G+ DTL+SI +
Sbjct  305   KVWESIVKKHGLYESKLEEITCFAALKAVLHFEFQHVCSMNKSRSFGWFGHVDTLQSIGI  364

Query  303   WVQKLREMKIIP  268
             WV++LR M IIP
Sbjct  365   WVERLRVMNIIP  376



>ref|XP_003607179.1| hypothetical protein MTR_4g073090 [Medicago truncatula]
 gb|AES89376.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=376

 Score =   445 bits (1144),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 231/376 (61%), Positives = 278/376 (74%), Gaps = 5/376 (1%)
 Frame = -2

Query  1395  NCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFD  1216
             N   +VALV+G TGM G+++ +ALKQP  LGGPWKVYGAARR    WFPSS LD ++TFD
Sbjct  2     NVRNSVALVVGVTGMAGLSLAKALKQPDCLGGPWKVYGAARRSADGWFPSSILDGFITFD  61

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
             A+N  DTH  L  +  EVTH+FW+  Q    EE NI +N TML NVL  L SS SSSL H
Sbjct  62    AVNSADTHDKLLPLVQEVTHLFWVTFQFVGDEEANITVNKTMLLNVLTVLKSSPSSSLIH  121

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsf  856
             +T+QTGTK YMGP+ DP L+T K+I HE PF E+ PRLP+PNFYY LEDLV  YA +   
Sbjct  122   ITLQTGTKHYMGPVHDPVLST-KLICHEPPFHENMPRLPYPNFYYVLEDLVTSYAPS--V  178

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++SIHRSSIIIG S  S  N L+ L VYA IC   G PFRYPGN+YTWEHFCDM+DA +L
Sbjct  179   TYSIHRSSIIIGMSPRSAHNVLMKLAVYAAICHHLGLPFRYPGNKYTWEHFCDMTDAGVL  238

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             A+Q +WA VTE AKNQAFNCTNGDVF WK++W L  ++F ++FV  E N  +EFD+ E M
Sbjct  239   AKQHVWAAVTEDAKNQAFNCTNGDVFTWKSMWMLLSEVFNVKFV--ELNDKEEFDLVELM  296

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             +DKGEIW  IV+++ L +T++EEI  + A   VLRFQFQHV SMNKSK+ GF  YADT K
Sbjct  297   RDKGEIWDLIVEEYGLHKTKLEEIASFEATVPVLRFQFQHVSSMNKSKDYGFFEYADTFK  356

Query  315   SIRVWVQKLREMKIIP  268
             SIR WV KLREMK+IP
Sbjct  357   SIRFWVAKLREMKLIP  372



>ref|XP_010098784.1| hypothetical protein L484_000585 [Morus notabilis]
 gb|EXC44184.1| hypothetical protein L484_000585 [Morus notabilis]
Length=381

 Score =   442 bits (1138),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 222/373 (60%), Positives = 292/373 (78%), Gaps = 6/373 (2%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS-FLDEYMTFDALNF  1204
             VAL++G TGM G+++ EALK P ALGGPW VYG AR+  P+WFPSS  +D +++FDAL+F
Sbjct  13    VALIVGVTGMAGISLAEALKSPEALGGPWTVYGTARQQKPTWFPSSATIDHFISFDALSF  72

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl-SHVTI  1027
             EDT + LS IS  VT +FW+A+QV + EE NI+ NS ML NVLR L SS +SS   HVT+
Sbjct  73    EDTLQKLSPISQHVTRLFWVAIQVRDTEESNIKANSVMLQNVLRVLNSSKNSSKLRHVTL  132

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             Q+GTK+YMGPIFDP+L   K+   + PF+ED  RLP+PNFYYALED+VA   + +SF++S
Sbjct  133   QSGTKRYMGPIFDPTLGVTKLAHPDPPFEEDAARLPYPNFYYALEDIVA--EKGHSFTYS  190

Query  846   ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQ  667
             +HR+SII+GAS+ S +N L+TLCVYA+IC  +  PFRYPG +YTWEH CD +DAR+LA+Q
Sbjct  191   VHRASIILGASARSFYNMLVTLCVYASICGHENLPFRYPGTKYTWEHLCDATDARVLAQQ  250

Query  666   QIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDK  487
              IWA VT+KAKNQA+NCTNGDVF WK++W++  ++F LEFV+FEE  ++  D  E MK K
Sbjct  251   HIWAAVTDKAKNQAYNCTNGDVFTWKSMWKVLAEIFGLEFVSFEE--EEYLDWVEMMKGK  308

Query  486   GEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIR  307
               +W  IV++H L +T+MEEITC+ A  TVL F+FQ+VCS+NKS+E GF GYA+TLKS+ 
Sbjct  309   ESVWEEIVERHGLNKTKMEEITCFEAANTVLHFEFQYVCSVNKSREYGFFGYANTLKSVS  368

Query  306   VWVQKLREMKIIP  268
             +WV +LR+MKIIP
Sbjct  369   MWVGRLRDMKIIP  381



>ref|XP_003609737.1| hypothetical protein MTR_4g121590 [Medicago truncatula]
 gb|AES91934.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09152.1| progesterone 5-beta-reductase 4 [Medicago truncatula]
Length=376

 Score =   431 bits (1109),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 278/371 (75%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV+G TGM G+++ +ALKQP  LGGPWKVYGAAR     WFPSS LD ++TFDA+N  
Sbjct  7     VALVVGVTGMAGLSLAKALKQPDCLGGPWKVYGAARHSPDEWFPSSILDSFITFDAVNSA  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   L  I+NEVTH+FW+  Q+   EE  I +N +ML NVL  L S  SS L+H+T+QT
Sbjct  67    DTRAKLLPIANEVTHLFWVTFQLVADEEVKISVNKSMLLNVLTVLKSYPSSPLTHITVQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK Y+GP+ DP  +T K+I HE PF+E+ PRL +PNFYYALEDLV  YA +   ++SIH
Sbjct  127   GTKHYLGPVHDPVQST-KLICHEPPFEENMPRLSYPNFYYALEDLVKSYAPS--ITYSIH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSIIIGAS  S +N L+ L  YA IC++ G PFR+PGNRYTWEHFCDM+DAR+LA+Q +
Sbjct  184   RSSIIIGASPRSAYNMLMVLATYAAICRQVGLPFRFPGNRYTWEHFCDMTDARVLAKQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT+KAKNQAFNCTNGDVFAWK++W++ C  F ++FV  +E   +EFD+ +FM+DKGE
Sbjct  244   WAAVTKKAKNQAFNCTNGDVFAWKSMWKVLCKTFAVKFVDLDEK--EEFDLVQFMRDKGE  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+++ L +T++EEI C+ AL  V RF+FQ V SMNKSK   F  YA+T  S++ W
Sbjct  302   VWDQIVEEYGLHKTKLEEIACFDALVPVFRFEFQLVSSMNKSKNYEFFEYAETFNSVKFW  361

Query  300   VQKLREMKIIP  268
             V KLREM +IP
Sbjct  362   VMKLREMNLIP  372



>ref|XP_004508264.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cicer 
arietinum]
Length=376

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 218/371 (59%), Positives = 278/371 (75%), Gaps = 5/371 (1%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VALV+G TGM G+++ EALK    L  PWKVYGAARR   +WFP S LD ++ FDA++  
Sbjct  7     VALVVGVTGMAGLSLAEALKDSNCLAAPWKVYGAARRFPNTWFPLSILDAFIAFDAVDLA  66

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   L  I++EVTH+FWL    D  EE N+ +N +ML NVL  L SS SS+L+HVT+QT
Sbjct  67    DTRAKLLPIAHEVTHLFWLTFNHDRDEEVNVTVNKSMLQNVLTVLKSSPSSTLTHVTVQT  126

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             GTK YMGPI DP  +T ++  HE PF E+ PRLP+P FYYALEDLVA YA +   ++SIH
Sbjct  127   GTKHYMGPINDPVRST-QLKGHEPPFNENMPRLPYPIFYYALEDLVASYAPS--ITYSIH  183

Query  840   rssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQI  661
             RSSIIIGAS  S  N+L+ L  YA IC+  G PFRYPG++YTWE+FCDM+DA +LA+Q +
Sbjct  184   RSSIIIGASPRSAINALMILATYAAICRHVGLPFRYPGSKYTWENFCDMTDASVLAKQHV  243

Query  660   WAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGE  481
             WA VT+ AKN+AFNCTNGDVF+WK++WRL  D+F++EFV  +E    EFD+ E M+DKG 
Sbjct  244   WAAVTKHAKNEAFNCTNGDVFSWKSMWRLLSDVFDVEFVELDEK--DEFDLVELMRDKGH  301

Query  480   IWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVW  301
             +W  IV+K+ L +T+++EI CY A+  VLRF+FQHV SMNKSK+ GF GYADT KSIR W
Sbjct  302   VWDMIVEKYGLHKTKLDEIACYEAMVPVLRFEFQHVSSMNKSKDYGFFGYADTFKSIRFW  361

Query  300   VQKLREMKIIP  268
             V K++EMK+IP
Sbjct  362   VNKMKEMKLIP  372



>ref|XP_010671934.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Beta 
vulgaris subsp. vulgaris]
Length=373

 Score =   424 bits (1091),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 218/379 (58%), Positives = 277/379 (73%), Gaps = 14/379 (4%)
 Frame = -2

Query  1398  ENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTF  1219
             +NC    ALV+G TGM G+++ +AL+ PTA GGPW +YGAARRP P+WFPSS +D Y+TF
Sbjct  5     QNC----ALVVGVTGMAGLSIAQALRNPTAQGGPWLIYGAARRPKPTWFPSSAVDHYITF  60

Query  1218  DALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds-ssl  1042
             DA+NF+DT+ +LS +S+++THVFW A+ V + EE+NI++NS ML NVL+ LT+      L
Sbjct  61    DAVNFDDTYTTLSPLSSQITHVFWAAIYVGQTEEDNIKINSIMLSNVLKVLTAHTRPIKL  120

Query  1041  SHVTIQTGTKQYMGPIF--DPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
              H+T+QTGT QY+GPI    PS A      HE PF ED  RLP+PNFY+ LED+V  Y  
Sbjct  121   RHITLQTGTSQYIGPIHFTSPSDAAQ----HEPPFHEDMGRLPYPNFYHVLEDVVKSYG-  175

Query  867   TNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSD  688
              +  ++SIHR SIII A + SV+N LLTL VYA ICK +  PF+YPGNRYTWEHFCDMSD
Sbjct  176   -SDLTYSIHRPSIIISALTRSVYNFLLTLAVYAEICKYQNAPFKYPGNRYTWEHFCDMSD  234

Query  687   ARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             AR+L EQ +W    EKAKN+ FNCTNGDVF+WK +    C+ F +EFV  +E G   FD+
Sbjct  235   ARVLGEQHVWGATNEKAKNEVFNCTNGDVFSWKKMRGFLCEEFGVEFVPLDEGGGL-FDL  293

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
              E MKDK  +W  IV++  L + +MEEITC+ A+QTVLRF FQ V SMNKSKE GFLGY 
Sbjct  294   VEEMKDKENVWDRIVEEKGLVKLKMEEITCFAAVQTVLRFNFQLVSSMNKSKEFGFLGYV  353

Query  327   DTLKSIRVWVQKLREMKII  271
             D+ KS+R W+ KLR+MKII
Sbjct  354   DSFKSVRFWIGKLRDMKII  372



>ref|XP_010671660.1| PREDICTED: iridoid synthase-like [Beta vulgaris subsp. vulgaris]
Length=373

 Score =   422 bits (1084),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 277/378 (73%), Gaps = 10/378 (3%)
 Frame = -2

Query  1398  ENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTF  1219
             +NC    AL++G TGM G+++ +AL+ PT   GPW +YGAARRP P+WFPSS +D Y+TF
Sbjct  5     QNC----ALIVGVTGMAGLSIAQALRSPTVQRGPWLIYGAARRPKPTWFPSSAVDHYITF  60

Query  1218  DALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssds-ssl  1042
             DA+NF++TH +LS +S+++THVFW A+ V   E++NI++NS ML NVL+ LT     + +
Sbjct  61    DAVNFDETHTTLSPLSSQITHVFWAAIHVGRTEDDNIKVNSAMLSNVLKVLTGHTQPNKV  120

Query  1041  SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETN  862
              HVT+QTGT QY+  ++    A      H+ PF ED  RLP+P+FY+ LED+V  Y   +
Sbjct  121   RHVTLQTGTSQYIDLVYFMGFADSAQ--HKPPFHEDMGRLPYPHFYHVLEDMVKSYG--S  176

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
               ++SIHR SIIIGAS+ SV+N LLTL VYA ICK +  PF+YPGN+YTWEHFCDM+DAR
Sbjct  177   DLTYSIHRPSIIIGASTRSVYNFLLTLAVYAEICKYQNAPFKYPGNKYTWEHFCDMTDAR  236

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             +L EQ +W+   EKAKNQ FNCTNGDVF+W+ +W + C+ F +EFV  +E G   FD+ E
Sbjct  237   VLGEQHVWSATNEKAKNQVFNCTNGDVFSWRKMWGVLCEEFGVEFVPLDEGGGL-FDLVE  295

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MKDKGE+W  IV++  L +T+MEEITC+ A Q V RF FQ V SMNKSKE GF GYAD+
Sbjct  296   SMKDKGEVWDKIVEEKGLVKTKMEEITCFVAFQYVTRFNFQMVNSMNKSKEFGFFGYADS  355

Query  321   LKSIRVWVQKLREMKIIP  268
              K++R W+ KLR+MKIIP
Sbjct  356   FKTVRFWIGKLRDMKIIP  373



>ref|XP_010259353.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=378

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/376 (57%), Positives = 281/376 (75%), Gaps = 7/376 (2%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDAL  1210
             +K+VAL++G TGMVG+ + EALK+P A GGPW VYG AR   PSWF SS +D Y+ FD  
Sbjct  6     AKSVALIVGITGMVGLNLAEALKKPRAPGGPWAVYGTARSAKPSWFSSSLVDGYIQFDLR  65

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVT  1030
             ++E TH+ L  ++N+VTH+FW+     + EE NI  NSTML NVLR LT S  S L HVT
Sbjct  66    DYEATHRELFPLANQVTHLFWMTFYYCDTEESNIAANSTMLANVLRVLTLSPISPLHHVT  125

Query  1029  IQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf  850
             + TGTKQYMGPIFDP L + +++PHE+PF+E+  RLPFPN Y+ALEDL+  ++    F++
Sbjct  126   LLTGTKQYMGPIFDPVLGS-RVVPHESPFREESDRLPFPNTYHALEDLLVSFSP--KFTW  182

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HRSSII GAS+ S  N LLT   YA IC+ +G PFR+PG+R+TWEHFCD SDA LLAE
Sbjct  183   SVHRSSIIFGASARSSHNILLTFAAYALICRREGSPFRFPGSRFTWEHFCDASDAGLLAE  242

Query  669   QQIW--AGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             QQIW     T  AKNQAFNCTNGDVF WK +W++ C++F++EFVAF E GDK FD  E M
Sbjct  243   QQIWAATTTTAMAKNQAFNCTNGDVFTWKYLWKVLCEVFDVEFVAFNE-GDK-FDWLEEM  300

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K+KG++W  IV+++ L +T +E+ITC+ A   VL F+ QHVCSM KS+E GF G+AD+ K
Sbjct  301   KNKGKVWDAIVEENGLCKTNLEDITCFNAANVVLNFRLQHVCSMTKSREFGFFGFADSAK  360

Query  315   SIRVWVQKLREMKIIP  268
             S++ WV+K+R+M IIP
Sbjct  361   SVKKWVEKMRDMNIIP  376



>gb|KDO47323.1| hypothetical protein CISIN_1g0426562mg, partial [Citrus sinensis]
Length=238

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 194/242 (80%), Gaps = 12/242 (5%)
 Frame = -2

Query  969  KMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsihrssiiIGASSLSVFNSL  790
            ++I H+ PFKED  RLPFPNFYYA+ED+ A Y+     ++S+HRSSIIIGASS S+ NSL
Sbjct  1    QLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPA--VTYSVHRSSIIIGASSRSLNNSL  58

Query  789  LTLCVYATICKEKGFPFRY--------PGNRYTWEHFCDMSDARLLAEQQIWAGVTEKAK  634
            LTL VYATIC+ +G PFRY         GN+YTWEHFCDMSD+R+LAEQQIWA  T++AK
Sbjct  59   LTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAK  118

Query  633  NQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKGEIWGGIVKKH  454
            NQAFNCTNGDVF WK++W+L  ++F++EFV F+E   ++FD+ E M++KGEIW  IV+KH
Sbjct  119  NQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEK--EKFDVVEMMEEKGEIWDEIVEKH  176

Query  453  RLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRVWVQKLREMKI  274
             L++T+MEEITC+ AL TVL  QFQHV SMNKS+E GF G+ DT+KSIR WV+KLREMKI
Sbjct  177  GLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKI  236

Query  273  IP  268
            IP
Sbjct  237  IP  238



>gb|ABR16709.1| unknown [Picea sitchensis]
Length=399

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 236/374 (63%), Gaps = 8/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VALVIG TG+VG  + E L       GPWKVYG ARRP P W P S + EY+  D L+
Sbjct  33    QGVALVIGVTGIVGNCLAEILPLSDTPRGPWKVYGVARRPKPDWSPDSPV-EYIQCDVLD  91

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E T + +S +  +VTH+FW+     E EE+N   N  ML NVL +L  +  +   H+ +
Sbjct  92    RELTLEKISPLK-DVTHLFWVVWVSRETEEQNCEDNGRMLSNVLDALLPNAENLQ-HICL  149

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET-Nsfsf  850
             QTG K Y+GP FD +       PHEAP+ E+ PRLP PNFYY LED+V   A+  +  ++
Sbjct  150   QTGAKHYLGP-FDAAARNRCFQPHEAPYHEELPRLPVPNFYYTLEDIVFEAAKKKDGLTW  208

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + IIG S  S+ N L TLCVYA ICK +G PF+YPGN  +WE F D SDA L+AE
Sbjct  209   SIHRPAAIIGFSPWSLMNVLGTLCVYAAICKHEGLPFKYPGNTISWEQFMDASDAELIAE  268

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA     AKNQAFNC+NGDVF WK +WR+  + F+LE +  E  G   F +AE MKD
Sbjct  269   QEIWAATDPYAKNQAFNCSNGDVFKWKRLWRIIAEKFDLEPLPREGEG---FSLAEAMKD  325

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV +++L+ T++EE+  +     VL   ++ V SMNKSKE GF G+ +T  S+
Sbjct  326   KGPVWDAIVGENKLYPTKIEEVGNWWFADFVLNVPWEPVFSMNKSKEYGFFGFRNTETSV  385

Query  309   RVWVQKLREMKIIP  268
               W+ K+R   I+P
Sbjct  386   GQWIDKIRASNIVP  399



>gb|ABK24388.1| unknown [Picea sitchensis]
Length=399

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 232/374 (62%), Gaps = 8/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VALVIG TG+VG  + E L      GGPWKVYG ARRP P W P S + EY+  D L+
Sbjct  33    QGVALVIGVTGIVGNCLAEILPLSDTPGGPWKVYGVARRPKPDWSPDSPV-EYVQCDVLD  91

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E T + +S +  +VTH+FW+     E EE+N   N  ML NVL +L  +  +   H+ +
Sbjct  92    REHTLEKISPLK-DVTHLFWVVWVNRETEEQNCEDNGRMLSNVLDALLPNAENLQ-HICL  149

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP FD         PHE PF E+ PRLP PNFYY LED+V   A+       
Sbjct  150   QTGGKHYLGP-FDAVARNRDFQPHEPPFHEELPRLPAPNFYYTLEDIVFEAAKKKQGLTW  208

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR ++I G S  S+ N + +LCVYA ICK +G PF+YPGN  TWE F D+SDA L+AE
Sbjct  209   SIHRPTVIFGFSPWSLMNIVGSLCVYAAICKHEGLPFKYPGNIITWEQFMDVSDAELIAE  268

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA     AKNQAFNC NGDVF WK +W++  + F+LE +++E  G   F +AE MKD
Sbjct  269   QEIWAATDLYAKNQAFNCANGDVFKWKRLWKIIAEKFDLELLSYEGEG---FSLAEVMKD  325

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV +++L  T++EE+  +     VL   +  V SMNKSKE GF G+ +T  S+
Sbjct  326   KGPVWDAIVGENKLHPTKIEEVGNWWFADLVLNPPWGTVLSMNKSKEYGFFGFRNTETSM  385

Query  309   RVWVQKLREMKIIP  268
               W+ K+R   I+P
Sbjct  386   GQWIDKVRSSNIVP  399



>gb|ABK24243.1| unknown [Picea sitchensis]
Length=399

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 235/376 (63%), Gaps = 12/376 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VALVIG TG+VG ++VE L      GGPWK+YG ARRP P W P + + EY+  D L 
Sbjct  33    QGVALVIGVTGIVGNSLVEILPLSDTPGGPWKIYGVARRPKPDWSPDTPV-EYIQCDVL-  90

Query  1206  FEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHV  1033
               D   +L KIS   +VTH+FW+     E EE+N   N  ML NVL +L  +  +   H+
Sbjct  91    --DRKLTLEKISPLKDVTHLFWVVWVSRETEEQNCEDNGRMLSNVLDALLPNAENLQ-HI  147

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET-Nsf  856
              +QTG K Y+GP FD         PHEAP+ E+ PRLP PNFYY LED+V   A+  +  
Sbjct  148   CLQTGAKHYLGP-FDAVARNRYFQPHEAPYHEELPRLPVPNFYYTLEDIVFEAAKKKDGL  206

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++SIHR S I G S  S+ N L TLCVYA ICK +G PF+YPGNR TWE F D+SDA L+
Sbjct  207   TWSIHRPSFIFGFSPWSLMNILGTLCVYAAICKHEGLPFKYPGNRITWEQFVDISDAELI  266

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ+IWA     AKNQAFNC+NGDV  WK +W +  + F+LE + ++  G   F +AE M
Sbjct  267   AEQEIWAATYPHAKNQAFNCSNGDVLKWKRLWGIIAEKFDLEPLPYKGEG---FSLAEAM  323

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  +V++++L  T++EE+  +      L    + V SMNKSKE GF G+ +T  
Sbjct  324   KDKGPVWDALVRENKLHPTKIEEVGNWWFADFTLNLPQETVHSMNKSKEYGFFGFRNTET  383

Query  315   SIRVWVQKLREMKIIP  268
             S+  W+ K++   ++P
Sbjct  384   SLGQWIDKMKASNVVP  399



>gb|ABR16676.1| unknown [Picea sitchensis]
Length=399

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 171/374 (46%), Positives = 236/374 (63%), Gaps = 8/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VALVIG TG+VG ++VE L      GGPWK+YG ARRP P W P + + EY+  D L+
Sbjct  33    QGVALVIGVTGIVGNSLVEILPLSDTPGGPWKIYGVARRPKPDWSPDTSV-EYIQCDVLD  91

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E T + +S +  +VTH+FW+     E EE+N   N  ML NVL +L  +  +   H+ +
Sbjct  92    RELTLEKISPLK-DVTHLFWVVWVNRETEEQNCEDNGRMLSNVLDALLPNAENLQ-HICL  149

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET-Nsfsf  850
             QTG K Y+GP FD         PHEAP+ E+ PRLP PNFYY LED+V   A+  +  ++
Sbjct  150   QTGAKHYLGP-FDAVAGNRYFQPHEAPYHEELPRLPVPNFYYTLEDIVFEAAKKKDGLTW  208

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR S I G S  S+ N + TLCVYA ICK +G PF+YPGNR TWE F D+SDA L+AE
Sbjct  209   SIHRPSFIFGFSPWSLMNIVGTLCVYAAICKHEGLPFKYPGNRITWEQFVDISDAELIAE  268

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA     AKNQAFNC+NGDV  WK +W +  + F+LE + ++  G   F +AE MKD
Sbjct  269   QEIWAATYPHAKNQAFNCSNGDVLKWKRLWGIIAEKFDLEPLPYKGEG---FSLAEAMKD  325

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  +V++++L  T++EE+  +   +  L    + + SMNKSKE GF G+ +T  S+
Sbjct  326   KGPVWDALVRENKLHPTKIEEVGNWWFAEFTLNLPQEMINSMNKSKEYGFFGFRNTETSL  385

Query  309   RVWVQKLREMKIIP  268
               W+ K++    +P
Sbjct  386   GQWIDKMKASNAVP  399



>ref|XP_006847874.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
 gb|ERN09455.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
Length=389

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 228/374 (61%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWKVYG  RRP P W     + EY+  D LN
Sbjct  26    QSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVGRRPCPKWSEDHPI-EYIQCDILN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS +++ +THVF++       E EN  +N  M  NVL +L  +  +   H+ +
Sbjct  85    LEETTAKLSPLTD-ITHVFYVTWADRISEAENCDVNGHMFRNVLDALLPNAPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP      A   + PHE P++ED PRLP  NFY+ LED++   AE       
Sbjct  143   QTGRKHYLGPF----EAIGHVKPHEPPYQEDVPRLPCLNFYHTLEDILFEAAEKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR ++I G S  S+ N + +LCVYA ICK +G PFR+PG++  WE F D SDA L+AE
Sbjct  199   SVHRPTVIFGFSPYSLMNLVGSLCVYAAICKHEGLPFRFPGSKAQWEGFSDASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   AKN+AFNC NGDVF WK +W++  + F LE V +E  G   F + E MK+
Sbjct  259   QHIWAAVDPHAKNEAFNCANGDVFRWKQLWKILGEQFGLELVEYEGKG---FSLVEAMKE  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T+++E+  +     +L  +   + SMNK+KE GFLG+ +TL S 
Sbjct  316   KGPVWDTIVKENELSETKLQEVAQWWFADVMLDNEGVGLDSMNKAKEHGFLGFRNTLTSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   SSWIDKMKAHKIVP  389



>ref|XP_002518657.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43582.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 224/377 (59%), Gaps = 15/377 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P W  +  L EY+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPIW-QADHLIEYIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E T + LS +  + TH+F++A   +  E EN  +N TML NVLR++  +  +   HV +
Sbjct  85    EEQTLEKLSTLK-DTTHIFFVAWASEPTEAENCIVNGTMLRNVLRAVIPNAENLQ-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIP-HEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf  850
             QTG K Y+G     S  +   IP HE+PF ED PRL   NFYY LED+  ++ ET     
Sbjct  143   QTGRKHYVG-----SFESIWKIPSHESPFHEDLPRLNDINFYYTLEDV--LFDETQKKEG  195

Query  849   sihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
                         G S  S+ N + TLCVYA ICK +G P  +PGNR  W+ + D SDA L
Sbjct  196   LTWSIHRPGVIFGFSPCSLINMVGTLCVYAAICKHQGLPLTFPGNRDAWDGYWDASDADL  255

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AE QIWA V   AKN+AFNC+NGDVF WK +W+   + FE+E   FEE  DK   + E 
Sbjct  256   IAEHQIWAAVDPYAKNEAFNCSNGDVFKWKHLWKELAEQFEIENYGFEEENDKRPSLVEM  315

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK+KG +W  IVK+  L  TR+EE+  +  +  +L+     + SMNKSKE GFLG+ ++ 
Sbjct  316   MKNKGPVWDEIVKEKELLPTRLEEVAAFWLVDLLLQGA-SLLDSMNKSKEHGFLGFRNSN  374

Query  318   KSIRVWVQKLREMKIIP  268
             KS   W+ KL+  +I+P
Sbjct  375   KSFASWIDKLKAQRIVP  391



>ref|XP_010271744.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=389

 Score =   288 bits (738),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 224/374 (60%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLIIGVTGVVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS ++ +VTH+F++       E  N   N  ML NVL ++  +  +   H+ +
Sbjct  85    PEETQSKLSPLT-DVTHIFYVTWTNRHTESANCEANGAMLRNVLTAVIPNAPNLN-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP      +  ++ PH+ PF ED PRL  PNFYY +ED L+    +    ++
Sbjct  143   QTGLKHYVGPF----ESFGRIQPHDPPFHEDLPRLNVPNFYYTMEDILLEEVQKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S+ N + TLCVYATICK +G P R+PG R  WE + D SDA ++AE
Sbjct  199   SIHRPGHIFGFSPYSLMNVIGTLCVYATICKHEGMPLRFPGTRIAWEGYSDASDADMIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC+NGDVF WK +W++  + F +E +  EE G     + E MKD
Sbjct  259   HQIWASVDPYAKNEAFNCSNGDVFKWKHLWKVLGEQFGVEELMMEEGG---LSLEEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++EE+  +  +  +   +  ++ SMNKSKE GFLG+ ++  S 
Sbjct  316   KGPVWDEIVREKELVPTKLEEVGVWWFVDAIFGLKESYLASMNKSKEHGFLGFRNSTNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   ISWIDKMKSYKIVP  389



>ref|XP_007042587.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
 gb|EOX98418.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 231/374 (62%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W  +  +D Y+  +  N
Sbjct  26    KSVALVIGITGIVGSSLAEILPFSDIPGGPWKVYGVARRPRPAWTNALPID-YIQCNISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T + LSK+  +VTH+F++A      E EN  +N TML NVL+++  +      HV +
Sbjct  85    EEETQEKLSKL-KDVTHIFYVAWAKKSSEAENCMVNGTMLRNVLKAVIPNAPKLK-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG + Y GP FD   +  K+ PH+ PF+ED PRLP  NF Y LED L     + +  ++
Sbjct  143   QTGRRHYTGP-FD---SVGKVQPHDPPFREDLPRLPVLNFCYTLEDVLFEEVKKKDGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + +LCVYA ICK +G P R+PG+R  W+ + D SDA L+AE
Sbjct  199   SVHRPGVIFGFSPCSLMNIVGSLCVYAAICKHEGKPLRFPGSRQAWDGYWDASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA +   AKN+AFNC+NGDVF WK +W++    F +E   F E+ D+   + E MKD
Sbjct  259   HQIWAALNRHAKNEAFNCSNGDVFKWKDLWKVLAKQFGIEDYGFHES-DERHSLVEMMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++ E+  +     VL  +   + SMNKSKE GF+G+ ++  S 
Sbjct  318   KGPLWDEIVREKGLVHTKLNEVGAWRFADAVLSGK-SLLDSMNKSKEHGFVGFRNSKTSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   NSWIDKMKTHKIVP  390



>ref|XP_007042586.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98417.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
Length=407

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 231/374 (62%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W  +  +D Y+  +  N
Sbjct  43    KSVALVIGITGIVGSSLAEILPFSDIPGGPWKVYGVARRPRPAWTNALPID-YIQCNISN  101

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T + LSK+  +VTH+F++A      E EN  +N TML NVL+++  +      HV +
Sbjct  102   EEETQEKLSKL-KDVTHIFYVAWAKKSSEAENCMVNGTMLRNVLKAVIPNAPKLK-HVCL  159

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG + Y GP FD   +  K+ PH+ PF+ED PRLP  NF Y LED L     + +  ++
Sbjct  160   QTGRRHYTGP-FD---SVGKVQPHDPPFREDLPRLPVLNFCYTLEDVLFEEVKKKDGLTW  215

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + +LCVYA ICK +G P R+PG+R  W+ + D SDA L+AE
Sbjct  216   SVHRPGVIFGFSPCSLMNIVGSLCVYAAICKHEGKPLRFPGSRQAWDGYWDASDADLIAE  275

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA +   AKN+AFNC+NGDVF WK +W++    F +E   F E+ D+   + E MKD
Sbjct  276   HQIWAALNRHAKNEAFNCSNGDVFKWKDLWKVLAKQFGIEDYGFHES-DERHSLVEMMKD  334

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++ E+  +     VL  +   + SMNKSKE GF+G+ ++  S 
Sbjct  335   KGPLWDEIVREKGLVHTKLNEVGAWRFADAVLSGK-SLLDSMNKSKEHGFVGFRNSKTSF  393

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  394   NSWIDKMKTHKIVP  407



>gb|AIW09147.1| progesterone 5-beta-reductase 5 [Catharanthus roseus]
Length=388

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 235/375 (63%), Gaps = 17/375 (5%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+VALV+G TG+VG ++ E LK P   GGPWKVYG ARRP P W     + EY+  D  N
Sbjct  29    KSVALVVGVTGIVGSSLAEVLKLPDTPGGPWKVYGVARRPCPVWLAKKPV-EYIQCDVSN  87

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ++T   LS +  ++TH+F+++     +  E+ + N+TM  N+L S+  + S+   HV +
Sbjct  88    NQETISKLSPLK-DITHIFYVSW----IGSEDCQTNATMFKNILNSVIPNASNLQ-HVCL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET--Nsfs  853
             QTG K Y G IF+      K++PH++PF ED PRL  PNFY+ LED+  +Y ET  N+ +
Sbjct  142   QTGIKHYFG-IFEEG---SKVVPHDSPFTEDLPRLNVPNFYHDLEDI--LYEETGKNNLT  195

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR +++ G S  S+ N + TLCVYATICK +     YPG++ +W  + D  DA L+A
Sbjct  196   WSVHRPALVFGFSPCSMMNIVSTLCVYATICKHENKALVYPGSKNSWNCYADAVDADLVA  255

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             E +IWA V  KAKNQ  NC NGDVF WK IW+   + F +E V + E G ++  +AE MK
Sbjct  256   EHEIWAAVDPKAKNQVLNCNNGDVFKWKHIWKKLAEEFGIEMVGYVE-GKEQVSLAELMK  314

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DK ++W  IVKK+ L  T+++EI  +     +       + SMNKSKELGFLG+ +++KS
Sbjct  315   DKDQVWDEIVKKNNLVPTKLKEIAAF-WFADIAFCSENLISSMNKSKELGFLGFRNSMKS  373

Query  312   IRVWVQKLREMKIIP  268
                 + K+R+ + IP
Sbjct  374   FVSCIDKMRDYRFIP  388



>gb|AIW09146.1| progesterone 5-beta-reductase 4 [Catharanthus roseus]
Length=390

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/375 (42%), Positives = 232/375 (62%), Gaps = 12/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPV-EYIQCDVYN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ++T   +S ++ +VTH+FW        E +   +N TM  NV+ +L  +  +   H+ I
Sbjct  85    SDETQAKISPLT-DVTHIFWTTWANRPTEAQCCEVNGTMFQNVVNALLPNAPNLS-HICI  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG K Y+GP      A  K+ PH+ PF ED PRL  PNFYY LED+      +    ++
Sbjct  143   QTGHKHYIGPF----EAFGKVKPHDTPFIEDVPRLDAPNFYYTLEDIAFDACNKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR ++I G S LS+ N + TLCVYA ICK +  P  +PG +  W  +   SDA L+AE
Sbjct  199   SVHRPAVIFGFSPLSMMNLVGTLCVYAAICKHENVPLTFPGTKAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEF-DIAEFMK  493
              QIWA V   AKN+AFNC+NGD+F WK +W++  + FE+++V F+EN  +EF  +++ MK
Sbjct  259   HQIWAAVDPYAKNEAFNCSNGDIFKWKHLWKVLAEQFEVDYVEFDEN--QEFVSLSDRMK  316

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DKG +W  IV+K++L  T++EE+  +     +L F+   + SMNKSKE GFLG+ +T KS
Sbjct  317   DKGSVWDEIVEKNQLIPTKLEEVATFWFADLILGFECM-LDSMNKSKEHGFLGFRNTAKS  375

Query  312   IRVWVQKLREMKIIP  268
             +   V K++  KI+P
Sbjct  376   LVSVVDKMKAHKIVP  390



>gb|AHA82033.1| iridoid synthase [Catharanthus roseus]
Length=386

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 241/391 (62%), Gaps = 17/391 (4%)
 Frame = -2

Query  1434  AFRYLTCKKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSW  1255
             A + L  K+ G     K+VALV+G TG+VG ++ E LK P    GPWKVYG ARRP P+W
Sbjct  11    AGKNLQNKENGVCKNYKSVALVVGVTGIVGSSLAEVLKLPDTPVGPWKVYGVARRPCPAW  70

Query  1254  FPSSFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVl  1075
                  + EY+  D  N ++T   LS +  ++TH+F+++     +  E+ + N+TM  N+L
Sbjct  71    LAKKPV-EYIQCDVSNNQETISKLSPLK-DITHIFYVSW----IGSEDCQTNATMFKNIL  124

Query  1074  rsltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYAL  895
              S+  + S+   HV +QTG K Y G IF+      K++PH++PF ED PRL  PNFY+ L
Sbjct  125   NSVIPNASNLQ-HVCLQTGIKHYFG-IFEEG---SKVVPHDSPFTEDLPRLNVPNFYHDL  179

Query  894   EDLVAIYAET--NsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNR  721
             ED+  +Y ET  N+ ++SIHR +++ G S  S+ N + TLCVYATICK +     YPG++
Sbjct  180   EDI--LYEETGKNNLTWSIHRPALVFGFSPCSMMNIVSTLCVYATICKHENKALVYPGSK  237

Query  720   YTWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVA  541
              +W  + D  DA L+AE +IWA V  KAKNQ  NC NGDVF WK IW+   + F +E V 
Sbjct  238   NSWNCYADAVDADLVAEHEIWAAVDPKAKNQVLNCNNGDVFKWKHIWKKLAEEFGIEMVG  297

Query  540   FEENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMN  361
             + E G ++  +AE MKDK ++W  IVKK+ L  T+++EI  +     +       + SMN
Sbjct  298   YVE-GKEQVSLAELMKDKDQVWDEIVKKNNLVPTKLKEIAAF-WFADIAFCSENLISSMN  355

Query  360   KSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             KSKELGFLG+ +++KS    + K+R+ + IP
Sbjct  356   KSKELGFLGFRNSMKSFVSCIDKMRDYRFIP  386



>ref|XP_004289734.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
1 [Fragaria vesca subsp. vesca]
 ref|XP_004289735.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=389

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 226/375 (60%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L  P   GGPWKVYG ARRP P W     + +Y+  D  +
Sbjct  26    QSVALVLGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPQPQWNADHHI-QYIQCDLSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E T   LS++++ VTH+F++       E EN   N  ML NVL ++  +  +   H+ +
Sbjct  85    SEQTETELSQLTD-VTHIFYVTWASKPSEAENCEANGKMLSNVLNAVIPNAPNLQ-HICM  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG KQY+GP         K+ PHE P+ ED  RL  PNFYY +ED L     +    ++
Sbjct  143   QTGRKQYVGPF----EMFGKIEPHEPPYVEDTSRLDCPNFYYVMEDILFEEVKKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  II G S  S+ N++ +LCVYA ICK +G P R+PG++ TWE F D SDA ++AE
Sbjct  199   SVHRPGIIFGFSPYSLINTIGSLCVYAAICKHEGQPLRFPGSKGTWEGFWDASDADMIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V   AKN+AFNC+NGDVF WK +W +  D FE+E        D+E  + E MKD
Sbjct  259   HEIWAAVEPYAKNEAFNCSNGDVFRWKHLWGILADQFEVESGGV----DEELRVEEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQF-QHVCSMNKSKELGFLGYADTLKS  313
             KG +W  IV+KH L  +++EE+  +  +  + R      + SMNKS+E GF+G+ ++  S
Sbjct  315   KGPVWDEIVRKHDLVPSKLEEVGNWWLVDIIFRIGVDSSMDSMNKSREHGFVGFRNSKTS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K++  +I+P
Sbjct  375   FLSWIDKMKSYRIVP  389



>sp|K7WDL7.1|IRIS_CATRO RecName: Full=Iridoid synthase [Catharanthus roseus]
 gb|AFW98981.1| iridoid synthase [Catharanthus roseus]
Length=388

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 239/386 (62%), Gaps = 21/386 (5%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             K+ G     K+VALV+G TG+VG ++ E LK P   GGPWKVYG ARRP P W     + 
Sbjct  20    KENGVCKSYKSVALVVGVTGIVGSSLAEVLKLPDTPGGPWKVYGVARRPCPVWLAKKPV-  78

Query  1233  EYMTFDALNFEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D  +++SK+S   ++TH+F+++     +  E+ + N+TM  N+L S+  
Sbjct  79    EYIQCDV---SDNQETISKLSPLKDITHIFYVSW----IGSEDCQTNATMFKNILNSVIP  131

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVA  880
             + S+   HV +QTG K Y G IF+      K++PH++PF ED PRL  PNFY+ LED+  
Sbjct  132   NASNLQ-HVCLQTGIKHYFG-IFEEG---SKVVPHDSPFTEDLPRLNVPNFYHDLEDI--  184

Query  879   IYAET--NsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
             +Y ET  N+ ++S+HR +++ G S  S+ N + TLCVYATICK +     YPG++ +W  
Sbjct  185   LYEETGKNNLTWSVHRPALVFGFSPCSMMNIVSTLCVYATICKHENKALVYPGSKNSWNC  244

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             + D  DA L+AE +IWA V  KAKNQ  NC NGDVF WK IW+   + F +E V + E G
Sbjct  245   YADAVDADLVAEHEIWAAVDPKAKNQVLNCNNGDVFKWKHIWKKLAEEFGIEMVGYVE-G  303

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
              ++  +AE MKDK ++W  IVKK+ L  T+++EI  +     +       + SMNKSKEL
Sbjct  304   KEQVSLAELMKDKDQVWDEIVKKNNLVPTKLKEIAAF-WFADIAFCSENLISSMNKSKEL  362

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ +++KS    + K+R+ + IP
Sbjct  363   GFLGFRNSMKSFVSCIDKMRDYRFIP  388



>gb|KHG08322.1| Uncharacterized protein F383_14595 [Gossypium arboreum]
Length=393

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 229/374 (61%), Gaps = 7/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+VALVIG TG+VG ++ E L      GGPWKVYG AR+P  +   S    EY+  D L+
Sbjct  26    KSVALVIGITGIVGNSLAEILPFSGIPGGPWKVYGVARQPRRA-STSHLPIEYIQCDVLD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T+  LSK+ N+VTHVF++A      E+EN  +N TML NVL+++  +      H+ +
Sbjct  85    EEETYDKLSKL-NDVTHVFYVAWDKRSTEDENCVINGTMLRNVLKAVIPNSRKLK-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG + Y GPI         + PH+ PF+ED  RL   NF Y LED L+    +  + ++
Sbjct  143   QTGRRHYTGPI--DLYGKYHVQPHDPPFREDLQRLKSSNFCYTLEDVLLEEVKQKENLTW  200

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S HR  ++ G S  S  N + +LC+YA ICK +G P R+PGNR  WE + D SDA L+AE
Sbjct  201   SGHRPGLVFGFSPFSSMNIVRSLCIYAAICKHEGEPLRFPGNRQAWEGYWDASDADLIAE  260

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA ++ +AKN+AFNC+NGDVF WK +W++  D F +E   F+E  +K   + E MKD
Sbjct  261   HQIWAAMSRRAKNEAFNCSNGDVFKWKDLWKVLADQFGIEHYGFQETEEKVPSLVEMMKD  320

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L   ++ +   +  + +VL  +   + SMNKSKE GF+G+ ++  S 
Sbjct  321   KGPVWDNIVRENDLLPMKLNDAGAWQFVDSVLSGK-SLLDSMNKSKEHGFVGFRNSKTSF  379

Query  309   RVWVQKLREMKIIP  268
               W++K++   I+P
Sbjct  380   NSWIKKMKTHNIVP  393



>ref|XP_006420622.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
 gb|ESR33862.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
Length=385

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/376 (42%), Positives = 225/376 (60%), Gaps = 7/376 (2%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDAL  1210
             ++ V L++G TG+VG ++ E L QP   GGPWKVYG ARRP P+W     + +Y+  D  
Sbjct  15    NQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKVYGVARRPRPAWNADHPI-QYIQCDVS  73

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVT  1030
             + ++T   LSK++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV 
Sbjct  74    DADETQAKLSKLT-DVTHIFYVTWASRPTELENCHVNGAMLRNVLRSVMPNAPNLR-HVC  131

Query  1029  IQTGTKQYMGPIFDPSLATD-KMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsf  856
             +QTG K Y+GP FD  + T     PH+ P+ ED PRL  PNFYY  ED L    A+ +  
Sbjct  132   LQTGGKHYLGP-FDYFVDTQLPHHPHDPPYTEDLPRLNVPNFYYDQEDILFEEVAKRDGL  190

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N   TLCVYA ICK +G P  +PG +  W+ F ++SDA L+
Sbjct  191   TWSVHRPLGIFGFSPYSMMNIACTLCVYAAICKHEGVPLLFPGTKEAWDGFTEVSDADLI  250

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQQIWA V   A+N+AFNC NGDVF WK  W++  + FE+E   F+E G++   + E M
Sbjct  251   AEQQIWAAVDPNARNEAFNCANGDVFKWKHFWKVLAERFEIEDYGFDEKGER-LRLVEIM  309

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K  +W  IV+K++L  T++ E+  +             + SMNKSK  GFLG+ ++  
Sbjct  310   KGKESVWEEIVRKNKLLPTKLNEVAIWWHADVSFDVGEDILVSMNKSKGHGFLGFRNSKN  369

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  370   SFIAWIDKMKRYKIVP  385



>ref|XP_006472268.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=389

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 227/387 (59%), Gaps = 11/387 (3%)
 Frame = -2

Query  1419  TCKKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSF  1240
               KK+G+++  + V LVIG TG++G ++ E L +P   GGPWKVYG ARRP P W     
Sbjct  11    AAKKLGEDD-ERNVGLVIGVTGILGNSLAEILPRPDTPGGPWKVYGVARRPRPHWNADHP  69

Query  1239  LDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             + EY+  D  + + T   LS+++ +VTH+F+        E EN ++N  ML NVL S+  
Sbjct  70    I-EYIQCDVSDPQQTQTKLSQLT-DVTHIFYTTWASSPTEVENCQINGAMLRNVLHSVIP  127

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPH--EAPFKEDYPRLPFPNFYYALEDL  886
             S  +   H+ + TG K Y+GP     +AT +M  H  E PF ED PRL  PNFYY  ED+
Sbjct  128   SAPNLR-HICLVTGAKHYLGPF---EVATRRMKSHPLEPPFTEDLPRLNMPNFYYTQEDI  183

Query  885   VAIYAETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWE  709
             +    E       S+HR  ++ G S  S+ N + TLCVYA +CK +G P  +PG +  WE
Sbjct  184   LFEEVEKREGLTWSVHRPHLVFGFSPYSLMNVVGTLCVYAALCKHEGIPLLFPGTKDCWE  243

Query  708   HFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEEN  529
              F   SDA L+AEQQIWA V  +A+N+AFNC+NGDVF WK +W++  + F +E   FEE 
Sbjct  244   GFSVASDADLIAEQQIWAVVDPRARNEAFNCSNGDVFKWKHLWKVLAERFGIEKYGFEEG  303

Query  528   GDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKE  349
             G+    + E +K K  +W  IVK+++L  T++ E+  +             + SMNKSKE
Sbjct  304   GET-VRLEEILKGKESVWEEIVKENQLRPTKLNEVAAWWIADVTFDIGAGMLVSMNKSKE  362

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GFLG+ D+ KS   W+ +L+  KI+P
Sbjct  363   YGFLGFRDSNKSFATWIDRLKHYKIVP  389



>ref|XP_006472267.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
Length=390

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 227/385 (59%), Gaps = 11/385 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK+G+++  + V LVIG TG++G ++ E L +P   GGPWKVYG ARRP P W     + 
Sbjct  14    KKLGEDD-ERNVGLVIGVTGILGNSLAEILPRPDTPGGPWKVYGVARRPRPHWNADHPI-  71

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
             EY+  D  + + T   LS+++ +VTH+F+        E EN ++N  ML NVL S+  S 
Sbjct  72    EYIQCDVSDPQQTQTKLSQLT-DVTHIFYTTWASSPTEVENCQINGAMLRNVLHSVIPSA  130

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPH--EAPFKEDYPRLPFPNFYYALEDLVA  880
              +   H+ + TG K Y+GP     +AT +M  H  E PF ED PRL  PNFYY  ED++ 
Sbjct  131   PNLR-HICLVTGAKHYLGPF---EVATRRMKSHPLEPPFTEDLPRLNMPNFYYTQEDILF  186

Query  879   IYAETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                E       S+HR  ++ G S  S+ N + TLCVYA +CK +G P  +PG +  WE F
Sbjct  187   EEVEKREGLTWSVHRPHLVFGFSPYSLMNVVGTLCVYAALCKHEGIPLLFPGTKDCWEGF  246

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQQIWA V  +A+N+AFNC+NGDVF WK +W++  + F +E   FEE G+
Sbjct  247   SVASDADLIAEQQIWAVVDPRARNEAFNCSNGDVFKWKHLWKVLAERFGIEKYGFEEGGE  306

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
                 + E +K K  +W  IVK+++L  T++ E+  +             + SMNKSKE G
Sbjct  307   T-VRLEEILKGKESVWEEIVKENQLRPTKLNEVAAWWIADVTFDIGAGMLVSMNKSKEYG  365

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ D+ KS   W+ +L+  KI+P
Sbjct  366   FLGFRDSNKSFATWIDRLKHYKIVP  390



>emb|CDP01225.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/384 (43%), Positives = 228/384 (59%), Gaps = 14/384 (4%)
 Frame = -2

Query  1416  CKKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFL  1237
             C + G +    + AL+IG TG+VG ++ E L      G PWKVYG ARRP P+W     L
Sbjct  16    CVENGGQKEHNSAALIIGITGIVGSSLAEMLLLHDTPGNPWKVYGVARRPRPTWLSDKRL  75

Query  1236  DEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltss  1057
             + Y+  D  N  +T   LS +  ++TH+F++      +  E+  LN +M  NVLR +  +
Sbjct  76    N-YIQCDISNSRETISKLSPLI-DITHIFYVCW----VGSEDCDLNGSMFRNVLRVVIPN  129

Query  1056  dssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAI  877
               +   HV +QTG K Y+G +FD      K  PHE+PF ED PRLP PNFYY LED++  
Sbjct  130   APNLQ-HVCLQTGIKYYLG-VFDERY---KQEPHESPFTEDLPRLPIPNFYYDLEDILEE  184

Query  876   YAETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFC  700
               +       S HR +++ G S  S+ N + T+ VYATICK +  P  YPG+ ++W+ + 
Sbjct  185   ETKAKLGLTWSAHRPALVFGFSPCSMMNMVSTISVYATICKHENKPLVYPGSDFSWDCYY  244

Query  699   DMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDK  520
             D+ DA LLAEQQIWA +  KAKNQAFNC+NGDVF WK IW++  + F LE V + + G K
Sbjct  245   DVVDADLLAEQQIWASMEPKAKNQAFNCSNGDVFKWKHIWKILAEQFGLEMVEYRK-GQK  303

Query  519   EFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGF  340
             E  +AE MK K  +W  IVKKH+L  T++ +I  +  L  V+ +    V  MNKSKELGF
Sbjct  304   ETSMAELMKGKEPVWDEIVKKHKLVPTKLNDIAAF-WLADVVFYSDNRVSCMNKSKELGF  362

Query  339   LGYADTLKSIRVWVQKLREMKIIP  268
             L + D+ KS    ++K+R    IP
Sbjct  363   LRFKDSTKSFLDSIEKMRAYGFIP  386



>ref|XP_007223008.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
 gb|EMJ24207.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
Length=394

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/375 (43%), Positives = 223/375 (59%), Gaps = 10/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L +P   GGPWKVYG ARRP P W     +D Y+  D  +
Sbjct  28    RSVGLVIGVTGIVGNSLAEILPRPDTPGGPWKVYGVARRPRPKWNADHPVD-YIQCDISD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LSK++ +VTH+F+++      E EN   N  ML NVL  +     +   HV++
Sbjct  87    PEDTKAKLSKLT-DVTHLFYVSWAHKATEVENCEANGAMLRNVLGVVIPVAPNIR-HVSL  144

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      +  K+  H+ PF ED PRL   NFYY  ED++   A+       
Sbjct  145   QTGTKHYIGPF----ESFGKIKAHDPPFTEDLPRLDVSNFYYTQEDILFDEAKKKEGLSW  200

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +  P ++PG++  W  F   SDA L+AE
Sbjct  201   SVHRPNTIFGFSPYSLMNVIGTLCVYAAICKHEKKPLKFPGSKAAWNCFSVASDADLIAE  260

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             Q IWA V   AKN+AFN  NGDVF WK +W++  + F +E     EE G++   + E MK
Sbjct  261   QHIWAAVDPYAKNEAFNVNNGDVFKWKHVWKVLAEQFGIEEYGIDEEEGERRLSLVEMMK  320

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              KG +W  IVKK++L  T++EE+  +     VL  +   + SMNKSKE GFLG+ ++ +S
Sbjct  321   GKGGVWEEIVKKNKLQPTKLEEVGVWWFADIVLCVE-SALDSMNKSKEHGFLGFRNSQES  379

Query  312   IRVWVQKLREMKIIP  268
                WVQK++  KI+P
Sbjct  380   FTSWVQKMKAYKIVP  394



>gb|AFN22088.1| putative progesterone 5-beta-reductase [Draba aizoides]
Length=389

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 227/374 (61%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ +VTHVF++     + E EN   N TML NVLR++  + ++   HV +
Sbjct  85    ADDTKSKLSALT-DVTHVFYVTWTSGDSESENCEANGTMLRNVLRAVVPNAANLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD  ++      HE PF ED PRL  PNFYY LED L+    +    ++
Sbjct  143   QTGTKHYLGP-FDTFVSGSH---HEPPFTEDMPRLQTPNFYYTLEDVLMEEIKKKEGVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLVFPGSKKAWEGFTTASDADLVAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  259   QQIWAAVDSYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K ++W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KEKVWEEMVKENQLQERKLEEVGVWWFADFILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>gb|AFZ41790.1| putative progesterone 5-beta-reductase [Spinacia oleracea]
Length=398

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 225/374 (60%), Gaps = 7/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWK+YG ARRP P W  S    EY+  D  +
Sbjct  31    QSVALIVGVTGIVGNSLAEILPLSDTPGGPWKIYGVARRPRPDW-NSDHPIEYIQCDISD  89

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS ++ ++T++F++     + E EN  LNS M  NVL S   +  +   H+ +
Sbjct  90    ENDAVSKLSPLT-DITNIFYVCWGNRDSEAENRELNSKMFRNVLNSTIPNSPNLK-HICL  147

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP        D    H+ PF ED PRL  PNFYY LED L A  A+  S ++
Sbjct  148   QTGMKHYIGPFESWGKKIDHQ-HHDPPFNEDMPRLDIPNFYYDLEDILFAEIAKKESLTW  206

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + +LCVYA ICK +G P ++PG + +WE +   SDA L+AE
Sbjct  207   SVHRPGSIFGFSPYSLMNVVGSLCVYAAICKHEGVPLQFPGTKASWESYSQASDADLIAE  266

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIW  V   AKN+AFNC+NGDVF WK +WR+  + FE+E   F+E+G++ F I E MK 
Sbjct  267   HQIWTSVDPYAKNEAFNCSNGDVFKWKQLWRVLGEQFEVEIADFDEDGER-FSIEERMKG  325

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  I++++ L  T++EE+  +  L      ++ H+ +MNKSKE GFLG+ +T  S 
Sbjct  326   KEGVWEEIIRENGLVATKLEEVGSWWFLDKAFDGEW-HLDTMNKSKEHGFLGFRNTKNSF  384

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  385   VSWIDKMKAYKIVP  398



>gb|AFW16644.1| putative progesterone 5beta-reductase [Passiflora incarnata]
Length=389

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 226/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  25    ESVALVVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPQPDWNADHPV-EYIQCDIAD  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LSK+  +VTH+F++       E EN R+NS ML N+L +L  +  +   H+ +
Sbjct  84    SNDVQTKLSKLV-DVTHIFYVTWANRSSEAENCRVNSLMLRNLLEALIPNAPNLR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP F+  L  +    H+ PF ED PRL  PNFYY LED++   ++       
Sbjct  142   QTGTKHYVGP-FELVLQLET---HDPPFTEDTPRLNAPNFYYTLEDILLEESKKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR  II G S  S+ N + +LC+YA ICK +G P  +PG + +WE++   SDA L+AE
Sbjct  198   SIHRPDIIFGFSPYSLMNIIGSLCIYAAICKHEGQPLLFPGTKESWENYAVASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA V   A N+ FNC NGD+F WK +W++  + FE+E   FEE  +K   + E MKD
Sbjct  258   QEIWACVDPNAHNEVFNCHNGDLFKWKHLWKVLAEQFEIEKYGFEER-EKRVTLEERMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W GIV+KH+L  T++EEI  +     ++   + ++  MNK KE GF G+ ++  S 
Sbjct  317   KGPVWDGIVQKHQLSSTKLEEIGAF-WFPDIILGGWSNISCMNKCKEHGFFGFRNSKNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   ISWIDKMKAYKIVP  389



>ref|XP_001754205.1| predicted protein [Physcomitrella patens]
 gb|EDQ81106.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 228/378 (60%), Gaps = 13/378 (3%)
 Frame = -2

Query  1398  ENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTF  1219
             E   + VAL++G TG+VG  +   L +P + GGPWKVYG ARRP P W PS+   EYM  
Sbjct  18    EVGEQKVALILGVTGIVGNYLASLLAKPDSYGGPWKVYGVARRPRPEWVPSNI--EYMQV  75

Query  1218  DALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslS  1039
             D L+ + T   L  +  +VTHVFW+     + E ENI LNS +L N        ++ +L 
Sbjct  76    DLLDRQQTLAKLGALE-DVTHVFWVTWVQGKTEAENIELNSRLLQN-SIDALLPNAKNLQ  133

Query  1038  HVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAET  865
             H+ +QTG KQY GP     LA  K+ P E+PF ED PRLP   FY+  ED+V  A+    
Sbjct  134   HIVLQTGGKQYTGPF---ELAG-KIQPCESPFVEDVPRLPCDQFYHNQEDIVFEAVKQSG  189

Query  864   NsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDA  685
                ++SIHR +II G ++ ++ N + TL VYA ICK++G P  +PGN++T+E   D SDA
Sbjct  190   GRLTYSIHRPTIIFGFAAGNLMNLVGTLAVYALICKQEGKPLVFPGNQFTYERLFDASDA  249

Query  684   RLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIA  505
              L+AEQ+IWA V   AKNQA N +NGDVF WK +WRL  D F +E    E NG+    + 
Sbjct  250   ELIAEQEIWACVEPAAKNQALNSSNGDVFKWKKLWRLLADYFGME--VGEYNGNSIL-LD  306

Query  504   EFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYAD  325
             EFMK K ++W  +VKK+ L   ++ +I  +     +L    ++V SMNKSKELGFLG+ D
Sbjct  307   EFMKGKEDMWDQVVKKYNLEPVKLNDIGHWWFADLILNQSAENVSSMNKSKELGFLGWRD  366

Query  324   TLKSIRVWVQKLREMKII  271
             T KS    + K++   +I
Sbjct  367   TEKSFLSVLDKMKANNLI  384



>gb|AFZ42259.1| putative progesterone 5-beta-reductase [Aethionema grandiflorum]
Length=388

 Score =   276 bits (705),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 225/374 (60%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNTDHPI-EYIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++       E EN   N +ML NVL+++    S+   HV +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTQRSTELENCEANGSMLRNVLQAVIPHASNLQ-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD +L       HEAPF ED PRL  PNFYY  ED L     +    ++
Sbjct  143   QTGTKHYVGP-FD-NLGKSH---HEAPFTEDLPRLQIPNFYYVQEDILFEEIKKREGVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTAASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V + AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWASVDQYAKNEAFNCNNDDIFKWKQLWKILAEQFGIEEFGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L  +++EE+  +  +  +L      + SMNKSKE GFLG+ ++ KS 
Sbjct  316   KERVWEEIVKENQLQESKLEEVAVWWFVDAILGVDGM-IDSMNKSKEHGFLGFRNSNKSF  374

Query  309   RVWVQKLREMKIIP  268
               WV K +  KI+P
Sbjct  375   VSWVDKYKAFKIVP  388



>ref|XP_006471285.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=393

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 222/375 (59%), Gaps = 9/375 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V L++G TG+VG ++ E + +    GGPWKVYG ARRP P W  +  + EY+  D  +
Sbjct  26    QNVGLILGVTGIVGNSLAEIMPRSDTPGGPWKVYGVARRPRPDWNANRPI-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  85    QEETQAKLSKLT-DVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP         K+  HE P+ ED PRL  P FYY  ED++    E       
Sbjct  143   QTGGKHYVGPF----ECIGKIPSHEPPYTEDLPRLNVPLFYYTQEDILFEEVEKREGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S+ N + TLCVYA ICK +GFP  +PG + TWE F + SDA L+AE
Sbjct  199   SIHRPFGIFGFSPYSLMNIVGTLCVYAAICKHEGFPLLFPGTKETWEGFSEYSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             Q+IWA V   A+N+AFNCTNGDVF WK +W++  + FE+E   F +E G +   + E MK
Sbjct  259   QEIWAAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGDEKGSERVRLEEIMK  318

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IV++++L  T++ E+  +     V+     +  SMNKSKE GFLG+ ++  S
Sbjct  319   GKESVWEEIVRENQLQPTKLNEVAVWSYADMVMNVGAGYSVSMNKSKEHGFLGFRNSKNS  378

Query  312   IRVWVQKLREMKIIP  268
                W+ +L+  +I+P
Sbjct  379   FVAWIGRLKSHRIVP  393



>ref|XP_006432523.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
 ref|XP_006471284.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 gb|ESR45763.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
Length=394

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 222/375 (59%), Gaps = 9/375 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V L++G TG+VG ++ E + +    GGPWKVYG ARRP P W  +  + EY+  D  +
Sbjct  27    QNVGLILGVTGIVGNSLAEIMPRSDTPGGPWKVYGVARRPRPDWNANRPI-EYIQCDISD  85

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  86    QEETQAKLSKLT-DVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAPNLR-HICL  143

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP         K+  HE P+ ED PRL  P FYY  ED++    E       
Sbjct  144   QTGGKHYVGPF----ECIGKIPSHEPPYTEDLPRLNVPLFYYTQEDILFEEVEKREGLTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S+ N + TLCVYA ICK +GFP  +PG + TWE F + SDA L+AE
Sbjct  200   SIHRPFGIFGFSPYSLMNIVGTLCVYAAICKHEGFPLLFPGTKETWEGFSEYSDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             Q+IWA V   A+N+AFNCTNGDVF WK +W++  + FE+E   F +E G +   + E MK
Sbjct  260   QEIWAAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGDEKGSERVRLEEIMK  319

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IV++++L  T++ E+  +     V+     +  SMNKSKE GFLG+ ++  S
Sbjct  320   GKESVWEEIVRENQLQPTKLNEVAVWSYADMVMNVGAGYSVSMNKSKEHGFLGFRNSKNS  379

Query  312   IRVWVQKLREMKIIP  268
                W+ +L+  +I+P
Sbjct  380   FVAWIGRLKSHRIVP  394



>ref|XP_006432524.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006432525.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471283.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
 gb|ESR45764.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 gb|ESR45765.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=392

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (60%), Gaps = 10/373 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             V L++G TG+VG ++ E L +    GGPWKVYG ARRP P W  +  + EY+  D  + E
Sbjct  28    VGLILGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPDWNANHPI-EYIQCDISDQE  86

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             +T   LSK++ +VTH+F++       E EN ++N +M  NVLRS+  +  +   H+ +QT
Sbjct  87    ETQAKLSKLT-DVTHIFYVTWASRPTEVENCQINGSMFRNVLRSIIPNAPNLR-HICLQT  144

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-si  844
             G K Y+GP FD        IP++ PF ED PRL  P FYY  ED++    E       SI
Sbjct  145   GGKHYLGP-FD----CIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSI  199

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR   I G S  S+ N + TLC+YA ICK +G P  +PG + TWE F + SDA L+AEQQ
Sbjct  200   HRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQ  259

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKE-FDIAEFMKDK  487
             IWA V   A+N+AFNCTNGDVF WK +W+   + FE+E   F +  D E   + EFMK K
Sbjct  260   IWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGK  319

Query  486   GEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIR  307
               +W  IV++++L  T++ E+  +      L     ++ SMNKSKE GFLG+ ++  S  
Sbjct  320   ESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFV  379

Query  306   VWVQKLREMKIIP  268
              W+ +L+  +I+P
Sbjct  380   TWIGRLKSHRIVP  392



>ref|XP_006432526.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471281.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471282.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
 gb|ESR45766.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=393

 Score =   276 bits (705),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (60%), Gaps = 10/373 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             V L++G TG+VG ++ E L +    GGPWKVYG ARRP P W  +  + EY+  D  + E
Sbjct  29    VGLILGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPDWNANHPI-EYIQCDISDQE  87

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             +T   LSK++ +VTH+F++       E EN ++N +M  NVLRS+  +  +   H+ +QT
Sbjct  88    ETQAKLSKLT-DVTHIFYVTWASRPTEVENCQINGSMFRNVLRSIIPNAPNLR-HICLQT  145

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-si  844
             G K Y+GP FD        IP++ PF ED PRL  P FYY  ED++    E       SI
Sbjct  146   GGKHYLGP-FD----CIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSI  200

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR   I G S  S+ N + TLC+YA ICK +G P  +PG + TWE F + SDA L+AEQQ
Sbjct  201   HRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQ  260

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKE-FDIAEFMKDK  487
             IWA V   A+N+AFNCTNGDVF WK +W+   + FE+E   F +  D E   + EFMK K
Sbjct  261   IWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGK  320

Query  486   GEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIR  307
               +W  IV++++L  T++ E+  +      L     ++ SMNKSKE GFLG+ ++  S  
Sbjct  321   ESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFV  380

Query  306   VWVQKLREMKIIP  268
              W+ +L+  +I+P
Sbjct  381   TWIGRLKSHRIVP  393



>gb|AFZ42258.1| putative progesterone 5-beta-reductase [Nasturtium officinale]
Length=388

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 223/374 (60%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ +VTHVF++     E E +N   N +ML NVL+++     +   HV +
Sbjct  85    ADDTRSKLSPLT-DVTHVFYVTWTSRESEHDNCEANGSMLRNVLQAIVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +   +      H+APF ED PRL   NFYY LED L     + +S ++
Sbjct  143   QTGTKHYVGPFDNYGRSR-----HDAPFTEDMPRLQIQNFYYTLEDVLFEEIKKKDSVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKNAWEGFSAASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V E AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDEYAKNEAFNCNNADIFKWKHLWKVLAEQFGIEEYGFEEG--KNLGLVETMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L  T++ E+  +     +L      + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEIVKENQLQETKLVEVGVWWFADVILGVDGM-IDSMNKSKEHGFLGFRNSNSSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>ref|XP_008351978.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=392

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/374 (44%), Positives = 226/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+V LVIG TG+VG ++ E L      GGPWKVYG ARRP P W     +D Y+  D  +
Sbjct  28    KSVGLVIGITGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPHWNADHAVD-YIQCDISD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT K LSK+S +VTH+F++       E EN   N+ ML NVLR + S+  +   HV +
Sbjct  87    PDDTQKKLSKLS-DVTHIFYVTWTNRSTENENCEANAAMLRNVLRIVISNAPNLR-HVCL  144

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTKQY+GP         K+  H+ P  ED PRL  PNFYYALED L+    +    ++
Sbjct  145   QTGTKQYIGPF----ETFGKIDHHDPPCSEDLPRLNAPNFYYALEDVLLEEVGKKEDITW  200

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N +  L VYA ICK +G P ++PG++  W  + D SDA L+AE
Sbjct  201   SVHRPGVIFGFSPYSLANMVAMLSVYAAICKHEGMPLKFPGSKEAWNCYSDASDADLIAE  260

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFN  NGDVF WK +W++  + FE+E   F+E G+K   +AE MK 
Sbjct  261   QQIWAAVDPYAKNKAFNVNNGDVFKWKQLWKVLAEQFEIEEYGFDEEGEK-LSLAELMKV  319

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L   ++ EI  +  +  V   +   + SMNKSKE GFLG+ ++  S 
Sbjct  320   KEGVWEQIVKENQLEPMKLVEIGQWWLVDLVFGGE-GLMTSMNKSKEHGFLGFRNSGNSF  378

Query  309   RVWVQKLREMKIIP  268
               W+ KL+  KI+P
Sbjct  379   VSWIDKLKAFKIVP  392



>ref|XP_010905261.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Elaeis 
guineensis]
Length=398

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 227/378 (60%), Gaps = 14/378 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPS---SFLDEYMTFD  1216
             ++V LVIG TG+VG ++ + L      GGPWKVYG +RRP P++ PS       E++  D
Sbjct  30    QSVGLVIGVTGIVGNSLAQILPLSDTPGGPWKVYGVSRRPRPAFLPSQPEGLPVEHIQCD  89

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
               +FEDT   LS ++ +VTH+F+ A      E EN  +NS ML NVL ++  +  +   H
Sbjct  90    VSDFEDTLAKLSPLA-DVTHIFYAARVNRSTEAENREVNSAMLRNVLTNVLPNAPNLR-H  147

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETN  862
             + +QTG K Y+GP         K+  HE+PF+E  PRL  PNFYY LEDL+   +     
Sbjct  148   ICLQTGIKHYVGPF---ESIHGKVKAHESPFREALPRLDCPNFYYDLEDLLFEEVAKRKG  204

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
             + ++SIHR   I G S  S+     TLCVYA IC+ +G P R+PG+R  WE F D SDA 
Sbjct  205   TVTWSIHRPVTIFGFSPSSLVG---TLCVYAAICQREGAPLRWPGSRVAWEGFSDASDAD  261

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             L+AEQQIWA V   AKN+AFNC+NGDVF WK +W L    F +++V ++   +  F + +
Sbjct  262   LIAEQQIWAAVDLHAKNEAFNCSNGDVFKWKHLWPLLARAFGVDWVGYQGE-EARFKLED  320

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MK +  +W  +V +H L  TR+E++  +  +  V   +  ++ SMNKSKE GFLG+ +T
Sbjct  321   AMKGREALWEEMVAEHGLAPTRLEDVGNWWFVDAVFGAEEMYLGSMNKSKEHGFLGFRNT  380

Query  321   LKSIRVWVQKLREMKIIP  268
             + S   W+ K+R  KI+P
Sbjct  381   VSSFDSWIDKMRVYKIVP  398



>gb|AGT29342.1| putative progesterone 5-beta reductase [Barbarea vulgaris]
Length=388

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 220/374 (59%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N TML NVL+++     +   HV +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRESEHENCEANGTMLRNVLQAIVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP  +   +      H+APF ED PRL   NFYY LED++    + N     
Sbjct  143   QTGTKHYVGPFDNHGRSR-----HDAPFTEDMPRLQIQNFYYTLEDVLFEEIKKNESVAW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKNAWEGFTTASDADLVAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAVVDPYAKNEAFNCSNADIFKWKHLWKVLAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L    +EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQERNLEEVGVWWFADIILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>ref|XP_010520747.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=380

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 163/392 (42%), Positives = 229/392 (58%), Gaps = 24/392 (6%)
 Frame = -2

Query  1407  MGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEY  1228
             M ++   K VAL+IG TG+VG ++ E L +P   GGPWKVYG ARRP P W     + EY
Sbjct  1     MSRQIYHKNVALIIGVTGLVGNSLSEILLKPETNGGPWKVYGVARRPRPRWNSDCRI-EY  59

Query  1227  MTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdss  1048
             +  D  + E T + LS +++ VTHVF++     E E E    N+ ML +VL ++  S   
Sbjct  60    IQCDVSDAETTRRKLSCLTD-VTHVFYVTWASRETEAECCDANAAMLRHVLTAVAPSLR-  117

Query  1047  slSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAE  868
                HV +QTGTKQY+GP    SL   ++  HE PF ED PRLP+PNFYYALED++    E
Sbjct  118   ---HVVLQTGTKQYVGPY--ESLG--RIRTHEPPFSEDLPRLPYPNFYYALEDVLCQELE  170

Query  867   TNsfsfs--ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDM  694
                 S S  +HR +++ G S  S+ N + + C+YA +CK +G P  +P ++ TWE +   
Sbjct  171   KTDQSVSWSVHRPNVVFGFSPYSLANIVFSFCIYAAVCKHEGVPMYFPLSKTTWECYSVA  230

Query  693   SDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEF  514
             SDA L+AEQ+IWA +    KN+AFNC+NGDVF WK +W +  + F +E   FEE   K  
Sbjct  231   SDADLIAEQEIWAAMEASCKNEAFNCSNGDVFKWKQLWGILAESFGIEEYGFEEG--KNL  288

Query  513   DIAEFMKDKGEIWGGIVKKHRLFRTRMEE--ITCYPALQTVLRFQFQHVC--------SM  364
              + E MKDKG  W  IV+KH L  T +++  +  +  +  V+       C        SM
Sbjct  289   GLVEMMKDKGNAWREIVEKHGLEETELDDGIVGSWKIVDAVMAEGGLLDCMKGDGILDSM  348

Query  363   NKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             NKSKE GFL + ++ KS   W+ K ++ KI+P
Sbjct  349   NKSKEFGFLSFRNSKKSFVHWISKYKDHKIVP  380



>ref|XP_006433105.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
 gb|ESR46345.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
Length=397

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 224/377 (59%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LVIG TG+VG ++ E L +    GGPWKVYGAARRP P W     + EY+  D  +
Sbjct  29    QHVGLVIGITGIVGNSLAEILPRQDTPGGPWKVYGAARRPRPDWNTDHPI-EYIQCDVSD  87

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   L+K++ +VTH+F++       E EN  +N TML NVLRS+  +  +   HV +
Sbjct  88    QDDTQAKLTKLT-DVTHIFYVTWASRPTEAENCEVNGTMLRNVLRSVIPNAPNLR-HVCL  145

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP    S +  K+ PH+ PF ED PRL  PNFYY  ED++    E       
Sbjct  146   QTGAKHYLGP----SESFGKIRPHDTPFTEDLPRLNVPNFYYTQEDILFEEVEKRKGPLP  201

Query  849   ---sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
                S+HR  +I G S  S+ N   TLCVYA ICK +G P  +PG++  WE +   SDA L
Sbjct  202   LTWSVHRPHLIFGFSPYSLMNVGGTLCVYAAICKHEGVPLLFPGSKDCWEGYSIASDADL  261

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AEQQIWA V    +N+AFNC+NGDVF WK +W++  + FE+E     + G++   + E 
Sbjct  262   IAEQQIWAAVDPYGRNEAFNCSNGDVFKWKHLWKVLAEQFEIENYGLPQEGER-VRLEEI  320

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K  +W  IV++++L  T++ E+  +     +L   F  + SMNKSKE GFLG+ ++ 
Sbjct  321   MKGKEGVWEEIVRENQLQPTKLSEVAVWGFADMMLDGGFLWLGSMNKSKEHGFLGFRNSK  380

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  +I+P
Sbjct  381   NSFVYWIDKMKTYRIVP  397



>gb|ADK13080.1| putative progesterone 5-beta-reductase [Nierembergia aristata]
Length=387

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  N
Sbjct  25    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI-EYIQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS +S +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  84    PTDIQSKLSVLS-DVTHVFYVTWANRSTEVENCEINGKMFKNVLNVIIPNCPNLR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H+ PF+ED PRL  PNFYY LED++    E       
Sbjct  142   QTGRKHYLGP-----FEMLGKVAHDPPFQEDLPRLQVPNFYYTLEDILFEEVEKKEGLTW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P R+PG +  W+ + D SDA L+AE
Sbjct  197   SVHRPGNIFGFSPYSLMNIVGTLCVYAAICKHEGLPLRFPGAKGAWDGYSDCSDADLIAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
               IWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E  +K + +AE MKD
Sbjct  257   HHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGMEAAEFDE--EKRWTLAEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG IW  IVK+  L  T++EE+  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  315   KGPIWDEIVKESGLVATKLEEVGVWWFVDLILSGDCP-LDTMNKSKEHGFLGFRNSQKAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  374   ASWIDKVKACKVVP  387



>gb|AFZ41795.1| putative progesterone 5-beta-reductase [Duboisia hopwoodii]
Length=388

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 220/374 (59%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPI-EYIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  85    TEDTQSKLSVLT-DVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGP-----FELYGKVAHDSPFHEDLPRLDAPNFYYTLEDVLFKEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  198   SVHRPGTIFGFSPFSLMNIVGTLCVYAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F  E   F+E  +K   +AE MKD
Sbjct  258   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGREVAEFDE--EKRCTLAEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++E++  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KGSVWDEIVKENGLTPTKLEDVGVWWFVDLILAGDCP-LDTMNKSKEHGFLGFRNSPKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKACKVVP  388



>ref|XP_002302422.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
 gb|EEE81695.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
Length=390

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/373 (43%), Positives = 227/373 (61%), Gaps = 10/373 (3%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N 
Sbjct  27    SVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPV-EYIQCDISNT  85

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              +T   LS+++ +VTH+F++   +   E ENI  N+ M  NVL+++  +  +   HV +Q
Sbjct  86    AETQAKLSQLT-DVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALNLK-HVCLQ  143

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAI-YAETNsfsfs  847
             TG K Y+GP F+      K+ PH+ P+ ED PRL  PNFYY LED++A   A+    ++S
Sbjct  144   TGLKHYVGP-FE---LVGKIEPHDTPYTEDLPRLSAPNFYYDLEDILAGEVAKKEGVTWS  199

Query  846   ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQ  667
             +HR   I+G S  S+ N + TLCVYA ICK +G P  +PG    W+ +   SDA L+AEQ
Sbjct  200   VHRPHTILGFSPYSLMNIMGTLCVYAAICKHEGMPLLFPGTESVWDAYSIASDADLIAEQ  259

Query  666   QIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDK  487
             +IWA V   A+N+AFN  NGDVF WK +W++  + F ++     E+G K+  + E MKDK
Sbjct  260   EIWAAVDPNARNEAFNIHNGDVFKWKHLWKVLAEQFGIKKYGLPESG-KKVSLTELMKDK  318

Query  486   GEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIR  307
             G +W  IVK ++L   ++EE+  +     VL  +    C MNKSKE GFLG+ ++  S+ 
Sbjct  319   GAVWEKIVKDNQLLPNKLEEVGVWWFADFVLGAESIISC-MNKSKEHGFLGFRNSKNSLI  377

Query  306   VWVQKLREMKIIP  268
              WV KL+  KI+P
Sbjct  378   SWVDKLKAHKIVP  390



>ref|XP_003638459.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35787.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 222/376 (59%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GG WKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLIIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI-EYIQCDITD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS ++ +VTH+F+++      E EN  +NS ML NVL ++  +  +   HV++
Sbjct  85    PNETQTKLSVLT-DVTHIFYVSWSNRPSEAENCEVNSAMLRNVLTAVIPNAPNLR-HVSL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP FD      K+  HE PF ED PRL  PNFYY  ED+  ++ ET      
Sbjct  143   QTGGKHYLGP-FD---LIGKINSHEPPFTEDLPRLDAPNFYYTQEDI--LFEETQKKEGL  196

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N + TLCVYA ICK +G P ++PG +  WE +   SDA L+
Sbjct  197   SWSVHRPQVIFGFSPYSLMNLVGTLCVYAAICKHEGVPLKFPGTKGAWESYSVASDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E G +   ++E M
Sbjct  257   AEQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVLAEQFGIEEYGFDEEGPR-LKLSELM  315

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  IVK+++L  T+++E+  +  +  +   +   V SMNK+KE GF+G+ +T  
Sbjct  316   KDKGPVWDEIVKENQLEATKIDEVGEWWFVDLMFGGE-GAVDSMNKAKEHGFVGFRNTKN  374

Query  315   SIRVWVQKLREMKIIP  268
             S+  W+ K R  KI+P
Sbjct  375   SLISWIDKTRAYKIVP  390



>ref|XP_004300685.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/373 (41%), Positives = 218/373 (58%), Gaps = 10/373 (3%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +V LVIG TG+VG ++ E L  P   GGPWKVYG ARRP P+W     +D Y+  D    
Sbjct  28    SVGLVIGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPRPNWNADHPVD-YVQCDVSKP  86

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              D    L+ ++ +VTH+F++       E EN   N+ ML NVL ++  +  +   H+ +Q
Sbjct  87    NDVKAKLAPLT-DVTHIFYVTWTSKATESENCEANAAMLRNVLNAMIPNAPNLK-HICLQ  144

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-s  847
             TG   Y+GP FD      K+ PH++PFKED PRL   NFYY +EDL+    E       S
Sbjct  145   TGGNHYLGP-FD---TWGKIQPHDSPFKEDMPRLNVQNFYYTMEDLMFKEVEKKEGMSWS  200

Query  846   ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQ  667
             +HR   I+  S  S+ N L +LCVYA ICK +G P R+PG +  W      SDA L+AEQ
Sbjct  201   VHRPDTILWFSPHSMINILASLCVYAAICKHEGMPLRFPGTKGAWNCLSTASDADLIAEQ  260

Query  666   QIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDK  487
             QIWA V   A+NQAFN  NGDVF WK +W++  + F +E   F+E G++   + E MK K
Sbjct  261   QIWAAVDPYARNQAFNINNGDVFKWKHLWKVLAENFGIEECGFQEKGER-VSLREMMKGK  319

Query  486   GEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIR  307
               +W  IVKKH+L  T++E++  +  +  +   +    C MNKSKE GF+G+ ++  S+ 
Sbjct  320   SGVWNEIVKKHQLVPTKLEQVGVWWFVDAIFSGECMFGC-MNKSKEHGFVGFRNSRNSLV  378

Query  306   VWVQKLREMKIIP  268
              W+ K++  KI+P
Sbjct  379   TWIDKMKAYKIVP  391



>gb|KDO81569.1| hypothetical protein CISIN_1g0159921mg, partial [Citrus sinensis]
Length=384

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 227/380 (60%), Gaps = 15/380 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L  P   GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  13    QSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNW-NADHLVEYVQCDVSD  71

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS+++ +VTH+F++       E EN ++N +M  NVLR++  +  +   HV +
Sbjct  72    PEETQAKLSQLT-DVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNLR-HVCL  129

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A  K+ P++ PF ED PRL  PNFYY LED++    E       
Sbjct  130   QTGTKHYLGPF----EAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELSW  185

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N +  LCVYA +CK +G P R+PG +  WE +   SDA L+AE
Sbjct  186   SVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAE  245

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE------ENGDKEFDI  508
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E             G +   +
Sbjct  246   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEEGGGGTQRVKL  305

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
             AEFMK K  +W  IV++++L  TR++E+  +  +  VL  + + + SMNKSKE GF G+ 
Sbjct  306   AEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAK-LASMNKSKEHGFSGFR  364

Query  327   DTLKSIRVWVQKLREMKIIP  268
             ++  S   W+ K++  KI+P
Sbjct  365   NSKNSFITWIDKVKGFKIVP  384



>ref|XP_006433601.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
 gb|ESR46841.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
Length=390

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 157/385 (41%), Positives = 224/385 (58%), Gaps = 11/385 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK+G+++  + V LVIG TG++G ++ + L +P   GGPWK YG ARRP P W     + 
Sbjct  14    KKLGEDD-ERNVGLVIGVTGILGNSLADILPRPDTPGGPWKAYGVARRPRPDWNADHPI-  71

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
             EY+  D  + E T   LS+++ +VTH+F+        E EN ++N  ML NVL S+  + 
Sbjct  72    EYIQCDVSDPEQTQTKLSQLT-DVTHIFYTTWASRPTEVENCQINGAMLRNVLHSVIPTA  130

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPH--EAPFKEDYPRLPFPNFYYALEDLVA  880
              +   H+ + TG K Y+GP     +AT +M  H  E PF ED PRL  PNFYY  ED++ 
Sbjct  131   PNLR-HICLVTGAKHYLGPF---EVATRRMKSHPLEPPFTEDLPRLNMPNFYYTQEDILF  186

Query  879   IYAETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                E       S+HR  ++ G S  S+ N + TLCVYA ICK +G P  +PG +  WE F
Sbjct  187   EEVEKREGLTWSVHRPHLVFGFSPYSLMNVVRTLCVYAAICKHEGIPLLFPGTKDCWEGF  246

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQQIWA V   A+N+AFNC+NGDVF WK +W++  + F +E   FEE G+
Sbjct  247   SVASDADLIAEQQIWAAVDPCARNEAFNCSNGDVFKWKHLWKVLAERFGIEKYGFEEGGE  306

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
                 + E +K K  +W  IVK+++L  T++ E+                + SMNKSKE G
Sbjct  307   T-VRLEEILKVKESVWEEIVKENQLRPTKLNEVAAGWIADVTFDIGAGMLVSMNKSKEHG  365

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ +L+  KI+P
Sbjct  366   FLGFRNSNKSFATWIDRLKHYKIVP  390



>ref|XP_006432519.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
 gb|ESR45759.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
Length=393

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 221/375 (59%), Gaps = 9/375 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG  + E L +    GGPWKVYG ARRP P W  +++  EY+  D  +
Sbjct  26    QNVGLVVGVTGIVGNCLAEILPRSDTPGGPWKVYGVARRPRPDW-SAAYPIEYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ++T   LSK++N +TH+F++       + EN  +NS M  NVLRS+  +  +   HV +
Sbjct  85    PDETRSKLSKLTN-ITHIFYMTWAGRPAQAENCEINSAMFRNVLRSVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG+K Y+GP         K+  H+ PF ED PRL    FYY  ED++    E       
Sbjct  143   QTGSKHYLGPF----ECIGKIPSHDPPFTEDLPRLNVQLFYYNQEDILFEEVEKRGGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + TLCVYA ICK +G P  + G R TWE F + SDA L+A+
Sbjct  199   SVHRPFVIFGFSPYSLMNIVGTLCVYAAICKHEGVPLLFYGTRDTWECFSEYSDAELVAQ  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             QQIWA V   A+N+AFNCTNGDVF WK +W++  + F++E   F EE G +     E MK
Sbjct  259   QQIWAAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFQIENYGFGEEKGSQRMRFEEIMK  318

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IV++++L  T++ E+  +     VL     H+ SMNKS+E GFLG+ ++  S
Sbjct  319   GKESVWEEIVRENQLKPTKLNEVAVWSYADLVLNVGAGHLASMNKSREHGFLGFRNSKNS  378

Query  312   IRVWVQKLREMKIIP  268
                W+ +L+  +I+P
Sbjct  379   FISWINRLKNYRIVP  393



>ref|XP_006471279.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 221/375 (59%), Gaps = 9/375 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG  + E L +    GGPWKVYG ARRP P W  +++  EY+  D  +
Sbjct  26    QNVGLVVGVTGIVGNCLAEILPRSDTPGGPWKVYGVARRPRPDW-SAAYPIEYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ++T   LSK++N +TH+F++       + EN  +NS M  NVLRS+  +  +   HV +
Sbjct  85    PDETRSKLSKLTN-ITHIFYMTWAGRPAQAENCEINSAMFRNVLRSVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG+K Y+GP         K+  H+ PF ED PRL    FYY  ED++    E       
Sbjct  143   QTGSKHYLGPF----ECIGKIPSHDPPFTEDLPRLNVQLFYYNQEDILFEEVEKRGGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + TLCVYA ICK +G P  + G R TWE F + SDA L+A+
Sbjct  199   SVHRPFVIFGFSPYSLMNIVGTLCVYAAICKHEGVPLLFYGTRDTWECFSEYSDAELVAQ  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             QQIWA V   A+N+AFNCTNGDVF WK +W++  + F++E   F EE G +     E MK
Sbjct  259   QQIWAAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFQIENYGFGEEKGSQRMRFEEIMK  318

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IV++++L  T++ E+  +     VL     H+ SMNKS+E GFLG+ ++  S
Sbjct  319   GKESVWEEIVRENQLKPTKLNEVAVWSYADLVLNVGAGHLASMNKSREHGFLGFRNSKNS  378

Query  312   IRVWVQKLREMKIIP  268
                W+ +L+  +I+P
Sbjct  379   FISWINRLKNYRIVP  393



>ref|XP_009599751.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
 dbj|BAH47640.1| progesterone 5beta reductase-A [Nicotiana tabacum]
Length=389

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 223/374 (60%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGLARRPRPSWNADHPID-YIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NV+  +  +  +   H+ +
Sbjct  85    PEDTQSKLSLLT-DVTHVFYVTWASRSTEVENCEINGKMFQNVVSVVIPNCPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP         K++ H++PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGPF----ELYGKLVAHDSPFHEDLPRLDAPNFYYTLEDVLFKEVEKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  199   SVHRPGVIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E  +    + E MKD
Sbjct  259   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVEAAEFDE--ENRCTLVEMMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++E++  +  +  +L    + + +MNKSKE GFLG+ ++ K+ 
Sbjct  317   KGPVWDEIVKENGLTPTKLEDVGVWWFVDLMLAGDCR-LDTMNKSKEHGFLGFRNSQKAF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  376   ISWIDKVKAYKVVP  389



>gb|KDP41649.1| hypothetical protein JCGZ_16056 [Jatropha curcas]
Length=390

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 225/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LV+G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVGLVLGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPI-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS+++ +VTH+F++       E EN  +N  M  NVL+++  +  +   H+ +
Sbjct  85    QAETQSKLSQLT-DVTHIFYVTWANRSSEAENCEINGLMFRNVLQAVIPNAPNLG-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP         K+ PH+ PF ED PRL  PNFYY LED L    A+    ++
Sbjct  143   QTGTKHYLGPF----ELLGKIQPHDPPFSEDLPRLDAPNFYYTLEDILFEEVAKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S+ N + TLCVYA ICK +G P  +PG++ +W  +   SDA L+AE
Sbjct  199   SIHRPHSIFGFSPYSLMNIIGTLCVYAAICKHEGLPLLFPGSKASWNCYSIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E     E G+ +  + E MKD
Sbjct  259   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWQVLAEQFGIENYGLNE-GENKLSLQEMMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++++L  T++EE+  +     V+ +   ++ SMNKSKE GFLG+ ++  S 
Sbjct  318   KGAVWEEIVRENQLQPTKLEEVAEW-WFADVILWGEDYLQSMNKSKEHGFLGFRNSKNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   ISWIDKVKAYKIVP  390



>ref|XP_008377976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
 ref|XP_008347607.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNW-NADHLVEYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTH+F++       E EN  +N  ML NVL S+  +      H+ +
Sbjct  85    PDDAKAKLSPLT-DVTHIFYVTWTNRSTEAENCEVNGNMLRNVLDSVIPNAPKLS-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  EDL+    E       
Sbjct  143   QTGAKHYVGPF----ESFGKIQPHDPPFTEDLPRLDAPNFYYTQEDLLFAEVEKKEDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG+   W  +   SDA L+AE
Sbjct  199   SVHRPETIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGSSAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   +AE MK 
Sbjct  259   QQIWAAVDPHAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGGR-LSLAERMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IV+++ L  TR+EE+  +  +  +L  +   +CSMNKSKE GF+G+ ++  S 
Sbjct  318   KEGVWEEIVRENELQATRLEEVGVWWFVDAMLGGEAM-ICSMNKSKEHGFVGFRNSRNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   VTWIDKVKSFKIVP  390



>gb|ABD33275.2| progesterone 5-beta-reductase, putative [Medicago truncatula]
Length=387

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 158/389 (41%), Positives = 228/389 (59%), Gaps = 12/389 (3%)
 Frame = -2

Query  1428  RYLTCKKMGQE-NCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF  1252
             RY+   K  +     + VAL+IG TG+VG ++ E L       GPWKVYG ARRP P W 
Sbjct  9     RYIQITKFKEAPRNVQNVALIIGVTGIVGNSLAEILPLKDTPVGPWKVYGVARRPRPMWN  68

Query  1251  PSSFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlr  1072
               + +  Y+  D  N  D    LS ++ +VTH+F+++      E +N  +N  ML NVL+
Sbjct  69    VDNPV-HYIQCDVSNQNDVELKLSPLT-DVTHIFYVSWTSRPTEAQNCEVNGAMLRNVLQ  126

Query  1071  sltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALE  892
             +L  +  +   HV++QTG K Y+GP         K+ PHE+PF ED PRL  PNFYY LE
Sbjct  127   ALIPNAPNLS-HVSLQTGAKHYVGPF----EIIGKIKPHESPFTEDVPRLDTPNFYYTLE  181

Query  891   D-LVAIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYT  715
             D L     +    ++ I+R  +I G S  S+ N + TLCVYA ICK +G P R+PG++  
Sbjct  182   DILFEEVGKKKGTTWFINRPQVIFGFSPYSMMNLIGTLCVYAAICKHEGLPLRFPGSKGA  241

Query  714   WEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE  535
             WE +   SDA L++EQ IW  V   AKN+AFNC+NGDVF WK +W++  + FE++   FE
Sbjct  242   WECYSTASDANLISEQHIWGAVDPNAKNEAFNCSNGDVFRWKHLWKVLAERFEIDDYGFE  301

Query  534   ENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKS  355
             E    E  +++ MKDKG +W  IV+++ L  T++EE+  +     + R +   + SMNKS
Sbjct  302   EG--SELRLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWWFADFMFRVE-GVLDSMNKS  358

Query  354   KELGFLGYADTLKSIRVWVQKLREMKIIP  268
             KE GFLG+ ++  S   W+ K +  KI+P
Sbjct  359   KEHGFLGFRNSKNSFISWIDKTKAYKIVP  387



>ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 ref|XP_004163586.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 gb|KGN58303.1| hypothetical protein Csa_3G610790 [Cucumis sativus]
Length=394

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 153/376 (41%), Positives = 218/376 (58%), Gaps = 10/376 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    ESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS+++ +VTH+F++       E EN   N  ML NVLRS+  +  +   H+ +
Sbjct  85    PQDAETKLSQLA-DVTHLFYVTWTNRTTEIENCEANVKMLRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK Y+G     S+       H+ PF ED PRL  PNFYY  EDL+    E +     
Sbjct  143   QTGTKHYVGSF--ESIINKSSQRHDPPFTEDLPRLECPNFYYKQEDLLWEEIEQSQKKDL  200

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N + TLCVYA ICK +G P ++PGN+  WE F   SDA L+
Sbjct  201   TWAVIRPNLIFGFSPFSLMNVVGTLCVYAAICKHEGRPLKFPGNKLAWEDFQVASDADLI  260

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IW  V   +KN+AFNC NGDVF WK  W++  + F +E   F+E G+    + + M
Sbjct  261   AEQHIWTAVDPYSKNEAFNCNNGDVFKWKHFWKVLAEQFNIEEYGFDEEGES-LTLVDLM  319

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDK ++W  IVK+++L +T++EEI  +  + ++      ++ SMNKSKE GFLG+ ++  
Sbjct  320   KDKSDVWDEIVKENQLQQTKLEEIGTWWFVDSIFSMS-GNIDSMNKSKEHGFLGFRNSKN  378

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  379   SFISWIDKIKAFKIVP  394



>gb|KDO81568.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=396

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 227/380 (60%), Gaps = 15/380 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L  P   GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  25    QSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNW-NADHLVEYVQCDVSD  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS+++ +VTH+F++       E EN ++N +M  NVLR++  +  +   HV +
Sbjct  84    PEETQAKLSQLT-DVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNLR-HVCL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A  K+ P++ PF ED PRL  PNFYY LED++    E       
Sbjct  142   QTGTKHYLGPF----EAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELSW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N +  LCVYA +CK +G P R+PG +  WE +   SDA L+AE
Sbjct  198   SVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE------ENGDKEFDI  508
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E             G +   +
Sbjct  258   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEEGGGGTQRVKL  317

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
             AEFMK K  +W  IV++++L  TR++E+  +  +  VL  + + + SMNKSKE GF G+ 
Sbjct  318   AEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAK-LASMNKSKEHGFSGFR  376

Query  327   DTLKSIRVWVQKLREMKIIP  268
             ++  S   W+ K++  KI+P
Sbjct  377   NSKNSFITWIDKVKGFKIVP  396



>ref|XP_010111562.1| hypothetical protein L484_011348 [Morus notabilis]
 gb|EXC31269.1| hypothetical protein L484_011348 [Morus notabilis]
Length=389

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 221/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LV+G TG+VG ++ E L      GGPWKVYG  RRP P+W     + EY+  D  +
Sbjct  26    QSVGLVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVGRRPRPNWNADHPI-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT+  LS ++ +VTH+F++       E EN  +N  M  NVLR+L  +  +   H+ +
Sbjct  85    PEDTNTKLSTLT-DVTHIFYVTWANRATEVENCEVNGAMFHNVLRALIPNAPNLS-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      +  K+ PH+ PF ED PRL +PNFYY LED++            
Sbjct  143   QTGTKHYIGPF----ESFGKIKPHDPPFTEDLPRLEYPNFYYTLEDVLQEEVRKKESLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ +   SDA L+AE
Sbjct  199   SVHRPDTIFGFSPYSLMNLIGTLCVYAAICKHEGRPLKFPGTKAAWDSYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC NGDVF WK  W++  + F +E    EE   +   + E MKD
Sbjct  259   QQIWAAVDLYAKNEAFNCNNGDVFRWKHFWKVLAEQFGIEDWGLEEG--ERLRLTELMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK+++L  T++EE+  +     ++      + SMNKSKE GFLG+ ++  S 
Sbjct  317   KGPVWEEIVKENQLEPTKLEEVGVW-WFADLMFSGRAPLSSMNKSKEHGFLGFRNSKNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   ISWIDKVKAYKIVP  389



>gb|KDO81567.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=397

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 227/380 (60%), Gaps = 15/380 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L  P   GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  26    QSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNW-NADHLVEYVQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS+++ +VTH+F++       E EN ++N +M  NVLR++  +  +   HV +
Sbjct  85    PEETQAKLSQLT-DVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A  K+ P++ PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGTKHYLGPF----EAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELSW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N +  LCVYA +CK +G P R+PG +  WE +   SDA L+AE
Sbjct  199   SVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE------ENGDKEFDI  508
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E             G +   +
Sbjct  259   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEEGGGGTQRVKL  318

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
             AEFMK K  +W  IV++++L  TR++E+  +  +  VL  + + + SMNKSKE GF G+ 
Sbjct  319   AEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAK-LASMNKSKEHGFSGFR  377

Query  327   DTLKSIRVWVQKLREMKIIP  268
             ++  S   W+ K++  KI+P
Sbjct  378   NSKNSFITWIDKVKGFKIVP  397



>emb|CDY08911.1| BnaC08g11410D [Brassica napus]
Length=390

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/374 (43%), Positives = 222/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +  +VTHVF++      +E EN ++N +ML NVLR++  +  +   HV +
Sbjct  85    EEDARSKLSPL-RDVTHVFYVTWTNRSVESENCKVNGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A D+   HEAPF ED PRL   NFYY LED+++   +       
Sbjct  143   QTGTKHYLGPFDSVGKAVDR---HEAPFTEDMPRLKVDNFYYTLEDVLSEEIKMKESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  200   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKEAWEGFTTASDADLVAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCSNADVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     VL      + SMNKSKE GFLG+ ++  S 
Sbjct  318   KERVWEEMVKENQLQVKKLDEVGVWWFADVVLGVD-GMIDSMNKSKEYGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_011017142.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Populus euphratica]
Length=389

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 227/374 (61%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  25    QSVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPV-EYIQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS+++ +VTH+F++   +   E ENI  N+ M  NVL+++  +  +   HV +
Sbjct  84    TAETQAKLSQLT-DVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALNLK-HVCL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAI-YAETNsfsf  850
             QTG K Y+GP F+      K+ PH+ P+ ED PRL  PNFYY LED++A   A+    ++
Sbjct  142   QTGLKHYVGP-FE---LVGKIEPHDTPYTEDLPRLSAPNFYYDLEDILAGEVAKKEGVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I+G S  S+ N + TLCVYA ICK +  P  +PG    W+ +   SDA L+AE
Sbjct  198   SVHRPHTILGFSPYSLMNIMGTLCVYAAICKHERMPLLFPGTESVWDAYSIASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA V   A+N+AFN  NGDVF WK +W++  + F ++     E+G K+  + E MKD
Sbjct  258   QEIWAAVDPNARNEAFNIHNGDVFKWKHLWKVLAEQFRIKKYGLPESG-KKVSLTELMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK ++L   ++EE+  +     VL  +    C MNKSKE GFLG+ ++  S+
Sbjct  317   KGAVWEKIVKDNQLLPNKLEEVGVWWFADFVLGAESIISC-MNKSKEHGFLGFRNSKNSL  375

Query  309   RVWVQKLREMKIIP  268
               WV KL+  KI+P
Sbjct  376   ISWVDKLKAHKIVP  389



>ref|XP_011017141.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Populus euphratica]
Length=390

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 227/374 (61%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNLDHPV-EYIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS+++ +VTH+F++   +   E ENI  N+ M  NVL+++  +  +   HV +
Sbjct  85    TAETQAKLSQLT-DVTHIFYVTWALRFTEAENIEANNLMFRNVLQAVIPNALNLK-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAI-YAETNsfsf  850
             QTG K Y+GP F+      K+ PH+ P+ ED PRL  PNFYY LED++A   A+    ++
Sbjct  143   QTGLKHYVGP-FE---LVGKIEPHDTPYTEDLPRLSAPNFYYDLEDILAGEVAKKEGVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I+G S  S+ N + TLCVYA ICK +  P  +PG    W+ +   SDA L+AE
Sbjct  199   SVHRPHTILGFSPYSLMNIMGTLCVYAAICKHERMPLLFPGTESVWDAYSIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q+IWA V   A+N+AFN  NGDVF WK +W++  + F ++     E+G K+  + E MKD
Sbjct  259   QEIWAAVDPNARNEAFNIHNGDVFKWKHLWKVLAEQFRIKKYGLPESG-KKVSLTELMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK ++L   ++EE+  +     VL  +    C MNKSKE GFLG+ ++  S+
Sbjct  318   KGAVWEKIVKDNQLLPNKLEEVGVWWFADFVLGAESIISC-MNKSKEHGFLGFRNSKNSL  376

Query  309   RVWVQKLREMKIIP  268
               WV KL+  KI+P
Sbjct  377   ISWVDKLKAHKIVP  390



>ref|XP_003589112.1| hypothetical protein MTR_1g018610 [Medicago truncatula]
 gb|AES59363.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=423

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 223/374 (60%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VAL+IG TG+VG ++ E L       GPWKVYG ARRP P W   + +  Y+  D  N
Sbjct  60    QNVALIIGVTGIVGNSLAEILPLKDTPVGPWKVYGVARRPRPMWNVDNPV-HYIQCDVSN  118

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS ++ +VTH+F+++      E +N  +N  ML NVL++L  +  +   HV++
Sbjct  119   QNDVELKLSPLT-DVTHIFYVSWTSRPTEAQNCEVNGAMLRNVLQALIPNAPNLS-HVSL  176

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP         K+ PHE+PF ED PRL  PNFYY LED L     +    ++
Sbjct  177   QTGAKHYVGPF----EIIGKIKPHESPFTEDVPRLDTPNFYYTLEDILFEEVGKKKGTTW  232

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
              I+R  +I G S  S+ N + TLCVYA ICK +G P R+PG++  WE +   SDA L++E
Sbjct  233   FINRPQVIFGFSPYSMMNLIGTLCVYAAICKHEGLPLRFPGSKGAWECYSTASDANLISE  292

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IW  V   AKN+AFNC+NGDVF WK +W++  + FE++   FEE    E  +++ MKD
Sbjct  293   QHIWGAVDPNAKNEAFNCSNGDVFRWKHLWKVLAERFEIDDYGFEEG--SELRLSDLMKD  350

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L  T++EE+  +     + R +   + SMNKSKE GFLG+ ++  S 
Sbjct  351   KGGVWEEIVRENELLYTKLEEVGDWWFADFMFRVE-GVLDSMNKSKEHGFLGFRNSKNSF  409

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  410   ISWIDKTKAYKIVP  423



>gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum falcatum]
Length=388

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 226/386 (59%), Gaps = 15/386 (4%)
 Frame = -2

Query  1413  KKMGQENCS---KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             K + QEN     ++VALV+G TG+VG ++ E L +    G PWKVYG ARRP P W  ++
Sbjct  14    KTIDQENVELKYESVALVVGVTGIVGNSLAEILPRTDTPGSPWKVYGIARRPRPQW-DAN  72

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
                EY+  D  N E+T   LS +  +VTH+F++       E EN  +NS M  N+L  + 
Sbjct  73    HPVEYIQCDISNPEETESRLSHLK-DVTHLFYVTWASRPTEAENCEINSQMFRNLLNCII  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +      H+ +QTG K Y+G     S  +   + H+ P+ ED PRL  PNFYY LED++
Sbjct  132   PNAPKLQ-HICLQTGKKHYLG-----SFDSYGGVAHDPPYSEDLPRLNAPNFYYNLEDIL  185

Query  882   AIYAETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 E       S+HR   I G S  S+ N + TLCVYA+ICK +G   R+PG +  W  
Sbjct  186   FEEVEKKKGLTWSVHRPGTIFGFSPNSMMNIICTLCVYASICKHEGVAMRFPGTKEAWSS  245

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             + + SDA L+AEQ+IWA V   AKN+AFNC+NGDVF WK  W++  + FE+E   FE  G
Sbjct  246   YSEASDADLIAEQEIWAVVDPYAKNEAFNCSNGDVFKWKHFWKVLAEKFEVECGEFE--G  303

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
              +   + E MKDKG +W  IVK++ L   ++E+I  +  +  +L  ++  + +MNKSKE 
Sbjct  304   GERLTLVELMKDKGSVWDEIVKENNLVPAKLEDIGLWWFVDYILGLEYP-LDTMNKSKEH  362

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++  S   W+ KL++ K++P
Sbjct  363   GFLGFRNSKTSFITWINKLKDSKVVP  388



>ref|XP_006471280.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/377 (40%), Positives = 216/377 (57%), Gaps = 13/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG ++ E L +P   GGPWKV+G ARRP P+W     +D Y+  D  +
Sbjct  26    QNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKVHGVARRPRPNWNARYPID-YIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  85    RDDTQAKLSKLT-DVTHIFYVTWASRPTEAENCKINGAMFRNVLRSVIPNAPNVR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP         K+  H+ PF ED PRL  P FYY  ED+  ++ E +     
Sbjct  143   QTGGKHYVGPF----ECIGKIPSHDPPFTEDLPRLNVPLFYYNQEDI--LFEEVDKREGL  196

Query  846   ihrssiiIGA---SSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                     G    S  S+ + + TLCVYA ICK +G P  + G R  WE F + SDA L+
Sbjct  197   AWSIHRPSGIFGFSPYSLMHIIGTLCVYAAICKHEGAPLVFHGTRDAWEGFQEFSDAELV  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEF  499
             AEQ+IWA V   A+N+AFNCTNGDVF WK +W++  + FE+E   F EE G +   + E 
Sbjct  257   AEQEIWAAVAPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGEEMGSERVRLEEV  316

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K   W  IV++++L  T++ E+  +     VL     +  SMNKSKE GFLG+ ++ 
Sbjct  317   MKGKESAWEEIVRENQLQPTKLNEVAVWSYADVVLNIGAGYFVSMNKSKEHGFLGFRNSK  376

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ +L+  +I+P
Sbjct  377   NSFITWIDRLKSHRIVP  393



>ref|XP_006472269.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=397

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 225/380 (59%), Gaps = 15/380 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L++G TG+VG ++ E L      GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  26    QSVGLIVGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPKPNW-NADHLVEYVQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS++  +VTH+F++       E EN ++N +M  NVLR++  +  +   HV +
Sbjct  85    PEETQAMLSQLI-DVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A  K+ PH+ PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGTKHYLGPF----EAFGKIKPHDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELSW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N +  LCVYA +CK +G P R+PG +  WE +   SDA L+AE
Sbjct  199   SVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE------NGDKEFDI  508
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E     E       G +   +
Sbjct  259   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEECGGGTQRVKL  318

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
             AEFMK K  +W  IV++++L  TR++E+  +  +  VL  + + + SMNKSKE GF G+ 
Sbjct  319   AEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAK-LASMNKSKEHGFSGFR  377

Query  327   DTLKSIRVWVQKLREMKIIP  268
             ++  S   W+ K++  KI+P
Sbjct  378   NSKNSFITWIDKVKGFKIVP  397



>gb|ABD33273.2| VEP1 , putative [Medicago truncatula]
Length=407

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 223/372 (60%), Gaps = 11/372 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W    ++  Y+  D  + +
Sbjct  46    VALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYV-HYIQCDVSDQK  104

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             D    LS ++ +VTH+F+++      E +N  +N +ML NVLR+L  +  +   HV++QT
Sbjct  105   DVELKLSPLT-DVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLNLC-HVSLQT  162

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsfsi  844
             GTK Y+G          K+  HE+PF ED PRL  PNFYY  ED L+    +    ++ I
Sbjct  163   GTKHYLGSF----ETIGKIKAHESPFTEDVPRLVTPNFYYTQEDILLEEVGKKKGTTWFI  218

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             +R   I G S  S+ N + TLCVYA ICK +G P R+PG++  WE +   SDA L+AEQ 
Sbjct  219   NRPHPIFGFSPYSMMNVIGTLCVYAAICKHEGLPLRFPGSKGAWECYSTASDANLIAEQH  278

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             IW      AKN+AFNC+NGDVF WK +W++  + FE++   FEE    E  +++ MKDKG
Sbjct  279   IWGAADPNAKNEAFNCSNGDVFKWKHLWKVLAERFEIDDYGFEEGS--ELRLSDLMKDKG  336

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV+++ L  T++EE+  +      LR +   + SMNK+KE GF+G+ ++  S   
Sbjct  337   GVWEEIVRENELLYTKLEEVGDWWFADFSLRLEGV-LDSMNKAKEHGFIGFRNSKNSFIS  395

Query  303   WVQKLREMKIIP  268
             W+ K +  KI+P
Sbjct  396   WIDKTKAYKIVP  407



>gb|AES59361.2| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=394

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 223/372 (60%), Gaps = 11/372 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W    ++  Y+  D  + +
Sbjct  33    VALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYV-HYIQCDVSDQK  91

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             D    LS ++ +VTH+F+++      E +N  +N +ML NVLR+L  +  +   HV++QT
Sbjct  92    DVELKLSPLT-DVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLNLC-HVSLQT  149

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsfsi  844
             GTK Y+G          K+  HE+PF ED PRL  PNFYY  ED L+    +    ++ I
Sbjct  150   GTKHYLGSF----ETIGKIKAHESPFTEDVPRLVTPNFYYTQEDILLEEVGKKKGTTWFI  205

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             +R   I G S  S+ N + TLCVYA ICK +G P R+PG++  WE +   SDA L+AEQ 
Sbjct  206   NRPHPIFGFSPYSMMNVIGTLCVYAAICKHEGLPLRFPGSKGAWECYSTASDANLIAEQH  265

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             IW      AKN+AFNC+NGDVF WK +W++  + FE++   FEE    E  +++ MKDKG
Sbjct  266   IWGAADPNAKNEAFNCSNGDVFKWKHLWKVLAERFEIDDYGFEEG--SELRLSDLMKDKG  323

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV+++ L  T++EE+  +      LR +   + SMNK+KE GF+G+ ++  S   
Sbjct  324   GVWEEIVRENELLYTKLEEVGDWWFADFSLRLE-GVLDSMNKAKEHGFIGFRNSKNSFIS  382

Query  303   WVQKLREMKIIP  268
             W+ K +  KI+P
Sbjct  383   WIDKTKAYKIVP  394



>gb|AHZ44505.1| putative progesterone 5 beta-reductase [Erophila verna]
Length=387

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 222/374 (59%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +S +VTHVF++       E+EN   N  ML NVLRS+     +   HV +
Sbjct  85    AEDCKSKLSVLS-DVTHVFYVTWTKGASEKENCEANGNMLKNVLRSVVPYAVNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD    T     HE PF ED PRL  PNFYY LED L+    +    S+
Sbjct  143   QTGTKHYVGP-FDNVSGT-----HEPPFTEDMPRLEAPNFYYTLEDILMEEIKKVEDVSW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  197   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLVFPGSKKAWEGFTTASDADLVAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F+++   F E   K   + + MK 
Sbjct  257   QQIWAAVDSYAKNEAFNCNNADIFKWKHLWKILAEQFDIKEYGFVEG--KNLGLVKMMKG  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K ++W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  315   KEKVWEEMVKENQLQEEKLEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  374   ISWIDKYKAFKIVP  387



>ref|XP_010939097.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Elaeis 
guineensis]
Length=461

 Score =   273 bits (699),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 224/377 (59%), Gaps = 12/377 (3%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPS---SFLDEYMTFDA  1213
             +V LVIG TG+VG ++ E L      GGPWKVYG +RRP PS   S       E++  D 
Sbjct  92    SVGLVIGVTGIVGNSLAEILPLADTPGGPWKVYGVSRRPHPSSLASQTEGLAIEHVQCDI  151

Query  1212  LNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHV  1033
              + ED    LS ++ +VTH+F++A      E EN  +NS ML NVL ++  +  +   HV
Sbjct  152   SDREDALAKLSPLT-DVTHIFYVAWVNRSTEAENREINSAMLRNVLTAVIPNAPNLQ-HV  209

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNs  859
              +QTG K Y+G       +  K+  HE PF ED PRL  PNFYY LED++   +     +
Sbjct  210   CLQTGRKHYLGSF----ESLGKVKGHEPPFVEDLPRLDCPNFYYDLEDILFEEVAKREGA  265

Query  858   fsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
              ++SIHR + I G S  S+ N +  LCVYA IC+ +G P R+PG+R  WE F D SDA L
Sbjct  266   VTWSIHRPTNIFGFSPSSLMNLMGILCVYAAICRREGVPLRWPGSRVLWEGFSDASDADL  325

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AE QIWA V   AKN+AFNC+NGDVF WK +W L    F +E+V ++   +  F + + 
Sbjct  326   IAEHQIWAAVDPYAKNEAFNCSNGDVFKWKHLWPLLAKEFGVEWVGYQGE-EARFKLEDA  384

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K  +W  +V +H L  TR+E++  +     VL  + +++ SMNKSKE GFLG+ +T+
Sbjct  385   MKGKEGLWEKMVAEHELAPTRLEQVGNWWFADVVLGLEEEYLDSMNKSKEHGFLGFRNTV  444

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  KI+P
Sbjct  445   TSFNSWIDKIKAYKIVP  461



>ref|XP_006450012.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
 gb|ESR63252.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
Length=393

 Score =   271 bits (692),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 215/377 (57%), Gaps = 13/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG ++ E L +P   GGPWK+YG ARRP P+W     +D Y+  D  +
Sbjct  26    QNVGLVVGVTGIVGNSLAEILPRPDTPGGPWKIYGVARRPRPNWNAKYPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  85    PDDTQAKLSKLA-DVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP         K+  H+ PF ED PRL    FYY  ED+  ++ E +     
Sbjct  143   QTGGKHYVGPF----ECIGKIPSHDPPFTEDLPRLNVSLFYYNQEDI--LFEEVDKRRGL  196

Query  846   ihrssiiIGA---SSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                     G    S  S+ N + TLCVYA ICK +G P  + G R  WE F + SDA L+
Sbjct  197   TWSIHRPSGIFGFSPHSLMNIIGTLCVYAAICKHEGAPLVFHGTRDAWEGFQEFSDAELV  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEF  499
             AEQ+IW  V   A+N+AFNCTNGDVF WK +W++  + FE+E   F EE G +   + E 
Sbjct  257   AEQEIWGAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGEEMGSERVRLEEV  316

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K  +W  IV++++L  T++ E+  +     VL     +  SMNKSKE GFLG+ ++ 
Sbjct  317   MKGKESVWEEIVRENQLQPTKLNEVAVWSYADVVLNIGAGYFVSMNKSKEHGFLGFRNSK  376

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ +L+  +I+P
Sbjct  377   NSFITWINRLKSHRIVP  393



>ref|XP_003598452.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|AES68703.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   271 bits (692),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 223/396 (56%), Gaps = 33/396 (8%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARRP PSW    
Sbjct  14    KKLDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  D    LS ++ +VTHVF++       E EN  +N TML N L ++ 
Sbjct  74    PV-EYIQCDITDPNDATTKLSVLT-DVTHVFYVCWASRPTEAENCEINGTMLKNALTAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV+IQTG K Y+GP      +  K+  HE P+ ED PRL + NFYY LED+ 
Sbjct  132   PNAPNLR-HVSIQTGGKHYVGPF----ESFGKIKYHEPPYTEDMPRLDYHNFYYTLEDV-  185

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + T+CVYA ICK +G P R+PG +  W
Sbjct  186   -LFEETGKKEGVSWSVHRPLLIFGFSPYSMMNIIGTICVYAAICKHEGVPLRFPGTKLAW  244

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
             E++   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E
Sbjct  245   ENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVIAEQFGIEEYGFDE  304

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC------  370
              G +   + E MKDKG +W  IVK++ L  T++EE         V  + F   C      
Sbjct  305   EGPR-LKLTELMKDKGPVWDEIVKENGLQVTKLEE---------VAEWWFADACFGGNGF  354

Query  369   --SMNKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
               SMNKSKE GFLG+ +T  S+  W+ + R  KI+P
Sbjct  355   TDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>gb|AEX31541.1| putative steroid 5beta-reductase [Armoracia rusticana]
Length=388

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 219/374 (59%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++     E E +N   N +ML NVL+++         HV +
Sbjct  85    ADDARSKLSPLT-DVTHVFYVTWTSRESEHDNCEANGSMLRNVLQAIVPHAPDLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD     +    H+APF ED PRL   NFYY LED L     +  S ++
Sbjct  143   QTGTKHYIGP-FD----NNGRSRHDAPFTEDMPRLQIQNFYYTLEDVLFEEIKKKESVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLLFPGSKNAWEGFTAASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W+   + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKFLAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L  T++EE+  +     V+      + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQGTKLEEVGVW-WFADVIHGVEGLIDSMNKSKEYGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K    KI+P
Sbjct  375   ISWIDKYEAFKIVP  388



>ref|XP_008220298.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Prunus mume]
 ref|XP_008220299.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Prunus mume]
 ref|XP_008220300.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Prunus mume]
Length=391

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 221/374 (59%), Gaps = 9/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    ESVGLVIGVTGIVGNSLAEILPISDTPGGPWKVYGVARRPRPNWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS +S +VTH+F++       E E+   N  M  NVL S+  +  +   HV +
Sbjct  85    ADDAKAKLSPLS-DVTHIFYVTWTNRSTEAESCEANGAMFRNVLNSVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG K Y+GP      A  K+ PHE+PF ED PRL +PNFYY LEDL+ A   + +  ++
Sbjct  143   QTGAKHYVGPF----EAFGKIQPHESPFTEDLPRLDYPNFYYTLEDLLFAEVEKKDDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +  P ++PG++  W  +   SDA L+AE
Sbjct  199   SVHRPDAIFGFSPYSMMNIVGTLCVYAAICKHERVPLKFPGSKAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   AKN+AFN  NGDVF WK +W++  + F +E    +E    +  + E MK 
Sbjct  259   QHIWAAVDPYAKNEAFNINNGDVFKWKHVWKVLAEQFGIEEYGIDEEEGAKLSLVELMKG  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L  TR+EE+  +  +   L  +   +CSMNKSKE GF+G+ ++  S 
Sbjct  319   KERVWEEIVKENQLQPTRLEEVGVWWFVDVWLGGE-GLLCSMNKSKEHGFVGFRNSRNSF  377

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  378   VTWIDKMKAFKIVP  391



>ref|XP_006471790.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471791.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   271 bits (692),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 153/377 (41%), Positives = 219/377 (58%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V L+IG TG+VG ++ E L +    GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  29    QHVGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTDHPI-EYIQCDVSD  87

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   L+K++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV +
Sbjct  88    EDDTQAKLTKLT-DVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLR-HVCL  145

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP    S +  K+ PH+ PF ED PRL  PNFYY  ED++    E      S
Sbjct  146   QTGAKHYLGP----SESFGKIRPHDTPFTEDLPRLNVPNFYYTQEDILFEEVEKRKGPLS  201

Query  846   ihrssiiI----GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
             +  S        G S  S+ N + TLCVYA ICK +G P  +PG++  WE +   SDA L
Sbjct  202   LTWSVHRPHVIFGFSPYSLMNVVGTLCVYAAICKHEGVPLLFPGSKDCWEGYSVASDADL  261

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AEQQIWA V   A+N+AFNC+NGDVF WK +W++  + FE+      E GD+   + E 
Sbjct  262   IAEQQIWAAVDPYARNEAFNCSNGDVFKWKHLWKVLAEQFEIANYGLPEEGDR-VRLEEI  320

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K  +W  IV++++L   ++ E+  +     +L   F  + SMNKSKE GFLG+ ++ 
Sbjct  321   MKGKEGVWEEIVRENQLQPAKLSEVAVWWFADLMLDGGFLLLDSMNKSKEHGFLGFRNSK  380

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  +I+P
Sbjct  381   NSFVNWIDKMKTYRIVP  397



>gb|AEY82379.1| putative progesterone 5-beta-reductase [Withania somnifera]
Length=388

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 221/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ + L      GGPWKVYG ARR  PSW     + EY+  D  N
Sbjct  25    QSVALIIGVTGIVGNSLADILPLADTPGGPWKVYGVARRSRPSWNTDHPM-EYIQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS +++ VTHVF++A      E EN  +N  M  NV+  +  +      H+ +
Sbjct  84    AEDTQSKLSLLTD-VTHVFYVASAKRSTEVENCEINGKMFQNVVNVIIPNCPELR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP     L       H+ PF E+ PRL  PNFYY LED++    E       
Sbjct  142   QTGRKHYLGP-----LELYGKGAHDPPFHEELPRLDAPNFYYVLEDILFKEVEKKEGLTW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK++G P ++PG +  W+ + D SDA L+AE
Sbjct  197   SVHRPGTIFGFSPYSLMNLVGTLCVYAAICKQEGLPLKFPGVKGAWDGYSDGSDADLIAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK +W++  + F +E   F+E G++   +AE MKD
Sbjct  257   HQIWAAVDPYAKNEAFNVSNGDVFKWKHLWKVLAEQFGVEAAEFDE-GERRCTLAEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK++ L  T++EE+  +  +  VL      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KDAVWEEIVKENGLIPTKLEEVGVWWFVDLVLAGDCA-LDTMNKSKEHGFLGFRNSQKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKAYKVVP  388



>ref|XP_006471792.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
Length=396

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/377 (41%), Positives = 219/377 (58%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V L+IG TG+VG ++ E L +    GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  28    QHVGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTDHPI-EYIQCDVSD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   L+K++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV +
Sbjct  87    EDDTQAKLTKLT-DVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLR-HVCL  144

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP    S +  K+ PH+ PF ED PRL  PNFYY  ED++    E      S
Sbjct  145   QTGAKHYLGP----SESFGKIRPHDTPFTEDLPRLNVPNFYYTQEDILFEEVEKRKGPLS  200

Query  846   ihrssiiI----GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
             +  S        G S  S+ N + TLCVYA ICK +G P  +PG++  WE +   SDA L
Sbjct  201   LTWSVHRPHVIFGFSPYSLMNVVGTLCVYAAICKHEGVPLLFPGSKDCWEGYSVASDADL  260

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AEQQIWA V   A+N+AFNC+NGDVF WK +W++  + FE+      E GD+   + E 
Sbjct  261   IAEQQIWAAVDPYARNEAFNCSNGDVFKWKHLWKVLAEQFEIANYGLPEEGDR-VRLEEI  319

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K  +W  IV++++L   ++ E+  +     +L   F  + SMNKSKE GFLG+ ++ 
Sbjct  320   MKGKEGVWEEIVRENQLQPAKLSEVAVWWFADLMLDGGFLLLDSMNKSKEHGFLGFRNSK  379

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  +I+P
Sbjct  380   NSFVNWIDKMKTYRIVP  396



>gb|AGL96526.1| putative progesterone 5-beta-reductase, partial [Brassica rapa 
subsp. pekinensis]
Length=390

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 221/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +  +VTHVF++       E +N ++N +ML NVLR++  +  +   HV +
Sbjct  85    EEDARSKLSSLK-DVTHVFYVTWTNRSSEVDNCKVNGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP        D+   HEAPF ED PRL   NFYY LED+++   +       
Sbjct  143   QTGTKHYLGPFDSVGKDVDR---HEAPFTEDMPRLKIENFYYTLEDVLSEEIKMKESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK++G    +PG++  WE F   SDA L+AE
Sbjct  200   SVHRPNTIFGFSPYSLLNIVGTLCVYAAICKQEGSKLVFPGSKEAWEGFTTASDADLVAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCSNADVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     VL      + SMNKSKE GFLG+ ++  S 
Sbjct  318   KESVWEEMVKENQLQEKKLDEVGVWWFADVVLGVD-GMIDSMNKSKEYGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_006433602.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
 gb|ESR46842.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
Length=400

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 226/383 (59%), Gaps = 18/383 (5%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L  P   GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  26    QSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNW-NADHLVEYVQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LS+++ +VTH+F++       E EN ++N +M  NVLR++  +  +   HV +
Sbjct  85    PEETQAKLSQLT-DVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      A  K+ P++ PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGTKHYLGPF----EAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELSW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N +  LCVYA +CK +G P R+PG +  WE +   SDA L+AE
Sbjct  199   SVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE---------ENGDKE  517
              QIWA V   AKN+AFNC NGDVF WK +W++  + F +E                G + 
Sbjct  259   HQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEEEEEGGGGTQR  318

Query  516   FDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFL  337
               +AEFMK K  +W  IV++++L  TR++E+  +  +  VL  + + + SMNKSKE GF 
Sbjct  319   VKLAEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAK-LASMNKSKEHGFS  377

Query  336   GYADTLKSIRVWVQKLREMKIIP  268
             G+ ++  S   W+ K +  KI+P
Sbjct  378   GFRNSKNSFITWIDKAKGYKIVP  400



>ref|XP_008790634.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/378 (41%), Positives = 224/378 (59%), Gaps = 12/378 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPS---SFLDEYMTFD  1216
             ++V LVIG TG+VG ++ E L      GGPWKVYG +RRP  S FPS       E++  D
Sbjct  30    QSVGLVIGVTGIVGNSLAEILPLADTPGGPWKVYGVSRRPRSSTFPSQTEGLAIEHVQCD  89

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
               + ED    LS ++ ++TH+F++A      E EN  +NS M  NVL ++  + S+   H
Sbjct  90    ISDREDALAKLSPLT-DITHIFYVAWVNRSTEAENREVNSAMFRNVLAAVIPNASNLQ-H  147

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETN  862
             + +QTG K Y+G       +  K+  HE PF ED PRL  PNFYY LED++   +     
Sbjct  148   ICLQTGRKHYVGSF----ESMGKVKTHEPPFVEDLPRLSCPNFYYDLEDILFEEVAKTDG  203

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
               ++S+HR + I G S  S+ N + TLCVYA +C+  G P R+PG+R  WE F D SDA 
Sbjct  204   KVTWSVHRPTNIFGFSPSSLMNLMGTLCVYAAVCRRAGVPLRWPGSRVVWEGFSDASDAD  263

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             L+AE QIWA V   AKN+AFNC+NGDVF WK +W L    F + +  ++    + F + +
Sbjct  264   LIAEHQIWAAVDPYAKNEAFNCSNGDVFKWKHLWPLLAKEFGVGWEGYQGEAAR-FKLED  322

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MK K  +W  +V +H L  T++EE+  +  +  VL  + +++ +MNKSKE GFLG+ +T
Sbjct  323   AMKGKEGLWEEMVAEHELAPTKLEEVGNWWFVDAVLGLEEEYLDNMNKSKEHGFLGFRNT  382

Query  321   LKSIRVWVQKLREMKIIP  268
             + S   W+ K+R  KI+P
Sbjct  383   VSSFNSWIDKIRAYKIVP  400



>ref|XP_003589110.1| hypothetical protein MTR_1g018590 [Medicago truncatula]
Length=399

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 223/374 (60%), Gaps = 13/374 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W    ++  Y+  D  + +
Sbjct  36    VALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYV-HYIQCDVSDQK  94

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             D    LS ++ +VTH+F+++      E +N  +N +ML NVLR+L  +  +   HV++QT
Sbjct  95    DVELKLSPLT-DVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLNLC-HVSLQT  152

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV---AIYAETNsfsf  850
             GTK Y+G          K+  HE+PF ED PRL  PNFYY  ED++       +    ++
Sbjct  153   GTKHYLGSF----ETIGKIKAHESPFTEDVPRLVTPNFYYTQEDILLEEVGVGKKKGTTW  208

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
              I+R   I G S  S+ N + TLCVYA ICK +G P R+PG++  WE +   SDA L+AE
Sbjct  209   FINRPHPIFGFSPYSMMNVIGTLCVYAAICKHEGLPLRFPGSKGAWECYSTASDANLIAE  268

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IW      AKN+AFNC+NGDVF WK +W++  + FE++   FEE    E  +++ MKD
Sbjct  269   QHIWGAADPNAKNEAFNCSNGDVFKWKHLWKVLAERFEIDDYGFEEG--SELRLSDLMKD  326

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L  T++EE+  +      LR +   + SMNK+KE GF+G+ ++  S 
Sbjct  327   KGGVWEEIVRENELLYTKLEEVGDWWFADFSLRLEGV-LDSMNKAKEHGFIGFRNSKNSF  385

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  386   ISWIDKTKAYKIVP  399



>gb|ADG56544.1| progesterone 5-beta-reductase [Erysimum crepidifolium]
Length=389

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 220/375 (59%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYLGPFSNLDGPR-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  197

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  198   WSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  257

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  258   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  316   GKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  375   FISWIDKYKAFKIVP  389



>ref|XP_008220361.1| PREDICTED: uncharacterized protein LOC103320460 [Prunus mume]
Length=830

 Score =   281 bits (719),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/375 (43%), Positives = 224/375 (60%), Gaps = 10/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L +P   GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  464   RSVGLVIGVTGIVGNSLAEILPRPDTPGGPWKVYGVARRPRPNWNADHPVD-YIQCDISD  522

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LSK++ +VTH+F+++      E EN   N  ML NVL  +     +   HV++
Sbjct  523   PEDTKAKLSKLT-DVTHIFYVSWANKASEVENCEANGAMLCNVLGVVIPVAPNIR-HVSL  580

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP      +  K+  H+ PF ED PRL  PNFYY  ED++   A+       
Sbjct  581   QTGTKHYIGPF----ESFGKIKAHDPPFTEDLPRLDVPNFYYTQEDILFDEAKKKEGLSW  636

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +  P ++PG++  W  F   SDA L+AE
Sbjct  637   SVHRPNTIFGFSPYSLMNVIGTLCVYAAICKHEKKPLKFPGSKAAWNCFSVASDADLIAE  696

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             Q IWA V   AKN+AFN  NGDVF WK  W++  + F +E     EE G++   + E MK
Sbjct  697   QHIWAAVDPYAKNEAFNVNNGDVFKWKHFWKVLAEQFGIEEYGLDEEEGERRLSLVEMMK  756

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              KG +W  IVKK++L  T++EE+  +     VL  +   + SMNKSKE GFLG+ ++ KS
Sbjct  757   GKGGVWEEIVKKNKLQPTKLEEVGVWWFADIVLCVE-SALDSMNKSKEHGFLGFRNSQKS  815

Query  312   IRVWVQKLREMKIIP  268
                WVQK++  KI+P
Sbjct  816   FTSWVQKMKAYKIVP  830


 Score =   266 bits (681),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 220/380 (58%), Gaps = 10/380 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYG ARRP P W     +D Y+  D  +
Sbjct  28    QSVALVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPDWSVDHPVD-YIQCDISD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS+++ +VTH+F++       E EN   N  M  N+LR +     +   HV++
Sbjct  87    PEDTKAKLSELT-DVTHIFYVTWTSRANEIENCEANGAMFRNLLRVVIPVAPNLR-HVSL  144

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP         K+  H+ PF ED PRL  PNFYY LED++    +       
Sbjct  145   QTGTKHYLGPF----ECIGKIKAHDPPFTEDLPRLDVPNFYYTLEDILFEEVQKKEGLTW  200

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK++G P ++PG++  WE +   SDA L+AE
Sbjct  201   SVHRPYNIFGFSPHSLMNIIGTLCVYAAICKQEGKPLKFPGSKVAWECYAMASDADLIAE  260

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEFMK  493
             Q IWA V   A N+AFN  NGDVF WK  W+   + F +E   F EE G+    + E MK
Sbjct  261   QHIWAAVDPNAANEAFNINNGDVFKWKQFWKGLAEQFGIEEHGFYEEEGEGRLSLVEMMK  320

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IVK++ L  T++EE+  +     VL  +   + SMNKSKE GFLG+ ++ KS
Sbjct  321   GKEGVWEEIVKENELQPTKLEEVGVWWFADYVLGGE-AVLDSMNKSKEHGFLGFRNSYKS  379

Query  312   IRVWVQKLREMKIIP*SVIP  253
                W++K++  KI+P  V P
Sbjct  380   FISWIEKMKSYKIVPKKVEP  399



>ref|XP_011069776.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=387

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 228/387 (59%), Gaps = 18/387 (5%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             +K  + +  + VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW     + 
Sbjct  14    RKPEENSGPQNVALIVGVTGIVGNSLAEILPVSETPGGPWKVYGVARRPRPSWNADHPV-  72

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
             +Y+  D  + + T   LS ++ +VTH+FW+       E E   LN  M  NVL ++  + 
Sbjct  73    QYIQCDVSDAKQTQAKLSPLT-DVTHIFWVTWGNRPTESECCDLNGAMFQNVLDAIMPNC  131

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIY  874
              +   H+ +QTG K Y+GP      A  K+ PHE PF ED PRL  PNFYY LED VA+ 
Sbjct  132   PNLT-HICVQTGHKHYIGPF----EAFGKIKPHETPFVEDVPRLDAPNFYYTLED-VALD  185

Query  873   A--ETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFC  700
             A  +    ++S+HR ++I G S  S+ N L +LCVYA ICK +  P ++PG +  W  + 
Sbjct  186   ACKKKPGLTWSVHRPAVIFGFSPYSMMNMLDSLCVYAAICKHEKVPLKFPGTKAAWNCYF  245

Query  699   DMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDK  520
               SDA L+AEQQIW  V    KN+AFNC+NGDVF WK +W++  D F +E+  F+EN  +
Sbjct  246   VASDADLIAEQQIWCSVDPNGKNEAFNCSNGDVFKWKHLWKVLADKFGVEYEEFDEN-QE  304

Query  519   EFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC---SMNKSKE  349
                +AE MKDKG +W  IVKK+ L  T++EE++ +      +   F   C   SMNKSKE
Sbjct  305   YVSLAERMKDKGPVWDEIVKKNNLTPTKLEEVSTF----WFVDLMFGGECMLDSMNKSKE  360

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GF G+ ++  S+   + K++  KI+P
Sbjct  361   HGFFGFRNSQNSLISVIDKMKAHKIVP  387



>ref|XP_007018551.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY15776.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=389

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/376 (42%), Positives = 218/376 (58%), Gaps = 15/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LV+G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVGLVVGVTGIVGNSLAEILPLTDTPGGPWKVYGVARRPRPNWSMDHPI-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ +VT++F+++      E EN  +N +ML NVLRS+  +  +   HV +
Sbjct  85    PKDTESKLSPLT-DVTYIFYVSWINRSSEAENCEINGSMLRNVLRSVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK Y+GP         K+ PH+ PF ED PRL  PNFYY  ED+  ++ ET      
Sbjct  143   QTGTKNYLGPF----ELLGKIQPHDPPFTEDLPRLNAPNFYYTQEDI--LFEETEKKEGL  196

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  SV N + TLCVYA ICK +G P  +PG R  WE + + SDA L+
Sbjct  197   TWSVHRPDVIFGFSPYSVMNIVGTLCVYAAICKHEGQPLWFPGIRAAWESYSNGSDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AE QIWA V   AKN+AFN  NGDVF WK +WR   + F +E   FEE   +   + E M
Sbjct  257   AEHQIWAAVDPYAKNEAFNVNNGDVFKWKHLWRALAEQFGIEEFGFEEG--QNLGLVEMM  314

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K  +W  IVK+++L  TR+EE+  +  +  +L  +   + SMNKSKE GFLG+ ++  
Sbjct  315   KGKERVWEEIVKENQLEETRLEEVGLWWFVDLILAGE-PPLSSMNKSKEHGFLGFRNSKN  373

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  374   SFITWIDKMKAYKIVP  389



>gb|ADG56542.1| progesterone 5-beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 221/375 (59%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP+PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPVPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYLGPFSNLDGPR-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKKISVT  197

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  198   WSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  257

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  258   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  316   GKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  375   FISWIDKYKAFKIVP  389



>gb|AEZ01594.1| progesterone 5-beta-reductase [Erysimum cheiri]
Length=389

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 222/375 (59%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  + +        H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYLGPFSNLNGPR-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  197

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  198   WSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  257

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  258   EQQIWAAVDSYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++ KS
Sbjct  316   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNKS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  375   FISWIDKYKAFKIVP  389



>ref|XP_009360365.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
 ref|XP_009360373.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 221/379 (58%), Gaps = 10/379 (3%)
 Frame = -2

Query  1401  QENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMT  1222
             Q    ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+ 
Sbjct  21    QPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPI-EYIQ  79

Query  1221  FDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl  1042
              D  + +D    LS ++ +VTHVF++       E EN  +N  ML NVL S+  +  +  
Sbjct  80    CDVSDPDDAKTKLSPLT-DVTHVFYVTWSSRSTEVENCEVNGNMLRNVLESVIPNAPNLR  138

Query  1041  SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAET  865
              H+ +QTG K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  EDL+ A   + 
Sbjct  139   -HICLQTGGKHYLGPF----ESFGKIQPHDPPFTEDLPRLDTPNFYYTQEDLLFAAVEKK  193

Query  864   NsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDA  685
                ++S+HR  +I G S  S+ N + TLCVYA ICK +G P R+PG++  W  +   SDA
Sbjct  194   EDLTWSVHRPDMIFGFSPFSLMNIVGTLCVYAAICKHEGLPLRFPGSKAAWNSYSVASDA  253

Query  684   RLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIA  505
              L+AE  IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   +A
Sbjct  254   DLIAEHHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGGR-LSLA  312

Query  504   EFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYAD  325
             E MK K  +W  IV+++ L  T++EE+  +  +  VL  +   + SMNKSKE GF+G+ +
Sbjct  313   ERMKGKEGVWEEIVRENELKETKLEEVGVWWFVDVVLGGE-GVLSSMNKSKEHGFVGFRN  371

Query  324   TLKSIRVWVQKLREMKIIP  268
             +  S   W+ K++  KI+P
Sbjct  372   SRNSFVTWIDKMKSFKIVP  390



>gb|ADG46023.1| progesterone 5-beta-reductase [Atropa belladonna]
Length=387

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 217/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  N
Sbjct  25    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHSI-EYVQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT  +LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  84    PEDTQSNLSLLT-DVTHVFYVTWANRSTEIENCEINGKMFRNVLNVIIPNCPNLR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             Q G K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  142   QAGRKHYLGP-----FELYGKVAHDSPFHEDLPRLSGPNFYYILEDILFKEMEKKEGLTW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P R+PG +  W  + D SDA L+AE
Sbjct  197   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLRFPGVKAAWNGYSDSSDADLIAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+ FN +NGDVF WK  W++  + F +E   F+E   K   + E MKD
Sbjct  257   HQIWAAVDPYAKNEEFNVSNGDVFKWKHFWKVLAEQFGVEATEFDEG--KRCTLGEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++EE+  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  315   KGAVWDEIVKENGLESTKLEEVGVWWFVDLILGGDCP-LDTMNKSKEHGFLGFRNSQKAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  374   ISWIDKVKAYKVVP  387



>ref|XP_006495229.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 214/377 (57%), Gaps = 13/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG ++ E L +    GGPWK+YG ARRP P+W     +D Y+  D  +
Sbjct  26    QNVGLVVGVTGIVGNSLAEILPRSDTPGGPWKIYGVARRPRPNWNAKYPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  85    PDDTQAKLSKLA-DVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP         K+  H+ PF ED PRL  P FYY  ED+  ++ E +     
Sbjct  143   QTGGKHYVGPF----ECIGKIPSHDPPFTEDLPRLNVPLFYYNQEDI--LFEEVDKRRGL  196

Query  846   ihrssiiIGA---SSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                     G    S  S+ N +  LCVYA ICK +G P  + G R  WE F + SDA L+
Sbjct  197   TWSIHRPSGIFGFSPYSLMNIIGILCVYAAICKHEGAPLVFHGTRDAWEGFQEFSDAELV  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEF  499
             AEQ+IWA V   A+N+AFNCTNGDVF WK +W++  + FE+E   F EE G +   + E 
Sbjct  257   AEQEIWAAVAPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGEEMGSERVRLEEV  316

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K   W  IV++++L  T++ E+  +     VL     +  SMNKSKE GFLG+ ++ 
Sbjct  317   MKGKESAWEEIVRENQLQPTKLNEVAVWSYADVVLNIGAGYFVSMNKSKEHGFLGFRNSK  376

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ +L+  +I+P
Sbjct  377   NSFITWINRLKSHRIVP  393



>ref|NP_001266103.1| putative steroid 5beta-reductase [Solanum lycopersicum]
 gb|AEX31545.1| putative steroid 5beta-reductase [Solanum lycopersicum]
Length=387

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 217/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARR  PSW     + EY+  D  N
Sbjct  25    ESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI-EYVQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  84    PEDTQSKLSVLT-DVTHVFYVTWANRSTEVENCEINGKMFRNVLNVIIPNCPNLR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H+ PF ED PRL  PNFYY LED++    E       
Sbjct  142   QTGRKHYLGP-----FELYGKVSHDPPFHEDLPRLDAPNFYYVLEDILFKEVEKKEGLTW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  197   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F LE   F+E   K   + E MKD
Sbjct  257   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLGEQFGLEAAEFDEG--KRCTLVEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++EE+  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  315   KGAVWDEIVKENGLVPTKLEEVGVWWFVDLILSGDCA-LDTMNKSKEHGFLGFRNSQKAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  374   ISWIDKVKAYKVVP  387



>ref|XP_006489807.1| PREDICTED: uncharacterized protein LOC102610524 [Citrus sinensis]
Length=826

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 226/376 (60%), Gaps = 7/376 (2%)
 Frame = -2

Query  1389  SKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDAL  1210
             ++ V L++G TG+VG ++ E L QP   GGPWKVYG ARRP P+W     + +Y+  D  
Sbjct  456   NQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKVYGVARRPRPAWNADHPI-QYIQCDVS  514

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVT  1030
             + ++T   LSK++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   H  
Sbjct  515   DADETQAKLSKLT-DVTHIFYVTWASRPTELENCHVNGAMLRNVLRSVIPNAPNLR-HFC  572

Query  1029  IQTGTKQYMGPIFDPSLATD-KMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsf  856
             +QTG K Y+GP FD  + T     PH+ P+ ED PRL  PNFYY  ED++    A+ +  
Sbjct  573   LQTGGKHYLGP-FDYFVETQLPHHPHDPPYTEDLPRLNVPNFYYDQEDILFEEVAKRDGL  631

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N   TLCVYA ICK +G P  +PG +  W+ F ++SDA L+
Sbjct  632   TWSVHRPLGIFGFSPYSMMNIAGTLCVYAAICKHEGVPLLFPGTKEAWDGFTEVSDADLI  691

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQQIWA V   A+N+AFNC NGDVF WK  W++  + FE+E   F+E G++   + E M
Sbjct  692   AEQQIWAAVDPNARNEAFNCANGDVFKWKHFWKVLAERFEIEDYGFDEKGER-LRLVEIM  750

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K  +W  IV+K++L  T++ E+  +             + SMNKSKE GFLG+ ++  
Sbjct  751   KGKESVWEEIVRKNKLLPTKLNEVAIWWHADVSFDVGEDILVSMNKSKEHGFLGFRNSKN  810

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  811   SFIAWIDKMKRYKIVP  826



>gb|AFK42748.1| unknown [Medicago truncatula]
Length=390

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 223/398 (56%), Gaps = 33/398 (8%)
 Frame = -2

Query  1419  TCKKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFP  1249
             T KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARR  PSW  
Sbjct  12    TKKKLDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNA  71

Query  1248  SSFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrs  1069
                + EY+  D  +  DT   LS ++ +VTHVF++       E EN  +N  ML NVL +
Sbjct  72    DHPV-EYIQCDITDPNDTTTKLSVLT-DVTHVFYVCWASRPTEAENCEINGAMLKNVLTA  129

Query  1068  ltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED  889
             +  +  +   HV+IQTG K Y+GP      +  K+  HE P+ ED PRL + NFYY LED
Sbjct  130   VIPNAPNLR-HVSIQTGGKHYVGPF----ESFGKIKHHEPPYTEDMPRLDYHNFYYTLED  184

Query  888   LVAIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRY  718
             +  ++ ET             +   G S  S+ N + T+CVYA ICK +G P R+PG + 
Sbjct  185   V--LFEETGKKEGVSWSVHRPLLIFGFSPYSMMNIIGTICVYAAICKHEGVPLRFPGTKL  242

Query  717   TWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF  538
              WE++   SDA L+AEQ IW  V   AKN+AFNC+NGDVF WK +W++  + F +E   F
Sbjct  243   AWENYYMASDADLIAEQHIWTAVDPYAKNEAFNCSNGDVFRWKQLWKVIAEQFGIEEYGF  302

Query  537   EENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC----  370
             +E G +   + E MKDKG +W  IVK++ L  T++EE         V  + F   C    
Sbjct  303   DEEGPR-LKLTELMKDKGPVWDEIVKENGLQVTKLEE---------VAEWWFADACFGGN  352

Query  369   ----SMNKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
                 SMNKSKE GFLG+ +T  S+  W+ + R  KI+P
Sbjct  353   GFTDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>ref|XP_002272271.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=389

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/376 (40%), Positives = 216/376 (57%), Gaps = 16/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V L++G TG+VG ++ E L      GGPWKVYG ARRP P+W   + + EY+  D  +
Sbjct  27    QGVGLIVGVTGIVGNSLAEILPLRDTPGGPWKVYGVARRPQPAWNADNCV-EYIQCDVFD  85

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LSK++ +VTH+F++       E EN R+N  M  NVL ++  +  +   H+ +
Sbjct  86    PEETSSKLSKLT-DVTHIFYVTWANMGSEAENCRVNGDMFRNVLSAVIPNAPNLQ-HICL  143

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP      A  K+ PH+ P+ E+ PRL   NFY+  ED+  ++ E       
Sbjct  144   QTGRKHYIGPF----EALGKIEPHDPPYHEEMPRLDVENFYHVQEDI--LFEEVRKKEGL  197

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N++ TLCVYATICK +G P R+PG + TW  + D+SDA L+
Sbjct  198   TWSVHRPGVIFGFSPYSMMNAIGTLCVYATICKHEGLPLRFPGTQDTWNGYWDVSDADLI  257

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AE  IWA V   AKN+AFNC+NGDVF WK +W++  + F LEF   E  G     + + M
Sbjct  258   AEHHIWAAVDPFAKNEAFNCSNGDVFKWKHLWKVLAEQFGLEFHEPEGQG---LSLEKMM  314

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  IV++  L  T++EE+  +     VL      + SMNKSKE GFLG+ ++  
Sbjct  315   KDKGPVWDEIVREKGLVPTKLEEVGQWWFADVVLS-AGSSLDSMNKSKEHGFLGFRNSKS  373

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  K +P
Sbjct  374   SFLSWIDKMKAYKFVP  389



>gb|ADG41743.1| putative progesterone 5 beta-reductase [Nicotiana tabacum]
Length=388

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPID-YIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  85    PEDTQSKLSLLT-DVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGP-----FELYGKVAHDSPFHEDLPRLDAPNFYYTLEDVLFKEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  198   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E       +AE MKD
Sbjct  258   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVEAAEFDEV--NRCTLAEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L   ++E++  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KGPVWDEIVKENGLTLAKLEDVGVWWFVDLILAGDCP-LDTMNKSKEHGFLGFRNSQKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKAYKVVP  388



>ref|XP_009360382.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 222/376 (59%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS I+ +VTH+F++       E EN   N+ ML NVL S+  +      HV +
Sbjct  85    PDDAKTKLSPIT-DVTHIFYVTWTNRSTEAENCEANAVMLRNVLNSVIPNAPKLQ-HVCL  142

Query  1026  QTGTKQYMGP--IFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsf  856
             QTG K Y+GP  +F       K+ PHE PF ED PRL  PNFYY LEDL+ A  A+  + 
Sbjct  143   QTGAKHYVGPFELFG------KIQPHEPPFTEDLPRLDAPNFYYTLEDLLFAEVAKKENL  196

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG++  W  +   SDA L+
Sbjct  197   TWSVHRPDAIFGFSPYSMMNIIGTLCVYAAICKHEGRPLKFPGSKAAWNCYSVASDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   + E M
Sbjct  257   AEQHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGGR-LSLVELM  315

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K ++W  IV+++ L  T++ E+  +  +   L  +   +CSMNKSKE GFLG+ ++  
Sbjct  316   KGKEKVWEEIVRENELQPTKLAEVGVWWFVDVWLSGE-GLLCSMNKSKEHGFLGFRNSRN  374

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  375   SFVTWIDKMKAFKIVP  390



>ref|XP_009771311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=388

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPID-YIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  85    PEDTQSKLSLLT-DVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGP-----FELYGKVAHDSPFHEDLPRLDAPNFYYTLEDVLFKEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  198   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E       +AE MKD
Sbjct  258   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVEAAEFDEV--NRCTLAEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L   ++E++  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KGPVWDEIVKENGLTPAKLEDVGVWWFVDLILAGDCP-LDTMNKSKEHGFLGFRNSQKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKAYKVVP  388



>ref|NP_001078438.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84869.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=387

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/389 (42%), Positives = 228/389 (59%), Gaps = 17/389 (4%)
 Frame = -2

Query  1419  TCKKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFP  1249
               KK+ ++  S++   VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W  
Sbjct  11    AAKKLDEDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNA  70

Query  1248  SSFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrs  1069
                +D Y+  D  + EDT   LS ++ +VTHVF++     E E EN   N +ML NVL++
Sbjct  71    DHPID-YIQCDVSDAEDTRSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMLRNVLQA  128

Query  1068  ltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIP-HEAPFKEDYPRLPFPNFYYALE  892
             +     +   HV +QTGTK Y+GP       T+   P H+ PF ED PRL   NFYY  E
Sbjct  129   IIPYAPNLR-HVCLQTGTKHYLGPF------TNVDGPRHDPPFTEDMPRLQIQNFYYTQE  181

Query  891   D-LVAIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYT  715
             D L     +  + ++SIHR ++I G S  S+ N + TLCVYA ICK +G P  +PG++  
Sbjct  182   DILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKA  241

Query  714   WEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFE  535
             WE F   SDA L+AEQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FE
Sbjct  242   WEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFE  301

Query  534   ENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKS  355
             E   K   + E MK K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKS
Sbjct  302   EG--KNLGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVE-GMIDSMNKS  358

Query  354   KELGFLGYADTLKSIRVWVQKLREMKIIP  268
             KE GFLG+ ++  S   W+ K +  KI+P
Sbjct  359   KEYGFLGFRNSNNSFISWIDKYKAFKIVP  387



>ref|XP_009109253.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY24831.1| BnaA08g14790D [Brassica napus]
Length=390

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 221/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +  +VTHVF++       E +N ++N +ML NVLR++  +  +   HV +
Sbjct  85    EEDARSKLSPLK-DVTHVFYVTWTNRSSEVDNCKVNGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP        D+   HEAPF E+ PRL   NFYY LED+++   +T      
Sbjct  143   QTGTKHYLGPFDSVGKDVDR---HEAPFTEEMPRLKIENFYYTLEDVLSEEIKTKESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  200   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKEAWEGFTTASDADLVAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCSNADVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     VL      + SMNKSKE GFLG+ ++  S 
Sbjct  318   KESVWEEMVKENQLQEKKLDEVGVWWFADVVLGVD-GMIDSMNKSKEYGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_011028990.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/376 (42%), Positives = 223/376 (59%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWKVYG ARRP P+W     LD  + +   +
Sbjct  26    QSVALVVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWN----LDHPVEYIQCD  81

Query  1206  FEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHV  1033
               DT ++ +K+S   +VTH+F++   +   E ENI+ N+ M  NVL+++  +  +   HV
Sbjct  82    ISDTAETQAKLSQLTDVTHIFYVTWALRFTEAENIQANNLMFRNVLQAVIPNAPNLK-HV  140

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfs  853
              +QTG K Y+GP F+      K+ PH+ P+ ED PRL  PNFYY LED++A    T    
Sbjct  141   CLQTGLKHYVGP-FE---LVGKIEPHDTPYTEDLPRLNAPNFYYDLEDILAEEVATKEGV  196

Query  852   f-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
               S+HR   I G S  S+ N + TL VYA ICK +G P  +PG    W  +   SDA L+
Sbjct  197   TWSVHRPHTIFGFSPYSLMNMMGTLSVYAAICKHEGMPLLFPGTESVWNAYSIASDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ+IWA V   A+N+AFN  NGDVF WK +W++  + F +E     E+G K+  + E M
Sbjct  257   AEQEIWAAVDPNAQNEAFNIHNGDVFKWKHLWKVLAEQFGIEKYGLPESG-KKVSLTELM  315

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  IVK ++L   ++EE+  +     VL  +    C MNKSKE GFLG+ ++  
Sbjct  316   KDKGAVWEKIVKDNQLLPNKLEEVGVWWFADFVLGAESIISC-MNKSKEHGFLGFRNSKN  374

Query  315   SIRVWVQKLREMKIIP  268
             S+  WV KL+  KI+P
Sbjct  375   SLISWVDKLKAHKIVP  390



>gb|AEZ01593.1| progesterone 5-beta-reductase [Erysimum odoratum]
Length=389

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 221/375 (59%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYGAARRP PSW     +D Y+  D  N
Sbjct  26    ESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGAARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYLGPFSNLDGPH-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  197

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  198   WSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  257

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  258   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEQYGFEEG--KNLGLVEMMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  316   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  375   FISWIDKYKAFKIVP  389



>ref|XP_010448593.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Camelina 
sativa]
Length=388

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/375 (42%), Positives = 221/375 (59%), Gaps = 14/375 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++     E E EN   N +ML NVLR++     +   HV +
Sbjct  85    ADDARSKLSPLT-DVTHVFYVTWTNRESETENCEANGSMLRNVLRAVVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPH-EAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfs  853
             QTGTK Y+GP       T+   PH + PF ED PRL   NFYY  ED L     +    +
Sbjct  143   QTGTKHYLGPF------TNVDGPHHDPPFTEDMPRLQIQNFYYTQEDVLFEEIKKKEGVT  196

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR ++I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  197   WSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLMFPGSKKAWEGFMTASDADLIA  256

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V + AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  257   EQQIWAAVDDYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  314

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  315   GKERVWEEMVKENQLLEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  373

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  374   FISWIDKYKAFKIVP  388



>ref|XP_007136737.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08731.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=389

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 223/375 (59%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    ESVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPSWNADHPI-EYVQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS ++ +VTHVF+++      E EN  +N  ML NVLR++  +  +   HV++
Sbjct  85    PADAESKLSVLT-DVTHVFFVSWTNRPTEAENCEVNGAMLQNVLRAVIPNAPNLR-HVSL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+G       +  K+  HE PF ED PRL  PNFYY  ED L    A+    ++
Sbjct  143   QTGTKHYLGSF----ESIGKIQSHEPPFTEDLPRLDTPNFYYNQEDILFEESAKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + ++CVYA ICK +G P R+PG +  WE +   SDA L+AE
Sbjct  199   SVHRPGTIFGFSPYSLMNLVGSVCVYAAICKHEGVPLRFPGTKGAWEGYSFSSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   A+N+AFNC+NGDVF WK +W++  + F +E   FEE       ++E MKD
Sbjct  259   QHIWAAVDPNARNEAFNCSNGDVFKWKHLWKVLAEQFGIEEYGFEEG--SHLKLSEVMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC-SMNKSKELGFLGYADTLKS  313
             KG +W  IV  ++L  T++EE+  +  +  +  F  + V  SMNK+KE GFLG+ ++  S
Sbjct  317   KGPVWDEIVSANQLLPTKLEEVGDWWFVDII--FSAEGVLDSMNKAKEHGFLGFRNSKNS  374

Query  312   IRVWVQKLREMKIIP  268
             +  W+ K +  KI+P
Sbjct  375   LISWIDKCKGYKIVP  389



>gb|AEO36945.1| progesterone 5beta-reductase [Erysimum albescens]
Length=390

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 220/375 (59%), Gaps = 12/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYVGPFSNLGGGPR----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  198

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  199   WSAHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  258

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V + AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  259   EQQIWAAVDQYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  316

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  317   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  375

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  376   FISWIDKYKAFKIVP  390



>ref|NP_194153.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 sp|Q9STX2.1|VEP1_ARATH RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR; 
AltName: Full=Protein VEIN PATTERNING 1 [Arabidopsis thaliana]
 emb|CAB45057.1| putative protein [Arabidopsis thaliana]
 emb|CAB79332.1| putative protein [Arabidopsis thaliana]
 gb|AAL32529.1| putative protein [Arabidopsis thaliana]
 gb|AAM64873.1| induced upon wounding stress [Arabidopsis thaliana]
 gb|AAP37838.1| At4g24220 [Arabidopsis thaliana]
 gb|ABU55811.1| progesterone 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84868.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=388

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/387 (42%), Positives = 228/387 (59%), Gaps = 17/387 (4%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++  S++   VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W    
Sbjct  14    KKLDEDEPSQSFESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              +D Y+  D  + EDT   LS ++ +VTHVF++     E E EN   N +ML NVL+++ 
Sbjct  74    PID-YIQCDVSDAEDTRSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMLRNVLQAII  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIP-HEAPFKEDYPRLPFPNFYYALED-  889
                 +   HV +QTGTK Y+GP       T+   P H+ PF ED PRL   NFYY  ED 
Sbjct  132   PYAPNLR-HVCLQTGTKHYLGPF------TNVDGPRHDPPFTEDMPRLQIQNFYYTQEDI  184

Query  888   LVAIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWE  709
             L     +  + ++SIHR ++I G S  S+ N + TLCVYA ICK +G P  +PG++  WE
Sbjct  185   LFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWE  244

Query  708   HFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEEN  529
              F   SDA L+AEQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE 
Sbjct  245   GFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG  304

Query  528   GDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKE  349
               K   + E MK K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE
Sbjct  305   --KNLGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVE-GMIDSMNKSKE  361

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GFLG+ ++  S   W+ K +  KI+P
Sbjct  362   YGFLGFRNSNNSFISWIDKYKAFKIVP  388



>ref|XP_002285152.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=390

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 230/374 (61%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPDWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++       E EN   N TML NVLR+L  +  +   H+ +
Sbjct  85    SEDALAKLSPLT-DVTHVFYVTWTNRATEIENCEANGTMLRNVLRALIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET-Nsfsf  850
             QTG K Y+GP      A  K+ PH+ P+ ED PRL  PNFYY LED++    E  +  ++
Sbjct  143   QTGGKHYIGPF----EAFGKIKPHDPPYHEDLPRLDAPNFYYTLEDILFEECEKKDDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  II G S  S+ N L TLC+YA ICK +G P ++PG++  W+ + D SDA L+AE
Sbjct  199   SVHRPVIIFGFSPYSMMNILGTLCIYAAICKHEGIPLKFPGSKAAWDCYSDASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   A+N+AFN TNGD+F WK +W++  + F++E+  FEE  +K+  + E MKD
Sbjct  259   QQIWATVDPYARNEAFNITNGDLFKWKHLWKVLAEQFDMEYAEFEEGEEKQ-SMVEMMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++E++  +  +  VL  +    C MNKSKE GFLG+ ++  S 
Sbjct  318   KGPVWEEIVREKELLPTKLEDVAQWWFIDLVLGGESLLNC-MNKSKEHGFLGFRNSRNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K+R  K+IP
Sbjct  377   VWWIDKMRGHKLIP  390



>ref|XP_008790041.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/378 (41%), Positives = 227/378 (60%), Gaps = 12/378 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPS---SFLDEYMTFD  1216
             ++V LVIG TG+VG ++ E L      GGPWKVYG +RRP    F S       E++  D
Sbjct  30    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVSRRPRSVSFGSLNEGLAVEHIQCD  89

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
               + +D    LS +++ VTHVF++A     +E EN  +NS ML NVL ++  +  +   H
Sbjct  90    VSDPDDAFAKLSPLTD-VTHVFYVAWVNRIVEAENREVNSAMLRNVLAAVLPNAPNLQ-H  147

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETN  862
             + +QTG K Y+G       +  K+  HE PF+ED PRL  PNFYY LED++   +     
Sbjct  148   ICLQTGRKHYLGSF----ESIGKVKAHEPPFREDLPRLDCPNFYYDLEDILFEEVAKREG  203

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
             + ++SIHR + I G S+ S+ N + +LC YA IC+ +G P ++PG+R  WE F D SDA 
Sbjct  204   AVTWSIHRPTTIFGFSTCSLMNFVGSLCAYAAICRREGAPLKWPGSRVAWEGFSDASDAD  263

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             L+AE  IWA +   AKN+ FNC+NGD+F WK +W L    F +E+V +E   ++ F + +
Sbjct  264   LIAEHHIWAAIDPYAKNEPFNCSNGDLFKWKHLWPLLAREFGVEWVGYEGE-ERRFKLVD  322

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MK+K  +W  +V +H L  TR+EE+  +  +  VL  +  H+ SMNKSKE GFLG+ +T
Sbjct  323   AMKEKEGLWEEMVAEHALAPTRLEEVGNWWFVDAVLGVEEVHLDSMNKSKEHGFLGFRNT  382

Query  321   LKSIRVWVQKLREMKIIP  268
             + S   W+ K+R  +I+P
Sbjct  383   VSSFISWIDKMRAYRIVP  400



>gb|AGN74845.1| putative enone 5-beta-reductase [Lepidium sativum]
Length=392

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 224/378 (59%), Gaps = 16/378 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E +N+  N +ML NVL+++     +   HV +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRESESKNVEANGSMLRNVLQAIVPHARNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD          H+ PF ED PRL   NFYY LED L     +T S ++
Sbjct  143   QTGTKHYLGP-FDNLEGPH----HDPPFTEDMPRLQIHNFYYTLEDILFEEIKKTESVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKYEGSPLLFPGSKKAWEGFTTASDADLVAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCSNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK--  316
             K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++ +  
Sbjct  316   KERVWEEMVKENQLQEKKLEEVGVWWVADVILSVEGM-IDSMNKSKEHGFLGFRNSFRNS  374

Query  315   --SIRVWVQKLREMKIIP  268
               S   W+ K +  KI+P
Sbjct  375   NNSFISWIDKYKAFKIVP  392



>gb|AEO36946.1| progesterone 5beta-reductase [Erysimum scoparium]
Length=390

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 221/375 (59%), Gaps = 12/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYVGPFSNLGGGPR----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  198

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  199   WSVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  258

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V + AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  259   EQQIWAAVDQYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  316

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  317   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  375

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  376   FISWIDKYKAFKIVP  390



>ref|XP_002510123.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52310.1| conserved hypothetical protein [Ricinus communis]
Length=390

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 225/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVALVLGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS+++ ++TH+F++     + E+EN  +N  M  NVL+++  +  +   H+ +
Sbjct  85    SAETQSKLSQLT-DITHIFYVTWTNRQSEDENCEINGLMFRNVLQAVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG K Y+GP      +  K+  H+ PF ED PRL  PNFYY LED++    A+    ++
Sbjct  143   QTGAKHYVGPF----ESLGKIQTHDPPFTEDLPRLDAPNFYYTLEDIMFEEVAKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S+ N + TLCVYATICK +G P  +PG +  W  +   SDA L+AE
Sbjct  199   SIHRPDQIFGFSPYSLMNIIGTLCVYATICKHEGLPLLFPGTKAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AK++AFNC NGDVF WK  W++  + F +E   FEE G+K   + E MK 
Sbjct  259   HQIWASVDPYAKDEAFNCNNGDVFKWKHFWKVLAEQFGIEEYGFEE-GEKRLSLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IV +++L  T+++E+  +  +  +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  318   KEAVWEEIVSENQLQPTKLDEVAVWWFVDLMLGGE-AVISSMNKSKEHGFLGFRNSKNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   ASWIDKMKAYKIVP  390



>gb|AHZ44506.1| putative progesterone 5 beta-reductase [Iberis amara]
Length=389

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 220/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++       E++N   N +ML NVL ++  +  +   HV +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRSSEQDNCEANGSMLRNVLGAIIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD     +K   H+ PF ED PRL   NFYY LED L     +    ++
Sbjct  143   QTGTKHYVGP-FD---NLEKAQHHDPPFMEDMPRLQIQNFYYTLEDILFEGIKKKEGVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  199   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKKAWEGFSTASDADLVAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V E AK +AFNC N D+  WK +W++  + F +E   FEE   K   + E MK 
Sbjct  259   QQIWAAVDEYAKTEAFNCNNDDISKWKHLWKVLAEQFGIEEYGFEEG--KNLGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+H+L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++ KS 
Sbjct  317   KERVWEEMVKEHQLQEKKLEEVGVWWFADIILGVEGM-IDSMNKSKEHGFLGFRNSNKSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>ref|XP_003638458.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35788.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09149.1| progesterone 5-beta-reductase 1 [Medicago truncatula]
Length=389

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 220/388 (57%), Gaps = 18/388 (5%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARRP PSW    
Sbjct  14    KKLDEDEAPQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  N  DT    S I  +VTH+F+++      EE+N  +N  ML NVLR++ 
Sbjct  74    PI-EYIQRDITNSNDTQTKFS-ILTDVTHIFYVSWTSRPTEEDNCEVNGVMLLNVLRAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV++QTG K Y+GP        DK+  HE  F ED PRL  PNFYY  ED+ 
Sbjct  132   PNAPNLC-HVSLQTGGKHYLGPF----ALIDKINSHEPSFTEDLPRLDIPNFYYTQEDI-  185

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + TLC+YA ICK +    ++PG +  W
Sbjct  186   -LFEETKKKEGLSWSVHRPLLIFGFSPYSLMNVVGTLCLYAAICKHEHISLKFPGTKRAW  244

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
             E +   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + FE+E   +E+
Sbjct  245   ESYYMASDADLIAEQHIWAAVDTYAKNEAFNCSNGDVFRWKQLWKVLTEQFEIEEYGYED  304

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSK  352
                    +AE MKDKG +W  IVK++ L  T++EE+  +         +   V SMNK+K
Sbjct  305   G--PRLRLAEMMKDKGPVWDEIVKENELQPTKLEEVAEWWVADATFGME-DIVDSMNKAK  361

Query  351   ELGFLGYADTLKSIRVWVQKLREMKIIP  268
             E GFLG+ ++  S+  W+ K R  KI+P
Sbjct  362   EHGFLGFRNSKNSLINWIDKTRAYKIVP  389



>ref|XP_009396895.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   268 bits (686),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 160/390 (41%), Positives = 233/390 (60%), Gaps = 24/390 (6%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRP-----LP-SWFPS-------  1246
             ++VA+VIGATG+VG ++V+ L      GGPWKVY  +RRP     LP S+ P+       
Sbjct  28    ESVAIVIGATGIVGTSLVDILPLADTPGGPWKVYAVSRRPPNSAILPYSYSPADAEAPVA  87

Query  1245  --SFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlr  1072
               +   +++  D L+  D    LS ++ +VTH+F++A      E EN  +NS ML NVL 
Sbjct  88    ADTLRVQHIQCDVLDAADAVAKLSPLT-DVTHLFYVAWANRLTEAENRVVNSAMLRNVLS  146

Query  1071  sltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALE  892
             ++  S  +   HV +QTG K Y+GP      A  K + H+ PF+ED PRLP PNFYY  E
Sbjct  147   AVVPSAPNLC-HVCLQTGRKHYVGPF----EAVGKALAHDPPFREDLPRLPVPNFYYDQE  201

Query  891   DLV--AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRY  718
             D++   +  +  + ++SIHR + I G S  S+ N + TLCVYA IC+++G P ++ G+R 
Sbjct  202   DILFDELSKKEGAVTWSIHRPTTIFGFSPTSLMNLIGTLCVYAAICRKEGAPLKWFGSRT  261

Query  717   TWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF  538
             TW+ F D SDA L+AEQQIWA V   AKN+AFN +NGD+F WK +W    D F LE V +
Sbjct  262   TWDGFNDASDADLIAEQQIWAAVDPYAKNEAFNISNGDLFKWKHLWAALADQFGLESVGY  321

Query  537   EENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNK  358
             E    + F + + M+ K  +W  IV ++ L  T++EE+  +     VL  +  H+ SMNK
Sbjct  322   EGEASR-FKLEDAMRGKEAVWAEIVAENELVPTKLEEVASWWFADVVLGLELAHLDSMNK  380

Query  357   SKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             SKE GFLG+ +T+ S    + K++  KI+P
Sbjct  381   SKEHGFLGFRNTVASFNSCIDKMKAFKIVP  410



>gb|AIA58905.1| putative progesterone 5-beta-reductase [Malcolmia maritima]
Length=388

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED L     +  S ++
Sbjct  143   QTGTKHYVGPFSNLGRPH-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKESVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPYSLMNMVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>ref|XP_006433107.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
 gb|ESR46347.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
Length=397

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 152/375 (41%), Positives = 217/375 (58%), Gaps = 12/375 (3%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             V L+IG TG+VG ++ E L +    GGPWKVYG ARRP P W     + EY+  D  + +
Sbjct  31    VGLLIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNADHPI-EYIQCDVSDED  89

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             DT   L+K++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV +QT
Sbjct  90    DTQAKLTKLT-DVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLR-HVCLQT  147

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             G K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  ED++    E      S+ 
Sbjct  148   GAKHYVGPF----ESFGKIRPHDTPFTEDLPRLNVPNFYYTQEDILFEEVEKRKGPLSLT  203

Query  840   rssiiI----GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
              S        G S  S+ N + TLCVYA ICK +G P  +PG++  WE +   SDA L+A
Sbjct  204   WSVHRPHVIFGFSPYSLMNVVGTLCVYAAICKHEGVPLLFPGSKDCWEGYSVASDADLIA  263

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   A+N+AFNC+NGDVF WK +W++  + FE+      E GD+   + E MK
Sbjct  264   EQQIWAAVDPYARNEAFNCSNGDVFKWKHLWKVLAEQFEIANYGLPEEGDR-VRLEEIMK  322

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  IV++++L   ++ E+  +     +L   F  + SMNKSKE GFLG+ ++  S
Sbjct  323   GKEGVWEEIVRENQLQPAKLSEVAVWWFADLMLDGGFLLLDSMNKSKEHGFLGFRNSKNS  382

Query  312   IRVWVQKLREMKIIP  268
                W+ K++  +I+P
Sbjct  383   FVNWIDKMKTYRIVP  397



>ref|XP_006665039.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Oryza 
brachyantha]
Length=396

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 153/393 (39%), Positives = 232/393 (59%), Gaps = 16/393 (4%)
 Frame = -2

Query  1419  TCKKMGQENCS------KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPS  1258
               KK  +EN +      ++VALV+G+TG+VG ++++ L      GGPWKVY  +RRPLP 
Sbjct  11    AVKKRQEENAAATEPSFQSVALVLGSTGLVGTSLLDILPLQDTPGGPWKVYAVSRRPLPP  70

Query  1257  WFP-SSFLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDN  1081
             W P  S     +  D  +     ++L+ ++ ++THVF++A      E +N+ +N+ ML N
Sbjct  71    WSPPDSPAVTNLHLDLADPAAVAEALTPLT-DITHVFYVAWSPQPTEAQNLEVNAAMLRN  129

Query  1080  VlrsltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYY  901
             VL  +  +  + + HV +QTG K Y+GP      A  K+   + PF ED PRL  PNFYY
Sbjct  130   VLSVVVPNCPALV-HVCLQTGRKHYIGPF----EAIGKIPVPDPPFAEDMPRLNCPNFYY  184

Query  900   ALEDLV--AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPG  727
               ED++   +     + S+S+HR + I G S  S  N + +LCVYA IC+++G   R+PG
Sbjct  185   DQEDVLFEEVSRRDGAVSWSVHRPTTIFGFSPRSAMNVVGSLCVYAAICRKEGAVLRWPG  244

Query  726   NRYTWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEF  547
              R  WE F D SDA L+AE +IWA V   AKN+AFNC+NGD++ WK +W +  D F +E+
Sbjct  245   TRVAWEGFSDASDADLIAEHEIWAAVEPFAKNEAFNCSNGDLYKWKLLWPMLADQFGVEW  304

Query  546   VAFEENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCS  367
               + E  +  F + + M  K  +W  IV ++ L  T ++EIT +  +  V   Q +H+ S
Sbjct  305   SGY-EGEESSFKLEDAMSGKEAVWAEIVMENGLVETELKEITNWWFVDAVFGVQSEHLDS  363

Query  366   MNKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             MNKSKE GFLG+ +T+ S   W++K++  KI+P
Sbjct  364   MNKSKEHGFLGFRNTVNSFNTWIEKMKVFKIVP  396



>gb|AGT29341.1| putative progesterone 5-beta reductase [Cardamine pratensis]
Length=388

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++     E E +N   N +ML NVLR++     +   HV +
Sbjct  85    EDDARSKLSPLT-DVTHVFYVTWTSRESEHDNCEANGSMLRNVLRAIVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QT TK Y+GP  +   +      H APF ED PRL   NFYY LED++    + N     
Sbjct  143   QTRTKHYIGPFDNHGRSR-----HGAPFTEDMPRLQIHNFYYTLEDVLFEEIKKNENVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNTIFGFSPFSLMNIVGTLCVYAAICKHEGSPLFFPGSKAAWEGFTAASDADLVAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V + AKN+AFNC N D+F WK +W+   + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDQYAKNEAFNCNNADIFKWKHLWKFLAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQEKKLEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNSSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>ref|XP_007223026.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
 gb|EMJ24225.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
Length=391

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 217/374 (58%), Gaps = 9/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    ESVGLVIGVTGIVGNSLAEILPISDTPGGPWKVYGVARRPRPNWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS +S +VTH+F++       E EN   N  M  NVL S+  +  +   HV +
Sbjct  85    ADDAKAKLSPLS-DVTHIFYVTWTNRSTEAENCEANGAMFRNVLNSVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG K Y+GP      A  K+ PHE PF ED PRL +PNFYY +EDL+ A   +    ++
Sbjct  143   QTGAKHYVGPF----EAFGKIQPHEPPFTEDLPRLDYPNFYYTMEDLLFAEMEKKEDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +  P ++PG++  W  +   SDA L+AE
Sbjct  199   SVHRPDAIFGFSPYSMMNIVGTLCVYAAICKHERVPLKFPGSKAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E    +  + E MK 
Sbjct  259   QHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEEEGAKLSLVELMKG  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L  TR+EE+  +  +   L  +   +CSMNKSKE GF+G+ ++  S 
Sbjct  319   KERVWEEIVKENQLQPTRLEEVGVWWFVDAWLGGE-GLLCSMNKSKEHGFVGFRNSRNSF  377

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  378   VTWIDKTKAFKIVP  391



>gb|ADG56540.1| progesterone 5-beta-reductase [Nerium oleander]
Length=387

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 217/374 (58%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPV-EYVQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LSK++ +VTHVF++       E EN   N  M  NVL ++  +  +   H+ +
Sbjct  85    KEDAESKLSKLT-DVTHVFYVTWASKSTEVENCEANGKMFRNVLDAIIPNCPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP           + HE PF ED PRL  PNFYY LED L     +    ++
Sbjct  143   QTGLKHYLGP-----FELFGKVGHEPPFTEDLPRLDVPNFYYTLEDILFEEVGKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P R+PG +  W+ +   SDA L+AE
Sbjct  198   SVHRPGNIFGFSPYSLMNLVGTLCVYAAICKHEGVPLRFPGCKEAWQGYSMCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
               IWA V   AKN+AFN +NGDVF WK  W++  + F  E+  +E  G+K   + E MKD
Sbjct  258   HHIWAAVDSYAKNEAFNVSNGDVFRWKHFWKVLAEQFGAEYAEYE--GEK-LSLQEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L  T++EE+  +     VL F+ Q + SMNKSKE GFLG+ ++  + 
Sbjct  315   KGSVWEDIVRENGLVPTKLEEVGVWWFADIVLGFECQ-LDSMNKSKEHGFLGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  374   ISWIDKAKAYKIVP  387



>gb|AHI88613.1| putative steroid 5-beta-reductase [Sinapis arvensis]
Length=390

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 224/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++       E EN ++N +ML NVLR++  +  +   HV +
Sbjct  85    AEDAKSKLSTLT-DVTHVFYVTWTNRSSEVENCKVNGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QT TK Y+GP FD S+  D +  HEAPF E+ PRL   NFYY LED+++   +       
Sbjct  143   QTRTKHYLGP-FD-SVGKD-VERHEAPFTEEMPRLQIENFYYTLEDVLSEEIKMKESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  200   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKKAWEGFTTASDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCSNADVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     VL      + SMNKSKE GFLG+ ++  S 
Sbjct  318   KERVWEEMVKENQLQEKKLDEVGVWWFADVVLGVD-GMIDSMNKSKEYGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKVFKIVP  390



>ref|XP_006433101.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
 gb|ESR46341.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
Length=399

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/377 (41%), Positives = 219/377 (58%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LVIG TG+VG ++ E L +    GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  31    QHVGLVIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNADHPI-EYIQCDVSD  89

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LSK++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV +
Sbjct  90    QDDTQAKLSKLT-DVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLR-HVCL  147

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP      +  K+ PH+ PF ED PRL   NFYY  ED++    E      S
Sbjct  148   QTGGKHYVGPF----ESFGKIRPHDTPFTEDLPRLNVTNFYYTQEDILFEEVEKRKGPLS  203

Query  846   ihrssiiI----GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
             +  S        G S  S+ N + TLCVYA ICK +G P  +PG++  WE +   SDA L
Sbjct  204   LTWSVHRPHIIFGFSPYSMMNVVGTLCVYAAICKHEGVPLLFPGSKDCWEGYSVASDADL  263

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AEQQIWA V   A+N+AFNC+NGDVF WK +W++  + FE+E     + G++   + E 
Sbjct  264   IAEQQIWAAVDPYARNEAFNCSNGDVFKWKHLWKVLAEQFEIENYGLPQEGER-VRLEEI  322

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             M+ K  +W  IVK+++L  T++ E+  +     +L   F  + SMNKSKE GFLG+ ++ 
Sbjct  323   MRGKEGVWEQIVKENQLQLTKLSEVAVWWFADMMLDGGFLLLDSMNKSKEHGFLGFRNSK  382

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  +I+P
Sbjct  383   NSFVNWIDKMKTYRIVP  399



>gb|ADG56539.1| progesterone 5-beta-reductase [Hoya carnosa]
Length=387

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 218/374 (58%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVALIIGVTGIVGSSLAEILPLSDTPGGPWKVYGVARRPRPAWNADCPI-EYVQCDIGN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LSK++ +VTHVF++       E EN  +N  M  N L +L  +  +   H+ +
Sbjct  85    REDTESKLSKLT-DVTHVFYVTWASKSNEIENCEVNGKMFKNALDALIPNCPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y GP           + HE+P+ ED PRL  PNFYY LED L     +    ++
Sbjct  143   QTGGKHYAGP-----FELWGKVGHESPYTEDLPRLDAPNFYYTLEDVLFEAVGKKEGVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK++G P ++PG +  WE +   SDA L+AE
Sbjct  198   SVHRPGNIFGFSPYSLMNLVGTLCVYAAICKQEGVPLKFPGCKEVWEGYSVASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V   AKN+AFN +NGDVF WK  W+L  + F +E+    E G ++    E MKD
Sbjct  258   HEIWAAVDPNAKNEAFNVSNGDVFKWKHFWKLLAEQFGVEYA---EYGGEKLSFEELMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV ++ L  T++EE+  +        ++   V SMNKSKE GFLG+ ++  + 
Sbjct  315   KGRVWEEIVAENGLVPTKLEEVGLWWFGDLCFGYECA-VLSMNKSKEHGFLGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W++K++  KI+P
Sbjct  374   ISWIEKMKAYKIVP  387



>gb|AFZ41789.1| putative progesterone 5-beta-reductase [Raphanus sativus]
Length=390

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 224/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +  +VTHVF++       E +N ++N +ML NVLR++  +  +   HV +
Sbjct  85    EEDARSKLSPL-RDVTHVFYVTWSNRSSEVDNCKVNGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+GP FD SL  D +  HE PF ED PRL   NFYY LED+++   +T      
Sbjct  143   QTGTKHYLGP-FD-SLGKD-VQRHEPPFTEDMPRLRVENFYYTLEDVLSEEIKTRESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR ++I G S  S+ N + TLCVYA ICK +G    +PG +  WE F   SDA L+AE
Sbjct  200   SVHRPNLIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGRKEAWEGFATASDADLVAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC+N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCSNADVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     VL      + SMNKSKE GFLG+ ++  S 
Sbjct  318   KERVWEEMVKENQLQEKKLDEVGLWWFADLVLGVDGM-LDSMNKSKEYGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_003636813.1| Progesterone 5-beta-reductase [Medicago truncatula]
 ref|XP_003638462.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35786.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09150.1| progesterone 5-beta-reductase 2 [Medicago truncatula]
Length=390

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/396 (40%), Positives = 222/396 (56%), Gaps = 33/396 (8%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARR  PSW    
Sbjct  14    KKLDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  D    LS ++ +VTHVF++       E EN  +N  ML NVL ++ 
Sbjct  74    PV-EYIQCDITDPNDATTKLSVLT-DVTHVFYVCWASRPTEAENCEINGAMLKNVLTAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV+IQTG K Y+GP      +  K+  HE P+ ED PRL + NFYY LED+ 
Sbjct  132   PNAPNLR-HVSIQTGGKHYVGPF----ESFGKIKYHEPPYTEDMPRLDYHNFYYTLEDV-  185

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + T+CVYA ICK +G P R+PG +  W
Sbjct  186   -LFEETGKKEGVSWSVHRPLLIFGFSPYSMMNIIGTICVYAAICKHEGVPLRFPGTKLAW  244

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
             E++   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E
Sbjct  245   ENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVIAEQFGIEEYGFDE  304

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC------  370
              G +   + E MKDKG +W  IVK++ L  T++EE         V  + F   C      
Sbjct  305   EGPR-LKLTELMKDKGPVWDEIVKENGLQVTKLEE---------VAEWWFADACFGGNGF  354

Query  369   --SMNKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
               SMNKSKE GFLG+ +T  S+  W+ + R  KI+P
Sbjct  355   TDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>gb|AEX31544.1| putative steroid 5beta-reductase [Solanum tuberosum]
Length=387

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 216/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARR  PSW     + EY+  D  N
Sbjct  25    ESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI-EYVQCDISN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +      H+ +
Sbjct  84    PEDTQSKLSVLT-DVTHVFYVTWANRSKEVENCEINGKMFRNVLNVIIPNCPHLR-HICL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  142   QTGRKHYLGP-----FELYGKVSHDSPFHEDLPRLDAPNFYYVLEDILFKEVEKKEGLTW  196

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  197   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAE  256

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E   K   + E MKD
Sbjct  257   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVEAAEFDEG--KRCTLVEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++EE+  +     +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  315   KGAVWDEIVKENGLVPTKLEEVGVWWFADLMLSGDCP-LDTMNKSKEHGFLGFRNSQKAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  374   ISWIDKVKAYKVVP  387



>ref|XP_010673631.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 227/374 (61%), Gaps = 9/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  30    QSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNAEHPI-EYIQCDISD  88

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VT++F++       E EN ++NS M  NVL ++  +  +   H+ +
Sbjct  89    KDDVVLKLSPLT-DVTNIFYVCWANCVTEAENCKINSMMFQNVLNAVVPNAPNLK-HICL  146

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y G  F+     + ++  + P+ ED PRL  PNFYY LED L A  A+    ++
Sbjct  147   QTGMKHYTGA-FEYWGKVEHLL--DPPYSEDMPRLELPNFYYDLEDILYAQVAKKEDITW  203

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  SV N L TLCVYA ICK +G PFR+PG++  WE +   SDA L+AE
Sbjct  204   SVHRPGCIFGFSPYSVMNVLGTLCVYAAICKHEGIPFRFPGSKIIWESYSQASDADLIAE  263

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E     F +AE++K 
Sbjct  264   HQIWAAVDPYAKNEAFNCSNGDVFKWKHLWQVLGEQFGVEVAEFDERVGG-FSLAEWIKG  322

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK++ L  T++EE+  +  +     + +  + +MNKSKE GFLG+ +T  S+
Sbjct  323   KDSVWEEIVKENDLVATKLEEVGTWQFVDMAFSWNWP-LDTMNKSKEHGFLGFRNTKNSL  381

Query  309   RVWVQKLREMKIIP  268
               WV K++  KI+P
Sbjct  382   IYWVDKMKAYKIVP  395



>ref|XP_003525919.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Glycine 
max]
Length=388

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 220/374 (59%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L       GPWKVYG ARRP P W     + EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLADTPAGPWKVYGVARRPRPPWNADHPV-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS +++ VTHVF+++      E EN  +N  ML NVLR++  +  +   HV++
Sbjct  85    PADAEAKLSALTD-VTHVFFVSWTNRSTEAENCEVNGAMLQNVLRAVIPNAPNLR-HVSL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP         K+  HE PF ED PRL  PNFYY  ED L    A+    ++
Sbjct  143   QTGGKHYIGPF----EFIGKIESHEPPFAEDMPRLDAPNFYYTQEDILFEETAKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + TL VYA ICK +G P R+PG R  WE +   SDA L+AE
Sbjct  199   SVHRPQVIFGFSPYSLMNMIGTLSVYAAICKHEGVPLRFPGTRGAWESYSCASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   A+N+AFNC+NGDVF WK +W++  + F +E   FEE G     ++E MKD
Sbjct  259   QHIWAAVDPYARNEAFNCSNGDVFRWKHLWKVLAEQFGIEEYGFEEEG---LSLSELMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV +++L  T+++E+  +  +  +   +   + SMNK+KE GFLG+ ++  S 
Sbjct  316   KGPVWDEIVSENQLLPTKLDEVADWWFVDLIFSGEGM-LDSMNKAKEHGFLGFRNSKNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKTKAYKIVP  388



>ref|XP_006353962.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 216/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARR  PSW     + EY+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRARPSWNADHPI-EYVQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +      H+ +
Sbjct  85    PEDTQSKLSVLT-DVTHVFYVTWANRSKEVENCEINGKMFRNVLNVIIPNCPHLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H++PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGP-----FELYGKVSHDSPFHEDLPRLDAPNFYYVLEDILFKEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  198   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   F+E   K   + E MKD
Sbjct  258   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVEAAEFDEG--KRCTLVEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++EE+  +     +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KGAVWDEIVKENGLVPTKLEEVGVWWFADLMLSGDCP-LDTMNKSKEHGFLGFRNSQKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKAYKVVP  388



>gb|ADG56545.1| progesterone 5-beta-reductase [Erysimum rhaeticum]
Length=389

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N +M+ NVL+++     +   H+ +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMIRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED L     +  S ++
Sbjct  143   QTGTKHYVGPFSNLGGGPR----HDPPFTEDMPRLQIQNFYYTQEDTLFEEIKKKESVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  199   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  259   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEQYGFEEG--KNLGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>gb|ADG56543.1| progesterone 5-beta-reductase [Erysimum x marshallii]
Length=389

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 225/387 (58%), Gaps = 16/387 (4%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+  +  S++   VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW    
Sbjct  14    KKLDDDEPSRSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              +D Y+  D  N E+    LS ++ +VTHVF++     E E EN   N +ML NVL+++ 
Sbjct  74    PID-YIQCDVSNAEEARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIV  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
                 +   H+ +QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++
Sbjct  132   PHAPNLR-HICLQTGTKHYLGPFSNLDGPH-----HDPPFTEDMPRLQIQNFYYTQEDIL  185

Query  882   --AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWE  709
                I  +  S ++SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE
Sbjct  186   FEEIKKKEISVTWSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWE  245

Query  708   HFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEEN  529
              F   SDA L+AEQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE 
Sbjct  246   GFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG  305

Query  528   GDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKE  349
               K   + E MK K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE
Sbjct  306   --KNLGLVEMMKGKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKE  362

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GFLG+ ++  S   W+ K +  KI+P
Sbjct  363   HGFLGFRNSNNSFISWIDKYKAFKIVP  389



>ref|XP_006367946.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 228/374 (61%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP PSW   ++  EY+  D  +
Sbjct  26    QSVGLIIGVTGIVGNSLAEILPGTDTPGGPWKVYGVARRPRPSW-NVNYPIEYIQCDISS  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   L+ +++ VTHVF++   +   E EN  +N  M  NVL ++  +  +   H+ +
Sbjct  85    PEETQSKLTLLTD-VTHVFYVTWAIRPTELENCEINGKMFQNVLDAIIPNCPNLS-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y G     S    + I H+ P+ E  PRLP PNFYY LED L     +    ++
Sbjct  143   QTGLKHYHG-----SFELFEKIAHDTPYHEGLPRLPAPNFYYTLEDILFEEVKKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR  +I G S  S+ N + TLCVYATICK +G P R+PG++  W+ +   SDA L+AE
Sbjct  198   SIHRPGLIFGFSPYSMMNIIGTLCVYATICKHEGLPLRFPGSKSAWDGYSYCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA +   AKN+AFN +NGDVF WK +W++  + F++E   F+E+  K + + E MKD
Sbjct  258   HQIWASMDPNAKNEAFNISNGDVFKWKHLWKVLAEEFQVEAEEFDES--KRWTLVEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG+IW  IVK++ L  +++EEI  +  +  VL+ +   + +MNKSKE GFLG+ ++  + 
Sbjct  316   KGQIWDEIVKENGLVESKLEEIGRWWFVDLVLKKECP-LDTMNKSKEHGFLGFRNSKNAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K +P
Sbjct  375   ISWIYKIKACKFVP  388



>ref|XP_008393755.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 222/376 (59%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTH+F++       E EN   N+ ML NVL S+  +      HV +
Sbjct  85    PDDAKTKLSPLT-DVTHIFYVTWTNRSTEAENCEANAVMLRNVLNSVIPNAPKLQ-HVCL  142

Query  1026  QTGTKQYMGP--IFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsf  856
             QTG K Y+GP  +F       K+ PHE PF ED PRL  PNFYY LEDL+ A  A+  + 
Sbjct  143   QTGAKHYVGPFELFG------KIQPHEPPFTEDLPRLDAPNFYYTLEDLLFAEXAKKENL  196

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG++  W  +   SDA L+
Sbjct  197   TWSVHRPDAIFGFSPXSMMNIIGTLCVYAAICKHEGRPLKFPGSKAAWNCYSVASDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   + E M
Sbjct  257   AEQHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGXR-LSLVELM  315

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K ++W  IV+++ L  T++ E+  +  +   L  +   +CSMNKSKE GFLG+ ++  
Sbjct  316   KGKEKVWEEIVRENELQPTKLAEVGVWWFVDVWLSGE-GLLCSMNKSKEHGFLGFRNSRN  374

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  +I+P
Sbjct  375   SFVTWIDKMKAFQIVP  390



>dbj|BAH47641.1| progesterone 5beta reductase-B [Nicotiana tabacum]
Length=388

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 216/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    QSVALIIGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNADHPID-YIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ +VTHVF++       E EN  +N  M  NVL  +  +  +   H+ +
Sbjct  85    PEDTQSKLSLLT-DVTHVFYVTWASRSTEVENCEINGKMFQNVLSVIIPNCPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H+ PF ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYLGP-----FELYGKVAHDFPFHEDLPRLDAPNFYYTLEDVLFKEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  W+ + D SDA L+AE
Sbjct  198   SVHRPGTIFGFSPYSLMNIVGTLCVYAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN  NGDVF WK  W++  + F +E   F+E       +AE MKD
Sbjct  258   HQIWAAVDPYAKNEAFNVRNGDVFKWKHFWKVLAEQFGVEAAEFDEV--NRCTLAEMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L   ++E++  +  +  +L      + +MNKSKE GFLG+ ++ K+ 
Sbjct  316   KGPVWDEIVKENGLTPAKLEDVGVWWFVDLILAGDCP-LDTMNKSKEHGFLGFRNSQKAF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  375   ISWIDKVKAYKVVP  388



>ref|XP_008393756.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/379 (41%), Positives = 218/379 (58%), Gaps = 10/379 (3%)
 Frame = -2

Query  1401  QENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMT  1222
             Q    ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+ 
Sbjct  21    QPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPI-EYVQ  79

Query  1221  FDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl  1042
              D  + ED    LS ++ +VTH+F++       E EN  +N  ML NVL S+  +  +  
Sbjct  80    CDVSDPEDAKTKLSPLT-DVTHIFYVTWANRSTEVENCEVNGNMLRNVLESVIPNAPNLR  138

Query  1041  SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETN  862
              H+ +QTG K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  EDL+    E  
Sbjct  139   -HICLQTGGKHYLGPF----ESFGKIQPHDPPFTEDLPRLDTPNFYYTQEDLLFAEVEKK  193

Query  861   sfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDA  685
                  S+HR  +I G S  S+ N + TLCVYA ICK +G P R+PG++  W  +   SDA
Sbjct  194   EDLTWSVHRPDMIFGFSPYSMMNIVGTLCVYAAICKHEGLPLRFPGSKAAWNSYSVASDA  253

Query  684   RLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIA  505
              L+AE  IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   +A
Sbjct  254   DLIAEHHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGGR-LRLA  312

Query  504   EFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYAD  325
             E MK K  +W  IV+++ L  T++EE+  +  +  VL  +   + S+NKSKE GF+G+ +
Sbjct  313   ERMKGKEGVWEEIVRENELKETKLEEVGVWWFVDVVLGGE-GLISSVNKSKEHGFVGFRN  371

Query  324   TLKSIRVWVQKLREMKIIP  268
             +  S   W+ K++  KI+P
Sbjct  372   SRNSFVTWIDKMKSFKIVP  390



>ref|XP_010277137.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=390

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 223/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP PSW    +  EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLNDTPGGPWKVYGVARRPRPSWH-VDYPIEYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ++T   LS ++ +VTH+F++     + E  N  +N  ML NVLR++  +  +   H+ +
Sbjct  85    PDETLAKLSPLT-DVTHLFYVTWTNRQSESANCEINGAMLRNVLRAVIPNAPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+G       +  K+  ++ P+ ED PRL  PNFYY LED++    E       
Sbjct  143   QTGRKHYIGSF----ESLGKIQTYDPPYHEDLPRLDAPNFYYTLEDILFEEVEKKEDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR   I G S  S  N + TLCVYATICK +G   R+PG+R  WE + + SDA ++AE
Sbjct  199   SIHRPGTIFGFSPYSQMNIVGTLCVYATICKHEGKLLRFPGSREVWEGYSNASDADMIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC+NGDVF WK +W++  + F +E   FEE  ++   + E MKD
Sbjct  259   HQIWASVDPHAKNEAFNCSNGDVFKWKHLWKVLGEQFGVECAEFEE--ERGLSLEEMMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV  + L  +++EEI  +  +  VL  +  ++ +MNKSKE GFLG+ ++  + 
Sbjct  317   KGAVWDEIVNDNGLVPSKLEEIGFWWFVDIVLGAKDTYLDNMNKSKEHGFLGFRNSTNAF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   ISWIDKMKAFKIVP  390



>ref|XP_009137807.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY34267.1| BnaA01g13700D [Brassica napus]
Length=390

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 221/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++       E EN   N TML NVLR++     +   HV +
Sbjct  85    PDDVRSKLSPLT-DVTHVFYVTWTNRSTERENCEANGTMLRNVLRAVVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  D  L T K   H+ PF ED PRL   NFYYALED L     +  S ++
Sbjct  143   QTGTKHYIGPFKD--LETTKY--HDPPFTEDMPRLGVENFYYALEDVLFEEIKKKESVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGTKLIFPGSKKAWEGFSTASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N DVF WK +W++  + F +E   FEE G     + E MK 
Sbjct  259   QQIWAAVDPYAKNEAFNCNNDDVFKWKHLWKVLAEQFGIEEYGFEE-GRNVGGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK++ L   +++E+  +  +  +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  318   KESVWEEMVKENGLAEKKLDEVGVWWFVDVILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_006471787.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=399

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/377 (40%), Positives = 219/377 (58%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LVIG TG+VG ++ E L +    GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  31    QHVGLVIGVTGIVGNSLAEILPRQDTPGGPWKVYGVARRPRPDWNTDHPI-EYIQCDVSD  89

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   L+K++ +VTH+F++       E EN  +N  ML NVLRS+  +  +   HV +
Sbjct  90    QDDTQAKLTKLT-DVTHIFYVTWASRPTEAENCEVNGAMLRNVLRSVIPNAPNLR-HVCL  147

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP      +  K+ PH+ PF ED PRL   NFYY  ED++    E      S
Sbjct  148   QTGGKHYVGPF----ESFGKIRPHDTPFTEDLPRLNVTNFYYTQEDILFEEVEKRKGPLS  203

Query  846   ihrssiiI----GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
             +  S        G S  S+ N + TLCVYA ICK +G P  +PG++  WE +   SDA L
Sbjct  204   LTWSVHRPHIIFGFSPYSMMNVVGTLCVYAAICKHEGVPLLFPGSKDCWEGYSVASDADL  263

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AEQQIWA V   A+N+AFNC+NGDVF WK +W++  + FE+E     + G++   + E 
Sbjct  264   IAEQQIWAAVDPYARNEAFNCSNGDVFKWKHLWKVLAEQFEIENYGLPQEGER-VRLEEI  322

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             M+ K  +W  IVK+++L  T++ E+  +     +L   F  + SMNKSKE GFLG+ ++ 
Sbjct  323   MRGKEGVWEQIVKENQLQLTKLSEVAVWWFADMMLDGGFLLLDSMNKSKEHGFLGFRNSK  382

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ K++  +I+P
Sbjct  383   NSFVNWIDKMKTYRIVP  399



>ref|XP_006432505.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
 gb|ESR45745.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
Length=393

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 213/377 (56%), Gaps = 13/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + V LV+G TG+VG ++ E L +    GGPWK+YG ARRP P+W     +D Y+  D  +
Sbjct  26    QNVGLVVGVTGIVGNSLAEILPRSDTPGGPWKIYGVARRPRPNWNAKYPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LSK++ +VTH+F++       E EN ++N  M  NVLRS+  +  +   H+ +
Sbjct  85    PDDTQAKLSKLA-DVTHIFYVTWASRPTEAENCQINGAMFRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP         K+  H+ PF ED PRL    FYY  ED+  ++ E +     
Sbjct  143   QTGGKHYVGPF----ECIGKIPSHDPPFTEDLPRLNVSLFYYNQEDI--LFEEVDKRRGL  196

Query  846   ihrssiiIGA---SSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                     G    S  S+ N + TLCVYA ICK +G P  + G R  WE F + SDA L+
Sbjct  197   TWSIHRPSGIFGFSPHSLMNIIGTLCVYAAICKHEGAPLVFHGTRDAWEGFQEFSDAELV  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAF-EENGDKEFDIAEF  499
             AEQ+IW  V   A+N+AFNCTNGDVF WK +W++  + FE+E   F EE G +   + E 
Sbjct  257   AEQEIWGAVDPNARNEAFNCTNGDVFKWKHLWKVLAEQFEIENYGFGEEMGSERVRLEEV  316

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             MK K   W  IV++++L  T++ E+  +     VL     +  SMNKSKE GFLG+ ++ 
Sbjct  317   MKGKESAWEEIVRENQLQPTKLNEVAVWSYADVVLNIGAGYFVSMNKSKEHGFLGFRNSK  376

Query  318   KSIRVWVQKLREMKIIP  268
              S   W+ +L+  +I+P
Sbjct  377   NSFITWINRLKSHRIVP  393



>ref|XP_010521424.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=389

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 217/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  27    QSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPQPSWNADHPID-YIQCDVSD  85

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTH+F++A      E EN   N+ ML NVLR++     +   HV +
Sbjct  86    TDDVRCKLSPLT-DVTHIFFVAWTNRGSEPENCETNAGMLRNVLRAIVPHAPNLR-HVCL  143

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP      A      H+ PF ED PRLP  NFYY LED++    E       
Sbjct  144   QTGAKHYIGP-----FANRGGSYHDPPFTEDLPRLPIQNFYYTLEDVLFEEVEKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S  N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSQMNMVGTLCVYAAICKHEGSPLLFPGSKTAWEGFAVSSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   A N+AFNC+NGDVF WK +W++  + F +E   FEE   K   + + M+ 
Sbjct  259   QQIWAAVDPYAGNEAFNCSNGDVFKWKHMWKVLAEQFGIEEFGFEEG--KNVGLGKMMEG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K   W  IVK+++L +T+MEE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KXXXWEEIVKENQLKKTKMEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSKNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAYKIVP  389



>gb|AAO63776.1| unknown [Populus tremuloides]
Length=391

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 224/374 (60%), Gaps = 11/374 (3%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +VAL++G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N 
Sbjct  27    SVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNEDHPV-EYIQCDISNT  85

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              +T   LSK++ +VTHVF++       EEEN  +N  M  NVL+++  + ++   HV +Q
Sbjct  86    AETQSKLSKLT-DVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVIPNAANLR-HVCLQ  143

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRL-PFPNFYYALEDLV-AIYAETNsfsf  850
             TG KQY+GP         K+  H+ PF ED PRL  FPNFYY LED++    A+    ++
Sbjct  144   TGGKQYVGPF----ALLGKIEAHDPPFTEDLPRLNDFPNFYYTLEDVMYEEVAKKEGVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  II G S  S+ N ++T+ VYA ICK +G P  +PG +  W  +   SDA L+AE
Sbjct  200   SVHRPDIIFGFSPHSLMNLIVTISVYAAICKHEGAPLIFPGTKEAWNGYAIASDANLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V  KAKN+AFN  NGD+F WK +W +    F +E   F E G+     AE MKD
Sbjct  260   HEIWACVEPKAKNEAFNINNGDLFKWKHMWTVLAQEFGIEKYGFVE-GESSVTFAEKMKD  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVKK++L   ++E++  +     ++     +V SMNK+KE GFLG+ ++ KS 
Sbjct  319   KGPVWEEIVKKNQLLSNKLEQVGGW-WFGDLIFSGSGYVASMNKAKEHGFLGFRNSKKSF  377

Query  309   RVWVQKLREMKIIP  268
               W+ K+R  K++P
Sbjct  378   VSWIHKMRAYKVVP  391



>gb|AHZ44508.1| putative progesterone 5 beta-reductase [Stellaria media]
Length=390

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/378 (42%), Positives = 219/378 (58%), Gaps = 19/378 (5%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L++G TG+VG ++ E L      GGPWKVYG ARRP P W      D  + +   +
Sbjct  27    QSVGLIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPEWN----TDHPIQYIQCD  82

Query  1206  FEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHV  1033
               D   +LSK+S   +VTH+F++       E EN R N +ML NVL+++  +  +   HV
Sbjct  83    VSDPDDALSKLSPLTDVTHIFYVTWTTKSSEIENCRANVSMLRNVLQAVIPNAPNIQ-HV  141

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfs  853
              +QTG K Y+GP FD   +  K+ PHE PF ED PRLP PNFYY LED  A++ E     
Sbjct  142   CLQTGAKHYVGP-FD---SFGKIQPHEPPFTEDMPRLPVPNFYYDLED--ALFEEVQKKE  195

Query  852   f---sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
                 S+HR + I G S  S+ N + +LCVYA ICK +G P  +PG +  WE F   SDA 
Sbjct  196   GVTWSVHRPTTIFGFSPYSLMNIVGSLCVYAAICKYEGKPLVFPGTKAAWEGFAVASDAD  255

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             L+AEQ+IWA V   AKN+AFNC NGDVF WK +W+   + F +E   FEE   K   +  
Sbjct  256   LIAEQRIWASVDPFAKNEAFNCNNGDVFKWKHLWKSLAEQFGIEDYGFEEG--KNVGLKT  313

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              M  K  +W  IV+K++L  T+++E+  +  +  +L  +   + SMNKSKE GF G+ + 
Sbjct  314   MMDGKQSVWEEIVRKNQLQETKLDEVGSWWFVDIILGVE-GALDSMNKSKEHGFAGFRNP  372

Query  321   LKSIRVWVQKLREMKIIP  268
               S   W+ K +  KI+P
Sbjct  373   KNSFVSWIDKCKAFKIVP  390



>gb|ADG56546.1| progesterone 5-beta-reductase [Gomphocarpus fruticosus]
Length=388

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 218/374 (58%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  27    QSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI-EYVQCDIAN  85

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT + LSK++ +VTHVF++       E EN  +N  ML NVL  L  +      HV +
Sbjct  86    REDTEEKLSKLT-DVTHVFYVTWANKSNEIENCEVNGKMLKNVLDVLVPNCPKLQ-HVCL  143

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y GP           + HE PF ED PRL  PNFYY LED L     +    ++
Sbjct  144   QTGGKHYCGP-----FELYGKVGHEPPFTEDLPRLDVPNFYYTLEDVLFEAVGKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK  G P ++PG +  WE +   SDA L+AE
Sbjct  199   SVHRPGNIFGFSPYSLMNLVGTLCVYAAICKHDGVPLKFPGCKEAWEGYSVCSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F++E   +E  G+K   + + MKD
Sbjct  259   HQIWAAVDPFAKNEAFNVSNGDVFKWKHFWKVLAEQFDVECGEYE--GEK-LSLEDMMKD  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV ++ L  T++EE+  +      L ++   + SMNKSKE GFLG+ ++  + 
Sbjct  316   KGGVWDEIVAENGLAPTKLEEVGLWWFGDICLGYECA-LMSMNKSKEHGFLGFRNSKNAF  374

Query  309   RVWVQKLREMKIIP  268
               W++K++  KI+P
Sbjct  375   ISWIEKMKAYKIVP  388



>ref|XP_007223050.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
 gb|EMJ24249.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
Length=389

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 215/374 (57%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+V LVIG TG+VG ++ E L      GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  28    KSVGLVIGVTGLVGNSLAEILPLHDTPGGPWKVYGVARRPRPDWSVDHTV-EYIQCDISD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS++++ VTH+F++       E +N   N  +L NVL S+  +  +   HV +
Sbjct  87    PIDAQTKLSQLTD-VTHIFYVTWTSRSTEADNCEANGALLRNVLSSVIPNAPNLS-HVCL  144

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK Y GP+     A  K+ PH+ P  ED PRL  P FYY LED++    E       
Sbjct  145   QTGTKHYDGPL----EAYGKVAPHDTPSTEDLPRLNVPLFYYTLEDVLFEEVEKKEGLTW  200

Query  846   ihrssiiIGASSLSVFNSLLT-LCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
                   +I   S  V  S+++ LC YA ICK +G P R+PG++  W+ + + SDA L+AE
Sbjct  201   SVHRPGLIFGFSPYVMLSIVSMLCAYAAICKHEGLPLRFPGSKAGWDSYSEASDADLIAE  260

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFN  NGDVF WK +W++  + FE+E   F+E     F + E M+D
Sbjct  261   QQIWAAVDPYAKNEAFNINNGDVFRWKQLWKVLAEEFEIEEYGFDEG----FSLVEMMRD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV +++L   ++EE+  +  ++ VL    + + SMNK+KE GF G+ +T  S 
Sbjct  317   KGGVWEEIVGENQLRHAKLEEVGLWEVVEVVLGGGAE-LSSMNKNKEHGFCGFRNTRNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   VYWIDKMKAHKIVP  389



>ref|XP_008447374.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Cucumis 
melo]
Length=393

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 154/376 (41%), Positives = 220/376 (59%), Gaps = 11/376 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALVIG TG+VG ++ E L      GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  26    ESVALVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPVWNADHPI-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS+++ +VTH+F++      +E +N   N  ML NVLRS+  +  +   H+ +
Sbjct  85    PQDAETKLSQLA-DVTHLFYVTWTNRTIEIDNCEANVEMLRNVLRSVIPNAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+G     S+       HE PF ED PRL  PNFYY  EDL+    E +     
Sbjct  143   QTGTKHYVGSF--ESVINKSSQRHEPPFTEDLPRLECPNFYYKQEDLLFEEIEQSQKKDL  200

Query  849   --sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
               ++ R ++I G S  S+ N + TLCVYA ICK +G P ++PG +  WE F   SDA L+
Sbjct  201   TWAVIRPNVIFGFSPFSLMNIVGTLCVYAAICKHEGRPLKFPGTKLAWEDFQAASDADLV  260

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IW  V   +KN+AFNC NGDVF WK  W++  + F +E   FEE   +   + + M
Sbjct  261   AEQHIWTAVDPYSKNEAFNCNNGDVFKWKHFWKVLAEQFNIEEYGFEEG--ERLTLVDLM  318

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDK ++W  IVK+++L  T++EEI  +  +  +      ++ SMNKSKE GFLG+ ++  
Sbjct  319   KDKSDVWDEIVKENQLQPTKLEEIGNWWYVDVIFSVS-GNIDSMNKSKEHGFLGFRNSKN  377

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  378   SFISWIDKIKAFKIVP  393



>emb|CDY03474.1| BnaC01g16080D [Brassica napus]
Length=389

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 222/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++       E EN   N +ML NVLR++  +  +   HV +
Sbjct  85    PDDVRSKLSPLT-DVTHVFYVTWTNRSSEGENCEANGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  D  L T +   H+ PF ED PRL   NFYYALED L     +  S ++
Sbjct  143   QTGTKHYIGPFKD--LETTRY--HDPPFTEDMPRLGVENFYYALEDVLFEEIKKKESVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGTKLSFPGSKKAWEGFSTASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N DVF WK +W++  + F +E   FEE   K   + E MK 
Sbjct  259   QQIWAAVDPYAKNEAFNCNNDDVFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   ++ E+  +  +  +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KESVWEEMVKENQLQEKKLGEVGVWWFVDVILGVE-GMIDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>ref|XP_010059860.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Eucalyptus 
grandis]
 gb|KCW66304.1| hypothetical protein EUGRSUZ_F00129 [Eucalyptus grandis]
Length=392

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 158/387 (41%), Positives = 228/387 (59%), Gaps = 15/387 (4%)
 Frame = -2

Query  1413  KKMGQENCSK---AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             K++ +E   K   +V L++G TG+VG ++ E L      GGPWKVYG ARRP P+W    
Sbjct  14    KRIDEEEAPKGFQSVGLILGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  D    LS ++ +VTHVF++       EEEN R+N  M  N L++L 
Sbjct  74    PI-EYIQCDLADEADAQAKLSPLT-DVTHVFYVTWANLSSEEENCRVNGAMFRNALQALV  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-L  886
              +  +   HV +QTGTK Y+GP      A  K+ PH+ PF ED PRL  PNFYY LED L
Sbjct  132   PNAPNLR-HVCLQTGTKHYLGPF----EAYGKVTPHDPPFTEDLPRLDAPNFYYTLEDIL  186

Query  885   VAIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 A+ +  S+S+HR  +I G S  S+ N + +LC YA ICK +G P  +PG +  W+ 
Sbjct  187   FEETAKKDDVSWSVHRPPVIFGFSPYSLMNIIGSLCAYAAICKHEGVPLMFPGTKEAWDC  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             +    DA L+AEQ IWA V   A+N+AFNC+NGDVF WK  W++  + F +E   F+E G
Sbjct  247   YSAAGDADLIAEQHIWAAVDPYARNEAFNCSNGDVFKWKHFWKVLAEQFGIEEYGFDEGG  306

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC-SMNKSKE  349
              +   + E MK K ++W  IV++++L  T++EE+  +  +   L F    +  SMNKSKE
Sbjct  307   PR-LRLTEAMKGKEKVWEEIVRENQLQETKLEEVGLWWFVD--LMFDGPALLDSMNKSKE  363

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GFLG+ ++  S   W+ K++  KI+P
Sbjct  364   HGFLGFRNSKNSFLSWIDKVKGYKIVP  390



>gb|AFZ41796.1| putative progesterone 5-beta-reductase [Sisymbrium officinale]
Length=388

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 220/374 (59%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++       E +N   N +ML NVLR++  +  +   HV +
Sbjct  85    AEDVRSKLSPLT-DVTHVFYVTWTNRSSESDNCEANGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP      +  +   H+ PF ED PRL   NFYY LED L     +  S ++
Sbjct  143   QTGTKHYIGP-----FSNLEKSHHDPPFTEDMPRLQIQNFYYTLEDVLFEEIKKKESVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR ++I G S  S+ N + TLCVYA ICK++G    +PG++  WE F   SDA L+AE
Sbjct  198   SVHRPNMIFGFSPYSLMNIVGTLCVYAAICKQEGSKLIFPGSKKAWEGFMTASDADLVAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L    ++E++ +      L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQEKNLDEVSAWSFADIALGVEGM-IDSMNKSKEHGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>ref|XP_009354120.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 220/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W  +  L EY+  D  +
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNW-NADHLVEYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D   +LS ++ +VTH+F++       E EN  +N  ML NVL S+  +      H+ +
Sbjct  85    PDDAKANLSPLT-DVTHIFYVTWTNRSTEAENCEVNGNMLRNVLDSVIPNAPKLS-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  EDL+    E       
Sbjct  143   QTGAKHYVGPF----ESFGKIQPHDPPFTEDLPRLDAPNFYYTQEDLLFAEVEKKEDLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYATICK +G P ++PG+   W  +   SDA L+AE
Sbjct  199   SVHRPETIFGFSPSSLMNIVGTLCVYATICKHEGLPLKFPGSSAAWNCYSVASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFN  NGDVF WK  W++  + F +E    EE G +   +AE MK 
Sbjct  259   QQIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIEEGGGR-LSLAERMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IV+++ L  TR+EE+  +  +  +L  +   +CSMNKSKE GF+G+ ++  S 
Sbjct  318   KEGVWEEIVRENELQATRLEEVGVWWFVDAMLGGE-SMICSMNKSKEHGFVGFRNSRNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  377   VTWIDKMKSFKIVP  390



>gb|AEY82380.1| putative progesterone 5-beta-reductase [Lunaria annua]
Length=389

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 220/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++       E ++   N +ML NVLR++  +  +   HV +
Sbjct  85    ADDARSKLSPLT-DVTHVFYVTWTNRPSEHDSCEANGSMLRNVLRAIVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD      K   H+ PF ED PRL   NFYY LED L     +    S+
Sbjct  143   QTGTKHYLGP-FD---NLGKSQHHDPPFTEDMPRLQIQNFYYTLEDILFEEIKKKEGVSW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  199   SIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLVFPGSKKAWEGFTAASDADLVAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + + MK 
Sbjct  259   QQIWAAVDPYAKNEAFNCNNADIFKWKHMWKVLAEQFGIEEYGFEEG--KNLGLVQMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   R+EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KERVWEEMVKENQLQERRLEEVGVWWFADVILGGEGM-IDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               WV K +  KI+P
Sbjct  376   SSWVDKYKAFKIVP  389



>ref|XP_008356369.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=391

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 222/374 (59%), Gaps = 9/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  +
Sbjct  26    QSVALVLGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNADHPV-EYIQCDLSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                TH  LS+++ +VTHVF++       E EN  +N  M  N+L ++ S+  +   H+ +
Sbjct  85    PHQTHSQLSQLT-DVTHVFYVTWASKPTEAENCEVNGNMFRNLLDAVISNAPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP         K+ PHE PF ED PRL  PNFYY LED L     +    ++
Sbjct  143   QTGRKHYIGPF----EILGKVEPHEPPFHEDLPRLDVPNFYYTLEDILFEEVKKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR S+I   S  S+ N + +LC+YA ICK +G   R+ G+R  W  + D+SDA L+AE
Sbjct  199   SVHRPSVIFXFSPYSLMNIVGSLCIYAAICKHEGKKLRFTGSRGAWNGYWDVSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC+NGDV  WK ++R+  + FEL+     E G  E  + E MKD
Sbjct  259   HQIWAAVDPYAKNEAFNCSNGDVVKWKHLFRVLAEQFELDIEDVGEEGGSEASLEEMMKD  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK+  L  T++EE+  +  +  +   +   + SMNKSKE GF+G+ ++  S 
Sbjct  319   KGPVWDEIVKEKGLVPTKLEEVGNWWFVDLMFGVE-TSLDSMNKSKEHGFVGFRNSKTSF  377

Query  309   RVWVQKLREMKIIP  268
               W+ +++  +++P
Sbjct  378   LTWIDRMKSYRLVP  391



>gb|AEO36947.1| progesterone 5beta-reductase [Erysimum caboverdeanum]
Length=390

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 220/375 (59%), Gaps = 12/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS ++ +V HVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEEARSKLSPLT-DVIHVFYVTWTKRESECENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYVGPFSNLGGGPR----HDPPFTEDMPRLHIQNFYYTQEDILFEEIKKKEISVT  198

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  199   WSVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIA  258

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V + AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  259   EQQIWAAVDQYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMK  316

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  317   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  375

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  376   FISWIDKYKAFKIVP  390



>ref|XP_002869731.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45990.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N +ML NVLR++  +  +   HV +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTNRESESENCEANGSMLRNVLRAIVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED L     +  + ++
Sbjct  143   QTGTKHYVGPFSNLDGPR-----HDPPFTEDMPRLQIQNFYYTQEDVLFDEIKKIETVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             +IHR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   TIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   ++EE+  +     +L      + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQEKKLEEVGVWWFADVILGVD-GLIDSMNKSKEHGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAFKIVP  388



>gb|EPS65468.1| progesterone 5-beta-reductase [Genlisea aurea]
Length=390

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 225/386 (58%), Gaps = 13/386 (3%)
 Frame = -2

Query  1413  KKMGQENCS---KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ +++     ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P W   +
Sbjct  14    KKLDEDDAPPKHQSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPPWNEDN  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              +  Y+  D  + EDT   LS +S +VTH+F+        E EN  +NS M  NVL  + 
Sbjct  74    PI-TYIQCDVSDPEDTQAKLSPLS-DVTHLFYATWANKSTEAENCEINSRMFQNVLDCII  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-L  886
              S  S   H+ + TG K Y+GP      +  K+ PH+ PF ED PRL   NFYY LED L
Sbjct  132   PSSPSLK-HICLVTGRKHYIGPF----ESFGKIEPHDPPFTEDLPRLDHINFYYDLEDIL  186

Query  885   VAIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                  +    ++S+HR   I G S  S+ N + TLCVY  ICK +G P R+PG +  WE 
Sbjct  187   FEQVKKKEGLTWSVHRPGTIFGFSPHSMMNIVGTLCVYTAICKHEGVPLRFPGVKAAWEG  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             + D SD+ L+AE QIWA V   AKN+AFN +NGDVF WK +W++  D F +E   F E G
Sbjct  247   YSDCSDSDLIAEHQIWAAVDPYAKNEAFNVSNGDVFKWKHLWKVLADQFGVENGGFVEEG  306

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             ++   +A+ MKDKG +W  IV+++ L    ++++  +  +  +L  +   + SMNKSKE 
Sbjct  307   ERA-TLADLMKDKGPVWDEIVRENGLLPCELKDVGLWWFVDLMLGGE-ALLDSMNKSKEH  364

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++  S   W+ K+R  KI+P
Sbjct  365   GFLGFRNSKNSFASWIDKVRAYKIVP  390



>gb|AEO36948.1| progesterone 5beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 219/375 (58%), Gaps = 13/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  N
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS ++ +VTHVF++     E E EN   N +ML NVL+++     +   H+ +
Sbjct  85    AEDARSKLSPLT-DVTHVFYVTWTKRESESENCEANGSMLRNVLQAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsfs  853
             QTGTK Y+GP  +          H+ PF ED PRL   NFYY  ED++   I  +  S +
Sbjct  143   QTGTKHYLGPFSNLDGPR-----HDPPFTEDMPRLQIQNFYYTQEDILFEEIKKKEISVT  197

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR + I G S  S+ N + TLCVYA ICK +  P  +PG++  WE F   SDA L+A
Sbjct  198   WSIHRPNTIFGFSPYSLMNIVGTLCVYAAICKHERSPLLFPGSKKAWEGFTTASDADLIA  257

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F ++   FEE   K   + E MK
Sbjct  258   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIDQYGFEEG--KNLGLVEMMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  316   GKERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  375   FISWIDKYKAFKIVP  389



>ref|XP_004248770.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
lycopersicum]
Length=385

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 224/374 (60%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++   L      GGPWKVYG ARRP P W  +  + EY+  D  N
Sbjct  23    QSVALIIGVTGIVGNSLAAILPCADTPGGPWKVYGVARRPRPPWNVNDPI-EYIQCDISN  81

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   L+ ++ ++THVF++       E EN  +N  ML NVL ++  +  +   H+ +
Sbjct  82    REETQSRLTLLT-DITHVFYVTWANRPTEVENCEINGKMLQNVLDAIIPNCPNLC-HICL  139

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y G     S      I H+ P+ E  PRLP PNFYY LED L     +    ++
Sbjct  140   QTGLKHYHG-----SFELFGKIAHDTPYHEGLPRLPVPNFYYTLEDILFEEVKKKEGLTW  194

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR  +I G S  S+ N + TLCVYA ICK +G P R+PG++  W+ +   SDA L+AE
Sbjct  195   SIHRPGLIFGFSPYSMMNIIGTLCVYAAICKHEGLPLRFPGSKCGWDGYSICSDADLIAE  254

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IWA V   AKN+AFN +NGDVF WK +W++    FE+E   F+EN  K + + E MKD
Sbjct  255   QHIWASVDPNAKNEAFNISNGDVFHWKHLWKVLGKEFEVEIEEFDEN--KRWRLEEMMKD  312

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG+IW  IV+++ L  +++EEI  +  +  VL  +   + +MNKSKE GFLG+ ++  + 
Sbjct  313   KGKIWDEIVEENGLVESKLEEIGGWWFVDLVLNEECP-LDTMNKSKEHGFLGFRNSKNAF  371

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  372   ISWIYKIKASKIVP  385



>ref|XP_008360976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/379 (41%), Positives = 216/379 (57%), Gaps = 10/379 (3%)
 Frame = -2

Query  1401  QENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMT  1222
             Q    ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+ 
Sbjct  21    QPRAPESVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWSADHPI-EYVQ  79

Query  1221  FDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl  1042
              D  + ED    LS ++ +VTH+F++       E EN  +N  ML NVL S+  +  +  
Sbjct  80    CDVSDPEDAKTKLSPLT-DVTHIFYVTWANRSTEVENCEVNGNMLRNVLESVIPNAPNLR  138

Query  1041  SHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETN  862
              H+ +QTG K Y+GP      +  K+ PH+ PF ED PRL  PNFYY  EDL+    E  
Sbjct  139   -HICLQTGGKHYLGPF----ESFGKIQPHDPPFTEDLPRLDTPNFYYTQEDLLFAEVEKK  193

Query  861   sfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDA  685
                  S+HR  +I G S  S+ N + TLCVYA ICK +G P R+PG++  W  +   SDA
Sbjct  194   EDLTWSVHRPDMIFGFSPYSMMNIVGTLCVYAAICKHEGLPLRFPGSKAAWNSYSVASDA  253

Query  684   RLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIA  505
              L+AE  IWA V   AKN+AFN  NGDVF WK  W++  + F +E    +E G +   +A
Sbjct  254   DLIAEHHIWAAVDPYAKNEAFNINNGDVFKWKHFWKVLAEQFGIEEYGIDEGGGR-LRLA  312

Query  504   EFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYAD  325
             E MK K  +W  IV+++ L  T++EE+  +  +  VL  +     S NKSKE GF+G+ +
Sbjct  313   ERMKGKEGVWEEIVRENELKETKLEEVGVWWFVDVVLGGE-GLXSSXNKSKEHGFVGFRN  371

Query  324   TLKSIRVWVQKLREMKIIP  268
             +  S   W+ K++  KI+P
Sbjct  372   SRNSFVTWIDKMKSFKIVP  390



>ref|XP_006387765.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
 gb|ERP46679.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
Length=388

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 232/385 (60%), Gaps = 14/385 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK   +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  14    KKPAVQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  72

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+  + SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  73    EYIQCD---ISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  129

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV +QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  130   IATNLR-HVCLQTGTKNYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  184

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK +G P  +PG +  W  +
Sbjct  185   EEVAKKEGVTWSVHRPDIIFGFSPYSLMNIIVTLSVYAAICKHEGAPLMFPGTKEAWNCY  244

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G+
Sbjct  245   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGGE  304

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             +E  +AE MKDKG +W  IVKK++L  T++EE+  +  + T+L      +  MNKSKE G
Sbjct  305   RE-TLAERMKDKGPVWEEIVKKNQLSPTKLEEVGGWWFVDTMLSGD-AFISCMNKSKEHG  362

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ K+R  KIIP
Sbjct  363   FLGFRNSTKSFVHWIGKMRSQKIIP  387



>gb|ABK96579.1| unknown [Populus trichocarpa x Populus deltoides]
Length=388

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 231/385 (60%), Gaps = 14/385 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK   +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  14    KKPAVQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  72

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+  + SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  73    EYIQCD---ISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  129

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV++QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  130   IATNLR-HVSLQTGTKHYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  184

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK  G P  +PG +  W  +
Sbjct  185   EEVAKKEGVTWSVHRPDIIFGFSPHSLMNIIVTLSVYAAICKHVGAPLMFPGTKEAWNCY  244

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G 
Sbjct  245   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGG-  303

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             K   +AE MKDKG +W  IVKK++LF T++EE+  +  + T+L      +  MNKSKE G
Sbjct  304   KRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWWYVDTMLSGD-AFISCMNKSKEHG  362

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ K+R  K+IP
Sbjct  363   FLGFRNSTKSFVHWIGKMRSQKVIP  387



>emb|CDP01226.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/381 (42%), Positives = 224/381 (59%), Gaps = 42/381 (11%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD---EYMTFD  1216
             ++VALV G TG++G ++ E L      GGPWKVYG ARRP PSW     LD   +Y+  D
Sbjct  24    QSVALVAGVTGIIGNSLAEILPLSDTPGGPWKVYGVARRPRPSWS----LDHPVQYIQCD  79

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
              LN +D    LS ++ ++TH+FW+       E E I++N  M  NVL ++  +  +   H
Sbjct  80    VLNADDARAKLSPLT-DITHIFWVTWANRPSEAECIQVNDAMFLNVLNAVVPNAPNLT-H  137

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNs  859
             + +QTG K Y+GP      +  K+ PHE PF ED PRLP PNFYY+LED L     +   
Sbjct  138   ICLQTGHKHYIGPF----ESLGKIKPHETPFVEDVPRLPVPNFYYSLEDILFETCKKKQG  193

Query  858   fsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
              ++S+HR+++I G S  S+ N + T+CVYA +CK +  PF++PG +  W  +   SDA L
Sbjct  194   LTWSVHRAAVIFGFSPYSMMNVIGTICVYAAMCKHEKVPFKFPGTKAAWNCYSVASDADL  253

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEF-DIAE  502
             +AE QIWA V   AKN+AFNCTNGD+F W+ +W++  + FELE+V  +EN  +EF  ++E
Sbjct  254   IAEHQIWAAVDPYAKNEAFNCTNGDLFKWRQLWKVLAEEFELEYVEVDEN--EEFVSMSE  311

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC---SMNKSKELGFLGY  331
             +MKDKG +                  TC+ A        F   C   SMNKSKE GFLG+
Sbjct  312   WMKDKGPV-----------------TTCWFA-----DVIFSGECMLDSMNKSKEHGFLGF  349

Query  330   ADTLKSIRVWVQKLREMKIIP  268
              +T KS+   + K+R  KI+P
Sbjct  350   RNTTKSVISVIDKMRAHKIVP  370



>ref|XP_004499012.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cicer 
arietinum]
Length=389

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 151/374 (40%), Positives = 223/374 (60%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W  ++ +  Y+  D  N
Sbjct  26    KNVALIIGVTGIVGNSLAEILPLNDTPGGPWKVYGVARRPRPTWNANNPV-HYIQCDVSN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS ++ +VTH+F+++      E +N  +N +ML NVLR+L  +  +   H+++
Sbjct  85    QNDVELKLSPLT-DVTHIFYVSWTSRPTEAQNSDVNGSMLRNVLRALIPNAPNLR-HISL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+G          K+  H++PF ED PRL   NFYY  ED L     +    ++
Sbjct  143   QTGAKHYVGSF----ETIGKIKGHDSPFTEDLPRLDILNFYYTQEDILFQEVGKKKGMTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
              I+R  +I G S  S+ N + TLCVYA ICK +  P ++PG++  WE +   SDA L+AE
Sbjct  199   FINRPQVIFGFSPYSMMNLIGTLCVYAAICKHECVPLKFPGSKAAWEGYSTASDANLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IW  V  KAKNQAFNC+NGDVF WK  W++  D F +E   FE+  D  F +++ MKD
Sbjct  259   QHIWGAVDPKAKNQAFNCSNGDVFKWKHFWKVLADKFGIENYGFEDGSD--FKLSDMMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+ + L   ++EE+  +  +  +LR +   + +MNK+K+ GFLG+ ++ +S 
Sbjct  317   KGGVWEDIVRDNGLLPNKLEEVGDWWFVDFMLRVE-GVLDTMNKAKQHGFLGFRNSKESF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKTKAYKIVP  389



>gb|AHZ44504.1| putative progesterone 5 beta-reductase [Cochlearia officinalis]
Length=389

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 218/374 (58%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNSDHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +++ VTHVF++     E E EN   N +ML NVLR++     + + HV +
Sbjct  85    AEDARSKLSPLTD-VTHVFYVTWTKRESETENCEANGSMLRNVLRAVVPHAPNLV-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +   +      HEAPF ED PRL   NFYY+LED L     +  S ++
Sbjct  143   QTGTKHYIGPFENIGKSH-----HEAPFTEDLPRLQVANFYYSLEDVLFEEIKKRESLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR + I G S  S+ N +  LCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNSIFGFSPYSMINIVGALCVYAAICKHEGAPLVFPGSKEAWEGFTTASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   F E G +   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHMWKVLAEQFGIEEYGFVE-GKESVGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VKK+ L    + + + +      L      + SMNKSKE GFLG+ ++  S+
Sbjct  317   KESVWEEMVKKYELQERDVVDESVWSFADVALGV-VGLIDSMNKSKEHGFLGFRNSSNSL  375

Query  309   RVWVQKLREMKIIP  268
               WV K +  KI+P
Sbjct  376   VSWVDKYKAFKIVP  389



>ref|XP_006387764.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
 gb|ERP46678.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
Length=446

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 232/385 (60%), Gaps = 14/385 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK   +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  72    KKPAVQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  130

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+  + SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  131   EYIQCD---ISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  187

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV++QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  188   IATNLR-HVSLQTGTKHYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  242

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK +G P  +PG +  W  +
Sbjct  243   EEVAKKEGVTWSVHRPDIIFGFSPHSLMNIIVTLSVYAAICKHEGAPLMFPGTKEAWNCY  302

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G 
Sbjct  303   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGG-  361

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             K   +AE MKDKG +W  IVKK++LF T++EE+  +  + T+L      +  MNKSKE G
Sbjct  362   KRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWWYVDTMLSGD-AFISCMNKSKEHG  420

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ K+R  K+IP
Sbjct  421   FLGFRNSTKSFVHWIGKMRSQKVIP  445



>gb|AFK45113.1| unknown [Medicago truncatula]
Length=390

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 158/396 (40%), Positives = 220/396 (56%), Gaps = 33/396 (8%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARR  PSW    
Sbjct  14    KKLDEDEAPRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRSRPSWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  D    LS ++ +VTHVF +       E EN  +N  ML NVL ++ 
Sbjct  74    PV-EYIQCDITDPNDATTKLSVLT-DVTHVFCVCWASRPTEAENCEINGAMLKNVLTAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV+IQTG K Y+GP      +  K+  HE P+ ED PRL + NFYY LED+ 
Sbjct  132   PNAPNLR-HVSIQTGGKHYVGPF----ESFGKIKYHEPPYTEDMPRLDYHNFYYTLEDV-  185

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + T+CVYA ICK +G P R+PG +  W
Sbjct  186   -LFEETGKKEGVSWSVHRPLLIFGFSPYSMMNIIGTICVYAAICKHEGVPLRFPGTKLAW  244

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
              ++   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E
Sbjct  245   ANYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVIAEQFGIEEYGFDE  304

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVC------  370
              G +   + E MKDKG +W  IVK++ L  T++EE         V  + F   C      
Sbjct  305   EGPR-LKLTELMKDKGPVWDEIVKENGLQVTKLEE---------VAEWWFADACFGGNGF  354

Query  369   --SMNKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
               SMNKSKE GFLG+ +T  S+  W+ + R  KI+P
Sbjct  355   TDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>gb|ADG46028.1| putative progesterone 5-beta-reductase [Calotropis procera]
Length=387

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI-EYVQCDIAN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT + LSK++ +VTHVF++       E EN  +N  ML NVL +L  +      H+ +
Sbjct  85    REDTEEKLSKLT-DVTHVFYVTWANKSNEIENCEVNGKMLKNVLDALIPNCPKLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y GP           + HE PF ED PRL  PNFYY LED L     +    ++
Sbjct  143   QTGGKHYCGP-----FELFGKVGHEPPFTEDLPRLDVPNFYYTLEDVLFEAVGKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + T+CVYA ICK +G P ++PG +  WE +   SDA L+AE
Sbjct  198   SVHRPGNIFGFSPYSLMNLVGTICVYAAICKHEGVPLKFPGCKEAWEGYSVCSDADLMAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F++E   +E  G+K   + E MKD
Sbjct  258   HQIWAAVDPFAKNEAFNLSNGDVFKWKHFWKVLAEQFDVECAEYE--GEK-LSLEEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV ++ L  T++EE+  +      L ++   + SMNKSKE GF G+ ++  + 
Sbjct  315   KGGVWEEIVAENGLAPTKLEEVGLWWFGDICLGYECA-LMSMNKSKEHGFFGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  374   ISWIDKMKAYKIVP  387



>gb|ADG56538.1| progesterone 5-beta-reductase [Asclepias curassavica]
Length=387

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 218/374 (58%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     + EY+  D  N
Sbjct  26    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPI-EYVQCDIAN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT + LSK++ +VTHVF++       E EN  +N  ML NVL  L  +      HV +
Sbjct  85    REDTEEKLSKLT-DVTHVFYVTWANKSNEIENCEVNGKMLKNVLDVLIPNCPKLQ-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y GP           + HE PF ED PRL  PNFYY+LED L     +    ++
Sbjct  143   QTGGKHYCGP-----FELYGKVGHEPPFTEDLPRLDVPNFYYSLEDVLFEAVGKKEGLNW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G   ++PG +  WE +   SDA L+AE
Sbjct  198   SVHRPGNIFGFSPYSLMNLVGTLCVYAAICKHEGVSLKFPGCKEAWEGYSVCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F++E   +E  G+K   + E MKD
Sbjct  258   HQIWAAVDPFAKNEAFNVSNGDVFKWKHFWKVLAEQFDVECGEYE--GEK-LSLEEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV ++ L  T++EE+  +      L ++   + SMNKSKE GF G+ ++  + 
Sbjct  315   KGGVWDEIVAENGLAPTKLEEVGLWWFGDICLGYECA-LMSMNKSKEHGFFGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W++K++  KI+P
Sbjct  374   ISWIEKMKAYKIVP  387



>gb|AHI88616.2| progesterone 5-beta-reductase [Capsella bursa-pastoris]
Length=386

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 216/374 (58%), Gaps = 16/374 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  28    QSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPQPSWNADHPID-YIQCDVSD  86

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTH+F++A      E EN   N+ ML NVLR++            +
Sbjct  87    TDDVRCKLSPLT-DVTHIFFVAWTNRGSEPENCETNAGMLRNVLRAIVPHAP------NL  139

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             +TG K Y+GP F    A      H+ PF ED PRLP  NFYY LED++    E       
Sbjct  140   RTGGKHYIGPTF----ANRGGSYHDPPFTEDLPRLPIQNFYYTLEDVLFEEVEKKEGLTW  195

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S  N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  196   SVHRPNTIFGFSPYSQMNMVGTLCVYAAICKHEGSPLLFPGSKTAWEGFAVSSDADLIAE  255

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   A N+AFNC+NGDVF WK +W++  + F +E   FEE   K   + + M+ 
Sbjct  256   QQIWAAVDPYAGNEAFNCSNGDVFKWKHMWKVLAEQFGIEEFGFEEG--KNVGLGKMMEG  313

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L +T+MEE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  314   KERVWEEIVKENQLKKTKMEEVGVWWFADVILGVE-GMIDSMNKSKEHGFLGFRNSKNSF  372

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  373   ISWIDKYKAYKIVP  386



>ref|XP_007226426.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
 gb|EMJ27625.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
Length=379

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 223/376 (59%), Gaps = 13/376 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+V LVIG TG+VG ++   L Q    GGPWKVYG ARRP P W  S +  EY+  D  +
Sbjct  14    KSVGLVIGVTGIVGNSLARILPQSDTPGGPWKVYGVARRPRPHWN-SDYPMEYIQCDISD  72

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS+++ +VTH+F++       E +N   N+ M+ NVLR + ++  +   HV +
Sbjct  73    PKDTVSKLSRLT-DVTHIFYVTWASRSTEPQNCEANAAMIRNVLRVVITNAPNLC-HVCL  130

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV---AIYAETNsf  856
             QTGT+ Y GP      +  K+ P E P  ED PRL  PNFYYALED++       E  + 
Sbjct  131   QTGTRHYFGPY----ESLGKVEPQEPPCLEDLPRLNAPNFYYALEDVLFEEVGKKEDLNI  186

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N +  L VYA+ICK +  P R+PG+   W  + D+SDA L+
Sbjct  187   TWSVHRPGSIFGFSPYSLVNIVAMLSVYASICKHEKKPLRFPGSEAAWNCYSDVSDADLI  246

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQQIWA V   AKN+AFN  NGDVF WK  W +  + FE+E   F+E G   F + E M
Sbjct  247   AEQQIWAAVDPNAKNEAFNVNNGDVFKWKQFWTVLAEQFEIEEYGFDEEGGG-FSLLEMM  305

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K+K  +W  IV++++L  T++EEI  +  L  +       + SMNKSKE GFLG+ ++ K
Sbjct  306   KEKEGVWEEIVRENQLEPTKLEEIGWW--LLDLFFSGEGLMTSMNKSKEHGFLGFRNSRK  363

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K +  KI+P
Sbjct  364   SFVSWIDKNKAFKIVP  379



>ref|XP_006283899.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
 gb|EOA16797.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
Length=388

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 221/375 (59%), Gaps = 14/375 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++     E E EN   N  ML NVLR++     +   HV +
Sbjct  85    ADDARSKLSPLT-DVTHVFYVTWTNRESESENCEANGAMLRNVLRAIVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPH-EAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfs  853
             QTGTK Y+GP       +++  PH + PF ED PRL   NFYY  ED L     +  S +
Sbjct  143   QTGTKHYVGPF------SNRDGPHHDPPFTEDMPRLQIQNFYYTQEDVLFEEIKKKESVT  196

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +SIHR ++I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+A
Sbjct  197   WSIHRPNVIFGFSPYSLMNIVGTLCVYAAICKHEGSPLMFPGSKKAWEGFTTASDADLIA  256

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  257   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLMEMMK  314

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  315   GKERVWEEMVKENQLQEKKLDEVGVWWFADVMLGVEGM-IDSMNKSKEHGFLGFRNSNNS  373

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  374   FISWIDKYKAFKIVP  388



>ref|XP_009360316.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Pyrus x bretschneideri]
Length=388

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/376 (40%), Positives = 213/376 (57%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  24    QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPNWSADHPVD-YIQCDISD  82

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +++ VTH+F++       E EN   N  M  NVL  +  +  +   H+++
Sbjct  83    PEDVQTKLSGLTD-VTHIFYVTWTSRATELENCEANGAMFRNVLSVVIPAAPNLR-HISL  140

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK Y+GP         K+  H+ PF ED PRL  PNFYY LED+  ++ E       
Sbjct  141   QTGTKHYIGPF----ECIGKIPAHDPPFTEDLPRLDVPNFYYTLEDI--LFEEVKKKPGL  194

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N + TLCVYA ICK++G P ++PG +  WE +   SDA L+
Sbjct  195   TWSVHRPYNIFGFSPHSLMNIIGTLCVYAAICKKEGRPLKFPGTKAAWECYAMASDADLI  254

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   A+N+AFN  NGDVF WK  W+   + F +E   F+E G++   + E M
Sbjct  255   AEQHIWAAVDPNAQNEAFNINNGDVFKWKQFWKGLAEQFGIEEYGFDEEGERR-SLVEEM  313

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K  +W  IV+++ L  T++EE+  +     VL  +   + SMNKSKE GFLG+ ++ K
Sbjct  314   KGKEGVWEEIVRENELQPTKLEEVGVWWFADYVLGGE-AVLDSMNKSKEHGFLGFRNSYK  372

Query  315   SIRVWVQKLREMKIIP  268
             S   W++K++  KI+P
Sbjct  373   SFVSWIEKMKAYKIVP  388



>emb|CDM86919.1| unnamed protein product [Triticum aestivum]
Length=397

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/387 (38%), Positives = 224/387 (58%), Gaps = 13/387 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF--PSSF  1240
             +    E   ++VAL++G+TG+VG ++++ L +    GGPWKVY  +RR  P W   P S 
Sbjct  19    RAAAAEPTFQSVALILGSTGIVGTSLLDILPRDDTPGGPWKVYAVSRRAPPGWSTPPPSP  78

Query  1239  LDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
                ++  D  +      +L+ ++ +VTHVF+ A    E E+ N  +N+ ML NVL  +  
Sbjct  79    AVTHLQLDLADAAAVRDALAPLT-DVTHVFYAAWSSHETEDRNREVNAGMLRNVLSVVVP  137

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAP-FKEDYPRLPFPNFYYALEDLV  883
                +   HV +QTG K Y+GP           IP   P + ED PRL  PNFYY LED++
Sbjct  138   GCPALA-HVCLQTGRKHYVGP-----FEAIGKIPAPTPAYTEDTPRLDHPNFYYDLEDVL  191

Query  882   --AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWE  709
                +     + ++S+HR ++I G S  S  N + +LCVYA IC+++G   R+PG +  WE
Sbjct  192   FHHVSGRDGAVTWSVHRPTVIFGFSPRSAMNVMGSLCVYAAICRKEGTTLRWPGCKVAWE  251

Query  708   HFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEEN  529
              F D SDA L+AE +IWA V   AKN+AFNC+NGDVF WK +W +  + F +E+  +E  
Sbjct  252   GFTDASDADLVAEHEIWAAVDPFAKNEAFNCSNGDVFKWKQLWPMLAERFGVEWAGYEGE  311

Query  528   GDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKE  349
              D  F +A+ M  K  +W  I++++ L  T +EEIT +  +  +     +H+ +MNKSKE
Sbjct  312   -DSRFSLADAMAGKEAVWTEILQENELVTTELEEITSWWFVDAMFSIDIEHLDNMNKSKE  370

Query  348   LGFLGYADTLKSIRVWVQKLREMKIIP  268
              GFLG+ +T+ S   W+ K++  K++P
Sbjct  371   HGFLGFRNTVNSFNAWIDKMKASKVVP  397



>ref|XP_009360311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Pyrus x bretschneideri]
Length=389

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/376 (40%), Positives = 213/376 (57%), Gaps = 14/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  25    QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWKVYGVARRPRPNWSADHPVD-YIQCDISD  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +++ VTH+F++       E EN   N  M  NVL  +  +  +   H+++
Sbjct  84    PEDVQTKLSGLTD-VTHIFYVTWTSRATELENCEANGAMFRNVLSVVIPAAPNLR-HISL  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK Y+GP         K+  H+ PF ED PRL  PNFYY LED+  ++ E       
Sbjct  142   QTGTKHYIGPF----ECIGKIPAHDPPFTEDLPRLDVPNFYYTLEDI--LFEEVKKKPGL  195

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N + TLCVYA ICK++G P ++PG +  WE +   SDA L+
Sbjct  196   TWSVHRPYNIFGFSPHSLMNIIGTLCVYAAICKKEGRPLKFPGTKAAWECYAMASDADLI  255

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   A+N+AFN  NGDVF WK  W+   + F +E   F+E G++   + E M
Sbjct  256   AEQHIWAAVDPNAQNEAFNINNGDVFKWKQFWKGLAEQFGIEEYGFDEEGERR-SLVEEM  314

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             K K  +W  IV+++ L  T++EE+  +     VL  +   + SMNKSKE GFLG+ ++ K
Sbjct  315   KGKEGVWEEIVRENELQPTKLEEVGVWWFADYVLGGE-AVLDSMNKSKEHGFLGFRNSYK  373

Query  315   SIRVWVQKLREMKIIP  268
             S   W++K++  KI+P
Sbjct  374   SFVSWIEKMKAYKIVP  389



>ref|XP_006284965.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
 gb|EOA17863.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
Length=388

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   +S ++ +VTHVF++     E E EN   N  ML NVLR++     +   HV +
Sbjct  85    AEETRSKISTLT-DVTHVFYVTWTNRESESENCEANGAMLRNVLRAIVPHAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +          HE PF ED PRL   NFYY  ED L     +  S ++
Sbjct  143   QTGTKHYVGPFSNLDGPH-----HEPPFTEDMPRLQIQNFYYTQEDVLFEEIQKKESVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             SIHR ++I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  198   SIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLMFPGSKKAWEGFTTASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +      L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KERVWEEMVKENQLQEKKLDEVGVWWFADVALGVEGV-IDSMNKSKEHGFLGFRNSNNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  +I+P
Sbjct  375   TYWIDKYKAFRIVP  388



>ref|XP_006413460.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
 gb|ESQ54913.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
Length=390

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 221/374 (59%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+    LS+++ +VTHVF++       E EN   N +ML NVLR++  +  +   HV +
Sbjct  85    AEEARSKLSRLT-DVTHVFYVTWTNRSSETENCDANGSMLRNVLRAVLPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP  +    + +   H+ PF ED PRL   NFYY LED L     +  S ++
Sbjct  143   QTGTKHYIGPFDNLEKRSQR---HDPPFTEDMPRLQIQNFYYTLEDVLFEEIKKKESVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  200   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKKAWEGFTAASDADLVAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  260   QQIWAAVDPYAKNEAFNCNNADMFKWKHLWKVLAEQFGIEEYGFEEG--KNLGLVEMMKG  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  318   KERVWEEMVKENQLQEKKLDEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSNNSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  377   ISWIDKYKAFKIVP  390



>ref|XP_006374843.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
 gb|ERP52640.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
Length=388

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 230/385 (60%), Gaps = 14/385 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK   +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  14    KKPAVQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  72

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+  + SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  73    EYIQCD---ISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  129

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV +QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  130   IATNLR-HVCLQTGTKNYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  184

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK +G P  +PG +  W  +
Sbjct  185   EEVAKKEGVTWSVHRPDIIFGFSPYSLMNIIVTLSVYAAICKHEGAPLMFPGTKEAWNCY  244

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G 
Sbjct  245   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGG-  303

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             K   +AE MKDKG +W  IVKK++L  T++EE+  +  + T+L      +  MNKSKE G
Sbjct  304   KRATLAERMKDKGPVWEEIVKKNQLSPTKLEEVGGWWFVDTMLSGD-AFISCMNKSKEHG  362

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ K+R  KIIP
Sbjct  363   FLGFRNSTKSFVHWIGKMRSQKIIP  387



>gb|AHI88614.1| putative progesterone 5-beta-reductase [Hesperis matronalis]
Length=388

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPID-YIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E     LS ++ +VTHVF+        E +N   N +ML NVLR++     +   H+ +
Sbjct  85    AEGARSKLSPLA-DVTHVFYATWTNRPSERDNCEANGSMLRNVLRAIVPHAPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD +L       H+ PF ED PRL   NFYY LED L+    +    ++
Sbjct  143   QTGTKHYLGP-FD-NLGKSH---HDPPFTEDLPRLQIQNFYYTLEDILLEEIKKIEGVTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +  P  +PG++  WE F   SDA L+AE
Sbjct  198   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHRRSPLLFPGSKKAWEGFTTASDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK 
Sbjct  258   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWKVLAEQFGIEEYGFEEG--KNLGLVEMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   ++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KDRVWEEMVKENQLQEMKLEEVGVWWFADVILGVEGM-IDSMNKSKEHGFLGFRNSTNSF  374

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  375   ISWIDKYKAYKIVP  388



>ref|XP_010530504.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=388

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 217/374 (58%), Gaps = 12/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TGMVG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    ESVGLIIGVTGMVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNTDHPV-EYIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               D    LS ++ +VTH+F++       E E+   N+ ML NVLR++     +   HV +
Sbjct  85    AIDAQSKLSPLT-DVTHIFFVTWTNRRSESESCDSNAAMLRNVLRAIVPHAPNLQ-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTGTK Y+ P+ +          H+ PF ED PRLP  NFYYALED++    E       
Sbjct  143   QTGTKHYIAPLDNLGGPH-----HDPPFTEDLPRLPVQNFYYALEDVLFEEVEKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + +LCVYA ICK +G P  +PG++  WE     SDA L+AE
Sbjct  198   SVHRPNTIFGFSPYSLMNLVGSLCVYAAICKHEGSPLLFPGSKVAWEGLTVSSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIW  V   AKN+AFNC NGDVF WK +W+   + F +E   F+E   K   + + MK 
Sbjct  258   QQIWTAVDRYAKNEAFNCNNGDVFKWKHLWKDLAEQFGIEEYGFKEG--KNVGLVKMMKG  315

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IVK+++L +TR+EE+  +  +  +L  Q   + SMNKSKE GFLG+ ++  S 
Sbjct  316   KEALWQEIVKENQLQKTRLEEVGTWWFVDMMLGVQGM-IDSMNKSKEHGFLGFRNSKNSF  374

Query  309   RVWVQKLREMKIIP  268
               WV K +  KI+P
Sbjct  375   ISWVDKYKAYKIVP  388



>dbj|BAK04809.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/386 (38%), Positives = 227/386 (59%), Gaps = 11/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF--PSSF  1240
             +    E   ++VAL++G+TG+VG ++++ L +    GG WKVY  +RR  P+W   P S 
Sbjct  19    RAAAAEPTFQSVALILGSTGIVGTSLLDILPRDDTPGGLWKVYAVSRRAPPAWSTPPPSP  78

Query  1239  LDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
                ++  D  +      +L  ++ +VTHVF+ A    E E+ N  +N+ ML NVL  +  
Sbjct  79    AVTHLQLDLADPAAVKDALGPLT-DVTHVFYAAWSSHETEDRNREVNAGMLRNVLSIVVP  137

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
             +  +   HV +QTG K Y+GP FD      K+   + P+ ED PRL  PNFYY LED++ 
Sbjct  138   NCPALA-HVCLQTGRKHYVGP-FD---VIGKIPAPDPPYTEDMPRLDHPNFYYDLEDVLF  192

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
               +     + S+S+HR ++I G S  S  N + +LCVYA IC+++G   R+PG +  WE 
Sbjct  193   DEVSRRDGAVSWSVHRPTVIFGFSPRSAMNVVGSLCVYAAICRKEGATLRWPGCQVAWEG  252

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             F D SDA L+AE +IWA V   AKN+AFNC+NGDVF WK +W +  D F +E+  +E   
Sbjct  253   FTDASDADLVAEHEIWAAVDPFAKNEAFNCSNGDVFKWKQLWPMLADRFGVEWAGYEGE-  311

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             D  F +++ M  K  +W  I++++ L  T +EEIT +  +  +     +H+ +MNKSKE 
Sbjct  312   DNRFSLSDAMAGKEAVWTEILQENELVTTELEEITSWGFVDAMFNIDIEHLDNMNKSKEH  371

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ +T+ S   W+ K++  K++P
Sbjct  372   GFLGFRNTINSFIAWIDKMKASKVVP  397



>gb|AIW09144.1| progesterone 5-beta-reductase 2 [Catharanthus roseus]
Length=389

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 214/374 (57%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L++G TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LSK++ +VTHVF++       E EN  +NS M  NVL ++  +  +   H+ +
Sbjct  85    PEDAQSMLSKLT-DVTHVFYVTWASKSTEVENCEVNSKMFRNVLNAIIPNCPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP     L     + HE PF E+ PRL  PNFYY LED++    +       
Sbjct  143   QTGLKHYLGPF---ELFGKAAVAHEPPFHEELPRLDVPNFYYTLEDILFEEVQKKEGLTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLC YA ICK +G P R+PG +  W+ +   SDA L+AE
Sbjct  200   SVHRPGNIFGFSPFSLMNLVGTLCAYAAICKHEGVPLRFPGCKEAWQGYSMCSDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F  E+  ++    +   + E MKD
Sbjct  260   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGAEYAEYQ---GERLSLQELMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L  +++EE+  +     VL  +   + SMNKSKE GFLG+ ++  + 
Sbjct  317   KGPVWENIVRENGLVPSKLEEVGVWWFADLVLSVECP-LDSMNKSKEHGFLGFRNSKNAF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI P
Sbjct  376   ISWIDKAKAYKIFP  389



>gb|EYU37596.1| hypothetical protein MIMGU_mgv1a007982mg [Erythranthe guttata]
Length=389

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/374 (40%), Positives = 221/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             +AVAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W   + ++ Y+  D  +
Sbjct  26    QAVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNDDNPIN-YIRCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ ++THVF++       E EN   N  ML NVL  +  +  +   H+ +
Sbjct  85    PDDIQAKLSPLT-DITHVFYVTWANRSTEVENCESNGKMLKNVLDVVIPNSPNLK-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP      +  K+  H+ P+ ED PRL + NFYY LED++    E       
Sbjct  143   QTGRKHYIGPF----ESYGKIETHDPPYSEDLPRLNYINFYYTLEDILFAEVEKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G   ++PG++  WE + D SDA L+AE
Sbjct  199   SVHRPGNIFGCSPSSMMNLVGTLCVYAAICKHEGSVLKFPGSKIAWEGYSDCSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   +EE   ++  + E MKD
Sbjct  259   HQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVECGGYEEG--QKLTLVEMMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK++ L  T++ ++  +     +L  +  ++ +MNKSKE GFLG+ ++  S+
Sbjct  317   KGPVWDEIVKENGLTETKLGDVGIWWFGDVILGSEC-YLDTMNKSKEHGFLGFRNSKNSL  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   ISWIDKVKAYKIVP  389



>ref|XP_010092100.1| hypothetical protein L484_001148 [Morus notabilis]
 gb|EXB50215.1| hypothetical protein L484_001148 [Morus notabilis]
Length=255

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 178/232 (77%), Gaps = 4/232 (2%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS-FLDEYMTFDALNF  1204
             VAL++G TGM G+++ EALK P ALGGPW VYG AR+  P+WFPSS  +D +++FDAL+F
Sbjct  13    VALIVGVTGMAGISLAEALKSPEALGGPWTVYGTARQQKPTWFPSSATIDHFISFDALSF  72

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdsssl-SHVTI  1027
             EDT + LS IS  VT +FW+A+QV + EE NI+ NS ML  VLR L SS +SS   HVT+
Sbjct  73    EDTLQKLSPISQHVTRLFWVAIQVRDTEESNIKANSIMLQIVLRVLNSSKNSSKLRHVTL  132

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTGTK YMGPIFDP+L   K+   + PF+ED  RLP+PNFYYALED+VA   + +SF++S
Sbjct  133   QTGTKHYMGPIFDPTLGVTKLAHPDPPFEEDAARLPYPNFYYALEDIVA--QKGHSFTYS  190

Query  846   ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMS  691
             +HR+SII+GAS+ S +N L+TLCVYA+IC+ +  PFRYPG +YTWEH CD +
Sbjct  191   VHRASIILGASARSFYNMLVTLCVYASICRHENLPFRYPGTKYTWEHLCDAT  242



>dbj|BAJ93442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/386 (38%), Positives = 227/386 (59%), Gaps = 11/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF--PSSF  1240
             +    E   ++VAL++G+TG+VG ++++ L +    GG WKVY  +RR  P+W   P S 
Sbjct  19    RAAAAEPTFQSVALILGSTGIVGTSLLDILPRDDTPGGLWKVYAVSRRAPPAWSTPPPSP  78

Query  1239  LDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
                ++  D  +      +L  ++ +VTHVF+ A    E E+ N  +N+ ML NVL  +  
Sbjct  79    AVTHLQLDLADPAAVKDALGPLT-DVTHVFYAAWSSHETEDRNREVNAGMLRNVLSIVVP  137

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
             +  +   HV +QTG K Y+GP FD      K+   + P+ ED PRL  PNFYY LED++ 
Sbjct  138   NCPALA-HVCLQTGRKHYVGP-FD---VIGKIPAPDPPYTEDMPRLDHPNFYYDLEDVLF  192

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
               +     + S+S+HR ++I G S  S  N + +LCVYA IC+++G   R+PG +  WE 
Sbjct  193   DEVSRRDGAVSWSVHRPTVIFGFSPRSAMNVVGSLCVYAAICRKEGATLRWPGCQVAWEG  252

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             F D SDA L+AE +IWA V   AKN+AFNC+NGDVF WK +W +  D F +E+  +E   
Sbjct  253   FTDASDADLVAEHEIWAAVDPFAKNEAFNCSNGDVFKWKQLWPMLTDRFGVEWAGYEGE-  311

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             D  F +++ M  K  +W  I++++ L  T +EEIT +  +  +     +H+ +MNKSKE 
Sbjct  312   DNRFSLSDAMAGKEAVWTEILQENELVTTELEEITSWGFVDAMFNIDIEHLDNMNKSKEH  371

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ +T+ S   W+ K++  K++P
Sbjct  372   GFLGFRNTINSFIAWIDKMKASKVVP  397



>ref|XP_009406008.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 226/386 (59%), Gaps = 20/386 (5%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARR-PLPSWFPSSFLD--------  1234
             ++VALVIGATG+VG +++  L  P   GGPWKVYG +RR P P+   SS           
Sbjct  28    QSVALVIGATGIVGSSLIGILPLPDTPGGPWKVYGVSRRSPNPNVVSSSAASSSDSADIN  87

Query  1233  --EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
                ++  D L+  D    LS +S +VTHVF++A      E EN   N+ ML NVL ++  
Sbjct  88    PIRHIQCDVLDAADAAAKLSPLS-DVTHVFYVAWASRFNEAENRTANAAMLRNVLAAVLP  146

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
             S  +   HV +QTG K Y+GP      +  K+  H+ PF ED PRL  PNFYY  ED++ 
Sbjct  147   SAPNLR-HVCLQTGRKHYIGPF----ESIGKISAHDPPFHEDLPRLNVPNFYYDQEDILF  201

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
               +     + ++SIHR   I G S  S+ N + TLCVYA IC+++G P ++ G+R  W+ 
Sbjct  202   DELSKRDGAVTWSIHRPGTIFGFSPTSLMNIIGTLCVYAAICRKEGAPLKWFGSRTAWDG  261

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             F D SDA L+AE QIWA V   AKN+AFNC+NGDVF WK +W L  D F LE V +E   
Sbjct  262   FSDASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVFKWKHLWALLADQFGLESVGYEGE-  320

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             +  F + + M++K  +W  IV ++ L  T++EE+  +     +L  +   + SMNKSKE 
Sbjct  321   EGRFKLEDAMREKELVWNEIVAENELVPTKLEEVGTWWFADAILGVEMPQLDSMNKSKEH  380

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ +TL S   W+ K++  +I+P
Sbjct  381   GFLGFRNTLTSFNSWIDKMKAFRIVP  406



>ref|XP_002991994.1| hypothetical protein SELMODRAFT_186462 [Selaginella moellendorffii]
 gb|EFJ06962.1| hypothetical protein SELMODRAFT_186462 [Selaginella moellendorffii]
Length=361

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 205/372 (55%), Gaps = 17/372 (5%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VA+VIG TG+ G ++   L +     G W+VYG  RR  P W PS     Y+  D L+  
Sbjct  6     VAIVIGVTGINGNSICRKLLEQ----GSWQVYGTGRRDRPDWLPSKV--SYVQLDLLDGV  59

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             D    LS + N +T +FW A    + EEEN   N T+  N L +L         HV + T
Sbjct  60    DVQTKLSPLKNRITTLFWAAWIPMQTEEENCDANGTIFRNTLDALLPGALR---HVCLTT  116

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             G K Y+GP FD       ++P E PF+ED PRLP PNFYY  EDL+    + +       
Sbjct  117   GAKHYVGP-FD---QWQDVMPAEVPFREDSPRLPVPNFYYVQEDLLFDRVKQHPHLTYSI  172

Query  840   rssiiI-GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
                  I G +  +  N +L L VYA ICK    PFR+ G+R TWE   D SDA L+AEQ+
Sbjct  173   HRPGAIFGFAPRNYMNCILGLAVYAAICKRDKLPFRFFGSRATWEGLIDASDADLIAEQE  232

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             IWA     AKNQA N TNGDVF WK +W +  D   L+ V F+    + F++   MK + 
Sbjct  233   IWAATHPAAKNQALNTTNGDVFKWKRLWAVIADEMGLDPVPFD---GESFNLESLMKGRD  289

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
               W  +V++H+L  T+ +++  +  L  +     +++CSMNKSKELGFLG+ ++ KS++ 
Sbjct  290   GAWDALVREHKLLPTKFQDVGQFWFLDAMFAAPVENLCSMNKSKELGFLGFRNSEKSLQH  349

Query  303   WVQKLREMKIIP  268
             W+Q L+  KI+P
Sbjct  350   WIQVLKAEKIVP  361



>gb|AHZ44509.1| putative progesterone 5 beta-reductase [Thlaspi arvense]
Length=389

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 219/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG AR P PSW     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARHPRPSWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED+   LS ++ +VTHVF++       E +    N +ML NVLR++  +  +   HV +
Sbjct  85    AEDSRSKLSPLT-DVTHVFYVTWTNGSSERDICEANGSMLRNVLRAIVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP FD    TD+  P   PF ED PRL   NFY+ LED L     +  + ++
Sbjct  143   QTGTKHYIGP-FDSLEKTDRPDP---PFTEDMPRLKIQNFYHTLEDILFEEIKKVENVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G P  +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSPLVFPGSKKAWEGFTAASDADLVAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFNC N D+F WK +WR+  + F +E   F E   K   + E MK 
Sbjct  259   QQIWAAVDPYAKNEAFNCNNADIFKWKHLWRILAEQFGIEEYGFVEG--KNLGLVEMMKG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK+++L   ++ E+  +     VL  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KERVWEEMVKENQLQEKKLGEVGVWWFADVVLGVEGM-IDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>ref|XP_003636810.1| Progesterone 5-beta-reductase [Medicago truncatula]
Length=809

 Score =   270 bits (691),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 220/374 (59%), Gaps = 14/374 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L+IG TG+VG ++ E L      GG WKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLIIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADHPI-EYIQCDITD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LS ++ +VTH+F+++      E EN  +NS ML NVL ++  +  +   HV++
Sbjct  85    PNETQTKLSVLT-DVTHIFYVSWSNRPSEAENCEVNSAMLRNVLTAVIPNAPNLR-HVSL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+GP FD      K+  HE PF ED PRL  PNFYY  ED+  ++ ET      
Sbjct  143   QTGGKHYLGP-FD---LIGKINSHEPPFTEDLPRLDAPNFYYTQEDI--LFEETQKKEGL  196

Query  846   ihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
                        G S  S+ N + TLCVYA ICK +G P ++PG +  WE +   SDA L+
Sbjct  197   SWSVHRPQVIFGFSPYSLMNLVGTLCVYAAICKHEGVPLKFPGTKGAWESYSVASDADLI  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   F+E G +   ++E M
Sbjct  257   AEQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVLAEQFGIEEYGFDEEGPR-LKLSELM  315

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  IVK+++L  T+++E+  +  +  +   +   V SMNK+KE GF+G+ +T  
Sbjct  316   KDKGPVWDEIVKENQLEATKIDEVGEWWFVDLMFGGE-GAVDSMNKAKEHGFVGFRNTKN  374

Query  315   SIRVWVQKLREMKI  274
             S+  W+ K R  KI
Sbjct  375   SLISWIDKTRAYKI  388


 Score =   268 bits (686),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 220/388 (57%), Gaps = 18/388 (5%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ ++   ++   VALV+G TG+VG ++ E L      GG WKVYG ARRP PSW    
Sbjct  434   KKLDEDEAPQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPSWNADH  493

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  N  DT    S I  +VTH+F+++      EE+N  +N  ML NVLR++ 
Sbjct  494   PI-EYIQRDITNSNDTQTKFS-ILTDVTHIFYVSWTSRPTEEDNCEVNGVMLLNVLRAVI  551

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV++QTG K Y+GP        DK+  HE  F ED PRL  PNFYY  ED+ 
Sbjct  552   PNAPNLC-HVSLQTGGKHYLGPF----ALIDKINSHEPSFTEDLPRLDIPNFYYTQEDI-  605

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + TLC+YA ICK +    ++PG +  W
Sbjct  606   -LFEETKKKEGLSWSVHRPLLIFGFSPYSLMNVVGTLCLYAAICKHEHISLKFPGTKRAW  664

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
             E +   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + FE+E   +E+
Sbjct  665   ESYYMASDADLIAEQHIWAAVDTYAKNEAFNCSNGDVFRWKQLWKVLTEQFEIEEYGYED  724

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSK  352
                    +AE MKDKG +W  IVK++ L  T++EE+  +         +   V SMNK+K
Sbjct  725   G--PRLRLAEMMKDKGPVWDEIVKENELQPTKLEEVAEWWVADATFGME-DIVDSMNKAK  781

Query  351   ELGFLGYADTLKSIRVWVQKLREMKIIP  268
             E GFLG+ ++  S+  W+ K R  KI+P
Sbjct  782   EHGFLGFRNSKNSLINWIDKTRAYKIVP  809



>ref|XP_011042197.1| PREDICTED: uncharacterized protein LOC105137942 [Populus euphratica]
Length=803

 Score =   270 bits (689),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 237/394 (60%), Gaps = 17/394 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK G +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  14    KKPGVQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  72

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+ ++ SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  73    EYIQCD---ISDSAQAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  129

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV++QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  130   IATNLR-HVSLQTGTKHYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  184

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK +G P  +PG +  W  +
Sbjct  185   EEVAKKEGVTWSVHRPDIIFGFSPHSLMNIIVTLSVYAAICKHEGAPLMFPGTKEAWNCY  244

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G 
Sbjct  245   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGG-  303

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             K   +AE MKDKG +W  IVKK++LF T++EE+  +  + T+L      +  MNKSKE G
Sbjct  304   KRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWWYVDTMLSGD-AFISCMNKSKEHG  362

Query  342   FLGYADTLKSIRVWVQKLREMKIIP*SVIPCFKT  241
             FLG+ ++ KS   W+ K+R  K+IP     CF T
Sbjct  363   FLGFRNSTKSFVYWIGKMRSQKVIPNC---CFNT  393


 Score =   260 bits (664),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 157/385 (41%), Positives = 231/385 (60%), Gaps = 14/385 (4%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK   +    +VAL++G TG+VG ++ E L +    GGPWKVYG ARRP P+W  +  + 
Sbjct  429   KKPAAQGGQGSVALIVGVTGIVGNSLAEILPRSDTPGGPWKVYGVARRPRPNWHENCPV-  487

Query  1233  EYMTFDALNFEDTHKSLSKISN--EVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslts  1060
             EY+  D     D+ ++ SK+S+  +VTH+F++       E EN ++N  M  N+L+++  
Sbjct  488   EYIQCD---ISDSAQAKSKLSHLTDVTHIFYVTWASRSNEAENCKINGLMFRNLLQAVVP  544

Query  1059  sdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-  883
               ++   HV +QTGTK Y+GP F+     +    H+ P+ ED PRL   NFYY LED++ 
Sbjct  545   IATNLR-HVCLQTGTKNYIGP-FESFYNFES---HDPPYSEDLPRLKVDNFYYTLEDVMF  599

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
                A+    ++S+HR  II G S  S+ N ++TL VYA ICK +G P  +PG +  W  +
Sbjct  600   EEVAKKEGVTWSVHRPDIIFGFSPYSLMNIIVTLSVYAAICKLEGAPLMFPGTKEAWNCY  659

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
                SDA L+AEQ+IWA V   A+NQAFN  N D F WK +W++  + F +E   FEE G+
Sbjct  660   AIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFKWKHLWKVLAEQFGIEKYGFEEGGE  719

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             +   +AE MKDK  +W  IVKK++L  T++EE+  +  + T+L      +  MNKSKE G
Sbjct  720   RA-TLAERMKDKEPVWEEIVKKNQLSPTKLEEVGGWWFVDTMLSGD-AFISCMNKSKEHG  777

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ ++ KS   W+ K+R  KIIP
Sbjct  778   FLGFRNSTKSFVYWIGKMRSQKIIP  802



>ref|XP_006387422.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
 gb|ERP46336.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
Length=391

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/374 (40%), Positives = 223/374 (60%), Gaps = 9/374 (2%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARR  P+W     + EY+  D  N
Sbjct  26    QSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDHPV-EYIQCDISN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LSK++ +VTHVF++       EEEN  +N  M  NVL+++  + S+   HV +
Sbjct  85    TAETQSKLSKLT-DVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVIPNASNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG K Y GP    +L    +  H++PF ED PRL FPNFYY LED++    A+    ++
Sbjct  143   QTGGKHYAGPF---ALLGKNIEAHDSPFTEDLPRLRFPNFYYTLEDVMFEEVAKKEGVTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N ++T+ VYA ICK +G P  + G++  W  +   SDA L+AE
Sbjct  200   SVHRPGVIFGFSPYSLMNMIVTISVYAAICKHEGVPLIFRGSKEAWNSYSIASDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V   A+N+AFN  NGD+F WK +W +  + F +E   FEE G+     AE MKD
Sbjct  260   HEIWACVDPNAQNEAFNIQNGDLFKWKHLWTVLAEEFGIEKYGFEE-GESSVTFAEKMKD  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++++L   ++E++  +     +       +C +NKSKE GFLG+ ++ KS 
Sbjct  319   KGPVWEEIVRENQLLPNKLEQVGGWWFADLMFSVPGSVIC-LNKSKEHGFLGFRNSKKSF  377

Query  309   RVWVQKLREMKIIP  268
               W+ K++  K++P
Sbjct  378   VSWIDKMKAYKVVP  391



>ref|XP_011092523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=389

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 222/374 (59%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GG WKVYG ARRP P+W   + ++ Y+  D  +
Sbjct  26    QSVALIIGVTGIVGSSLAEILPLADTPGGRWKVYGVARRPRPNWNDDNRVN-YIRCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ ++TH+F++       E EN ++N  ML NVL ++  +      H+ +
Sbjct  85    PDDTRAKLSTLT-DITHLFYVTWANKPTEAENCQVNGKMLKNVLDAVIPNCPRLK-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K YMGP      +  K+  H+ P+ ED PRL + NFYY LED L     +    ++
Sbjct  143   QTGRKHYMGPF----ESYGKIETHDPPYTEDLPRLSYMNFYYTLEDILFEEVKKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N ++TLCVYA ICK +G   R+PG +  W+ + D SDA L+AE
Sbjct  199   SVHRPGNIFGFSPYSMMNLMVTLCVYAAICKHEGKVLRFPGCKAAWDGYSDCSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN +NGDVF WK  W++  + F LE   +EE   +   + E MKD
Sbjct  259   HQIWAAVDPFAKNEAFNVSNGDVFKWKHFWKVLAEQFGLECGKYEEG--QTLTLQELMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IVK+  L +T++E++  +     +L  +   + +MNKSKE GFLG+ ++  S 
Sbjct  317   KGPVWDEIVKEKELMQTKLEDVGIWWFGDVILGNEC-FLDTMNKSKEHGFLGFRNSKNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  376   VSWIDKVKAYKIVP  389



>ref|XP_006374842.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
 gb|ERP52639.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
Length=391

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 223/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             K+VALV+G TG+VG ++ E L      GGPWKVYG AR   P+W   + + EY+  D  +
Sbjct  27    KSVALVVGVTGIVGNSLAEILPLADTPGGPWKVYGVARGKRPNWNEDNPV-EYIQCDISD  85

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                T   LS ++ +VTH+F++     E E EN ++N  M  NVL ++  +  +   H+ +
Sbjct  86    RNQTQSKLSLLT-DVTHIFYVTWANRETESENCKINGLMFRNVLEAVILNAHNLR-HICL  143

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP         K+  H+ PF ED PRL FPNFYY LED L    A+    ++
Sbjct  144   QTGTKHYVGPF----QFFGKIEAHDPPFTEDLPRLEFPNFYYTLEDILFQEVAKKEGLTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ + + TLCVYA ICK +G   R+PG +  W  +   SDA L+AE
Sbjct  200   SVHRPDNIFGFSPHSLMSIVRTLCVYAAICKHEGTLMRFPGVKEVWNCYAIASDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V   AKN+AFN  NGDVF WK +W++  + F LE   F E  ++   +AE MK+
Sbjct  260   HEIWACVDPSAKNEAFNIHNGDVFKWKHLWKVLGEQFGLEEYGFVET-EERISLAETMKE  318

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++++L  T++EE+  +  +  +   +   + SMNKSKE GFLG+ ++ KS 
Sbjct  319   KGAVWEEIVRENQLLPTKLEEVGAWWFVDLIFGGEVS-IPSMNKSKEHGFLGFRNSKKSF  377

Query  309   RVWVQKLREMKIIP  268
               W++K++  K++P
Sbjct  378   ISWIEKMKASKVVP  391



>ref|XP_010099074.1| hypothetical protein L484_011508 [Morus notabilis]
 gb|EXB76663.1| hypothetical protein L484_011508 [Morus notabilis]
Length=378

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 215/374 (57%), Gaps = 22/374 (6%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G TG+VG ++ E L      GGPWK    A  P+           Y+  D  +
Sbjct  26    QSVALVVGVTGIVGNSLAEILPLSDTPGGPWK---NADHPI----------TYIQCDVSD  72

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              + T   LSK+++ VTH+F++       E EN  +N  ML NVL ++     +   H+ +
Sbjct  73    PQQTKDHLSKLTD-VTHIFYVTWSSQPTEAENCSVNGAMLGNVLEAVIPHAPNLQ-HICL  130

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP         K+ PHE PF ED PRL  PNFYY  ED LV    +    ++
Sbjct  131   QTGRKHYIGPF----ELLGKVEPHEPPFHEDLPRLDAPNFYYVQEDILVEEVKKKEGLTW  186

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N + +LCVYA ICK +G   R PG R   E + D SDA L+AE
Sbjct  187   SVHRPGVIFGFSPSSLMNIIGSLCVYAAICKHEGMKLRIPGTREGREAYLDASDADLIAE  246

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFNC+NGDVF WK +W++  + FELE+  FE++GD    + E MKD
Sbjct  247   HQIWAAVDTYAKNEAFNCSNGDVFKWKHMWKVLTEQFELEYEEFEDDGDS-LTLVEMMKD  305

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KGE+W  IVK++ L  T +EE+  +     VL      + SMNKSKE GF+G+ ++  S 
Sbjct  306   KGEVWDQIVKENGLVPTNLEEVGNFWFADLVLTLGTT-LDSMNKSKEYGFVGFRNSKSSF  364

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  365   ISWIDKMKSYKIVP  378



>ref|XP_011016706.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/386 (40%), Positives = 227/386 (59%), Gaps = 13/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSK---AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+  +  S+   +VAL++G TG+VG ++ E L      GGPWKVYG ARR  P+W    
Sbjct  14    KKIEDDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  N  +T   LSK++ +VTHVF++       EEEN  +N  ML NVL+++ 
Sbjct  74    PV-EYIQCDISNTAETQSKLSKLT-DVTHVFYVTWASKSTEEENCEINGLMLRNVLQAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              + S+   HV +QTG K Y GP         K+  H++PF ED PRL FPNFYY LED++
Sbjct  132   PNASNLR-HVCLQTGGKHYAGPF----ALLGKIEAHDSPFTEDLPRLRFPNFYYTLEDVM  186

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 A+    ++S+HR  +I G S  S+ N ++T+ VYA ICK +G P  + G++  W  
Sbjct  187   FEEVAKKEGVTWSVHRPGVIFGFSPYSLMNMIVTISVYAAICKHEGVPLIFRGSKEAWNS  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             +   SDA L+AE +IWA V   A+N+AFN  NGD+F WK +W    + F +E   FEE G
Sbjct  247   YSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFKWKHLWTALAEEFGIEKYGFEE-G  305

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             +     AE MKDKG +W  IV++++L   ++E++  +     +       +C +NKSKE 
Sbjct  306   ESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWWFADLMFSIPGSVLC-LNKSKEH  364

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++ KS   W+ K++  K++P
Sbjct  365   GFLGFRNSKKSFVSWIDKMKAYKVVP  390



>ref|XP_004501803.1| PREDICTED: uncharacterized protein LOC101510608 [Cicer arietinum]
Length=805

 Score =   269 bits (687),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 161/396 (41%), Positives = 225/396 (57%), Gaps = 23/396 (6%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK+ +E   ++   VALVIG TG+VG ++ E L      GG WKVYG ARRP P+W    
Sbjct  14    KKLDEEEEPRSFQNVALVIGVTGIVGNSLAEILPLADTPGGRWKVYGVARRPRPAWNEDH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  D    LS ++ +VTH+F++       E EN  +N TML NVLR++ 
Sbjct  74    PV-EYIQCDITDSNDAESKLSVLT-DVTHIFYVCWASRPTEAENCEINGTMLKNVLRAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   HV++QTG K Y+G       +  K+ PHE P+ ED PRL   NFYY LED+ 
Sbjct  132   PNAPNLR-HVSLQTGGKHYVGSF----ESFGKIKPHEPPYTEDMPRLDTRNFYYTLEDV-  185

Query  882   AIYAETNsfsfsihrssiiI---GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTW  712
              ++ ET             +   G S  S+ N + TLCVYA ICK +G P R+PG +  W
Sbjct  186   -LFEETGKKEDLSWSVHRPLLIFGFSPYSLMNIIGTLCVYAAICKHEGVPLRFPGTKLAW  244

Query  711   EHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEE  532
             E++   SDA L+AEQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   +EE
Sbjct  245   ENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFKWKQLWKVLAEQFGIEEYGYEE  304

Query  531   NGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSK  352
                    ++E MKDKG +W  IVK ++L  T++EE+  +      L        +MNKSK
Sbjct  305   G--PRLKLSELMKDKGPVWDEIVKVNQLQPTKLEEVAEWWFADVSLGGN-GFTDTMNKSK  361

Query  351   ELGFLGYADTLKSIRVWVQKLREMKIIP*SVIPCFK  244
             E GFLG+ +T  S+  W+ K R  KI     +PC+K
Sbjct  362   EHGFLGFRNTKNSLINWIDKTRAYKI-----VPCYK  392


 Score =   267 bits (683),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 223/378 (59%), Gaps = 21/378 (6%)
 Frame = -2

Query  1383  AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNF  1204
             +V L++G TG+VG ++ E L  P   GG WKVYG ARRP PSW     + EY+  D  + 
Sbjct  443   SVGLIVGVTGIVGNSLAEILPLPDTPGGRWKVYGVARRPRPSWNADHPI-EYIQCDITDP  501

Query  1203  EDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQ  1024
              +T   LS ++ +VTH+F+++      E EN  +N  ML NVLR++  +  +   HV++Q
Sbjct  502   NETQSKLSVLT-DVTHIFYVSWTKRPTEAENCEVNGAMLRNVLRAVIPNAPNLR-HVSLQ  559

Query  1023  TGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf--  850
             TG K Y+GP FD      K+  HE PF ED PRL  PNFYY  ED+  ++ ET       
Sbjct  560   TGGKHYVGP-FD---LIGKVNSHEPPFTEDLPRLDAPNFYYTQEDI--LFEETGKKEGLK  613

Query  849   -sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
              SIHR  +I G S  S  N + +LCVYA ICK +G P R+PG +  WE +  +SDA L+A
Sbjct  614   WSIHRPEVIFGFSPYSSMNIIGSLCVYAAICKHEGVPLRFPGTKEVWEDYYVVSDADLIA  673

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQ IWA V   AKN+AFNC+NGDVF WK +W++  + F +E   +EE       ++E MK
Sbjct  674   EQHIWAAVDPYAKNEAFNCSNGDVFRWKQLWKVLAEQFGIEEYGYEEG--PRLKLSELMK  731

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQF---QHVCSMNKSKELGFLGYADT  322
             DKG +W  IVK ++L  T ++E+  +        F F   + V SMNK+KE GF G+ +T
Sbjct  732   DKGPVWDEIVKLNKLEATNIDEVGNW----WFADFTFGGIRIVDSMNKAKEHGFFGFRNT  787

Query  321   LKSIRVWVQKLREMKIIP  268
               S+  W+ + R  KI+P
Sbjct  788   KNSLITWIDRTRAFKIVP  805



>gb|AGM16376.1| putative progesterone 5-beta-reductase [Cakile maritima]
Length=389

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 218/374 (58%), Gaps = 11/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++       E EN   N  ML NVLR++  +  +   HV +
Sbjct  85    ADDVRSKLSPLT-DVTHVFYVTWTNRSSESENCEANGNMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTGTK Y+GP     L T K   H+ PF ED PRL   NFYY LED L     +  S S+
Sbjct  143   QTGTKHYIGPF--GGLETTKY--HDPPFTEDMPRLRIENFYYTLEDVLFEEIKKRESVSW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+AE
Sbjct  199   SVHRPNTIFGFSPYSLMNVVGTLCVYAAICKHEGSKLVFPGSKKAWEGFSTASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AK +AFNC N D+F WK +W++  + F +E   FEE   K   + E M+ 
Sbjct  259   QQIWAAVDPYAKKEAFNCNNDDIFKWKHLWKVLAEQFGIEEYGFEEG--KNVGLVEMMRG  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  +VK++ L   +++E+  +  +  +L  +   + SMNKSKE GFLG+ ++  S 
Sbjct  317   KESVWEEMVKENGLQEKKLDEVGVWWFVDVILGVE-GMIDSMNKSKEHGFLGFRNSNNSF  375

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  376   ISWIDKYKAFKIVP  389



>gb|AIW09143.1| progesterone 5-beta-reductase 1 [Catharanthus roseus]
Length=387

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 215/374 (57%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L++G TG+VG ++ E L      GGPWKVYG ARRP PSW     + EY+  D  +
Sbjct  26    QSVGLILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWNADHPI-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              E+T   LSK+++ VTHVF++       E EN   N  M  NVL ++  +  +   H+ +
Sbjct  85    PEETESKLSKLTD-VTHVFYVTWTNKSTEVENCEANGKMFRNVLNAIIPNCPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y GP      A       E PF ED PRL  PNFYY LED++    +       
Sbjct  143   QTGLKHYFGPFEFFGKAA-----QETPFHEDLPRLDVPNFYYTLEDILFEEVQKKEGLSW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG +  WE +   SDA L+AE
Sbjct  198   SVHRPGTIFGFSPFSLMNLVGTLCVYAAICKHEGLPLKFPGCKEAWEGYSMCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   AKN+AFN +NGDVF WK  W++  + F LE   +E  GDK   + E MKD
Sbjct  258   QQIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGLECAEYE--GDK-VSLEEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K  +W  IV+++ L  T++EE+  +  +  +   ++  + SMNKSKE GFLG+ ++  + 
Sbjct  315   KEAVWEEIVRENGLLPTKLEEVGGFWFVDFIFGVEYP-LDSMNKSKEHGFLGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  374   ISWIDKAKAYKIVP  387



>gb|AEX31542.1| putative steroid 5beta-reductase [Vitis vinifera]
Length=390

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 161/386 (42%), Positives = 230/386 (60%), Gaps = 13/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSKA---VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK  +++  +    V LVIG TG+VG ++ E L      GGPWKVYG ARRP P W    
Sbjct  14    KKFDEDDAPRGFQNVGLVIGVTGIVGDSLAEILPLSDTPGGPWKVYGVARRPRPDWNADH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  + ED    LS ++ +VTHVF++       E EN   N TML NVLR+L 
Sbjct  74    PV-EYIQCDISDSEDALAKLSPLT-DVTHVFYVTWTNRATEIENCEANGTMLRNVLRALI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              +  +   H+ +QTG K Y+GP      A  K+ PH+ P+ ED PRL  PNFYY LED++
Sbjct  132   PNAPNLR-HICLQTGGKHYIGPF----EAFGKIKPHDPPYHEDLPRLDAPNFYYTLEDIL  186

Query  882   AIYAET-NsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 E  +  ++S+HR  II G S  S+ N L TLC+YA ICK +G P ++PG++  W+ 
Sbjct  187   FEECEKKDDLTWSVHRPVIIFGFSPYSMMNILGTLCIYAAICKHEGIPLKFPGSKAAWDC  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             + D SDA L+AEQQIWA V   A+N+AFN TNGD+F WK +W++  + F++E+  FEE  
Sbjct  247   YSDASDADLIAEQQIWATVDPYARNEAFNITNGDLFKWKHLWKVLAEQFDMEYAEFEEGE  306

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             +K+  + E MKDKG +W  IV++  L  T++E++  +  +  VL  +    C MNKSKE 
Sbjct  307   EKQ-SMVEMMKDKGPVWEEIVREKELLPTKLEDVAQWWFIDLVLGGESLLNC-MNKSKEH  364

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++  S   W+ +      +P
Sbjct  365   GFLGFRNSRNSFVWWMPQEVTNSFLP  390



>gb|AHZ44507.1| putative progesterone 5 beta-reductase [Isatis tinctoria]
Length=390

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 223/375 (59%), Gaps = 12/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+W     +D Y+  D  +
Sbjct  26    ESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHPID-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ +VTHVF++       E +N   N +ML NVLR++  +  +   HV +
Sbjct  85    DDDVRSKLSTLT-DVTHVFYVTWANRSSESDNCEANGSMLRNVLRAVVPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIP-HEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfs  853
             QTGTK Y+GP FD   A DK +  H+ PF ED PRL   NFYY LED L     +  S +
Sbjct  143   QTGTKHYIGP-FD---AVDKSVQRHDPPFTEDMPRLQIQNFYYTLEDVLFEEIKKKESVT  198

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR + I G S  S+ N + TLCVYA ICK +G    +PG++  WE F   SDA L+A
Sbjct  199   WSVHRPNTIFGFSPYSLMNIVGTLCVYAAICKHEGSKLVFPGSKKAWEGFTAASDADLIA  258

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             EQQIWA V   AKN+AFNC N D+F WK +W++  + F +E   FEE   K   + E MK
Sbjct  259   EQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGFEEG--KNVGLVEMMK  316

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
              K  +W  +VK+++L   +++E+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  317   GKERVWEEMVKENQLQENKLDEVGVWWFADVILGVE-GMIDSMNKSKEHGFLGFRNSNNS  375

Query  312   IRVWVQKLREMKIIP  268
                W+ K +  KI+P
Sbjct  376   FISWIDKYKAFKIVP  390



>ref|XP_002969677.1| hypothetical protein SELMODRAFT_92604 [Selaginella moellendorffii]
 gb|EFJ28801.1| hypothetical protein SELMODRAFT_92604 [Selaginella moellendorffii]
Length=394

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 222/372 (60%), Gaps = 13/372 (3%)
 Frame = -2

Query  1377  ALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFED  1198
             AL++G TG+VG ++VEAL++P A G PW++ G ARRP P WF    +D Y+  + LN  +
Sbjct  27    ALIVGVTGIVGNSLVEALQRPDAPGAPWRIRGIARRPKPRWFEHPDVD-YIQCNLLNLSE  85

Query  1197  THKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTG  1018
                 LS +   VTHVFW+A +    EEEN   N  ML +VL++L         HV +QTG
Sbjct  86    VTPKLSSLGG-VTHVFWVAWEKQSTEEENCEANGFMLRSVLQALLPVAKRLK-HVCLQTG  143

Query  1017  TKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLP-FPNFYYALED-LVAIYAETNsfsfsi  844
              K Y+GP F     T K   +  PF ED PR+P  PNFYY LED L    + ++  ++S+
Sbjct  144   VKHYLGPYFH--FGTIKH--YRPPFHEDLPRVPGLPNFYYTLEDILFEACSPSSGITWSV  199

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR +II G +  +  N L +L +YA ICK +   F +PGNR +WE   ++SDA L+AEQ+
Sbjct  200   HRPNIIFGFAPRNHANVLGSLAIYAAICKHQKLSFNFPGNRQSWETLTNVSDADLVAEQE  259

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA     AKN+AFN  +GD  +W+ +W +    F+LE  A++    K   + + +K+K 
Sbjct  260   LWAATNPSAKNEAFNIADGDCTSWERLWAVMAREFKLECPAYD---GKPVSLEQLLKNKK  316

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV ++ L  T +++ T + A+   L F FQ V  MNKSKE GFL Y ++ KS+  
Sbjct  317   NVWEQIVVENGLLETAVQDETWW-AVDLCLNFPFQVVSCMNKSKEHGFLSYRNSEKSVIY  375

Query  303   WVQKLREMKIIP  268
             W++K++E  I+P
Sbjct  376   WIRKMKEKNILP  387



>emb|CAN63254.1| hypothetical protein VITISV_028488 [Vitis vinifera]
Length=1000

 Score =   269 bits (687),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 232/374 (62%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V LVIG TG+VG ++ E L      GGPWKVYG ARRP P W     + EY+  D  +
Sbjct  636   QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPDWNADHPV-EYIQCDISD  694

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              ED    LS +++ VTHVF++       E EN   N TML NVLR+L  +  +   H+ +
Sbjct  695   SEDALAKLSPLTD-VTHVFYVTWTNRATEIENCEANGTMLRNVLRALIPNAPNLR-HICL  752

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAET-Nsfsf  850
             QTG K Y+GP F+   A  K+ PH+ P+ ED PRL  PNFYY LED++    E  +  ++
Sbjct  753   QTGGKHYIGP-FE---AFGKIKPHDPPYHEDLPRLDAPNFYYTLEDILFEECEKKDDLTW  808

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  II G S  S+ N L TLC+YA ICK +G P ++PG++  W+ + D SDA L+AE
Sbjct  809   SVHRPVIIFGFSPYSMMNILGTLCIYAAICKHEGIPLKFPGSKAAWDCYSDASDADLIAE  868

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             QQIWA V   A+N+AFN TNGD+F WK +W++  + F++E+  FEE  +K+  + E MKD
Sbjct  869   QQIWATVDPYARNEAFNITNGDLFKWKHLWKVLAEQFDMEYAEFEEGEEKQ-SMVEMMKD  927

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++E++  +  +  VL  +    C MNKSKE GFLG+ ++  S 
Sbjct  928   KGPVWEEIVREKELLPTKLEDVAQWWFIDLVLGGESLLNC-MNKSKEHGFLGFRNSRNSF  986

Query  309   RVWVQKLREMKIIP  268
               W+ K+R  K+IP
Sbjct  987   VWWIDKMRGHKLIP  1000



>ref|XP_002981288.1| hypothetical protein SELMODRAFT_444825 [Selaginella moellendorffii]
 gb|EFJ17476.1| hypothetical protein SELMODRAFT_444825 [Selaginella moellendorffii]
Length=394

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 222/372 (60%), Gaps = 13/372 (3%)
 Frame = -2

Query  1377  ALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFED  1198
             AL++G TG+VG ++VEAL++P A G PW++ G ARRP P WF    +D Y+  + LN  +
Sbjct  27    ALIVGVTGIVGNSLVEALQRPDAPGAPWRIRGIARRPRPRWFEHPDVD-YIQCNLLNLSE  85

Query  1197  THKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTG  1018
                 LS +   VTHVFW+A +    EEEN   N  ML +VL++L         HV +QTG
Sbjct  86    VTPKLSSLDG-VTHVFWVAWEKKSTEEENCEANGFMLRSVLQTLLPVAKRLK-HVCLQTG  143

Query  1017  TKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLP-FPNFYYALED-LVAIYAETNsfsfsi  844
              K Y+GP F     T K   +  PF ED PR+P  PNFYY LED L    + ++  ++S+
Sbjct  144   VKHYLGPYFH--FGTIKH--YRPPFCEDLPRVPGLPNFYYTLEDILFEACSPSSGITWSV  199

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR +II G +  +  N L +L +YA ICK +   F +PGNR +WE   ++SDA L+AEQ+
Sbjct  200   HRPNIIFGFAPRNHANVLGSLAIYAAICKHQKLSFNFPGNRQSWETLTNVSDADLVAEQE  259

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA     AKN+AFN  +GD  +W+ +W +    F+LE  A++    K   + + +K+K 
Sbjct  260   LWAATNPSAKNEAFNVADGDCTSWERLWAVMAREFKLECPAYD---GKPVSLEQLLKNKK  316

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV ++ L  T +++ T + A+   L F FQ V  MNKSKE GFL Y ++ KS+  
Sbjct  317   NVWEQIVVENGLLETAVQDETWW-AVDLCLNFPFQVVSCMNKSKEHGFLSYRNSEKSVIY  375

Query  303   WVQKLREMKIIP  268
             W++K++E  I+P
Sbjct  376   WIRKMKEKNILP  387



>ref|XP_002989828.1| hypothetical protein SELMODRAFT_160458 [Selaginella moellendorffii]
 gb|EFJ09095.1| hypothetical protein SELMODRAFT_160458 [Selaginella moellendorffii]
Length=361

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/372 (39%), Positives = 204/372 (55%), Gaps = 17/372 (5%)
 Frame = -2

Query  1380  VALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFE  1201
             VA+VIG TG+ G ++   L +     G W+VYG  RR  P W PS     Y+  D L+  
Sbjct  6     VAIVIGVTGINGNSICRKLLE----QGSWQVYGTGRRDRPDWLPSKV--SYVQLDLLDGV  59

Query  1200  DTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQT  1021
             D    LS + N +T +FW A    + EEEN   N T+  N L +L         HV + T
Sbjct  60    DVQTKLSPLKNRITTLFWAAWIPMQTEEENCDANGTIFRNTLDALLPGALR---HVCLTT  116

Query  1020  GTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfsih  841
             G K Y+GP FD       ++P E PF+ED PRLP PNFYY  EDL+    + +       
Sbjct  117   GAKHYVGP-FD---QWQDVMPAEVPFREDSPRLPVPNFYYVQEDLLFDRVKQHPHLTYSI  172

Query  840   rssiiI-GASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
                  I G +  +  N +L L VYA ICK    PFR+ G++ TWE   D SDA L+AEQ+
Sbjct  173   HRPGAIFGFAPRNYMNCILALAVYAAICKRDKLPFRFFGSKATWEGLIDASDADLIAEQE  232

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             IWA     AKNQA N TNGDVF WK +W +  D   ++ V F+    + F++   MK + 
Sbjct  233   IWAATHPAAKNQALNTTNGDVFKWKRLWAVIADEMGVDPVPFD---GESFNLESLMKGRD  289

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
               W  +V +H+L  T+ +++  +  L  +     +++C+MNKSKELGFLG+ ++ KS++ 
Sbjct  290   GAWDALVHEHKLLPTKFQDVGQFWFLDAMFAAPVENLCNMNKSKELGFLGFRNSEKSLQH  349

Query  303   WVQKLREMKIIP  268
             W+Q L+  KI+P
Sbjct  350   WIQVLKAEKIVP  361



>ref|XP_002465092.1| hypothetical protein SORBIDRAFT_01g031950 [Sorghum bicolor]
 gb|EER92090.1| hypothetical protein SORBIDRAFT_01g031950 [Sorghum bicolor]
Length=396

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 230/385 (60%), Gaps = 10/385 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             +    E   ++VALV+G+TG+VG ++++ L       GPWKVY  +RRPLP W P+    
Sbjct  19    QAAAAEPSYQSVALVVGSTGIVGTSLLDILPLADTPAGPWKVYAVSRRPLPPWSPAPSPA  78

Query  1233  -EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltss  1057
               ++  D  +    H +L+ ++ +VTHVF++A      E EN   N+ ML NVL  +  +
Sbjct  79    VTHLHLDLADAAAVHDALTPLT-DVTHVFFVAWTSRATEAENREANAAMLRNVLSVVVPN  137

Query  1056  dssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--  883
               + + HV +QTG K Y+GP      A  K+   E PF ED PRL  PNFYY +ED++  
Sbjct  138   CPALV-HVCLQTGRKHYVGPF----EAIGKVATPEPPFTEDMPRLDCPNFYYDMEDVLFD  192

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
              +     + S+S+HR + + G S  S  N + +LCVYA IC+++G   R+PG+R TWE F
Sbjct  193   HVSRRGGAVSWSVHRPTTVFGYSPRSAMNLVGSLCVYAAICRKEGATLRWPGSRVTWEGF  252

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
              D SDA L+AE +IWA V   AKN+AFNC+NGD+F WK +W +  D F +E+  +E   +
Sbjct  253   SDASDADLIAEHEIWAAVDPFAKNEAFNCSNGDIFKWKQLWPILADHFGVEWAGYEGEEN  312

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             + F + + M  K  +W  IV+++ L  T ++EIT +  +  +   + Q + SMNKSKE G
Sbjct  313   R-FRLEDAMAGKEAVWAEIVRENELIATELDEITNWWFVDAMFAVETQLLDSMNKSKEHG  371

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ +T+ S   W++K++  KI+P
Sbjct  372   FLGFRNTVTSFNTWIEKMKVFKIVP  396



>emb|CDM86889.1| unnamed protein product [Triticum aestivum]
Length=393

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/376 (40%), Positives = 225/376 (60%), Gaps = 10/376 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD-EYMTFDAL  1210
             ++VALV+G+TG+VG ++V+ L +    GGPWKVY  +RRPLP W P       ++  D  
Sbjct  25    QSVALVVGSTGIVGTSLVDILPRHDTPGGPWKVYAVSRRPLPPWSPPPSPAVTHLHLDLA  84

Query  1209  NFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVT  1030
             +     ++L+ ++ ++THVF+ A      E +N   NS ML N+L  +     +   HV 
Sbjct  85    DPVAVAEALTPLT-DITHVFYAAWSSHPTEAQNREANSAMLRNMLSVVVPGCPALA-HVC  142

Query  1029  IQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNsf  856
             +QTG K Y+GP      A  K+   + P+ ED PRL +PNFYY  ED++   +     + 
Sbjct  143   LQTGRKHYIGPY----EAIGKIPIPDPPYTEDMPRLDYPNFYYDQEDVLFEEVSHRDGAV  198

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             S+S+HR S++ G S  S  N + +LCVYA IC+++G   R+PG R  WE F D SDA LL
Sbjct  199   SWSVHRPSVVFGFSPRSAMNVVASLCVYAAICRKEGATLRWPGTRVAWEGFSDASDADLL  258

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AEQ+IWA V   AKN+ FNC+NGD++ WK +W +  D F +E+  +E   D  F +A+ M
Sbjct  259   AEQEIWAAVDPLAKNEPFNCSNGDLYKWKQLWPMVADRFGVEWTGYEGE-DSRFMLADAM  317

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
               K  +W  I++++ L  T ++EI  +  L  V   + +H+ SMNKSKE GFLG+ +T K
Sbjct  318   AGKEAVWAEILQENELVTTELQEIANWWFLDAVFNVKSEHLDSMNKSKEHGFLGFRNTAK  377

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++ +KI+P
Sbjct  378   SFNAWIDKMKALKIVP  393



>gb|AIW09145.1| progesterone 5-beta-reductase 3 [Catharanthus roseus]
Length=394

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/380 (39%), Positives = 214/380 (56%), Gaps = 21/380 (6%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++V L++G TG+VG ++ E L      GGPWKVYG ARR  P+W     + EY+  D  N
Sbjct  29    QSVGLILGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRSRPTWHADHPI-EYIQCDLSN  87

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDE--MEEENIRLNSTMLDNVlrsltssdssslSHV  1033
              E+T   LS ++ +VTH+F++         + EN   N  M  NVL ++  +  +   H+
Sbjct  88    PEETESKLSNLT-DVTHIFYVTCVTANKYTDAENCDANGKMFRNVLNAIIPNCPNLQ-HI  145

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfs  853
              +QTG K Y G            + HE+P  ED PRL  PNFYY LED+  +Y E     
Sbjct  146   CLQTGLKHYFGRSL-----VGNFVCHESPCYEDLPRLDVPNFYYTLEDI--LYEEVQKKE  198

Query  852   fsihrssiiIGA---SSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
                            S  S  N + TLCVYA ICK++G P ++PG++  WE +   SDA 
Sbjct  199   GLTWSVHRPGTIFVFSPFSSMNLVGTLCVYAAICKQQGLPLKFPGSKNVWEGYSMCSDAD  258

Query  681   LLAEQQIWAGVTE--KAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDI  508
             L+AEQQIWA +     AKN+AFN +NGDVF WK IW++  + F LEFV F+  G+K   +
Sbjct  259   LVAEQQIWAAIDHLPNAKNEAFNVSNGDVFKWKYIWKVLAEQFGLEFVEFD--GEK-LSL  315

Query  507   AEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYA  328
              E M DKG IW  IV+++ L  T++E++  +     +L F+F  + SMNKSKE GFLG+ 
Sbjct  316   QEMMIDKGPIWEEIVRENGLLGTKLEQVGVWWFADVLLGFEFP-LDSMNKSKEHGFLGFR  374

Query  327   DTLKSIRVWVQKLREMKIIP  268
             ++  S   W++K +  KI+P
Sbjct  375   NSKNSFLSWIEKTKAYKIVP  394



>ref|XP_010905259.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Elaeis guineensis]
Length=425

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 219/363 (60%), Gaps = 12/363 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF---PSSFLDEYMTFD  1216
             ++V LVIG TG+VG ++ E L      GGPWKVYG +RRPL   F         E++  D
Sbjct  32    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVSRRPLSVSFRPLTEGLAVEHIQCD  91

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
               + +D    LS +++ VTHVF++A     +E EN  +NS +L NVL ++  +  +   H
Sbjct  92    VSDPDDALAKLSPLTD-VTHVFYVAWANRIVEAENREVNSALLRNVLAAVLPNAPNLQ-H  149

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETN  862
             V +QTG K Y+G       +  K+  HE PF+ED PRL  PNFYY LED++   +     
Sbjct  150   VCLQTGRKHYLGSF----ESLGKVKAHEPPFREDLPRLDCPNFYYDLEDILFEEMAKRDG  205

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
             + ++SIHR + I G S+ S+ N + +LC YA IC+ +G P ++PG+R  WE F D SDA 
Sbjct  206   TVTWSIHRPTTIFGFSTYSLMNLVGSLCAYAAICRREGAPLKWPGSRVVWEDFSDASDAD  265

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             ++AE QIWA +   AKN+AFNC+NGD+F WK +W L    F +E+V + E  ++ F + +
Sbjct  266   MIAEHQIWAAIDPYAKNEAFNCSNGDLFKWKHLWPLLAREFGVEWVGY-EGEEQRFKLVD  324

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MK+K  +W  IV +H L  TR+EE+  +  +  V   +  H+ SMNKSKE GFLG+ +T
Sbjct  325   AMKEKEGLWEEIVAEHELAPTRLEEVGNWWFVDAVFGVEEVHLDSMNKSKEHGFLGFRNT  384

Query  321   LKS  313
             + S
Sbjct  385   VVS  387



>gb|EAY90583.1| hypothetical protein OsI_12184 [Oryza sativa Indica Group]
Length=396

 Score =   255 bits (651),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 153/392 (39%), Positives = 231/392 (59%), Gaps = 18/392 (5%)
 Frame = -2

Query  1413  KKMGQENCS------KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF  1252
             KK  +EN +      ++VALV+G+TG+VG ++++ L      GGPWKVY  +RRPLP   
Sbjct  13    KKRQEENAAATEPSFQSVALVVGSTGIVGTSLLDILPLQDTPGGPWKVYAVSRRPLPP--  70

Query  1251  PSSFLDEYMTFDALNFEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNV  1078
              S      +T   L+  D+      ++   ++THVF++A      E +N  +NS ML NV
Sbjct  71    WSPPASPAVTHLHLDLADSAAVAEALTPLTDITHVFYVAWSAHPTEAQNREVNSAMLRNV  130

Query  1077  lrsltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYA  898
             L  +  +  + + HV +QTG K Y+GP         K+   + PF ED  RL  PNFYY 
Sbjct  131   LSVVVPNCPALV-HVCLQTGRKHYIGPF----EVIGKIAAPDPPFTEDMLRLDCPNFYYD  185

Query  897   LEDLV--AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGN  724
             LED++   +     + S+S+HR +++ G S  S  N + +LCVYA IC+++G   R+PG+
Sbjct  186   LEDVLFDEVSRRDGAVSWSVHRPTVVFGFSPRSAMNVVGSLCVYAAICRKEGAVLRWPGS  245

Query  723   RYTWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFV  544
             R  WE F D SDA L+AE +IWA V   AKN+AFNC+NGD++ WK +W +  D F +E+ 
Sbjct  246   RVAWEGFSDASDADLIAEHEIWAAVEPFAKNEAFNCSNGDLYKWKLLWPMLADQFGVEWS  305

Query  543   AFEENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSM  364
              + E  +  F +A+ M  K  +W  IVK++ L  T +EEIT +  +  V   + +H+ SM
Sbjct  306   GY-EGEESSFKLADAMSGKEAVWAEIVKENDLMDTELEEITNWWFVDAVFGVRSEHLDSM  364

Query  363   NKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             NKSKE GFLG+ +T+ S   W++K++  KI+P
Sbjct  365   NKSKEHGFLGFRNTVNSFNTWIEKMKVFKIVP  396



>ref|XP_010905260.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Elaeis guineensis]
Length=397

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 217/360 (60%), Gaps = 12/360 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF---PSSFLDEYMTFD  1216
             ++V LVIG TG+VG ++ E L      GGPWKVYG +RRPL   F         E++  D
Sbjct  32    QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVSRRPLSVSFRPLTEGLAVEHIQCD  91

Query  1215  ALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSH  1036
               + +D    LS +++ VTHVF++A     +E EN  +NS +L NVL ++  +  +   H
Sbjct  92    VSDPDDALAKLSPLTD-VTHVFYVAWANRIVEAENREVNSALLRNVLAAVLPNAPNLQ-H  149

Query  1035  VTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETN  862
             V +QTG K Y+G       +  K+  HE PF+ED PRL  PNFYY LED++   +     
Sbjct  150   VCLQTGRKHYLGSF----ESLGKVKAHEPPFREDLPRLDCPNFYYDLEDILFEEMAKRDG  205

Query  861   sfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDAR  682
             + ++SIHR + I G S+ S+ N + +LC YA IC+ +G P ++PG+R  WE F D SDA 
Sbjct  206   TVTWSIHRPTTIFGFSTYSLMNLVGSLCAYAAICRREGAPLKWPGSRVVWEDFSDASDAD  265

Query  681   LLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAE  502
             ++AE QIWA +   AKN+AFNC+NGD+F WK +W L    F +E+V + E  ++ F + +
Sbjct  266   MIAEHQIWAAIDPYAKNEAFNCSNGDLFKWKHLWPLLAREFGVEWVGY-EGEEQRFKLVD  324

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MK+K  +W  IV +H L  TR+EE+  +  +  V   +  H+ SMNKSKE GFLG+ +T
Sbjct  325   AMKEKEGLWEEIVAEHELAPTRLEEVGNWWFVDAVFGVEEVHLDSMNKSKEHGFLGFRNT  384



>ref|XP_002960184.1| hypothetical protein SELMODRAFT_74145 [Selaginella moellendorffii]
 gb|EFJ37723.1| hypothetical protein SELMODRAFT_74145 [Selaginella moellendorffii]
Length=394

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 224/372 (60%), Gaps = 13/372 (3%)
 Frame = -2

Query  1377  ALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFED  1198
             AL++G TG+VG ++VEAL++P A G PW++ G ARRP P WF    +D Y+  + LN  +
Sbjct  27    ALIVGVTGIVGNSLVEALQRPDAPGAPWRIRGIARRPRPRWFEHPDVD-YIQCNLLNLSE  85

Query  1197  THKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTG  1018
                 LS +   VTHVFW+A +    EEEN   N  ML +VL++L         HV +QTG
Sbjct  86    VTPKLSSLDG-VTHVFWVAWEKKSTEEENCEANGFMLRSVLQTLLPVAKKLK-HVCLQTG  143

Query  1017  TKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLP-FPNFYYALEDLV-AIYAETNsfsfsi  844
              K Y+GP F     T K   +  PF+ED P++P  PNFYY LED++    + ++  ++S+
Sbjct  144   VKHYLGPYF--HFGTIKH--YRPPFREDLPQVPGLPNFYYTLEDILFEACSPSSGITWSV  199

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR +II G +  +  N L +L +YA ICK +   F +PGNR +WE   ++SDA L+AEQ+
Sbjct  200   HRPNIIFGFAPRNHANVLGSLAIYAAICKHQKLSFNFPGNRQSWETLTNVSDADLVAEQE  259

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA    +AKN+AFN  +GD  +W+ +W +    F+LE   ++    K   + + +K+K 
Sbjct  260   LWAATNPRAKNEAFNVADGDCTSWERLWAVMAREFKLECPVYD---GKPVSLDQLLKNKK  316

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV ++ L  T +++ T + A+   L F FQ V  MNKSKE GFL Y ++ KS+  
Sbjct  317   NVWEQIVVENGLLETAVQDETWW-AVDLCLNFPFQVVSCMNKSKEHGFLSYRNSEKSVIY  375

Query  303   WVQKLREMKIIP  268
             W++K++E  I+P
Sbjct  376   WIRKMKEKNILP  387



>ref|XP_011017140.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/386 (39%), Positives = 228/386 (59%), Gaps = 13/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSK---AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK  ++  S+   +VAL++G TG+VG ++ E L      GGPWKVYG ARR  PSW    
Sbjct  14    KKTEEDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPSWNEDH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  +  +T   LSK+++ VTH+F++       EEEN  +N  M  NVL+++ 
Sbjct  74    PV-EYIQCDISSTVETQSKLSKLTD-VTHIFYVTWASKSTEEENCEINGLMFRNVLQAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              + ++   HV +QTG KQY+GP         K+  H++PF ED PR  FPNFY+ LED++
Sbjct  132   PNAANLR-HVCLQTGAKQYVGPF----ELFGKIEAHDSPFTEDLPRSRFPNFYHTLEDVM  186

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 A+    ++S+HR  +I G S  S+ N ++T+ VYA ICK +G P  + G++  W  
Sbjct  187   FEEVAKKEGVTWSVHRPGVIFGFSPYSLMNMIVTISVYAAICKHEGVPLIFRGSKEAWNS  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             +   SDA L+AE +IWA V   A+N+AFN  NGD+F WK +W +  + F +E   FEE G
Sbjct  247   YSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFKWKHLWTILAEEFGIEKYGFEE-G  305

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             +     AE MKDKG +W  IV++++L   ++E++  +     V       +C +NKSKE 
Sbjct  306   ESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWWFADFVFSIPGSVLC-LNKSKEH  364

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++ KS   W+ K++  K++P
Sbjct  365   GFLGFRNSKKSFVSWIDKMKAYKVVP  390



>ref|XP_011088171.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Sesamum 
indicum]
Length=389

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/376 (40%), Positives = 219/376 (58%), Gaps = 15/376 (4%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW   + ++ Y+  D  +
Sbjct  26    ESVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNDDNPIN-YIQCDVSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +D    LS ++ ++THVF++       E EN   N  ML NVL ++  +      H+ +
Sbjct  85    PDDAQAKLSTLT-DITHVFYVTWTNRSTEAENCEANGKMLKNVLDAVIPNCPKLK-HICL  142

Query  1026  QTGTKQYMGP--IFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsf  856
             QTG K Y+GP  IF       K+  H+ P+ ED PRL + NFYY LED L     +    
Sbjct  143   QTGRKHYIGPFEIFG------KIETHDPPYTEDLPRLNYINFYYTLEDILFEEVKKKEGL  196

Query  855   sfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLL  676
             ++S+HR   I G S  S+ N + TLCVYA ICK +G   R+PG +  W+ + D SDA L 
Sbjct  197   TWSVHRPGTIFGFSPYSMMNLVGTLCVYAAICKHEGEVLRFPGCKAAWDGYSDCSDADLT  256

Query  675   AEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFM  496
             AE QIWA V   AKN+AFN +NGDVF WK  W++  + F +E   +EE   +   + E M
Sbjct  257   AEHQIWAAVDPYAKNEAFNVSNGDVFKWKNFWKVLAEQFGVECGGYEEG--QTLTLEELM  314

Query  495   KDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLK  316
             KDKG +W  IV+++ L  T++E++  +     +L  +   + +MNKSKE GFLG+ ++  
Sbjct  315   KDKGAVWDEIVRENGLTPTKLEDVGLWWFGDIILGNECP-LDTMNKSKEHGFLGFRNSKN  373

Query  315   SIRVWVQKLREMKIIP  268
             S   W+ K++  KI+P
Sbjct  374   SFISWIDKVKAYKIVP  389



>ref|XP_011022580.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=389

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 221/375 (59%), Gaps = 11/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKV+G ARR  P+W     + EY+  D  +
Sbjct  24    QSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVHGVARRSRPNWNEDHPV-EYIQCDIAD  82

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                T   LSK++ +VTH+F++     + E EN  +N  M  NVL+++  +  +   HV +
Sbjct  83    TAQTQSKLSKLT-DVTHIFYVTWASKDTEVENCEINGLMFRNVLQAVIPNAPNLR-HVCL  140

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRL-PFPNFYYALEDLV-AIYAETNsfs  853
             QTG K Y+GP         K+  H+ PF ED PRL  FPNFYY LED++    A+    +
Sbjct  141   QTGGKHYLGPF----QLFGKIEAHDPPFTEDLPRLNDFPNFYYTLEDVMYEEVAKKEGVT  196

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR  +I G S  S+ N ++T+ VYA ICK +G P  +PG +  W  +   SDA L+A
Sbjct  197   WSVHRPDVIFGFSPHSLMNMIVTISVYAAICKHEGAPLIFPGTKEAWNSYAIASDANLIA  256

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             E +IWA V  KAKN+AFN  NGD+F WK +W +    F +E   F E G+    +AE MK
Sbjct  257   EHEIWACVEPKAKNEAFNINNGDLFKWKHLWTVLAQEFGIEKYGFVE-GESSVTLAEKMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DKG +W  IVKK++L   ++E++  +     ++      V SMNK+KE GFLG+ ++ KS
Sbjct  316   DKGPVWEEIVKKNQLLSNKLEQVGGW-WFGDMMFSGPGIVASMNKAKEHGFLGFRNSKKS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K+R  K++P
Sbjct  375   FVSWIHKMRAYKVVP  389



>ref|XP_004983958.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Setaria 
italica]
Length=396

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/386 (39%), Positives = 221/386 (57%), Gaps = 12/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             +    E   ++VALV+G+TG+VG ++++ L      GGPWKVY  +RRPLP W P     
Sbjct  19    QAAAAEPTYQSVALVVGSTGIVGTSLLDILPLADTPGGPWKVYALSRRPLPPWSPPPSPA  78

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
                    L          K   ++THVF++A      E EN   N+ ML NVL  +  + 
Sbjct  79    VTHLHLDLADAAAVADALKPLTDITHVFYVAWTARPTEAENREANAAMLRNVLSVVVPNC  138

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIY  874
              + + HV +QTG K Y+GP      A   +   + PF ED PRL  PNFYY +ED+  ++
Sbjct  139   PALV-HVCLQTGRKHYVGPF----EALGGVSFPDPPFTEDMPRLDCPNFYYDMEDI--LF  191

Query  873   AETNsfsfsihrs----siiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
              E N    ++  S    + + G S  S  N + +LCVYA IC+++G  FR+PG+R  WE 
Sbjct  192   DEVNRREGAVSWSVHRPTTVFGYSPRSAMNVVGSLCVYAAICRKEGATFRWPGSRIAWEG  251

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             F D SDA L+AE +IWA V   AKN+AFNC+NGD++ WK +W +  D F +E+  +E   
Sbjct  252   FSDASDADLIAEHEIWAAVDPFAKNEAFNCSNGDLYKWKYLWPILADHFGVEWAGYEGEE  311

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             ++ F + E M  K  +W  IV+++ L  T ++EIT +  +  V   +F+H+ SMNKSKE 
Sbjct  312   NR-FKLEEAMAGKEALWAEIVRENELISTELDEITNWWFVDAVFGVEFEHLDSMNKSKEH  370

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ +T+ S   W++KL+  KI+P
Sbjct  371   GFLGFRNTVNSFNTWIEKLKVFKIVP  396



>ref|NP_001050440.1| Os03g0436400 [Oryza sativa Japonica Group]
 gb|AAU89185.1| progesterone 5-beta-reductase, putative [Oryza sativa Japonica 
Group]
 gb|AAU89226.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96808.1| progesterone 5-beta-reductase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12354.1| Os03g0436400 [Oryza sativa Japonica Group]
 gb|EAZ27443.1| hypothetical protein OsJ_11392 [Oryza sativa Japonica Group]
 dbj|BAG97572.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/392 (39%), Positives = 231/392 (59%), Gaps = 18/392 (5%)
 Frame = -2

Query  1413  KKMGQENCS------KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWF  1252
             KK  +EN +      ++VALV+G+TG+VG ++++ L      GGPWKVY  +RRPLP   
Sbjct  13    KKRQEENAAATEPSFQSVALVVGSTGIVGTSLLDILPLQDTPGGPWKVYAVSRRPLPP--  70

Query  1251  PSSFLDEYMTFDALNFEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNV  1078
              S      +T   L+  D+      ++   ++THVF++A      E +N  +NS ML N+
Sbjct  71    WSPPASPAVTHLHLDLADSAAVAEVLTPLTDITHVFYVAWSAHPTEAQNREVNSAMLRNI  130

Query  1077  lrsltssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYA  898
             L  +  +  + + HV +QTG K Y+GP         K+   + PF ED  RL  PNFYY 
Sbjct  131   LSVVVPNCPALV-HVCLQTGRKHYIGPF----EVIGKIAAPDPPFTEDMLRLDCPNFYYD  185

Query  897   LEDLV--AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGN  724
             LED++   +     + S+S+HR +++ G S  S  N + +LCVYA IC+++G   R+PG+
Sbjct  186   LEDVLFNEVSRRDGAVSWSVHRPTVVFGFSPRSAMNVVGSLCVYAAICRKEGAVLRWPGS  245

Query  723   RYTWEHFCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFV  544
             R  WE F D SDA L+AE +IWA V   AKN+AFNC+NGD++ WK +W +  D F +E+ 
Sbjct  246   RVAWEGFSDASDADLIAEHEIWAAVEPFAKNEAFNCSNGDLYKWKLLWPMLADQFGVEWS  305

Query  543   AFEENGDKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSM  364
              + E  +  F +A+ M  K  +W  IVK++ L  T +EEIT +  +  V   + +H+ SM
Sbjct  306   GY-EGEESSFKLADAMSGKEAVWAEIVKENDLMDTELEEITNWWFVDAVFGVRSEHLDSM  364

Query  363   NKSKELGFLGYADTLKSIRVWVQKLREMKIIP  268
             NKSKE GFLG+ +T+ S   W++K++  KI+P
Sbjct  365   NKSKEHGFLGFRNTVNSFNTWIEKMKVFKIVP  396



>ref|XP_006386483.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
 gb|ERP64280.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
Length=390

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 227/386 (59%), Gaps = 13/386 (3%)
 Frame = -2

Query  1413  KKMGQENCSK---AVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSS  1243
             KK  ++  S+   +VAL++G TG+VG ++ E L      GGPWKVYG ARR  P+W    
Sbjct  14    KKTEEDEASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRSRPNWNEDH  73

Query  1242  FLDEYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrslt  1063
              + EY+  D  N  +T   LSK++ +VTHVF++       EEEN  +N  M  NVL+++ 
Sbjct  74    PV-EYIQCDISNTAETQSKLSKLT-DVTHVFYVTWASKSTEEENCEINGLMFRNVLQAVI  131

Query  1062  ssdssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV  883
              + ++   HV +QTG   Y GP    +L    +  H++PF ED PRL FPNFYY LED++
Sbjct  132   PNAANLR-HVCLQTGL-HYAGPF---ALLGKNIEAHDSPFTEDLPRLRFPNFYYPLEDVM  186

Query  882   -AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEH  706
                 A+    ++S+HR  +I G S  S+ N ++T+ VYA ICK +G P  + G++  W  
Sbjct  187   FEEVAKKEGVTWSVHRPGVIFGFSPYSLMNMIVTISVYAAICKHEGVPLIFHGSKEAWNS  246

Query  705   FCDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENG  526
             +   SDA L+AE +IWA V   A+N+AFN  NGD+F WK +W +  + F +E   FEE G
Sbjct  247   YSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFKWKHLWTVLAEEFGIEKYGFEE-G  305

Query  525   DKEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKEL  346
             +     AE MKDKG +W  IV++++L   ++E++  +     V       +C +NKSKE 
Sbjct  306   ESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWWFADLVFSIPGSVLC-LNKSKEH  364

Query  345   GFLGYADTLKSIRVWVQKLREMKIIP  268
             GFLG+ ++ KS   W+ K++  K++P
Sbjct  365   GFLGFRNSKKSFVSWIDKMKAYKVVP  390



>gb|EYU37597.1| hypothetical protein MIMGU_mgv11b006498mg [Erythranthe guttata]
Length=391

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/375 (42%), Positives = 224/375 (60%), Gaps = 11/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VAL++G TG+VG ++ E L      GGPWK+YG ARRP P+W   + ++ Y+  D  +
Sbjct  26    EGVALIVGVTGIVGNSLAEILPHSDTPGGPWKIYGVARRPRPTWNADNPVN-YIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              EDT   LS ++ ++THVF++       E EN  +N  ML N+L ++  +  +   H+ +
Sbjct  85    PEDTRVKLSPLT-DITHVFYVTWANKSTEAENCEVNGKMLQNLLDAVIPNSPNLK-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIP-HEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf  850
             QTG K Y+GP      +  K IP H+ P+ ED PRL   NFYY LED++    E      
Sbjct  143   QTGRKHYIGPF----ESFGKNIPTHDPPYTEDLPRLNHINFYYTLEDILFAEVEKKEGLT  198

Query  849   -sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
              SIHR   I G S  S+ N + TLCVYA ICK +G P ++PG++  WE + D SDA L+A
Sbjct  199   WSIHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGVPMKFPGSKIAWEGYSDCSDADLIA  258

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             E QIWA V   AKN+AFN +NGDVF WK  W+   + F +EFV +EE   +E  + E MK
Sbjct  259   EHQIWAAVDRFAKNEAFNVSNGDVFKWKHFWKALAEHFGVEFVEYEEG-GEEVKLEELMK  317

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DKG +W  IV+++ L  T++EE+  +     +L  +   + SMNKSKE GFLG+ ++  S
Sbjct  318   DKGSVWDEIVRENGLTVTKLEEVGTWWFSDLILGGECS-LDSMNKSKEHGFLGFRNSKSS  376

Query  312   IRVWVQKLREMKIIP  268
                W+ K++  KI+P
Sbjct  377   FVSWMYKVQACKIVP  391



>tpg|DAA45880.1| TPA: hypothetical protein ZEAMMB73_620077 [Zea mays]
Length=396

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/385 (39%), Positives = 229/385 (59%), Gaps = 10/385 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             +    E   ++VALV+G+TG+VG ++++ L       GPWKVY  +RRPLP W P+    
Sbjct  19    QAAAAEPSYQSVALVVGSTGIVGTSLLDILPLADTPAGPWKVYAVSRRPLPPWSPAPSPA  78

Query  1233  -EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltss  1057
               ++  D  +     ++L  ++ ++THVF++A      E EN   NS ML NVL  +  +
Sbjct  79    VTHLHLDLADSAAVAEALQPLT-DITHVFFVAWTNRPTEAENREANSAMLRNVLSVVVPN  137

Query  1056  dssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--  883
               + + HV +QTG K Y+GP      A  K+   + PF ED PRL  PNFYY +ED++  
Sbjct  138   CPALV-HVCLQTGRKHYVGPF----EAIGKVAAPDPPFTEDMPRLDCPNFYYDMEDILFH  192

Query  882   AIYAETNsfsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHF  703
              +     + S+S+HR + + G S  S  N + +LCVYA IC+++G   R+PG+R TWE F
Sbjct  193   EVSRRDGAVSWSVHRPTTVFGYSPRSAMNLVGSLCVYAAICRKEGTTLRWPGSRVTWEGF  252

Query  702   CDMSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGD  523
              D SDA L+AE +IWA V   AKN+AFNC+NGD+F WK +W +  D F LE+  +E   +
Sbjct  253   SDASDADLIAEHEIWAAVDPFAKNEAFNCSNGDLFKWKQLWPILADHFGLEWAGYEGEEN  312

Query  522   KEFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELG  343
             + F + E M  K  +W  IV+++ L  T ++EIT +  +  +   + Q + SMNKSKE G
Sbjct  313   R-FKLEEAMAGKEAVWAEIVRENDLIATELDEITNWWFVDAMFAVETQLLDSMNKSKEHG  371

Query  342   FLGYADTLKSIRVWVQKLREMKIIP  268
             FLG+ +T+ S   W++KL+  KI+P
Sbjct  372   FLGFRNTVSSFNTWIEKLKVFKIVP  396



>ref|XP_003562377.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brachypodium 
distachyon]
Length=396

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/377 (39%), Positives = 226/377 (60%), Gaps = 12/377 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV+G+TG+VG ++++ L      GGPWKVY  +RRPLP    S      +T   L+
Sbjct  28    QSVALVVGSTGIVGTSLLDILPLQDTPGGPWKVYALSRRPLPP--WSPPPSPAVTHLHLD  85

Query  1206  FEDTHKSLSKIS--NEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHV  1033
               D+      ++   ++THVF++A      E +N   NS ML NVL  +  +  + + HV
Sbjct  86    LADSAAVADALTPLTDITHVFYVAWSNHPTEAQNREANSAMLRNVLSVVVPNCPALV-HV  144

Query  1032  TIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV--AIYAETNs  859
              +QTG K Y+GP      A  K+   + P+ ED PRL +PNFYY  ED++   +     +
Sbjct  145   CLQTGRKHYIGPF----EAIGKIPAPDPPYTEDMPRLDYPNFYYDQEDVLFDEVSRRGGA  200

Query  858   fsfsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARL  679
              S+S+HR + I G S  S  N + +LCVYA IC+++G   R+PG++  WE F D SDA L
Sbjct  201   VSWSVHRPTTIFGFSPRSAMNVVGSLCVYAAICRKEGATMRWPGSKVAWEGFSDSSDADL  260

Query  678   LAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEF  499
             +AE +IWA V   AKN+AFNC+NGD++ WK +W +  D FE+E+  ++   ++ F + + 
Sbjct  261   IAEHEIWAAVDPFAKNEAFNCSNGDLYKWKQLWPMLADHFEVEWAGYDGEENR-FMLTQA  319

Query  498   MKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTL  319
             M  K  +W  I++++ L RT +EEIT +  +  +   + QH+ SMNKSKE GFLG+ +T 
Sbjct  320   MAGKEAVWAEILQENELIRTELEEITNWWFVDALFNVETQHLDSMNKSKEHGFLGFRNTT  379

Query  318   KSIRVWVQKLREMKIIP  268
              S   W++K++  KI+P
Sbjct  380   NSFNTWIEKMKVFKIVP  396



>ref|XP_002304533.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
 gb|ABK95799.1| unknown [Populus trichocarpa]
 gb|EEE79512.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
Length=389

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 220/375 (59%), Gaps = 11/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKV+G ARR  P+W     + EY+  D  +
Sbjct  24    QSVALIIGVTGIVGNSLAEILPLSDTPGGPWKVHGVARRSRPNWNQDHPV-EYIQCDIAD  82

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                T   LSK++ +VTH+F++     + E EN  +N  M  NVL+++  +  +   HV +
Sbjct  83    TAQTQSKLSKLT-DVTHIFYVTWASKDTEVENCEINGLMFRNVLQAVIPNAPNLR-HVCL  140

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRL-PFPNFYYALEDLV-AIYAETNsfs  853
             QTG K Y+GP         K+  H+ PF ED PRL  FPNFYY LED++    A+    +
Sbjct  141   QTGGKHYLGPF----ELLGKIEAHDPPFTEDLPRLNDFPNFYYTLEDVMYEEVAKKEGVT  196

Query  852   fsihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLA  673
             +S+HR  +I G S  S+ N ++T+ VYA ICK +G P  +PG +  W  +   SDA L+A
Sbjct  197   WSVHRPDVIFGFSPHSLMNMIVTISVYAAICKHEGAPLIFPGTKEAWNSYAIASDANLIA  256

Query  672   EQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMK  493
             E +IWA V  KAKN+AFN  NGD+F WK +W +    F +E   F E G+     AE MK
Sbjct  257   EHEIWACVEPKAKNEAFNIHNGDIFKWKHLWTVLAQEFGIEKYGFVE-GESSVTFAEKMK  315

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DKG +W  IVKK++L   ++E++  +     ++      V SMNK+KE GFLG+ ++ KS
Sbjct  316   DKGPVWEEIVKKNQLLANKLEQVGGW-WFGDLMFSGPGCVTSMNKAKEHGFLGFRNSKKS  374

Query  312   IRVWVQKLREMKIIP  268
                W+ K+R  K++P
Sbjct  375   FVSWIHKMRAYKVVP  389



>gb|ABD33272.2| hypothetical protein MtrDRAFT_AC158501g31v2 [Medicago truncatula]
Length=366

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 214/374 (57%), Gaps = 34/374 (9%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             + VAL+IG TG+VG ++ E L      GGPWKVYG ARRP P+  P +            
Sbjct  26    QNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPNLSPLT------------  73

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                          +VTH+F+++      E +N ++N +ML NVLR+L  +  +   HV++
Sbjct  74    -------------DVTHIFYVSWTSMPTEAQNCKVNGSMLRNVLRALIPNTLNLC-HVSL  119

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y G          K+ PHE+PF ED PRL  PNFY+  ED L+    +    ++
Sbjct  120   QTGIKHYFGSF----EIVGKIKPHESPFTEDVPRLVTPNFYHTQEDILLEEVGKKKGMTW  175

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
              I+R  +I G S  S+ N + TLCVYA ICK +G P R+PG++  WE +   SDA L++E
Sbjct  176   FINRPQVIFGFSPYSMMNLIGTLCVYAAICKHEGLPLRFPGSKGAWECYSTASDANLISE  235

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
             Q IW  V   AKN+AFNC+NGDVF WK +W++  + FE++   FEE    E  +++ MKD
Sbjct  236   QHIWGAVDPNAKNEAFNCSNGDVFRWKHLWKVLAERFEIDDYGFEEG--SELRLSDLMKD  293

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV+++ L  T++EE+  +     + R +   + SMNKSKE GFLG+ ++    
Sbjct  294   KGGVWEEIVRENELLYTKLEEVGDWWFADFMFRVE-GVLDSMNKSKEHGFLGFRNSKNVF  352

Query  309   RVWVQKLREMKIIP  268
               W+ K +  KI+P
Sbjct  353   ISWIDKTKVYKIVP  366



>ref|XP_008236416.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like 
[Prunus mume]
Length=395

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 153/378 (40%), Positives = 221/378 (58%), Gaps = 13/378 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV G TG+VG ++ E L  P   GGPWKVYG ARR  P W     + EY+  D  +
Sbjct  26    QSVALVAGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRARPEWNADHHI-EYIQCDLSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                TH  LS+++ +VTHVF++       E EN   N  M  N+L ++  +  +   H+ +
Sbjct  85    PHQTHSELSQLT-DVTHVFYVTWASKPTEAENCEANGNMFRNLLDAVIPNAPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALED-LVAIYAETNsfsf  850
             QTG K Y+GP         K  PHE PF ED PRL  PNFYY LED L     +    ++
Sbjct  143   QTGRKHYIGPF----EMWGKFEPHEPPFHEDLPRLNVPNFYYTLEDILFEEVKKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR S+I G S  S+ N + +LCVYA ICK  G   R+ G+R  W  + D SDA L+AE
Sbjct  199   SVHRPSVIFGFSPYSLMNIVGSLCVYAAICKHIGKKLRFSGSRGAWNGYXDASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEF----DIAE  502
              +IWA V   AKN+AFNC+NGDV  WK +WR+  + F++EF  F+++ + E      + E
Sbjct  259   HEIWAAVDPYAKNEAFNCSNGDVCKWKNLWRVLAEQFDMEFEDFDDDDEGEGESRPSMEE  318

Query  501   FMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADT  322
              MKDKG +W  IV+++ L  T++EEI  +  +  +   +   V SMNKSK+ GF+G+ ++
Sbjct  319   MMKDKGPVWDEIVRENGLVPTKLEEIGNWWFVDVIFGVE-SSVDSMNKSKDHGFVGFRNS  377

Query  321   LKSIRVWVQKLREMKIIP  268
               S   W+ K++  +++P
Sbjct  378   RTSFVTWIDKMKSYRLVP  395



>ref|XP_002967521.1| hypothetical protein SELMODRAFT_86439 [Selaginella moellendorffii]
 gb|EFJ32120.1| hypothetical protein SELMODRAFT_86439 [Selaginella moellendorffii]
Length=394

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 223/372 (60%), Gaps = 13/372 (3%)
 Frame = -2

Query  1377  ALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALNFED  1198
             AL++G TG+VG ++VEAL++P A G PW++ G ARRP P WF    +D Y+  + LN  +
Sbjct  27    ALIVGVTGIVGNSLVEALQRPDAPGAPWRIRGIARRPRPRWFEHLDVD-YIQCNLLNLSE  85

Query  1197  THKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTIQTG  1018
                 +S +   VTHVFW+A +    EEEN   N  ML +VL++L         HV +QTG
Sbjct  86    VTPKISSLDG-VTHVFWVAWEKKSTEEENCEANGFMLRSVLQTLLPVAKRLK-HVCLQTG  143

Query  1017  TKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLP-FPNFYYALEDLV-AIYAETNsfsfsi  844
              K Y+GP F     T K   +  PF ED PR+P  PNFYY LED++    + ++  ++S+
Sbjct  144   VKHYLGPYF--HFGTIKH--YRPPFHEDLPRVPGLPNFYYDLEDILFEACSPSSGITWSV  199

Query  843   hrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQQ  664
             HR +II G +  +  N L +L +YA ICK +   F +PGNR +WE   ++SDA L+AEQ+
Sbjct  200   HRPNIIFGFAPRNHANVLGSLAIYAAICKHQKLSFNFPGNRQSWETLTNVSDADLVAEQE  259

Query  663   IWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKDKG  484
             +WA    +AKN+AFN  +GD  +W+ +W +    F+LE   ++    K   + + +K+K 
Sbjct  260   LWAATNPRAKNEAFNVADGDCTSWERLWAVMAREFKLECPVYD---GKPVSLDQLLKNKK  316

Query  483   EIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSIRV  304
              +W  IV ++ L  T +++ T + A+   L F FQ V  MNKSKE GFL Y ++ KS+  
Sbjct  317   NVWEQIVVENGLLETAVQDETWW-AVDLCLNFPFQVVSCMNKSKEHGFLSYRNSEKSVIY  375

Query  303   WVQKLREMKIIP  268
             W++K++E  I+P
Sbjct  376   WIRKMKEKNILP  387



>ref|XP_010556421.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Tarenaya hassleriana]
Length=384

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 222/384 (58%), Gaps = 10/384 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK+  E   ++V L+IG TG+VG ++   L      GGPWKVYG ARRP P W     + 
Sbjct  9     KKLDAEPHYRSVGLIIGVTGIVGNSLAGILPLSDTSGGPWKVYGVARRPRPDWTTDQQI-  67

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
             +Y+  D  +  D    LS ++ +VTH+F++     E E EN   N+ ML NVLR++    
Sbjct  68    QYIQCDVSDAIDVRTKLSPLT-DVTHIFYVTWTNRETESENCSANAAMLRNVLRAVVPHA  126

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIY  874
              +   HV +QTGTK Y GP FD ++A      H++PF ED PRL   NFYY  ED++   
Sbjct  127   PNLR-HVCLQTGTKHYAGP-FD-NVAGRSF--HDSPFTEDLPRLSLRNFYYDQEDVLFEE  181

Query  873   AETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCD  697
              E       S+HR + I G S  S+ N + +LCVYA ICK +G P  +PG++  WE F  
Sbjct  182   VEKKEGLTWSVHRPNRIFGFSPYSLINMVGSLCVYAAICKHEGSPLMFPGSKAAWEGFTV  241

Query  696   MSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCD-MFELEFVAFEENGDK  520
              SDA L+AEQ+IWA     AKN+AFNC NGDVF WK +W++  +     E+   EE G +
Sbjct  242   ASDADLVAEQEIWAATDPYAKNKAFNCNNGDVFKWKHLWKILAEKFEIEEYGFEEEEGRE  301

Query  519   EFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGF  340
             +  + + M+ K  +WG IVK+  L +T+MEE+  +  +  +LR +    C MNKSKE GF
Sbjct  302   KVGLVKMMEGKDRVWGEIVKEKDLEKTKMEEMGEWWVVDLILRVEGMVDC-MNKSKEHGF  360

Query  339   LGYADTLKSIRVWVQKLREMKIIP  268
             L + ++ KS   W+ K R  KI+P
Sbjct  361   LAFRNSTKSFAYWIDKYRAHKIVP  384



>ref|XP_011088182.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Sesamum indicum]
Length=390

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 217/374 (58%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW    +   Y+  D LN
Sbjct  26    ESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSW-SDDYPINYIQCDVLN  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ ++THVF+        E EN   N  ML NVL ++  +  +   H+ +
Sbjct  85    RDDTQAKLSTLT-DITHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCPNLK-HICM  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP F+     +  +  E P+ ED PRL + NFYY LED++    E       
Sbjct  143   QTGRKHYVGP-FEAFGKLETQL--ETPYTEDMPRLNYINFYYTLEDILCKEVEKKEGLTW  199

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLC YA ICK +G   R+PG +  W+ + D SDA L+AE
Sbjct  200   SVHRPGTIFGFSPHSMMNLVGTLCAYAAICKHEGKVLRFPGCKEAWDGYSDCSDADLIAE  259

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN  NGDV+ WK +W++  + F +E    EE     F+    MKD
Sbjct  260   HQIWAAVDPHAKNEAFNVNNGDVYKWKHLWKVLAEQFGVECGEHEEGQTITFE--GLMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  +V+++ L  T++E++  +     +L  +   + +MNKSKE GFLG+ ++ KS 
Sbjct  318   KGGVWDEMVRENGLTPTKLEDVGLWWFADVILGNKC-FLDTMNKSKEHGFLGFRNSKKSF  376

Query  309   RVWVQKLREMKIIP  268
               W++K++  KI+P
Sbjct  377   ISWIEKVKANKIVP  390



>ref|XP_011029002.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 148/374 (40%), Positives = 225/374 (60%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYGAARR  P+W     + EY+  D  +
Sbjct  26    QSVALILGVTGIVGNSLAEILPLSDTPGGPWKVYGAARRSRPNWNVDHPV-EYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
               +T   LSK++ +VTH+F++       EEEN  +N  M  NVL+++  +  +   HV +
Sbjct  85    TAETQSKLSKLA-DVTHIFYVTWASKPTEEENCEINGLMFRNVLQAVIPNAPNLR-HVCL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLV-AIYAETNsfsf  850
             QTG KQY+GP         K+  H+ PF ED PRL  PNFYY LED++    A+    ++
Sbjct  143   QTGGKQYVGPF----ELYGKIEAHDPPFTEDLPRLNAPNFYYTLEDVMFEEVAKKEGVTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR  +I G S  S+ N ++T+ VYA ICK +G P  + G++  W  +   SDA L+AE
Sbjct  199   SVHRPDVIFGFSPYSLMNLIVTISVYAAICKHEGAPLIFRGSKEAWNGYAIASDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              +IWA V   A+N+AFN  NGD+F WK +WR+  + F +E   FEE G+     AE MKD
Sbjct  259   HEIWACVDPNAQNEAFNIHNGDLFKWKHLWRILAEEFGIEEYGFEE-GESSITFAEAMKD  317

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             K ++W  IVKK++L   ++E++  +     ++      V ++NK+KE GFLG+ ++ KS 
Sbjct  318   KEQVWEEIVKKNQLLPNKLEQVGGW-WFADLIFGGPGIVTNLNKTKEHGFLGFRNSKKSF  376

Query  309   RVWVQKLREMKIIP  268
               W+ K+++ K++P
Sbjct  377   VSWLDKMKDYKVVP  390



>ref|XP_011088183.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Sesamum indicum]
Length=389

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 217/374 (58%), Gaps = 10/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL+IG TG+VG ++ E L      GGPWKVYG ARRP PSW    +   Y+  D LN
Sbjct  25    ESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSW-SDDYPINYIQCDVLN  83

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS ++ ++THVF+        E EN   N  ML NVL ++  +  +   H+ +
Sbjct  84    RDDTQAKLSTLT-DITHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCPNLK-HICM  141

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP F+     +  +  E P+ ED PRL + NFYY LED++    E       
Sbjct  142   QTGRKHYVGP-FEAFGKLETQL--ETPYTEDMPRLNYINFYYTLEDILCKEVEKKEGLTW  198

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLC YA ICK +G   R+PG +  W+ + D SDA L+AE
Sbjct  199   SVHRPGTIFGFSPHSMMNLVGTLCAYAAICKHEGKVLRFPGCKEAWDGYSDCSDADLIAE  258

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
              QIWA V   AKN+AFN  NGDV+ WK +W++  + F +E    EE     F+    MKD
Sbjct  259   HQIWAAVDPHAKNEAFNVNNGDVYKWKHLWKVLAEQFGVECGEHEEGQTITFE--GLMKD  316

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  +V+++ L  T++E++  +     +L  +   + +MNKSKE GFLG+ ++ KS 
Sbjct  317   KGGVWDEMVRENGLTPTKLEDVGLWWFADVILGNKC-FLDTMNKSKEHGFLGFRNSKKSF  375

Query  309   RVWVQKLREMKIIP  268
               W++K++  KI+P
Sbjct  376   ISWIEKVKANKIVP  389



>ref|XP_010556422.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Tarenaya hassleriana]
Length=383

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 222/384 (58%), Gaps = 10/384 (3%)
 Frame = -2

Query  1413  KKMGQENCSKAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLD  1234
             KK+  E   ++V L+IG TG+VG ++   L      GGPWKVYG ARRP P W     + 
Sbjct  8     KKLDAEPHYRSVGLIIGVTGIVGNSLAGILPLSDTSGGPWKVYGVARRPRPDWTTDQQI-  66

Query  1233  EYMTFDALNFEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssd  1054
             +Y+  D  +  D    LS ++ +VTH+F++     E E EN   N+ ML NVLR++    
Sbjct  67    QYIQCDVSDAIDVRTKLSPLT-DVTHIFYVTWTNRETESENCSANAAMLRNVLRAVVPHA  125

Query  1053  ssslSHVTIQTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIY  874
              +   HV +QTGTK Y GP FD ++A      H++PF ED PRL   NFYY  ED++   
Sbjct  126   PNLR-HVCLQTGTKHYAGP-FD-NVAGRSF--HDSPFTEDLPRLSLRNFYYDQEDVLFEE  180

Query  873   AETNsfsf-sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCD  697
              E       S+HR + I G S  S+ N + +LCVYA ICK +G P  +PG++  WE F  
Sbjct  181   VEKKEGLTWSVHRPNRIFGFSPYSLINMVGSLCVYAAICKHEGSPLMFPGSKAAWEGFTV  240

Query  696   MSDARLLAEQQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCD-MFELEFVAFEENGDK  520
              SDA L+AEQ+IWA     AKN+AFNC NGDVF WK +W++  +     E+   EE G +
Sbjct  241   ASDADLVAEQEIWAATDPYAKNKAFNCNNGDVFKWKHLWKILAEKFEIEEYGFEEEEGRE  300

Query  519   EFDIAEFMKDKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGF  340
             +  + + M+ K  +WG IVK+  L +T+MEE+  +  +  +LR +    C MNKSKE GF
Sbjct  301   KVGLVKMMEGKDRVWGEIVKEKDLEKTKMEEMGEWWVVDLILRVEGMVDC-MNKSKEHGF  359

Query  339   LGYADTLKSIRVWVQKLREMKIIP  268
             L + ++ KS   W+ K R  KI+P
Sbjct  360   LAFRNSTKSFAYWIDKYRAHKIVP  383



>ref|XP_007201077.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
 gb|EMJ02276.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
Length=392

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/375 (39%), Positives = 217/375 (58%), Gaps = 10/375 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VALV G TG+VG ++ + L  P   GGPWKVYG ARR  P W     + EY+  D  +
Sbjct  26    QSVALVAGVTGIVGNSLADILPLPDTPGGPWKVYGVARRARPDWNADHPI-EYIQCDLSD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
                TH  LS+++ +VTH+F++       E EN   N  M  N+L ++  +  +   H+ +
Sbjct  85    PHQTHSELSQLT-DVTHIFYVTWASKPTEAENCEANGNMFRNLLDAVIPNAPNLQ-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsfs  847
             QTG K Y+G          K+ PHE PF ED PRL  PNFYY LED++    +    ++S
Sbjct  143   QTGRKHYVGSF----EMLGKVEPHEPPFHEDLPRLNVPNFYYTLEDILFEEVKKEGLTWS  198

Query  846   ihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAEQ  667
             +HR ++I G S   + N + +LCVYA ICK  G   R+ G+R  W  + D SDA L+AE 
Sbjct  199   VHRPTVIFGFSPYCLMNIVGSLCVYAAICKHVGKKLRFSGSRGVWNGYWDASDADLIAEH  258

Query  666   QIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDM--FELEFVAFEENGDKEFDIAEFMK  493
             QIWA V   AKN+AFNC+NGDV+ WK +WR+  +    E E    ++ G+    + E MK
Sbjct  259   QIWAAVDPYAKNEAFNCSNGDVYKWKHLWRVLAEQFDMEFEDFDDDDEGELRPSMEEMMK  318

Query  492   DKGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKS  313
             DKG +W  IV+++ L  T++EEI  +  +  +   +   V SMNKSKE GF+G+ ++  S
Sbjct  319   DKGPVWDEIVRENDLVPTKLEEIGNWWFVDVMFGVE-SSVDSMNKSKEHGFVGFRNSRTS  377

Query  312   IRVWVQKLREMKIIP  268
                W+ K++  +++P
Sbjct  378   FVTWIDKMKSYRLVP  392



>emb|CDO97253.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/374 (39%), Positives = 213/374 (57%), Gaps = 13/374 (3%)
 Frame = -2

Query  1386  KAVALVIGATGMVGVAMVEALKQPTALGGPWKVYGAARRPLPSWFPSSFLDEYMTFDALN  1207
             ++VAL++G TG+VG ++ E L      GGPWKVYG ARRP PSW     +  Y+  D  +
Sbjct  26    QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGLARRPRPSWNADHPI-HYIQCDISD  84

Query  1206  FEDTHKSLSKISNEVTHVFWLALQVDEMEEENIRLNSTMLDNVlrsltssdssslSHVTI  1027
              +DT   LS + +++TH+F++       E +N ++N  M  N+L ++  S  +   H+ +
Sbjct  85    PQDTQSKLSHL-DDITHLFYVTWANRSTELDNCQVNGNMFRNLLSAVIPSSPNLR-HICL  142

Query  1026  QTGTKQYMGPIFDPSLATDKMIPHEAPFKEDYPRLPFPNFYYALEDLVAIYAETNsfsf-  850
             QTG K Y+GP           + H+ PF ED PRL   NFYY LED++    +       
Sbjct  143   QTGRKHYLGP-----FELFGKVGHDPPFHEDLPRLDVQNFYYTLEDILFEEVQKKEGLTW  197

Query  849   sihrssiiIGASSLSVFNSLLTLCVYATICKEKGFPFRYPGNRYTWEHFCDMSDARLLAE  670
             S+HR   I G S  S+ N + TLCVYA ICK +G P ++PG R  W+ + D SDA L+AE
Sbjct  198   SVHRPGNIFGFSPYSLMNIVGTLCVYAAICKHEGAPLKFPGCREAWDGYSDCSDADLIAE  257

Query  669   QQIWAGVTEKAKNQAFNCTNGDVFAWKTIWRLFCDMFELEFVAFEENGDKEFDIAEFMKD  490
               IWA V   AKN+AFN +NGDVF WK  W++  + F  E   +E        + E MKD
Sbjct  258   HHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGAECGEYEGG---PLSLKEMMKD  314

Query  489   KGEIWGGIVKKHRLFRTRMEEITCYPALQTVLRFQFQHVCSMNKSKELGFLGYADTLKSI  310
             KG +W  IV++  L  T++EE+  +     VL++    + +MNKSKE GFLG+ ++  + 
Sbjct  315   KGPVWDEIVREKGLVPTKLEEVGVWWFADVVLQYPCL-LDTMNKSKEHGFLGFRNSKNAF  373

Query  309   RVWVQKLREMKIIP  268
               W+ K++  KI+P
Sbjct  374   ISWIDKVKAYKIVP  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3958969345722