BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25236_g9_i2 len=1833 path=[1863:0-223 8512:224-350 2214:351-391
9362:392-830 2691:831-857 13276:858-881 34594:882-888 34601:889-889
13307:890-1022 2883:1023-1048 14447:1049-1060 2921:1061-1104
26858:1105-1244 3085:1245-1269 30715:1270-1484 30930:1485-1510
31522:1511-1516 31528:1517-1832]

Length=1833
                                                                      Score     E

ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    624   0.0      
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    621   0.0      
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         620   0.0      
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         619   0.0      
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    615   0.0      
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    613   0.0      
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         603   0.0      
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               578   0.0      
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    568   0.0      Vitis vinifera
emb|CBI22166.3|  unnamed protein product                                570   0.0      
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         565   0.0      
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    563   0.0      
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         559   0.0      
ref|XP_007046207.1|  Serine carboxypeptidase 46                         555   0.0      
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...    551   0.0      
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   548   0.0      
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    546   0.0      
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             545   0.0      
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         541   0.0      
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   539   0.0      
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             539   0.0      
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         537   0.0      
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...    528   2e-179   
ref|XP_007099702.1|  Serine carboxypeptidase 46                         526   2e-178   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         525   7e-178   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     525   8e-178   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    527   1e-177   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     520   5e-176   
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         520   7e-176   
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45         509   8e-172   
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640          509   1e-171   
ref|XP_006829355.1|  hypothetical protein AMTR_s02986p00003470          470   5e-157   
ref|XP_007046209.1|  Serine carboxypeptidase 46 isoform 2               431   2e-142   
gb|ABK26025.1|  unknown                                                 404   6e-132   Picea sitchensis
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    395   2e-127   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         390   1e-125   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         390   1e-125   Vitis vinifera
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             390   2e-125   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         389   5e-125   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         389   6e-125   
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          388   1e-124   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         387   2e-124   
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         387   4e-124   
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45-like    386   6e-124   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         386   6e-124   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    387   6e-124   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         386   9e-124   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    387   1e-123   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         385   1e-123   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         384   2e-123   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    384   3e-123   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    384   7e-123   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    383   1e-122   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         383   1e-122   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             383   1e-122   
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             383   1e-122   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         382   2e-122   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                383   2e-122   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    382   2e-122   
gb|ABK25202.1|  unknown                                                 382   3e-122   Picea sitchensis
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         382   3e-122   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    383   3e-122   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    382   4e-122   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   381   5e-122   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    381   5e-122   
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    381   6e-122   
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         381   7e-122   
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          380   8e-122   
emb|CDY11750.1|  BnaC03g58280D                                          380   8e-122   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                381   8e-122   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             380   1e-121   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             380   1e-121   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         380   1e-121   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         381   1e-121   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         380   1e-121   
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         380   2e-121   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    382   2e-121   
gb|ABR16719.1|  unknown                                                 380   2e-121   Picea sitchensis
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             380   2e-121   
ref|XP_002512656.1|  serine carboxypeptidase, putative                  379   2e-121   Ricinus communis
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    379   3e-121   
gb|KEH33274.1|  serine carboxypeptidase-like protein                    379   3e-121   
emb|CDY19500.1|  BnaC04g10990D                                          379   4e-121   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             379   5e-121   
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    379   5e-121   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                         378   6e-121   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         378   6e-121   Populus trichocarpa [western balsam poplar]
gb|AES77859.2|  serine carboxypeptidase-like protein                    378   7e-121   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         378   7e-121   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         378   7e-121   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         378   8e-121   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         378   1e-120   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    378   1e-120   
ref|NP_564298.1|  serine carboxypeptidase-like 45                       377   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    377   1e-120   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    377   2e-120   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         377   3e-120   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         377   3e-120   
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             377   3e-120   
emb|CDX90124.1|  BnaA08g18600D                                          376   3e-120   
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    376   3e-120   
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    377   4e-120   
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         376   5e-120   
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         376   5e-120   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         377   5e-120   
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    376   6e-120   
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45-like    375   7e-120   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         375   7e-120   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             375   8e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    375   8e-120   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         376   8e-120   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    375   8e-120   
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    375   1e-119   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    375   1e-119   
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         375   1e-119   
ref|XP_002893504.1|  SCPL45                                             375   1e-119   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             375   1e-119   
ref|NP_850212.1|  serine carboxypeptidase-like 46                       375   1e-119   Arabidopsis thaliana [mouse-ear cress]
gb|KCW64995.1|  hypothetical protein EUGRSUZ_G02537                     375   1e-119   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         375   2e-119   Vitis vinifera
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             375   2e-119   
gb|KEH35690.1|  serine carboxypeptidase-like protein                    374   2e-119   
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         374   2e-119   
gb|AAB80670.1|  putative serine carboxypeptidase II                     374   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    374   3e-119   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         374   3e-119   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         374   3e-119   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          374   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         374   3e-119   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    374   4e-119   
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    374   4e-119   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             374   5e-119   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         374   5e-119   
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         373   6e-119   
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             373   6e-119   
ref|XP_003630573.1|  Serine carboxypeptidase                            373   6e-119   
ref|NP_001151474.1|  LOC100285107 precursor                             374   7e-119   Zea mays [maize]
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          373   7e-119   Zea mays [maize]
gb|EAY93940.1|  hypothetical protein OsI_15713                          373   1e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    372   1e-118   
ref|XP_002511104.1|  serine carboxypeptidase, putative                  372   1e-118   Ricinus communis
gb|EEC68261.1|  hypothetical protein OsI_36290                          373   1e-118   Oryza sativa Indica Group [Indian rice]
ref|NP_001176565.1|  Os11g0522900                                       373   1e-118   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    372   1e-118   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         373   2e-118   
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    372   2e-118   
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         372   2e-118   
ref|XP_002517289.1|  serine carboxypeptidase, putative                  371   3e-118   Ricinus communis
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    371   4e-118   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                372   4e-118   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              371   5e-118   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    371   5e-118   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         370   5e-118   
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             370   5e-118   
ref|NP_001052663.1|  Os04g0396800                                       371   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         370   6e-118   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         370   9e-118   
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             370   1e-117   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             370   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          370   1e-117   Sorghum bicolor [broomcorn]
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    370   2e-117   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    369   2e-117   
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    369   2e-117   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         369   2e-117   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         369   3e-117   
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         369   4e-117   
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    369   4e-117   
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         369   4e-117   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         368   5e-117   
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         368   7e-117   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             367   7e-117   Populus trichocarpa [western balsam poplar]
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          367   9e-117   
emb|CBI32794.3|  unnamed protein product                                367   1e-116   
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    367   1e-116   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         367   1e-116   
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    367   2e-116   
ref|XP_007028221.1|  Serine carboxypeptidase 45                         367   2e-116   
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         367   2e-116   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         367   2e-116   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         367   3e-116   
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    368   4e-116   
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         366   5e-116   
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         366   5e-116   
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         365   7e-116   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         365   9e-116   
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    365   9e-116   
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             365   1e-115   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    365   1e-115   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         364   1e-115   
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         365   1e-115   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         364   2e-115   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         363   2e-115   
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         364   2e-115   
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    364   2e-115   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    364   3e-115   
emb|CDY61693.1|  BnaC05g51120D                                          363   3e-115   
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             364   3e-115   
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         364   3e-115   
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    364   4e-115   
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700          363   6e-115   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                363   7e-115   
emb|CDO98312.1|  unnamed protein product                                362   8e-115   
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    364   9e-115   
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         363   9e-115   
gb|KDP37690.1|  hypothetical protein JCGZ_06347                         362   1e-114   
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    362   1e-114   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                362   1e-114   
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45         363   1e-114   
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         362   2e-114   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like    361   2e-114   
ref|XP_006380972.1|  hypothetical protein POPTR_0006s03480g             362   2e-114   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         361   2e-114   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         361   2e-114   
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               362   3e-114   
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    361   3e-114   
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    362   4e-114   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    360   6e-114   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               361   7e-114   
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         360   8e-114   
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    360   9e-114   
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         360   1e-113   
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                359   1e-113   
emb|CDX80725.1|  BnaC08g05590D                                          359   2e-113   
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         359   2e-113   
gb|KEH35413.1|  serine carboxypeptidase-like protein                    359   2e-113   
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             359   3e-113   
gb|KHG30064.1|  Serine carboxypeptidase-like 45                         359   3e-113   
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               358   3e-113   
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         360   3e-113   
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    358   4e-113   
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             358   4e-113   
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    357   5e-113   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         357   7e-113   
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    357   9e-113   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         357   1e-112   Vitis vinifera
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             357   1e-112   
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     357   1e-112   
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    357   1e-112   
emb|CBI32795.3|  unnamed protein product                                357   1e-112   
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    361   1e-112   
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    357   1e-112   
emb|CDY48945.1|  BnaA08g04690D                                          357   1e-112   
ref|XP_006380973.1|  hypothetical protein POPTR_0006s03480g             357   2e-112   
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                357   2e-112   
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    356   2e-112   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             356   2e-112   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             357   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                356   3e-112   
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    356   3e-112   
gb|KEH37845.1|  serine carboxypeptidase-like protein                    356   3e-112   
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    356   4e-112   
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    356   5e-112   
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          355   7e-112   
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         355   9e-112   
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    355   1e-111   
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                356   1e-111   
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         354   1e-111   
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         355   2e-111   
ref|NP_175046.1|  serine carboxypeptidase-like 44                       354   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          353   3e-111   
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         353   3e-111   
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         353   4e-111   
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42-like    353   4e-111   
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    353   5e-111   
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    353   7e-111   
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         353   7e-111   
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             353   7e-111   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         352   8e-111   
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like    352   9e-111   
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    352   9e-111   
ref|XP_002891272.1|  predicted protein                                  352   1e-110   
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         352   1e-110   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         352   1e-110   
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         352   1e-110   
emb|CDP12019.1|  unnamed protein product                                352   1e-110   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    351   2e-110   
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         352   2e-110   
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         352   2e-110   
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               351   2e-110   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    351   2e-110   
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                351   2e-110   
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    351   2e-110   
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         352   2e-110   
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             351   3e-110   
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         351   3e-110   
ref|XP_004159625.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    351   3e-110   
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         350   4e-110   
ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    351   4e-110   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                350   4e-110   
ref|XP_002526159.1|  serine carboxypeptidase, putative                  350   5e-110   
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         350   8e-110   
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    351   8e-110   
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         350   8e-110   
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         350   8e-110   
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    350   9e-110   
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    350   1e-109   
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         349   1e-109   
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         349   2e-109   
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          349   2e-109   
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    349   2e-109   
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                348   3e-109   
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             348   3e-109   
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         348   3e-109   
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    348   3e-109   
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    348   3e-109   
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         349   4e-109   
ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    348   4e-109   
ref|XP_008443350.1|  PREDICTED: serine carboxypeptidase-like 45         348   4e-109   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like    348   6e-109   
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         348   6e-109   
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        348   6e-109   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         347   8e-109   
ref|XP_004136677.1|  PREDICTED: serine carboxypeptidase-like 45-like    347   9e-109   
ref|XP_002517286.1|  serine carboxypeptidase, putative                  345   2e-108   
ref|NP_199039.1|  serine carboxypeptidase-like 42                       346   2e-108   
ref|NP_001067496.1|  Os11g0213600                                       345   3e-108   
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         345   4e-108   
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         345   5e-108   
gb|KGN44500.1|  hypothetical protein Csa_7G319000                       345   7e-108   
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         345   8e-108   
ref|XP_002520628.1|  serine carboxypeptidase, putative                  344   1e-107   
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like    343   1e-107   
ref|NP_199038.1|  serine carboxypeptidase-like 41                       344   1e-107   
gb|ABK25236.1|  unknown                                                 344   1e-107   
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             343   2e-107   
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         343   2e-107   
gb|AAD28662.1|  putative serine carboxypeptidase II                     343   3e-107   
emb|CAN72076.1|  hypothetical protein VITISV_041583                     343   3e-107   
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         343   4e-107   
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45         343   4e-107   
ref|NP_001183841.1|  hypothetical protein precursor                     342   6e-107   
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    342   1e-106   
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             342   1e-106   
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         341   2e-106   
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42         341   2e-106   
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         341   3e-106   
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    341   3e-106   
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         340   3e-106   
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         340   3e-106   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         340   4e-106   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    337   1e-105   
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         338   2e-105   
gb|EEE51848.1|  hypothetical protein OsJ_33355                          338   3e-105   
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45         338   3e-105   
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    337   5e-105   
gb|ACM17527.1|  putative serine carboxy peptidase                       336   1e-104   
emb|CAN70439.1|  hypothetical protein VITISV_011900                     336   1e-104   
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             335   2e-104   
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             335   5e-104   
emb|CBI32802.3|  unnamed protein product                                344   5e-104   
emb|CDY23340.1|  BnaA08g12060D                                          335   6e-104   
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             334   6e-104   
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         333   1e-103   
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45         332   2e-103   
gb|EMT29573.1|  Serine carboxypeptidase-like 45                         336   2e-103   
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg             332   9e-103   
emb|CBI32801.3|  unnamed protein product                                330   9e-103   
gb|KDO53634.1|  hypothetical protein CISIN_1g0128612mg                  328   1e-102   
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          332   1e-102   
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45         330   3e-102   
ref|XP_004173353.1|  PREDICTED: serine carboxypeptidase-like 42-like    327   4e-102   
ref|XP_006578942.1|  PREDICTED: serine carboxypeptidase-like 42-l...    329   4e-102   
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          328   6e-102   
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             328   2e-101   
gb|KHN30339.1|  Serine carboxypeptidase-like 45                         328   2e-101   
ref|XP_009107654.1|  PREDICTED: serine carboxypeptidase-like 44 i...    325   3e-101   
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         327   3e-101   
emb|CDX93108.1|  BnaA03g38300D                                          325   2e-100   
gb|EAY80352.1|  hypothetical protein OsI_35523                          325   1e-99    
emb|CDY70042.1|  BnaCnng66490D                                          322   1e-99    
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                  321   2e-99    
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          322   2e-99    
ref|XP_010055737.1|  PREDICTED: serine carboxypeptidase-like 45         323   2e-99    
ref|XP_006830556.1|  hypothetical protein AMTR_s00117p00106310          322   6e-99    
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    320   1e-98    
ref|XP_001776058.1|  predicted protein                                  319   1e-98    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         320   1e-98    
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg             319   1e-98    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         321   1e-98    
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...    318   2e-98    
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             319   3e-98    
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor     320   3e-98    
ref|NP_178937.2|  serine carboxypeptidase-like 43                       318   5e-98    
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                    317   9e-98    
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    318   1e-97    
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             318   2e-97    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    317   2e-97    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         317   2e-97    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         317   2e-97    
gb|KGN59387.1|  hypothetical protein Csa_3G816000                       318   3e-97    
ref|XP_010055727.1|  PREDICTED: serine carboxypeptidase-like 45         317   4e-97    
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              317   4e-97    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             317   4e-97    
ref|XP_010055765.1|  PREDICTED: serine carboxypeptidase-like 45         317   5e-97    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         316   5e-97    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          317   6e-97    
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              316   7e-97    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              316   1e-96    
dbj|BAJ85578.1|  predicted protein                                      316   1e-96    
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           315   2e-96    
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    315   2e-96    
ref|XP_002529402.1|  serine carboxypeptidase, putative                  315   2e-96    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    315   2e-96    
ref|NP_001031351.1|  serine carboxypeptidase-like 43                    314   3e-96    
ref|NP_194790.1|  serine carboxypeptidase 24                            314   3e-96    
dbj|BAJ92218.1|  predicted protein                                      316   3e-96    
gb|KCW90013.1|  hypothetical protein EUGRSUZ_A02209                     314   6e-96    
emb|CDY66139.1|  BnaAnng21620D                                          314   6e-96    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         313   8e-96    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             312   2e-95    
emb|CBI29056.3|  unnamed protein product                                313   2e-95    
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                313   2e-95    
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            312   2e-95    
ref|XP_008443181.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   2e-95    
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         313   3e-95    
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         311   4e-95    
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         311   5e-95    
ref|XP_011041420.1|  PREDICTED: serine carboxypeptidase-like 45         314   5e-95    
ref|XP_004488374.1|  PREDICTED: serine carboxypeptidase-like 45-like    313   6e-95    
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             311   8e-95    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             310   1e-94    
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    310   1e-94    
ref|XP_004488543.1|  PREDICTED: serine carboxypeptidase-like 45-like    313   1e-94    
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   310   1e-94    
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          310   2e-94    
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              310   2e-94    
emb|CDP10248.1|  unnamed protein product                                309   2e-94    
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            310   2e-94    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    310   3e-94    
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         309   4e-94    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         309   4e-94    
ref|NP_001150705.1|  LOC100284338 precursor                             309   4e-94    
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         310   4e-94    
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            309   4e-94    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         309   4e-94    
gb|KCW90015.1|  hypothetical protein EUGRSUZ_A02214                     309   4e-94    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    309   5e-94    
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    310   5e-94    
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       309   5e-94    
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    306   6e-94    
emb|CDP08509.1|  unnamed protein product                                309   7e-94    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         308   8e-94    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                308   8e-94    
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             308   9e-94    
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    308   9e-94    
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         308   1e-93    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    308   1e-93    
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    309   1e-93    
gb|EAY87844.1|  hypothetical protein OsI_09265                          307   2e-93    
gb|AFK47012.1|  unknown                                                 303   2e-93    
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         308   2e-93    
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    309   2e-93    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          309   2e-93    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         307   2e-93    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    308   2e-93    
ref|XP_002517750.1|  serine carboxypeptidase, putative                  308   2e-93    
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    306   3e-93    
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            306   4e-93    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         306   4e-93    
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       316   4e-93    
ref|XP_008443182.1|  PREDICTED: serine carboxypeptidase-like 45 i...    306   5e-93    
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       306   5e-93    
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          306   5e-93    
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         307   6e-93    
ref|XP_002528403.1|  serine carboxypeptidase, putative                  306   6e-93    
gb|AES59494.2|  serine carboxypeptidase-like protein                    306   8e-93    
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         307   9e-93    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    305   9e-93    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    305   9e-93    
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    306   1e-92    
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         307   1e-92    
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             305   1e-92    
ref|XP_001751694.1|  predicted protein                                  306   1e-92    
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         306   1e-92    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    305   1e-92    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    305   1e-92    
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    305   2e-92    
emb|CBI21207.3|  unnamed protein product                                305   2e-92    
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            305   2e-92    
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         305   2e-92    
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             305   2e-92    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    305   2e-92    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         304   2e-92    
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         304   2e-92    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         304   2e-92    
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            305   2e-92    
gb|AFK37459.1|  unknown                                                 304   3e-92    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          304   3e-92    
ref|XP_003592367.1|  Serine carboxypeptidase-like protein               305   3e-92    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         304   3e-92    
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    304   3e-92    
gb|EMS56738.1|  Serine carboxypeptidase-like 42                         303   4e-92    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             304   4e-92    
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                303   6e-92    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    303   6e-92    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         305   7e-92    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         303   7e-92    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       303   7e-92    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             303   8e-92    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         303   8e-92    



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/422 (69%), Positives = 353/422 (84%), Gaps = 3/422 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLTLWLNGGPGCSS+G+GAFMEHGPFQPG+DG L+KNKYSWNLE
Sbjct  54    LFYYFVEADSENATSLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGKDGRLIKNKYSWNLE  113

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY NW+D  TA++NL+F+L W +KFP+Y+NS+L+L GES
Sbjct  114   SNMLYVESPIGVGFSYSNTSSDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGES  173

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQL  L+L YN+K N++  KLK+IALGNPLLD++IS+ ++E+LWSHGAISD+LL
Sbjct  174   YAGHYIPQLTILLLDYNRKPNVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELL  233

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              MKR+ICN+TR +LE+I  NMSNEC  V   T EE+GSD D  DLL PIC+SS A  Q+ 
Sbjct  234   TMKRTICNETRLLLESIHNNMSNECSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLG  293

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                   + T+ K D R   GDPCLTDRI  YL +PEVQKALHANTT+LP+ WDFC G LQ
Sbjct  294   VL--GTLATIHKKDVR-KIGDPCLTDRINMYLNKPEVQKALHANTTHLPYAWDFCLGHLQ  350

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ  ++A N++P LS ILK +I +LL+SGDQDTKIP+TQTR IA +LAR+LKL+A +++G
Sbjct  351   YQRGDLAINVIPLLSNILKENIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYG  410

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD +QI GWSQS+GG I GKNV++LTFA+VRGAAHEVP+TSPSQALTLFRAFLKG PP
Sbjct  411   PWYDDMQIGGWSQSYGGVIEGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPP  470

Query  1261  PR  1266
              R
Sbjct  471   SR  472



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/424 (68%), Positives = 354/424 (83%), Gaps = 3/424 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLTLWLNGGPGCSS+G+GAF EHGPFQPG+DG L+KNKYSWNLE
Sbjct  51    LFYYFVEADSENATSLPLTLWLNGGPGCSSVGFGAFKEHGPFQPGKDGRLIKNKYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPI VGFSYSNTSSDY NW+D  TA++NL+F+L W +KFP+Y+NS+L+L GES
Sbjct  111   SNMLYIESPIRVGFSYSNTSSDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQL  L++ YN+K N++  KLK+IALGNPLLD++IS+ ++E+LWSHGAISD+LL
Sbjct  171   YAGHYIPQLTILLIDYNRKPNVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELL  230

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              MKR+ICN+TR +LE+I  NMSN+C  V   T EE+GSD D  DLL PIC+SS A  Q+ 
Sbjct  231   TMKRTICNETRLLLESIHNNMSNDCSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLG  290

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                   + T+ + D R  +GDPCLTDRIY YL +PEVQKALHANTT+LP+ WDFC G LQ
Sbjct  291   VLGK--LATIHEKDVR-KSGDPCLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQ  347

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ  ++A N++P LS ILK +I +LL+SGDQDTKIPVTQTR IA +LAR+LKL+A +++G
Sbjct  348   YQRGDLAINVIPLLSNILKENIQVLLYSGDQDTKIPVTQTRKIAKLLARDLKLVALDKYG  407

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD +QI GWSQS+GG   GKNV++LTFA+VRGAAHEVP+TSPSQALTLFRAFLKG PP
Sbjct  408   PWYDDLQIGGWSQSYGGVREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPP  467

Query  1261  PRTS  1272
             PR S
Sbjct  468   PRRS  471



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/423 (68%), Positives = 350/423 (83%), Gaps = 6/423 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLTLWLNGGPGCSS+G+GAFMEHGPFQPG DGNL+KNKYSWNL 
Sbjct  53    LFYYFVEADSENAASLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGIDGNLMKNKYSWNLV  112

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY NW+DT TA++NL+F+L WFKKFPQYRNSD+YL GES
Sbjct  113   SNMLYVESPIGVGFSYSNTSSDYINWDDTATAKENLQFILNWFKKFPQYRNSDVYLAGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQL  L+L YN+K N+    LK+IALGNPLLD++IS+ +A++LWSHGAISD+LL
Sbjct  173   YAGHYIPQLTVLLLDYNRKPNVEPINLKSIALGNPLLDLEISVKSAQYLWSHGAISDELL  232

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              MKR+ICN+TR +LE+I  N+SNEC  V+  T EE+GSDID  DLL P C+SS   +Q+ 
Sbjct  233   TMKRTICNETRFLLESIHNNLSNECKKVSELTDEEMGSDIDMGDLLAPTCVSSGTAKQL-  291

Query  721   FFRNNLVTTLTKIDKRVAA--GDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                  L T   K  K+      DPCLTDRI  YL +PEVQKALHANTTYLP+ WDFC G 
Sbjct  292   ---GALATIHGKFVKKAVGEVADPCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLGN  348

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y+ +++A N +P LS ILK +I +LLFSGDQD+KIP+TQTR IA +LAR++KL+A ++
Sbjct  349   LHYRREDLAVNTIPLLSNILKENIQVLLFSGDQDSKIPLTQTRKIAKLLARDVKLVALDK  408

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +G WYDG+QI GWSQSFGG   GKN+++LTFA+VRGAAHEVP+TSPSQALTLFRAFL+G+
Sbjct  409   YGSWYDGLQIGGWSQSFGGLREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGH  468

Query  1255  PPP  1263
             PPP
Sbjct  469   PPP  471



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/422 (68%), Positives = 350/422 (83%), Gaps = 3/422 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLTLWLNGGPGCSS+G+G FMEHGPFQPG+DG L+KNKYSWNLE
Sbjct  51    LFYYFVEADSENATSLPLTLWLNGGPGCSSVGFGVFMEHGPFQPGKDGRLIKNKYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY NW+D  TA++NL+F+L W +KFP+YRN DL+L GES
Sbjct  111   SNMLYVESPIGVGFSYSNTSSDYVNWDDVATAKENLQFLLNWLEKFPEYRNLDLFLAGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQL  L+L YN+K N++  KLK+IALGNPLLD++IS+ ++E+LWSHGAISD+LL
Sbjct  171   YAGHYIPQLTVLLLDYNRKPNVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELL  230

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              MKR+ICN+TR +LE+I  NMSNEC  V   T EE+GSD D+ DLL PIC+SS    Q+ 
Sbjct  231   TMKRTICNETRLLLESIHHNMSNECSKVWDLTNEEMGSDTDTGDLLAPICVSSGVAGQLG  290

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                   + ++ + D R   GDPCLTDRIY YL +PEVQKALHANTT+LP+ WDFC G LQ
Sbjct  291   VLGK--LASIHEKDVR-EIGDPCLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQ  347

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ  ++A N++P LS ILK +I +LL+SGDQDTKIP+TQTR IA +LAR+LKL+A +++G
Sbjct  348   YQRGDLAINVIPLLSNILKENIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYG  407

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYDG+QI GWSQSFGG   GKNV++LTFA++RGAAHEVP+TSPSQALTLFR FLKG  P
Sbjct  408   PWYDGLQIGGWSQSFGGVREGKNVTYLTFATIRGAAHEVPYTSPSQALTLFRTFLKGQSP  467

Query  1261  PR  1266
              R
Sbjct  468   SR  469



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/425 (67%), Positives = 355/425 (84%), Gaps = 2/425 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLTLWLNGGPGCSS+GYGAFMEHGPF+PG+DG+L+KN +SWNLE
Sbjct  51    LFYYFVEADSENAASLPLTLWLNGGPGCSSVGYGAFMEHGPFRPGKDGSLIKNNFSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVGFSYSNTSSD+ NW+DT TA++NL+F+L+WFKKFP+YRNSD+YLTGES
Sbjct  111   SNMLYVDSPIGVGFSYSNTSSDHINWDDTATAKENLQFILKWFKKFPRYRNSDVYLTGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQ A L+L YN+  N++  KLK+IALGNPLLDIDIS+ +AE+LW+HG ISD+LL
Sbjct  171   YAGHYIPQFAVLLLDYNRTPNVKPIKLKSIALGNPLLDIDISVKSAEYLWAHGVISDELL  230

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              M ++ICN+T+ ++E      SNEC  V     EE+G+DI   D+LLP C+SS+A  Q+ 
Sbjct  231   DMHKTICNETKFMIEYTHNETSNECAKVMEHKTEEMGNDIVRYDILLPKCVSSSAAGQLK  290

Query  721   FFRNNLVTTLTKIDKRVA-AGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                 NL T   K DK+V    DPCL + I  YL +PEVQKALHANTT LP++W+ CSG L
Sbjct  291   AL-GNLATVHEKFDKKVGKVADPCLKEWINLYLNKPEVQKALHANTTNLPYSWEVCSGPL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY+M+++A++I+P LS ILK HIPILLFSGDQD+ +P+TQTR IA +LA++LKL+A +++
Sbjct  350   QYKMEDVATDIIPLLSNILKQHIPILLFSGDQDSILPLTQTRKIAKLLAQDLKLVALDKY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
             GPWYDG+QI GWSQS+GG   GKNV++LTFA+VRGAAHEVP+TSPSQALTLFRAFL+GYP
Sbjct  410   GPWYDGLQIGGWSQSYGGVREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYP  469

Query  1258  PPRTS  1272
             PPR S
Sbjct  470   PPRKS  474



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/425 (67%), Positives = 352/425 (83%), Gaps = 2/425 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLT+WLNG PGCSSLGYGAFMEHGPFQPG+DG L+KN +SWNLE
Sbjct  53    LFYYFVEADSENAASLPLTIWLNGAPGCSSLGYGAFMEHGPFQPGKDGRLIKNNFSWNLE  112

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVGFSYSNTSSD  NW+DT TA++NL+F+L+WFKKFPQYRNSD+YLTGES
Sbjct  113   SNMLYVDSPIGVGFSYSNTSSDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQ A L+L YN+  N++  KLK+IALGNPLLDI+IS+ +AE+LW+HG ISD+LL
Sbjct  173   YAGHYIPQFAVLLLDYNRTPNVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELL  232

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              M ++ICN+TR ++E +    SNEC  V     EE+G+DI   D+LLP C+SS+A  ++ 
Sbjct  233   DMHKTICNETRYVMEFVHNETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLK  292

Query  721   FFRNNLVTTLTKIDKRVA-AGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                 NL T   K DK+V    DPCL + I  YL +PEVQKALHANTTYLP++W+ CSG L
Sbjct  293   AL-GNLTTVHGKFDKKVGKVADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPL  351

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY+M++ A +I+P LS ILK HIPILLFSGDQD+ +P+TQTR IA +LA++LKL+A +++
Sbjct  352   QYKMEDAAIDIIPLLSNILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKY  411

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
             GPWYDG+QI GWSQS+GG   GKN+++LTFA+VRGAAHEVP+TSPSQALTLFRAFL+GYP
Sbjct  412   GPWYDGLQIGGWSQSYGGVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYP  471

Query  1258  PPRTS  1272
             PPR S
Sbjct  472   PPRKS  476



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/420 (67%), Positives = 344/420 (82%), Gaps = 6/420 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFV+A+++N  SLPLT+WLNGGPGCSS+G+GAFMEHGPFQP  DG+L+KNKYSWNL 
Sbjct  53    LFYYFVDADSENAASLPLTVWLNGGPGCSSVGFGAFMEHGPFQPRIDGSLIKNKYSWNLV  112

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY NW+DT TA++NL+F+L WFKKFPQYRNSD+YL GES
Sbjct  113   SNMLYVESPIGVGFSYSNTSSDYTNWDDTATAKENLQFILNWFKKFPQYRNSDVYLAGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQL  L+L YN+K N++  KLK+IALGNPLLD++IS+ ++E+LWSHGAISD+LL
Sbjct  173   YAGHYIPQLTVLLLDYNRKPNVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELL  232

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              M+R ICN+TR +LE+I  N+SNEC  V   T EE+GSDID  DLL P C+SS   +Q+ 
Sbjct  233   TMRRKICNETRFLLESIHNNVSNECTKVWELTDEEMGSDIDMGDLLAPTCVSSGTARQL-  291

Query  721   FFRNNLVTTLTKIDKRVAA--GDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                  L T   K  K       + CLTDRI  YL +PEVQKALHANTTYLP+ WDFC G 
Sbjct  292   ---GALATIHGKFVKHEVGKVAETCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLGY  348

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y+ +++A N +P LS ILK +I +L FSGDQD+KIP+TQTR IA +LAR+LKL+A ++
Sbjct  349   LHYRREDLAVNTIPLLSNILKENIQVLFFSGDQDSKIPLTQTRKIAKLLARDLKLVALDK  408

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +GPWYDG+QI GWSQSFGG   GKNV++LTFA+VRGAAHEVPFTSPSQALTLFRAFL+G+
Sbjct  409   YGPWYDGLQIGGWSQSFGGLREGKNVTYLTFATVRGAAHEVPFTSPSQALTLFRAFLRGH  468



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/427 (64%), Positives = 339/427 (79%), Gaps = 10/427 (2%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE ++ NP   PLTLWLNGGPGCSSLG+GAF EHGPFQPG +G+L+KN+YSWNLE
Sbjct  60    LFYYFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLYLESPIGVGFSYSNTSSDY   NDT TA +NL F+L WFKKFPQYR+SDLYL+GES
Sbjct  120   SNMLYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L+L YNK+ + R  KLKAIALGNPLLD++IS++ AEFLWSHG ISD++L
Sbjct  180   YAGHYIPQLAALILSYNKRFSGRPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEML  239

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++C+++R++ E++  N+S +CI V     EE+GS  D  DL+LPICLSS    Q V
Sbjct  240   MLRKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTV  299

Query  721   FFRNNLVTTLTKIDKRVA-----AGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFC  885
             +        L ++  ++A     A DPCL DRIY YL  P+VQ+ALHANTT+LP  W+FC
Sbjct  300   Y-----QGALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWEFC  354

Query  886   SGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIA  1065
              G L YQ +++  NI+P LS++L+  IPILLF+GDQD+KIP+TQTR IANMLA ELKL+ 
Sbjct  355   GGHLVYQRESLEINIIPLLSKLLRRSIPILLFNGDQDSKIPLTQTRIIANMLAEELKLVP  414

Query  1066  FERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFL  1245
             F  + PWYD  Q+ GW+QSFG +  GKNV++LTFA+VRGAAHEVP+TSPSQALTLFRAFL
Sbjct  415   FGSYAPWYDKTQVGGWTQSFGQARKGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFL  474

Query  1246  KGYPPPR  1266
             +G P PR
Sbjct  475   RGSPLPR  481



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/424 (63%), Positives = 338/424 (80%), Gaps = 4/424 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +PLS PLTLWLNGGPGCSSLG+GAFME+GPFQPG +G LVKNK+SWN+E
Sbjct  55    LFYYFVEAETAHPLSRPLTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSS+YF WNDT+TA+DNLRF++ WF++FP Y++S+L+LTGES
Sbjct  115   SNMLYVESPIGVGFSYSNTSSNYF-WNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGES  173

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L+++YNK+ NIR  KLKAIALGNPLLD+DIS+ A ++LWSHGAISDD L
Sbjct  174   YAGHYIPQLAALLVEYNKRPNIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTL  233

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CND++ + E   G +S EC  V     +E+  D++  DLL+P CLSSN+ QQ  
Sbjct  234   LLEKTVCNDSKYLREYYHGQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFR  293

Query  721   FFRNNLVTTLTKIDKRVAAG--DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
               +        +ID+R      DPCL DRI+ YL  P+VQKALHANTT+LP+ WDFCSG 
Sbjct  294   L-KGLQGKIYAEIDRRTRGTIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGP  352

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+  +++P ++ +L+ +I ILL+SGDQD K+P+TQTR I N LA++LKL+ F +
Sbjct  353   LVYQVDNLDMDLLPLIAYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTK  412

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +G WYD  Q+ GWSQSFG    G N++ LTFA+VRGAAHEVPFTSPSQALTLF++FL G 
Sbjct  413   YGTWYDKEQVGGWSQSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGS  472

Query  1255  PPPR  1266
             PPPR
Sbjct  473   PPPR  476



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/424 (63%), Positives = 338/424 (80%), Gaps = 4/424 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +PLS PLTLWLNGGPGCSSLG+GAFME+GPFQPG +G LVKNK+SWN+E
Sbjct  126   LFYYFVEAETAHPLSRPLTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIE  185

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSS+YF WNDT+TA+DNLRF++ WF++FP Y++S+L+LTGES
Sbjct  186   SNMLYVESPIGVGFSYSNTSSNYF-WNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGES  244

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L+++YNK+ NIR  KLKAIALGNPLLD+DIS+ A ++LWSHGAISDD L
Sbjct  245   YAGHYIPQLAALLVEYNKRPNIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTL  304

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CND++ + E   G +S EC  V     +E+  D++  DLL+P CLSSN+ QQ  
Sbjct  305   LLEKTVCNDSKYLREYYHGQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFR  364

Query  721   FFRNNLVTTLTKIDKRVAAG--DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
               +        +ID+R      DPCL DRI+ YL  P+VQKALHANTT+LP+ WDFCSG 
Sbjct  365   L-KGLQGKIYAEIDRRTRGTIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGP  423

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+  +++P ++ +L+ +I ILL+SGDQD K+P+TQTR I N LA++LKL+ F +
Sbjct  424   LVYQVDNLDMDLLPLIAYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTK  483

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +G WYD  Q+ GWSQSFG    G N++ LTFA+VRGAAHEVPFTSPSQALTLF++FL G 
Sbjct  484   YGTWYDKEQVGGWSQSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGS  543

Query  1255  PPPR  1266
             PPPR
Sbjct  544   PPPR  547



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/424 (63%), Positives = 334/424 (79%), Gaps = 4/424 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +PLS PLTLW NGGPGCSSLG+GAFME+GPFQPG +G LVKNK+SWNLE
Sbjct  55    LFYYFVEAKTADPLSRPLTLWFNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNLE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDYF WNDT+TA+DNLRFV+ W ++FP Y++S+L+LTGES
Sbjct  115   SNMLYVESPIGVGFSYSNTSSDYF-WNDTRTAEDNLRFVINWLEEFPNYKDSELFLTGES  173

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L+++YN+K NIR  KLK+IALGNPLLD+DIS+ AA++LW+HGAISD  L
Sbjct  174   YAGHYIPQLAALIVEYNQKPNIRPIKLKSIALGNPLLDLDISVLAADYLWAHGAISDHTL  233

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CN ++ + E I G +S  C  V      E+G+D+   DLLLPICLSSN+ QQ  
Sbjct  234   MLEKTVCNYSKFLREYIHGQLSEGCNNVYNRVVNEIGNDVRQDDLLLPICLSSNSAQQFK  293

Query  721   FFRNNLVTTLTKIDKRV--AAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
               +    T    I +R      DPCL+DRI  YL  P+VQKALHANTT+LP+ W FC+G 
Sbjct  294   L-KGQRGTIHAAIARRTRETIPDPCLSDRILTYLNNPQVQKALHANTTHLPYHWGFCAGP  352

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+YQ+ N+  N++P +  ++K  IPILLFSGDQD  IP+TQTR IAN +A++LKL+ F  
Sbjct  353   LEYQIDNLDMNLIPLIEHLIKEGIPILLFSGDQDAIIPLTQTRIIANNVAKDLKLVPFTE  412

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +G WYD  Q+ GW+QSFGG   GKNV+ LTFA+VRGAAHEVPFTSPSQALT+F++FL G 
Sbjct  413   YGTWYDKKQVGGWTQSFGGLREGKNVTLLTFATVRGAAHEVPFTSPSQALTMFKSFLSGS  472

Query  1255  PPPR  1266
             P PR
Sbjct  473   PLPR  476



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/426 (62%), Positives = 338/426 (79%), Gaps = 6/426 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +PLS PLTLWLNGGPGCSSLG+GAFME+GPFQPG +G LVKNK+SWN+E
Sbjct  55    LFYYFVEAETAHPLSRPLTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKT--AQDNLRFVLEWFKKFPQYRNSDLYLTG  354
             SNMLY+ESPIGVGFSYSNTSS+YF WNDT+T  A+DNLRF++ WF++FP Y++S+L+LTG
Sbjct  115   SNMLYVESPIGVGFSYSNTSSNYF-WNDTRTVAAEDNLRFIVNWFEEFPYYKDSELFLTG  173

Query  355   ESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDD  534
             ESYAGHYIPQLA L+++YNK+ NIR  KLKAIALGNPLLD+DIS+ A ++LWSHGAISDD
Sbjct  174   ESYAGHYIPQLAALLVEYNKRPNIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDD  233

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
              L +++++CND++ + E   G +S EC  V     +E+  D++  DLL+P CLSSN+ QQ
Sbjct  234   TLLLEKTVCNDSKYLREYYHGQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQ  293

Query  715   MVFFRNNLVTTLTKIDKRVAAG--DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
                 +        +ID+R      DPCL DRI+ YL  P+VQKALHANTT+LP+ WDFCS
Sbjct  294   FRL-KGLQGKIYAEIDRRTRGTIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCS  352

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L YQ+ N+  +++P ++ +L+ +I ILL+SGDQD K+P+TQTR I N LA++LKL+ F
Sbjct  353   GPLVYQVDNLDMDLLPLIAYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPF  412

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
              ++G WYD  Q+ GWSQSFG    G N++ LTFA+VRGAAHEVPFTSPSQALTLF++FL 
Sbjct  413   TKYGTWYDKEQVGGWSQSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLS  472

Query  1249  GYPPPR  1266
             G PPPR
Sbjct  473   GSPPPR  478



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/418 (65%), Positives = 323/418 (77%), Gaps = 4/418 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++ NPL+ PLTLWLNGGPGCSSLG+GAFMEHGPFQP  DG+LVKN+YSWNLE
Sbjct  52    LFYYFVEADSANPLANPLTLWLNGGPGCSSLGFGAFMEHGPFQPREDGHLVKNQYSWNLE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLYLESPIGVGFSYSNTSSDY   ND  TA+DN++F+L WF++FPQYRNSDLYL+GES
Sbjct  112   SNMLYLESPIGVGFSYSNTSSDYLGLNDATTAKDNMQFLLNWFEEFPQYRNSDLYLSGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLADL+L YNK+ + R  KLKAIALGNPLLD DIS+  AEFLWSHG ISD+ L
Sbjct  172   YAGHYIPQLADLILDYNKRFSGRPIKLKAIALGNPLLDPDISVINAEFLWSHGVISDETL  231

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              + +++CN +R + E+I  N+S ECI V     EE+GS  D  DL+LPIC S     Q  
Sbjct  232   LLSKTVCNASRHLKESIHQNLSKECIHVLNKLEEEMGSYTDPGDLILPICFSPTLLGQTF  291

Query  721   F--FRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
             F    N L   L        A DPC  D I  YL  P+VQ+ALHANTT+L   W+FC G 
Sbjct  292   FQGTHNRLHWKLAM--SSAVATDPCRVDEIRQYLNTPKVQEALHANTTHLSSVWEFCGGH  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ ++I  NI+P LS++LK  IP+LLF+GDQD+KIP+TQTR IANMLA+ELKL+ F  
Sbjct  350   LSYQRESIGINIIPLLSKLLKRSIPVLLFNGDQDSKIPLTQTRIIANMLAKELKLVPFGS  409

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
             + PWYD  Q+ GW+QSFG    G+N++FLTFA+VRGAAHEVP+TSP QALTLF+AFL+
Sbjct  410   YAPWYDKKQVGGWTQSFGKVRRGQNLTFLTFATVRGAAHEVPYTSPFQALTLFQAFLR  467



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/427 (62%), Positives = 329/427 (77%), Gaps = 4/427 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE +A +PL  PLTLWLNGGPGCSSLGYGAFMEHGPFQPG DG LVKN+YSWNLE
Sbjct  49    LFYYFVEVDAADPLLHPLTLWLNGGPGCSSLGYGAFMEHGPFQPGEDGFLVKNQYSWNLE  108

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY   NDT TA++NL+F++ WFK+FPQYRNSDLYLTGES
Sbjct  109   SNMLYVESPIGVGFSYSNTSSDYIGVNDTFTAEENLQFLVNWFKEFPQYRNSDLYLTGES  168

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L+L YNK  N +  +LKA+ALGNPLLD +ISID  EF WSHG ISD++L
Sbjct  169   YAGHYIPQLAALVLDYNKHSNGKPIRLKAVALGNPLLDWEISIDNTEFFWSHGLISDEML  228

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++C+  R  +E++  N+S EC  V      E+GS     D+ LPIC S +   Q V
Sbjct  229   MLRKTVCSRPRDAIESLHNNLSKECTDVIHKQRAEIGSYTQYGDVTLPICTSRSLFGQTV  288

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT-L  897
             + RN          + V  GDPC+ DRI+ YL +PEVQ+ALHANTT+LP+ W+FC+GT L
Sbjct  289   YLRNFDTLDAELPMRSVIPGDPCIEDRIHKYLNKPEVQEALHANTTHLPYRWEFCTGTDL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+ +N+ +NI+P L  +L+  IPILL++GDQD KIP+TQTR IANMLA+E+ L+ F   
Sbjct  349   VYERKNLETNIIPLLLNLLRSGIPILLYNGDQDAKIPLTQTRIIANMLAKEMNLVPFGNF  408

Query  1078  G---PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
             G   PW+D +Q+ GW+QSFG +  GKN++FLT+A+VRG AHEVP+TSPS  LTLFRAF+K
Sbjct  409   GNYAPWFDNMQVGGWTQSFGQAKEGKNITFLTYATVRGGAHEVPYTSPSPGLTLFRAFVK  468

Query  1249  GYPPPRT  1269
             G P PRT
Sbjct  469   GSPLPRT  475



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/389 (65%), Positives = 319/389 (82%), Gaps = 2/389 (1%)
 Frame = +1

Query  109   MEHGPFQPGRDGNLVKNKYSWNLESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNL  288
             MEHGPFQPG+DG L+KN +SWNLESNMLY++SPIGVGFSYSNTSSD  NW+DT TA++NL
Sbjct  1     MEHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTSSDNINWDDTATAKENL  60

Query  289   RFVLEWFKKFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPL  468
             +F+L+WFKKFPQYRNSD+YLTGESYAGHYIPQ A L+L YN+  N++  KLK+IALGNPL
Sbjct  61    QFILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTPNVKPIKLKSIALGNPL  120

Query  469   LDIDISIDAAEFLWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEV  648
             LDI+IS+ +AE+LW+HG ISD+LL M ++ICN+TR ++E +    SNEC  V     EE+
Sbjct  121   LDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHNETSNECAKVIELRTEEM  180

Query  649   GSDIDSSDLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVA-AGDPCLTDRIYAYLQRP  825
             G+DI   D+LLP C+SS+A  ++     NL T   K DK+V    DPCL + I  YL +P
Sbjct  181   GNDIVKYDVLLPKCVSSSAAGRLKAL-GNLTTVHGKFDKKVGKVADPCLNEWINLYLNKP  239

Query  826   EVQKALHANTTYLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKI  1005
             EVQKALHANTTYLP++W+ CSG LQY+M++ A +I+P LS ILK HIPILLFSGDQD+ +
Sbjct  240   EVQKALHANTTYLPYSWEVCSGPLQYKMEDAAIDIIPLLSNILKQHIPILLFSGDQDSVL  299

Query  1006  PVTQTRTIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGA  1185
             P+TQTR IA +LA++LKL+A +++GPWYDG+QI GWSQS+GG   GKN+++LTFA+VRGA
Sbjct  300   PLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGGVREGKNITYLTFATVRGA  359

Query  1186  AHEVPFTSPSQALTLFRAFLKGYPPPRTS  1272
             AHEVP+TSPSQALTLFRAFL+GYPPPR S
Sbjct  360   AHEVPYTSPSQALTLFRAFLRGYPPPRKS  388



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/424 (61%), Positives = 326/424 (77%), Gaps = 2/424 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EA++ + LSLPLTLWLNGGPGCSS+G+G FMEHGPFQP  +G L+KN+YSWNLE
Sbjct  51    LFYYFAEAQSPDHLSLPLTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVG+SYSNTSSDY  WND  TA+DNLRF++ WFK+FPQY++S+ +L G+S
Sbjct  111   SNMLYVDSPIGVGYSYSNTSSDYKLWNDAATAEDNLRFIVNWFKEFPQYKDSEFFLAGDS  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L++KYNK+ NIR  KL+ IALGNPLLD+DIS+   E+LWSHGAISD+ L
Sbjct  171   YAGHYVPQLATLIMKYNKQPNIRPIKLRGIALGNPLLDLDISVLGGEYLWSHGAISDETL  230

Query  541   AMKRSICNDTRAILENIQG-NMSNECILVNGATGEEVGSDIDSSDLLLPICLS-SNAKQQ  714
              +++++CND++ + E + G N S  C  V     EEVG+DID  DLL P C+  S + +Q
Sbjct  231   MLEKTVCNDSKYLREFVHGNNHSQGCNQVFDRISEEVGADIDRQDLLSPFCIPISTSTEQ  290

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                   +     T   +  + GDPC+  RI+ YL +P+VQKALHANTT+LP+ WDFC G 
Sbjct  291   FKPIDKHGKIHKTMARRGASTGDPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGP  350

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ ++   NI+P +SE+LK  IPILL+SGDQDTKIP+TQTR IAN LA++LKL+    
Sbjct  351   LVYQFEDFELNIIPLVSELLKEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTT  410

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +GPWY+  Q+ GWSQSFG    GKNV+ LTFA+VRG AHEVPFTSPS+ALTLFR+ L G 
Sbjct  411   YGPWYNDKQVGGWSQSFGAFRDGKNVTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTGS  470

Query  1255  PPPR  1266
             P PR
Sbjct  471   PLPR  474



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/424 (61%), Positives = 325/424 (77%), Gaps = 2/424 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EA++ + LSLPLTLWLNGGPGCSS+G+G FMEHGPFQP  +G L+KN+YSWNLE
Sbjct  51    LFYYFAEAQSPDHLSLPLTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVG+SYSNTSSDY  WND  TA+DNLRF++ WFK+FPQY++S+ +L G+S
Sbjct  111   SNMLYVDSPIGVGYSYSNTSSDYKLWNDAATAEDNLRFIVNWFKEFPQYKDSEFFLAGDS  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L++KYNK+ NIR  KL+ IALGNPLLD+DIS+   E+LWSHGAISD+ L
Sbjct  171   YAGHYVPQLATLIMKYNKQPNIRPIKLRGIALGNPLLDLDISVLGGEYLWSHGAISDETL  230

Query  541   AMKRSICNDTRAILENIQG-NMSNECILVNGATGEEVGSDIDSSDLLLPICLS-SNAKQQ  714
              ++R++CND++ + E + G N S  C  V     EEVG+DID  DLL P C+  S + +Q
Sbjct  231   MLERTVCNDSKYLREFVHGNNHSQGCNQVFDRISEEVGADIDRQDLLSPFCVPISTSTEQ  290

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                   +     T   +  + GDPC+  RI+ YL +P+VQKALHANTT+LP+ WDFC G 
Sbjct  291   FKPIDKHGKIHKTMARRGASTGDPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGP  350

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ ++   NI+P +SE+LK  IPILL+SGDQDTKIP+TQTR IAN LA++LKL+    
Sbjct  351   LVYQFEDFELNIIPLVSELLKEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTI  410

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +GPWY+  Q+ GWSQSFG    GKNV+ LTFA+VRG AHEVPFTSPS+ALTLFR+ L   
Sbjct  411   YGPWYNDKQVGGWSQSFGAFRDGKNVTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTRS  470

Query  1255  PPPR  1266
             P PR
Sbjct  471   PLPR  474



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 325/424 (77%), Gaps = 2/424 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EA++ + LSLPLTLWLNGGPGCSS+G+G FMEHGPFQP  +G L+KN+YSWNLE
Sbjct  51    LFYYFAEAQSPDHLSLPLTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVG+SYSNTSSDY  WND  TA+DNLRF++ WFK+FPQY++S+ +L G+S
Sbjct  111   SNMLYVDSPIGVGYSYSNTSSDYKLWNDAATAEDNLRFIVNWFKEFPQYKDSEFFLAGDS  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L++KYNK+ NIR  KL+ IALGNPLLD+DIS+   E+LWSHGAISD+ L
Sbjct  171   YAGHYVPQLATLIMKYNKQPNIRPIKLRGIALGNPLLDLDISVLGGEYLWSHGAISDETL  230

Query  541   AMKRSICNDTRAILENIQG-NMSNECILVNGATGEEVGSDIDSSDLLLPICLS-SNAKQQ  714
              +++++CN+++ + E + G N S  C  V     EEVG+DID  DLL P C+  S + +Q
Sbjct  231   MLEKTVCNNSKYLREFVHGNNHSQGCNQVFDRISEEVGADIDRQDLLSPFCIPISTSTEQ  290

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                   +     T   +  + GDPC+  RI+ YL +P+VQKALHANTT+LP+ WDFC G 
Sbjct  291   FKPIDKHGKIHKTMARRGASTGDPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGP  350

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ ++   NI+P +SE+LK  IPILL+SGDQDTKIP+TQTR IAN LA++LKL+    
Sbjct  351   LVYQFEDFELNIIPLVSELLKEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTT  410

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +GPWY+  Q+ GWSQSFG    GKNV+ LTFA+ RG AHEVPFTSPS+ALTLFR+ L G 
Sbjct  411   YGPWYNDKQVGGWSQSFGAFRDGKNVTNLTFATARGGAHEVPFTSPSEALTLFRSLLTGS  470

Query  1255  PPPR  1266
             P PR
Sbjct  471   PLPR  474



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/426 (61%), Positives = 321/426 (75%), Gaps = 9/426 (2%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY VEA++ +PLS PLTLWLNGGPGCSS+G+G  MEHGPFQP  +  L KNKYSWNLE
Sbjct  56    LFYYLVEADSAHPLSRPLTLWLNGGPGCSSVGFGVLMEHGPFQPKDNRLLAKNKYSWNLE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVGFSYSNTSSDY ++NDT TA+DNL+F+L W +KFP+Y+NSDLYL GES
Sbjct  116   SNMLYVDSPIGVGFSYSNTSSDYTSYNDTTTAEDNLKFLLNWLEKFPKYKNSDLYLAGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGH+IPQLA L+L+YNKK NIR  KLK +ALGNPLLD+DISI  AE LWSHGAISD+ L
Sbjct  176   YAGHFIPQLASLLLEYNKKPNIRPIKLKGVALGNPLLDLDISIAFAENLWSHGAISDETL  235

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++C  +R   E +  N+S EC  V     +EVG ++D +DLL   CL S   +Q  
Sbjct  236   MLEKTVCKISRYFKEFVHNNLSKECSDVFDRINKEVGDELDRNDLLSLQCLPSTEAEQ--  293

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
              FR       + I     AGDPCL DRI AYL +P VQKALHA    +P  W FC+G LQ
Sbjct  294   -FRAAKAIMHSNIGLLRGAGDPCLPDRILAYLNKPVVQKALHA----VPTNWSFCAGPLQ  348

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQM+++A+N++P +S++LK  IPI+ +SGDQDTKIP+TQTR IAN +A+ LKL+    +G
Sbjct  349   YQMESLATNMIPIISDLLKSDIPIMFYSGDQDTKIPLTQTRIIANAMAKSLKLVPLTSYG  408

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG--Y  1254
             PWYD  Q+ GW+QSFG    GKNV++LTFA+VRG +HEVP+TSPSQ LTLFR FL G   
Sbjct  409   PWYDNKQVGGWAQSFGKQREGKNVTYLTFATVRGGSHEVPYTSPSQTLTLFRVFLSGSLL  468

Query  1255  PPPRTS  1272
             P P+ S
Sbjct  469   PAPKVS  474



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/426 (60%), Positives = 325/426 (76%), Gaps = 10/426 (2%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++ NPLSLPLTLWLNGGPGCSSLG+GAFMEHGPFQPG +G L+KN+YSWNL 
Sbjct  50    LFYYFVEAQSTNPLSLPLTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLA  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY  WND+ TA DNLRF++ W ++FPQY++S+ +LTGES
Sbjct  110   SNMLYVESPIGVGFSYSNTSSDYNLWNDSNTAGDNLRFIVNWLEEFPQYKDSEFFLTGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L+YNK+ N++  KLK+IALGNPLLD+DIS+   +F+WSHGAISD+ L
Sbjct  170   YAGHYVPQLATLILQYNKQPNVKPIKLKSIALGNPLLDLDISVLTGDFMWSHGAISDETL  229

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CN +  + E +    S  C  V     EE G DIDS DLLLP CL+S + QQ  
Sbjct  230   MLEKTVCNGSTYLRELVNNQESKGCNDVFNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFK  288

Query  721   FFRNNLVTTLTKIDKRV----AAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
              F  +      KI   +    A+GDPC+ DRI+ YL  P+VQ+ALHANTT+LP+ W+FC 
Sbjct  289   LFGKH-----GKIPNMMVNFGASGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFCG  343

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L YQ ++   NI+P +++++   +PILLFSGDQDTKIP+TQTR IA  LA +LKL   
Sbjct  344   GPLDYQYKDFELNIIPQIADLIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPT  403

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +  WYD  Q+ GWSQSFG    GKN+++LT+A+VRGAAHEVP+T+PS ALTLF++FL 
Sbjct  404   TNYANWYDKQQVGGWSQSFGAFRDGKNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLT  463

Query  1249  GYPPPR  1266
             G P P 
Sbjct  464   GSPLPN  469



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/426 (60%), Positives = 325/426 (76%), Gaps = 10/426 (2%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++ NPLSLPLTLWLNGGPGCSSLG+GAFMEHGPFQPG +G L+KN+YSWNL 
Sbjct  50    LFYYFVEAQSTNPLSLPLTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLA  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY  WND+ TA DNLRF++ W ++FPQY++S+ +LTGES
Sbjct  110   SNMLYVESPIGVGFSYSNTSSDYNLWNDSNTAGDNLRFIVNWLEEFPQYKDSEFFLTGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L+YNK+ N++  KLK+IALGNPLLD+DIS+   +F+WSHGAISD+ L
Sbjct  170   YAGHYVPQLATLVLQYNKQPNVKPIKLKSIALGNPLLDLDISVLTGDFMWSHGAISDETL  229

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CN +  + E +    S  C  V     EE G DIDS DLLLP CL+S + QQ  
Sbjct  230   MLEKTVCNGSTYLRELVNNQESKGCNDVFNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFK  288

Query  721   FFRNNLVTTLTKIDKRV----AAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
              F  +      KI   +    A+GDPC+ DRI+ YL  P+VQ+ALHANTT+LP+ W+FC 
Sbjct  289   LFGKH-----GKIPNMMVNFGASGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFCG  343

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L YQ ++   NI+P +++++   +PILLFSGDQDTKIP+TQTR IA  LA +LKL   
Sbjct  344   GPLDYQYKDFELNIIPQIADLIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPT  403

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +  WYD  Q+ GWSQSFG    GKN+++LT+A+VRGAAHEVP+T+PS ALTLF++FL 
Sbjct  404   TNYANWYDKQQVGGWSQSFGAFRDGKNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLT  463

Query  1249  GYPPPR  1266
             G P P 
Sbjct  464   GSPLPN  469



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 320/423 (76%), Gaps = 1/423 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A++PLS PLTLW NGGPGCSSLG+GAF EHGPF+P  DG L KN++SWN  
Sbjct  56    LFYYFVEADARDPLSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKV  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNT+SDY NW D  TA+ N++F+L W+K++P+YR+SDLYL+GES
Sbjct  116   SNMLYVESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L YNK+   +  KL+AIALGNPLLDI IS+DAA FLWSHG ISD+ L
Sbjct  176   YAGHYVPQLAALLLDYNKQSRGKLIKLRAIALGNPLLDIQISVDAATFLWSHGVISDETL  235

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +K ++CND+R + + I   +S EC  V     EE+G+  D  D+L P C S  A  Q  
Sbjct  236   KLKETVCNDSRYLTQQIHNKISMECAEVFQKQVEEMGNFTDPDDVLEPYCFSGTAVVQSA  295

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
               R+       K+ +R+   DPCL D I++YL  P+VQKALHAN T LP  W+FCSG L 
Sbjct  296   -SRSMWDAYHAKLARRMVLTDPCLGDFIFSYLNNPQVQKALHANITKLPSVWNFCSGPLS  354

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             Y   +I  +I+P LS +++ H+ +LLFSGDQD+K+P+ QTR IANM+A++LK  +  ++ 
Sbjct  355   YHDVDIGIDIIPLLSALIEKHLRVLLFSGDQDSKVPLMQTRMIANMIAQDLKFTSLGKYA  414

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD +Q+ GW+QSFG S  GKNV+ LTFA+VRGAAHEVP+TSPSQALTLF+AFL+G  P
Sbjct  415   PWYDKMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSP  474

Query  1261  PRT  1269
             P+ 
Sbjct  475   PKV  477



>ref|XP_010322533.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/425 (60%), Positives = 320/425 (75%), Gaps = 37/425 (9%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+++N  SLPLT+WLNG                                   E
Sbjct  53    LFYYFVEADSENAASLPLTIWLNG-----------------------------------E  77

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY++SPIGVGFSYSNTSSD  NW+DT TA++NL+F+L+WFKKFPQYRNSD+YLTGES
Sbjct  78    SNMLYVDSPIGVGFSYSNTSSDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGES  137

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQ A L+L YN+  N++  KLK+IALGNPLLDI+IS+ +AE+LW+HG ISD+LL
Sbjct  138   YAGHYIPQFAVLLLDYNRTPNVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELL  197

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              M ++ICN+TR ++E +    SNEC  V     EE+G+DI   D+LLP C+SS+A  ++ 
Sbjct  198   DMHKTICNETRYVMEFVHNETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLK  257

Query  721   FFRNNLVTTLTKIDKRVA-AGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                 NL T   K DK+V    DPCL + I  YL +PEVQKALHANTTYLP++W+ CSG L
Sbjct  258   AL-GNLTTVHGKFDKKVGKVADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPL  316

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY+M++ A +I+P LS ILK HIPILLFSGDQD+ +P+TQTR IA +LA++LKL+A +++
Sbjct  317   QYKMEDAAIDIIPLLSNILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKY  376

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
             GPWYDG+QI GWSQS+GG   GKN+++LTFA+VRGAAHEVP+TSPSQALTLFRAFL+GYP
Sbjct  377   GPWYDGLQIGGWSQSYGGVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYP  436

Query  1258  PPRTS  1272
             PPR S
Sbjct  437   PPRKS  441



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score =   526 bits (1355),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 316/423 (75%), Gaps = 3/423 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++      PLTLWLNGGPGCSSLG+GAFMEHGPFQPG DG L+KN+YSWNLE
Sbjct  51    LFYYFVEADSNTDELKPLTLWLNGGPGCSSLGFGAFMEHGPFQPGEDGTLIKNEYSWNLE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTS +Y  WNDT+TAQDNL F+L W ++FPQY+ SD +L GES
Sbjct  111   SNMLYVESPIGVGFSYSNTSKNYL-WNDTQTAQDNLMFILNWLEEFPQYKESDFFLAGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L++++NKK NI    LKAIALGNPLLD+DIS+ A +FLWSHGAISD+ L
Sbjct  170   YAGHYIPQLAALLVEHNKKPNIEPVNLKAIALGNPLLDLDISVLAGDFLWSHGAISDETL  229

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CND++ + E +    S  C  V     +EVG D+   DLLLP CLSS+  +Q+ 
Sbjct  230   FLEKTVCNDSKYLREYVHDKWSEGCNDVFNRVEDEVGVDVGLDDLLLPTCLSSSYAEQLK  289

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
               +  L    + + KR   GDPCL  RI  YL R EVQKALH +TT+ P  W FC G L 
Sbjct  290   -LKGKLGKIHSAVAKRAKKGDPCLEGRILTYLNRREVQKALHVSTTHHPSHWAFCEGPLV  348

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ  N+  N++P +S+++K  IP+LL++GDQD KIP+TQTR IAN +A++LKL+    +G
Sbjct  349   YQEDNLDMNLIPLVSDLIKEAIPVLLYNGDQDAKIPLTQTRIIANNIAKDLKLVPLTEYG  408

Query  1081  PWYDGVQIAGWSQSFGGSILGKN-VSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
              WYD  Q+ GW++SFG +   KN  ++LTFA+VRGAAHEVPFTS SQALTLF +F+ G P
Sbjct  409   TWYDNKQVGGWTKSFGATEDRKNYATYLTFATVRGAAHEVPFTSHSQALTLFHSFVNGIP  468

Query  1258  PPR  1266
              PR
Sbjct  469   LPR  471



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   525 bits (1352),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 315/423 (74%), Gaps = 1/423 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A++P S PLTLW NGGPGCSSLG+GAF EHGPF+P  DG L KN++SWN  
Sbjct  56    LFYYFVEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKV  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNT+SDY NW D  TA+ N++F+L W+K++P+YR+SDLYL+GES
Sbjct  116   SNMLYVESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L YNK+ + +  KLKAIALGNPLLD+ IS+D A FLWSHG ISD+ L
Sbjct  176   YAGHYVPQLAALVLDYNKQSHGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETL  235

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +K ++CND+R   E I   +S EC  V     EE+G+  D  D+L P C S  A  Q  
Sbjct  236   KLKETVCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSA  295

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                +       K+ +R+   DPCL + I++YL  P VQKALHANTT LP  W FCSG L 
Sbjct  296   -SSSAWDAYHAKLARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLS  354

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             Y   +I  +I P LS ++K H+ +LLFSGDQD+KIP+TQTR IA+M+AR LK  +  ++ 
Sbjct  355   YHDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYA  414

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD +Q+ GW+QSFG S  GKNV+ LTFA+VRGAAHEVP+TSPSQALTLF+AFL+G  P
Sbjct  415   PWYDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSP  474

Query  1261  PRT  1269
             P+ 
Sbjct  475   PKV  477



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score =   525 bits (1352),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 315/423 (74%), Gaps = 1/423 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A++P S PLTLW NGGPGCSSLG+GAF EHGPF+P  DG L KN++SWN  
Sbjct  55    LFYYFVEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKV  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNT+SDY NW D  TA+ N++F+L W+K++P+YR+SDLYL+GES
Sbjct  115   SNMLYVESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L YNK+ + +  KLKAIALGNPLLD+ IS+D A FLWSHG ISD+ L
Sbjct  175   YAGHYVPQLAALVLDYNKQSHGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETL  234

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +K ++CND+R   E I   +S EC  V     EE+G+  D  D+L P C S  A  Q  
Sbjct  235   KLKETVCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSA  294

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                +       K+ +R+   DPCL + I++YL  P VQKALHANTT LP  W FCSG L 
Sbjct  295   -SSSAWDAYHAKLARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLS  353

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             Y   +I  +I P LS ++K H+ +LLFSGDQD+KIP+TQTR IA+M+AR LK  +  ++ 
Sbjct  354   YHDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYA  413

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD +Q+ GW+QSFG S  GKNV+ LTFA+VRGAAHEVP+TSPSQALTLF+AFL+G  P
Sbjct  414   PWYDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSP  473

Query  1261  PRT  1269
             P+ 
Sbjct  474   PKV  476



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score =   527 bits (1358),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/417 (60%), Positives = 318/417 (76%), Gaps = 6/417 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++ NPLSLPLTLWLNGGPGCSSLG+GAFMEHGPFQPG +G L+KN+YSWNL 
Sbjct  50    LFYYFVEAQSTNPLSLPLTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLA  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY  WND+ TA DNLRF++ W ++FPQY++S+ +LTGES
Sbjct  110   SNMLYVESPIGVGFSYSNTSSDYNLWNDSNTAGDNLRFIVNWLEEFPQYKDSEFFLTGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L+YNK+ N++  KLK+IALGNPLLD+DIS+   +F+WSHGAISD+ L
Sbjct  170   YAGHYVPQLATLILQYNKQPNVKPIKLKSIALGNPLLDLDISVLTGDFMWSHGAISDETL  229

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CN +  + E +    S  C  V     EE G DIDS DLLLP CL+S + QQ  
Sbjct  230   MLEKTVCNGSTYLRELVNNQESKGCNDVFNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFK  288

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
              F  +       ++   A+GDPC+ DRI+ YL  P+VQ+ALHANTT+LP+ W+FC G L 
Sbjct  289   LFGKHGKMPNMMVNFG-ASGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFCGGPLD  347

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ ++   NI+P +++++   +PILLFSGDQDTKIP+TQTR IA  LA +LKL     + 
Sbjct  348   YQYKDFELNIIPQIADLIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYA  407

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              WYD  Q+ GWSQSFG    GKN+++LT+A+VRGAAHEVP+T+PS ALT    FL G
Sbjct  408   NWYDKQQVGGWSQSFGAFRDGKNITYLTYATVRGAAHEVPYTTPSPALT----FLSG  460



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score =   520 bits (1340),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 313/423 (74%), Gaps = 1/423 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A++P S PLTLW NGGPGCSSLG+GAF EHGPF+P  DG L KN++SWN  
Sbjct  55    LFYYFVEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKV  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNT+SDY NW D  TA+ N++F+L W+K++P+YR+SDLYL+GES
Sbjct  115   SNMLYVESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L YNK+ + +  KLKAIALGNPLLD+ +S++ A FLWSHG ISD+ L
Sbjct  175   YAGHYVPQLAALVLDYNKQSHGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETL  234

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +K ++CND+R   E I   +S EC  V     EE+G+  D  D+L P C S  A  Q  
Sbjct  235   KLKETVCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSA  294

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                +       K+ +R+   DPCL D I++YL  P+VQKALHANTT LP  W FCSG L 
Sbjct  295   -SSSAWDAYHAKLARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLS  353

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             Y   +I  +I P LS ++K H+ +LLFSGDQD+KIP+TQTR IANM+ARELK  +  ++ 
Sbjct  354   YHDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYA  413

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWY+  Q+ GW++SFG S  GKN + LTFA+VRGAAHEVP+TSP QALTLF+AFLKG   
Sbjct  414   PWYNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSL  473

Query  1261  PRT  1269
             P+ 
Sbjct  474   PKV  476



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   520 bits (1339),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 313/423 (74%), Gaps = 1/423 (0%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A++P S PLTLW NGGPGCSSLG+GAF EHGPF+P  DG L KN++SWN  
Sbjct  56    LFYYFVEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKV  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNT+SDY NW D  TA+ N++F+L W+K++P+YR+SDLYL+GES
Sbjct  116   SNMLYVESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L YNK+ + +  KLKAIALGNPLLD+ +S++ A FLWSHG ISD+ L
Sbjct  176   YAGHYVPQLAALVLDYNKQSHGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETL  235

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +K ++CND+R   E I   +S EC  V     EE+G+  D  D+L P C S  A  Q  
Sbjct  236   KLKETVCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSA  295

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                +       K+ +R+   DPCL D I++YL  P+VQKALHANTT LP  W FCSG L 
Sbjct  296   -SSSAWDAYHAKLARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLS  354

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             Y   +I  +I P LS ++K H+ +LLFSGDQD+KIP+TQTR IANM+ARELK  +  ++ 
Sbjct  355   YHDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYA  414

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWY+  Q+ GW++SFG S  GKN + LTFA+VRGAAHEVP+TSP QALTLF+AFLKG   
Sbjct  415   PWYNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSL  474

Query  1261  PRT  1269
             P+ 
Sbjct  475   PKV  477



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score =   509 bits (1311),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 246/427 (58%), Positives = 318/427 (74%), Gaps = 13/427 (3%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA++ +PLS PLTLWL+GGPGCSSLG GAF E+GPFQ    G+L KN YSWNLE
Sbjct  55    LFYYFVEADSAHPLSRPLTLWLSGGPGCSSLGEGAFTENGPFQSKDSGHLAKNIYSWNLE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTS DY +WNDT TA+DNL+F+L W +KFP+Y++SDLYL G+S
Sbjct  115   SNMLYVESPIGVGFSYSNTSLDYISWNDTTTAEDNLKFLLNWLEKFPKYKHSDLYLAGDS  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHY+PQLA L+L+YN+K +IR  KLK +ALG+PLL++DIS+++A+ LWSHGAISD+ L
Sbjct  175   YAGHYVPQLASLLLEYNRKPDIRPIKLKGVALGSPLLNLDISMESADDLWSHGAISDETL  234

Query  541   AMKRSICNDTRAILE-NIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
              ++++IC       E  +  N+S ECI V      E+G D+D +DLL   CL S+  +Q 
Sbjct  235   MLEKTICKIPTYYKELFVYKNLSKECIDVFDRINGEIGDDLDRNDLLSFKCLPSSRAEQ-  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
               FR      +    K  +A DPCL+DR+ AYL RP+VQKALHA    +P  W FCSG L
Sbjct  294   --FRARATNPMA---KGTSAADPCLSDRVLAYLNRPKVQKALHA----IPVNWSFCSGPL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QYQM N+  NI+P +S++LK +I I+L++GDQD K+ ++QTR IAN +A+ LKL+    +
Sbjct  345   QYQMDNVDINIIPVVSDLLKSNISIMLYNGDQDAKVSLSQTRIIANTIAKSLKLVPLTSY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG--  1251
             GPWYD  Q+ GW+QSFG    GKNV++LTFA+VRG +H  P+TSPSQALTLFRAFL    
Sbjct  405   GPWYDNKQVGGWAQSFGKLRYGKNVTYLTFATVRGGSHGAPYTSPSQALTLFRAFLSASS  464

Query  1252  YPPPRTS  1272
              P P+ +
Sbjct  465   LPTPKVA  471



>ref|XP_006838780.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score =   509 bits (1311),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 301/423 (71%), Gaps = 4/423 (1%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +  S PLTLWLNGGPGCSSLG GA MEHGP+    + +LV NKYSWNL 
Sbjct  60    LFYYFVEADTHHRASRPLTLWLNGGPGCSSLGIGALMEHGPYLVHDNSSLVNNKYSWNLA  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SNMLY+ESPIGVGFSYSNTSSDY NWNDTKTA+DNLRF++ WF+KFP YR SDLYLTGES
Sbjct  120   SNMLYVESPIGVGFSYSNTSSDYINWNDTKTAEDNLRFLINWFEKFPAYRGSDLYLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L++ YNKK    A KLKAIALGNP +D+DIS+++ E+LW+HG ISD   
Sbjct  180   YAGHYIPQLAALLMAYNKKHTTGAIKLKAIALGNPFVDMDISVNSGEYLWAHGLISDQTF  239

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CND+  +    +G  S  CI       EE+G ++D  D+LLP CL+S    Q V
Sbjct  240   ELEKTLCNDSSYMRAFYRGEYSEPCIYTFKMVAEEMGVNVDEGDILLPKCLTSVPSMQAV  299

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
                 N          R+ +GD C  +RI+ YL R +VQ+A HAN T LP+ WD CSG L 
Sbjct  300   SRGLNGKIHAKISLSRMGSGDLCSWERIFKYLNRADVQRAFHANATGLPYNWDSCSGPLV  359

Query  901   YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERHG  1080
             YQ  N   +I P +  +LK  IPI L+SGDQD+KIP+TQTR IAN LA+ LKL    ++ 
Sbjct  360   YQDDNSEIDIRPLILSLLKEDIPIFLYSGDQDSKIPLTQTRIIANQLAKRLKLSPITKYA  419

Query  1081  PWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYPP  1260
             PWYD  Q+ GW Q+FG      N + LTFA+VRGAAHEVPFTSPSQALTLFRAF+ G P 
Sbjct  420   PWYDKKQVGGWVQAFGRG----NRTLLTFATVRGAAHEVPFTSPSQALTLFRAFITGSPL  475

Query  1261  PRT  1269
             P +
Sbjct  476   PTS  478



>ref|XP_006829355.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
 gb|ERM96771.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
Length=442

 Score =   470 bits (1210),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 280/388 (72%), Gaps = 21/388 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A + +S PLTLWLNGGPGCSSLG+GAFMEHGPFQPG +  L+ NKYSWNLE
Sbjct  55    LFYYFVEADAHDSISRPLTLWLNGGPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             SN+LY+ESPIGVGFSYSNTSSDY +WNDT TA+DNLRF++ WF+KFP YR+SDLYLTGES
Sbjct  115   SNVLYVESPIGVGFSYSNTSSDYIHWNDTTTAKDNLRFLINWFEKFPAYRDSDLYLTGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
             YAGHYIPQLA L++ YNK+ NIR  KLKAIALGNPLLD+DIS+++ +FLW+HG ISD  L
Sbjct  175   YAGHYIPQLATLLVDYNKQPNIRPIKLKAIALGNPLLDLDISVNSEDFLWAHGVISDSAL  234

Query  541   AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
              +++++CN +  +   +    S  C  V     +E+G D D  D+LLPICLS+ +  Q V
Sbjct  235   KLQKTVCNISTYLRFYVHDQYSQACNDVFNIVNDELGPDTDRGDILLPICLSNGSSLQGV  294

Query  721   FFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTLQ  900
             F +        K    + +GDPCL DR++AYL +PEVQKALHAN T+LP+ WDFCSG+L 
Sbjct  295   FPKGIHGKIQAKRSLSIRSGDPCLGDRVFAYLNKPEVQKALHANITHLPFHWDFCSGSLS  354

Query  901   ---------------------YQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQ  1017
                                  YQ  N+  ++MP +  +L  +IP+LL+SGDQD KIP+TQ
Sbjct  355   LSYKKSLPGELIFLSKFRPLVYQEDNLDMDVMPLMVHLLNENIPVLLYSGDQDAKIPLTQ  414

Query  1018  TRTIANMLARELKLIAFERHGPWYDGVQ  1101
             TR IAN LA  LKL +  ++ PWYD  Q
Sbjct  415   TRIIANQLANTLKLFSITKYAPWYDKKQ  442



>ref|XP_007046209.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
 gb|EOY02041.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
Length=401

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 258/332 (78%), Gaps = 10/332 (3%)
 Frame = +1

Query  1    LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
            LFYYFVE ++ NP   PLTLWLNGGPGCSSLG+GAF EHGPFQPG +G+L+KN+YSWNLE
Sbjct  60   LFYYFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLE  119

Query  181  SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
            SNMLYLESPIGVGFSYSNTSSDY   NDT TA +NL F+L WFKKFPQYR+SDLYL+GES
Sbjct  120  SNMLYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGES  179

Query  361  YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAEFLWSHGAISDDLL  540
            YAGHYIPQLA L+L YNK+ + R  KLKAIALGNPLLD++IS++ AEFLWSHG ISD++L
Sbjct  180  YAGHYIPQLAALILSYNKRFSGRPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEML  239

Query  541  AMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQMV  720
             +++++C+++R++ E++  N+S +CI V     EE+GS  D  DL+LPICLSS    Q V
Sbjct  240  MLRKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTV  299

Query  721  FFRNNLVTTLTKIDKRVA-----AGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFC  885
            +        L ++  ++A     A DPCL DRIY YL  P+VQ+ALHANTT+LP  W+FC
Sbjct  300  Y-----QGALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWEFC  354

Query  886  SGTLQYQMQNIASNIMPTLSEILKHHIPILLF  981
             G L YQ +++  NI+P LS++L+  IPILLF
Sbjct  355  GGHLVYQRESLEINIIPLLSKLLRRSIPILLF  386



>gb|ABK26025.1| unknown [Picea sitchensis]
Length=384

 Score =   404 bits (1038),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 273/395 (69%), Gaps = 19/395 (5%)
 Frame = +1

Query  109   MEHGPFQP-GRDGNLV-KNKYSWNLESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQD  282
             MEHGPF+P G +G L+  NKYSWN+E+NMLYLESPIGVGFSYSN+SSDY  +ND  TAQD
Sbjct  1     MEHGPFKPRGHNGELLWTNKYSWNMETNMLYLESPIGVGFSYSNSSSDYQYYNDAMTAQD  60

Query  283   NLRFVLEWFKKFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGN  462
             NL F+L WF+KFP+YR+ D Y+TGESY GHY+PQLA L+L +NK  NI+  KL+ IA+GN
Sbjct  61    NLAFLLNWFEKFPEYRSVDFYITGESYGGHYVPQLATLVLNHNKNPNIKPVKLEGIAMGN  120

Query  463   PLLDIDISIDAAEFLWSHGAISDDLLAMKRSICNDTRAILEN-IQGNMSNECILVNGATG  639
             P +DI+ISI+  EF WSHG ISD+   + +S+CN++R  +E+ +  N+S  C  V     
Sbjct  121   PFVDIEISINNDEFFWSHGLISDETYRLAQSVCNNSRRWVESYVLNNLSKTCQNVFSKVQ  180

Query  640   EEVGSDIDSSDLLLPICLSSNAKQQMVF-----FRNNLVTTLTKIDKRVAAGDPCLTDRI  804
              E G +I+  D+ L +CL+    Q         F++ +  T  KI       DPC+  +I
Sbjct  181   SETG-NINLEDVTLGLCLNGGGSQTTGSGKPRKFQHKIEHTFNKI-------DPCIDFKI  232

Query  805   YAYLQRPEVQKALHANTTYLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFS  984
               YL + EV+K+LHANT+     W+ CSG L Y  +N   N++P LS++LK  + I L+S
Sbjct  233   NQYLNKQEVKKSLHANTSLY---WEACSGKLHYDQKNRGINVIPVLSDLLKAGLRITLYS  289

Query  985   GDQDTKIPVTQTRTIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLT  1164
             GDQD+K+P T TRTIAN LA+EL L     +GPWYD  Q+AGW+QS+G ++ GKN S LT
Sbjct  290   GDQDSKVPFTATRTIANNLAKELNLYTVIPYGPWYDNKQVAGWTQSYGHTVKGKNESILT  349

Query  1165  FASVRGAAHEVPFTSPSQALTLFRAFLKGYPPPRT  1269
             +A+VRG  HEVP+T+PS+AL L+RAF++  P P +
Sbjct  350   YATVRGGGHEVPYTNPSEALNLYRAFIRALPLPSS  384



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 270/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  62    LFYYFTEAEL-DPSAKPLVLWLNGGPGCSSVGVGAFSENGPFRPS-EQVLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSY+N +S Y   +D  TA+DNL F+L WF KFPQY+  DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSYANDTSCYEGVDDKMTARDNLVFLLRWFSKFPQYKVRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM+K+NKKKNI  F LK  ALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAELMVKFNKKKNI--FNLKGAALGNPVLEFSTDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +    CN +R + E  +G++S  C  V G   +E    +D  D+ L +C+SS   Q  
Sbjct  238   YRIFTLACNYSRYVSEYYRGSLSAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D    YL R +VQ ALHA    +P  W  CS  L
Sbjct  298   VLSPQQVTENI----------DVCVEDETVNYLNRKDVQDALHARLAGVP-KWSVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  +++  IP+L++SGDQD+ IP+T +RT+   LA+ELKL     +
Sbjct  347   EYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G          LTFA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  407   RVWFAGKQVGGWTQVYG--------DILTFATIRGASHEAPFSQPERSLVLFRAFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 271/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P     LV+N+YSWN E
Sbjct  62    LFYYFAEAEL-DPSTKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGQ-LLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQY++ DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSYATDSSYYEGVNDKMTARDNLVFLLRWFTKFPQYKDRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM+ +NKK N+  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAELMVLFNKKNNV--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S  C  V G    E    +D  D+ L +C+SS   Q  
Sbjct  238   YRIFTSACNYSRYVSEYYRGSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        +  ++ +R+   D C+ D    YL R +VQ ALHA  T +P  W  CS  L
Sbjct  298   VL-------SPQQVAERI---DVCVEDETVNYLNRKDVQDALHARLTGVP-KWTVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+ +  +  +  ++   IP+L++SGDQD+ IP+T +RT+   LA ELKL     +
Sbjct  347   EYELLNLENPTISVVGSLVSSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELKLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L FA++RGA+HE PF+ P ++L LFRAFL+  P
Sbjct  407   RVWFEGKQVGGWTQVYG--------DILAFATIRGASHEAPFSQPERSLVLFRAFLQRRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/423 (47%), Positives = 273/423 (65%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P   PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  62    LFYYFAEAET-DPAIKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-LLVRNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  SS Y   ND  TA+DNL F+ +W  KFPQY+N DL++TGES
Sbjct  120   ANMLYLETPIGVGFSYSTDSSSYAAVNDKITARDNLVFLQKWLLKFPQYKNRDLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+    +++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFATDLNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S+ C  V    G E    +D  D+ L +C+SS   Q  
Sbjct  238   YKMFTSFCNYSRYVSEYYRGSVSSICSRVMSQVGRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D   +YL R +VQKALHA    +   W  CS  L
Sbjct  298   VLSPQQVTETI----------DVCVEDETESYLNRRDVQKALHARLVGVN-KWSVCSNIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA EL L     +
Sbjct  347   DYELLDLEIPTISIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLNTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LFRAFL G P
Sbjct  407   RVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFRAFLGGRP  458

Query  1258  PPR  1266
              P+
Sbjct  459   LPQ  461



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   390 bits (1002),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 273/424 (64%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF E+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN+YSWN E
Sbjct  64    LFYYFAESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNEYSWNKE  121

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQYR+ DL+LTGES
Sbjct  122   ANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLVFLLRWFNKFPQYRSRDLFLTGES  181

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+K N KK I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  182   YAGHYVPQLAKLMIKMNTKKKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  239

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  + ++S  C  V G    E    +D  D+ L +C+SS      
Sbjct  240   YNMFTTVCNYSRYVSEYYRDSISPLCSKVMGQVSRETSKFVDKYDVTLDVCISS------  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++N+++   K  +   + D C+ D++  YL R +VQ+ALHA    +   WD CS  L
Sbjct  294   VLSQSNVIS--PKTQEASESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNVL  350

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   L R+L L     +
Sbjct  351   NYDMLNLEVPTLPVVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLGRQLGLNTTVPY  410

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q  G +        L+FA+VRGA+HEVPF+ P ++L LF++FLKG  
Sbjct  411   RVWFEGQQVGGWTQVHGNT--------LSFATVRGASHEVPFSQPRRSLVLFKSFLKGIS  462

Query  1258  PPRT  1269
              P  
Sbjct  463   LPEV  466



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   389 bits (999),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 269/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P     LV+N++SWN E
Sbjct  62    LFYYFAEAEL-DPYTKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGQ-VLVRNEFSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSY+  SS Y   +D  TA+DNL F+L WF KFPQY++ DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSYATDSSYYDGVDDKMTARDNLVFLLRWFTKFPQYKDRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM+ +NKKKN+  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAELMVLFNKKKNV--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +    CN +R + E  +G++S  C  V G    E    +D  D+ L +C+SS   Q  
Sbjct  238   YRIFTYACNYSRYVSEYYRGSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D    YL R +VQ A+HA  T +P  W  CS  L
Sbjct  298   VLSPQQVPEHI----------DVCVEDETVNYLNRKDVQDAMHARLTGVP-KWSVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  +++  IP+L++SGDQD+ IP+T +RT+   LA+ELKL     +
Sbjct  347   EYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G          LTFA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  407   RVWFEDKQVGGWTQVYG--------DILTFATIRGASHEAPFSQPERSLVLFRAFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score =   389 bits (999),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 203/422 (48%), Positives = 267/422 (63%), Gaps = 23/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  64    LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGNAALVRNEYSWNKE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESPIGVGFSYS  SS Y   ND  TA+DNL F+  WF KFPQYRN  LY+TGES
Sbjct  123   ANILYLESPIGVGFSYSVNSSSYEGVNDKITARDNLVFLQNWFLKFPQYRNRSLYITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+LML +NKK+ I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYIPQLAELMLHFNKKEKI--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  240

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  241   YKLFTSACNYSRYVSEYYRGSLSPICSKVMSLVTTETSRFVDKYDVTLDVCISSVLSQSK  300

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D    YL R +V+ ALHA    +   W  CS  L
Sbjct  301   VLSPQQVTENI----------DVCVEDETVNYLNRRDVRNALHARLVGVN-RWLVCSNIL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ +I    +  +  I++  IP+L++SGDQD+ IP+T +R + + LARELKL     +
Sbjct  350   DYELLDIEIPTINVVGRIIEAGIPVLVYSGDQDSVIPLTGSRKLVHRLARELKLRTTTPY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G+Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF+AFL+G P
Sbjct  410   RVWFAGMQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKAFLEGRP  461

Query  1258  PP  1263
              P
Sbjct  462   LP  463



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   388 bits (997),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/424 (47%), Positives = 271/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF E+GPF+P  +  LV+N YSWN E
Sbjct  62    LFYYFVEAEI-DPASKPLVLWLNGGPGCSSVGVGAFSENGPFRPNGE-VLVRNDYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  SS Y   +D  TA+DNL F+  W+ KFP YR  DL++TGES
Sbjct  120   ANMLYLETPIGVGFSYSTNSSSYVAVDDETTARDNLVFLQRWYHKFPNYRQRDLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA LM++ NKK+N+  F LK IALGNP+L+  I  ++ AE+ WSHG ISD  
Sbjct  180   YAGHYIPQLAKLMVELNKKQNL--FNLKGIALGNPVLEFAIDFNSRAEYFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q M
Sbjct  238   YRMFTSVCNYSRYVSEYYRDSVSPSCSRVMSQVSRETSKFVDKYDVTLDVCISSVLSQSM  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           ++ +RV   D C+ D+I  YL R +VQKALHA    +   W  CS  L
Sbjct  298   VL-------NPQQVSERV---DVCVEDKIVNYLNRKDVQKALHALLVGVR-RWAVCSNIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LA+EL L     +
Sbjct  347   DYQLLNLEIPTISIVGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVRGLAKELGLETTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  407   RVWFEGKQVGGWTQVYG--------NILAFATIRGASHEAPFSQPERSLMLFKSFLEGKP  458

Query  1258  PPRT  1269
              P  
Sbjct  459   LPEV  462



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   387 bits (995),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/424 (47%), Positives = 274/424 (65%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN YSWN E
Sbjct  61    LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNRE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  W+ KFP YR+ DLY+TGES
Sbjct  119   ANMLYLETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA LM+++NKK+N+  F LK IALGNP+++     ++ AE+ WSHG ISD  
Sbjct  179   YAGHYIPQLAKLMVEFNKKQNL--FNLKGIALGNPVMEFATDFNSRAEYFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q M
Sbjct  237   YKMFTSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSM  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                         ++ +RV   D C+ D+I  YL + +VQKALHA    +   W  CS  L
Sbjct  297   AI-------NPQQVSERV---DVCVEDKIVNYLNQKDVQKALHARLVGVR-RWTVCSNIL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +R++ + LA+EL+L     +
Sbjct  346   DYQLLNLEMPTISIVGSLIKSGIPVLVYSGDQDSVIPLTGSRSLVSRLAKELELETTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  406   RVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLMLFKSFLEGKP  457

Query  1258  PPRT  1269
              P  
Sbjct  458   LPEV  461



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   387 bits (993),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 199/425 (47%), Positives = 271/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE   P S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  67    LFYYFAEAEI-TPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  123

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSY+ +SS Y   +D  TA+DNL F+  WF KFPQY++ DL+LTGE
Sbjct  124   EANMLYLETPVGVGFSYAKSSSSYIAVDDEATARDNLVFLQRWFNKFPQYKHRDLFLTGE  183

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ N+K+  ++F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  184   SYAGHYIPQLAKLMIEINRKE--KSFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDS  241

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + +MS  C  V     +E    +D  D+ L +C+SS   Q 
Sbjct  242   TYNMFTSVCNYSRYVSEYYRDSMSPVCSRVMSQVSKETSKFVDKYDVTLDVCISSVLSQS  301

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V   N +   +          D C+ D+   YL R +VQKALHA    +   WD CS  
Sbjct  302   KVISPNQMTERI----------DVCVEDKTVNYLNRKDVQKALHARLVGVR-RWDVCSNI  350

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +R++   LA EL L     
Sbjct  351   LDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIPLTGSRSLVYRLATELGLNTTVP  410

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  411   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPGRSLRLFKSFLEGR  462

Query  1255  PPPRT  1269
             P P  
Sbjct  463   PLPEV  467



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   386 bits (992),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 271/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  65    LFYYFVEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGQVLVRNEYSWNR  121

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+PIGVGFS S  SS+Y   +D  TA+DNL F+  WF KFPQY++ DL+LTGE
Sbjct  122   EANMLYLETPIGVGFSNSRHSSNYVAVDDKATARDNLVFLQRWFNKFPQYKHRDLFLTGE  181

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ N+K+ +  F LK +ALGNP+L+     ++ AE+ WSHG ISD 
Sbjct  182   SYAGHYIPQLAKLMVEANRKEKL--FNLKGLALGNPVLEYATDFNSRAEYFWSHGLISDS  239

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  240   TYRMFTSVCNYSRYVSEYYRDSVSPVCSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQS  299

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                  N +   +          D C+ D+I  YL R +VQ ALHA    +   WD CS  
Sbjct  300   KAISPNQMTERI----------DVCVEDKIVNYLNRKDVQNALHAKLVGVR-RWDVCSNI  348

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQM ++    +  +  I+K  IP+L++SGDQD+ IP+T +RT+ + LAREL L     
Sbjct  349   LDYQMLDLEIPTISLVGSIVKAGIPVLVYSGDQDSVIPLTGSRTLVDRLARELGLNTTVP  408

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  409   YRVWFQGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLQGR  460

Query  1255  PPPRT  1269
             P P+ 
Sbjct  461   PLPQV  465



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score =   386 bits (991),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 198/425 (47%), Positives = 270/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE   P S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  58    LFYYFAEAEI-TPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  114

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSY+ +SS Y   +D  TA+DNL F+  WF KFPQY+  DL+LTGE
Sbjct  115   EANMLYLETPVGVGFSYAKSSSSYIAVDDEATARDNLVFLQRWFNKFPQYKQRDLFLTGE  174

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ N+K+  ++F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  175   SYAGHYIPQLAKLMIEINRKE--KSFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDS  232

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + +MS  C  V     +E    +D  D+ + +C+SS   Q 
Sbjct  233   TYNMFTSVCNYSRYVSEYYRDSMSPVCSRVMSQVSKETSKFVDKYDVTIDVCISSVLSQS  292

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V   N +   +          D C+ D+   YL R +VQKALHA    +   WD CS  
Sbjct  293   KVISPNQMTERI----------DVCVEDKTVNYLNRKDVQKALHARLVGVR-RWDVCSNI  341

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +R++   LA EL L     
Sbjct  342   LDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIPLTGSRSLVYRLATELGLNTTVP  401

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  402   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPGRSLRLFKSFLEGR  453

Query  1255  PPPRT  1269
             P P  
Sbjct  454   PLPEV  458



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   387 bits (993),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 200/435 (46%), Positives = 270/435 (62%), Gaps = 35/435 (8%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  62    LFYYFTEAEL-DPSAKPLVLWLNGGPGCSSVGVGAFSENGPFRPS-EQVLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSY+N +S Y   +D  TA+DNL F+L WF KFPQY+  DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSYANDTSCYEGVDDKMTARDNLVFLLRWFSKFPQYKVRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIA-----------LGNPLLDIDISIDA-AEF  504
             YAGHY+PQLA+LM+K+NKKKNI  F LK  A           LGNP+L+     ++ AEF
Sbjct  180   YAGHYVPQLAELMVKFNKKKNI--FNLKGAAPIFPFSRCTWQLGNPVLEFSTDFNSRAEF  237

Query  505   LWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLP  684
              WSHG ISD    +    CN +R + E  +G++S  C  V G   +E    +D  D+ L 
Sbjct  238   FWSHGLISDSTYRIFTLACNYSRYVSEYYRGSLSAVCARVMGQVTQETSRFVDKYDVTLD  297

Query  685   ICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYL  864
             +C+SS   Q  V     +   +          D C+ D    YL R +VQ ALHA    +
Sbjct  298   VCISSVLSQSKVLSPQQVTENI----------DVCVEDETVNYLNRKDVQDALHARLAGV  347

Query  865   PWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLA  1044
             P  W  CS  L+Y++ N+    +  +  +++  IP+L++SGDQD+ IP+T +RT+   LA
Sbjct  348   P-KWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPLTGSRTLVQRLA  406

Query  1045  RELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQAL  1224
             +ELKL     +  W+ G Q+ GW+Q +G          LTFA++RGA+HE PF+ P ++L
Sbjct  407   KELKLKTTVPYRVWFAGKQVGGWTQVYG--------DILTFATIRGASHEAPFSQPERSL  458

Query  1225  TLFRAFLKGYPPPRT  1269
              LFRAFL+G P P T
Sbjct  459   VLFRAFLQGRPLPET  473



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   386 bits (991),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 201/424 (47%), Positives = 265/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LV+N+YSWN E
Sbjct  62    LFYYFVEAE-MDPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYS  SS Y   ND KTA DNL F+  WF KFP Y+N DLY+TGES
Sbjct  120   ANMLYLEAPAGVGFSYSGDSSFYDGVNDKKTAWDNLVFLQRWFNKFPGYKNRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+++NKK  I  F LK IA+GNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMVEFNKKAKI--FNLKGIAMGNPVLEFATDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q +
Sbjct  238   YRIFTSACNYSRYVSEYYRGSLSPVCARVMSQVTRETSRFVDKYDVTLDVCISSVLSQSL  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D    YL R +VQ ALHA  T +   W  CS  L
Sbjct  298   VLSPQQVPENI----------DVCIEDETVNYLNRKDVQDALHARLTGVT-KWTVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY++ N+    +  +  +LK  IP+L++SGDQD+ IP+T +RT+   LA E+ L     +
Sbjct  347   QYELLNLEIPTITLVGSLLKARIPVLVYSGDQDSVIPLTGSRTLVQKLANEMGLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LFR+FL+G P
Sbjct  407   RVWFEGKQVGGWTQVYG--------DILSFATIRGASHEAPFSQPERSLVLFRSFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 270/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LW+NGGPGCSS+G GAF EHGPF+P    NLV+N+YSWN E
Sbjct  101   LFYYFVEAET-NPASKPLVLWVNGGPGCSSIGTGAFSEHGPFRPS-GKNLVRNEYSWNKE  158

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYS  +S Y+  ND  TA+DNL F+  W  KFP+++N DL++TGES
Sbjct  159   ANMLYLETPAGVGFSYSTNTSYYYGVNDEMTARDNLVFMQRWLDKFPEHKNKDLFITGES  218

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+++N +K    F LK IALGNPLL+     ++ AEFLWSHG ISD  
Sbjct  219   YAGHYVPQLAQLMIQFNDQK---LFNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDST  275

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  S CN +R + +  +G++S+ C+ V      E+   ID  D+ L +C+SS   Q  
Sbjct  276   YGFFTSDCNYSRFLSKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQS-  334

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG--  891
                       LT   K V + D C+ D  Y YL R +VQK+LHA+   +   W  C+   
Sbjct  335   --------KALTPQQKVVESTDVCVEDETYNYLNRDDVQKSLHAHLVGVS-GWIACTNYR  385

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              ++Y M N+  + +P LS + +  I IL++SGDQD+ IP+T TRT+ + LA EL L    
Sbjct  386   VIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTV  445

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+Q +G          LTFA++RG +HE PF+ P ++L LF +FLKG
Sbjct  446   PYRVWFEGKQVGGWTQVYG--------DILTFATIRGGSHEAPFSQPQRSLVLFNSFLKG  497

Query  1252  YPPPR  1266
              P P 
Sbjct  498   KPLPE  502



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score =   385 bits (989),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/425 (47%), Positives = 272/425 (64%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  67    LFYYFAEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  123

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS ++S Y   +D  TA+DNL F+  WF KFPQYR+ DL+L GE
Sbjct  124   EANMLYLETPVGVGFSYSKSNSSYMAVDDEATARDNLVFLQRWFNKFPQYRHMDLFLAGE  183

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA L+++ N+K+    F LK IALGNP+L+    +++ AEFLWSHG ISD 
Sbjct  184   SYAGHYIPQLAKLIVEINRKEK---FNLKGIALGNPVLEFATDLNSQAEFLWSHGLISDS  240

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + ++S  C  V     +E    +D  D+ L +C+SS   Q 
Sbjct  241   TYNMFTSVCNYSRYVSEYYRHSVSPVCSRVMSQVTKETSQFVDKYDVTLDVCISSVLSQS  300

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                  N +   +          D C+ D+   YL R +VQKALHA    +   WD CS  
Sbjct  301   KFISPNQMTERI----------DVCVEDKTVNYLNRKDVQKALHARLVGVR-RWDVCSSI  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+YQM N+    +  +  ++K  I +L++SGDQD+ IP+T +R + + LAREL+L     
Sbjct  350   LEYQMLNLEVPTISLVGSLVKQGIQVLVYSGDQDSVIPLTGSRRLVSRLARELELNTTVP  409

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  410   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLRLFKSFLEGR  461

Query  1255  PPPRT  1269
             P P  
Sbjct  462   PLPEV  466



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   384 bits (987),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 269/422 (64%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN YSWN E
Sbjct  54    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNYYSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQYR+ DL+LTGES
Sbjct  112   ANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLIFLLRWFNKFPQYRSRDLFLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++ N K  I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  172   YAGHYVPQLAKLIIEMNTKNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  + ++S  C  V G    E    +D  D+ L +C+SS   Q  
Sbjct  230   YNMFTTVCNYSRYVSEYYRDSVSPLCSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSK  289

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +   + D C+ D++  YL R +VQ+ALHA    +   WD CS  L
Sbjct  290   VI--------CPQSQEANESIDVCVDDKVTNYLNRRDVQEALHAKLVGIR-KWDVCSNIL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L +   +
Sbjct  341   DYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNSTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  401   RVWFEGQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEGRP  452

Query  1258  PP  1263
              P
Sbjct  453   LP  454



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 269/422 (64%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN YSWN E
Sbjct  66    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNYYSWNKE  123

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQYR+ DL+LTGES
Sbjct  124   ANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLIFLLRWFNKFPQYRSRDLFLTGES  183

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++ N K  I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  184   YAGHYVPQLAKLIIEMNTKNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  241

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  + ++S  C  V G    E    +D  D+ L +C+SS   Q  
Sbjct  242   YNMFTTVCNYSRYVSEYYRDSVSPLCSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSK  301

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +   + D C+ D++  YL R +VQ+ALHA    +   WD CS  L
Sbjct  302   VI--------CPQSQEANESIDVCVDDKVTNYLNRRDVQEALHAKLVGIR-KWDVCSNIL  352

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L +   +
Sbjct  353   DYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNSTVPY  412

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  413   RVWFEGQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEGRP  464

Query  1258  PP  1263
              P
Sbjct  465   LP  466



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   384 bits (985),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 270/424 (64%), Gaps = 25/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N++SWN E
Sbjct  65    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNRE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+ +W +KFPQY+N  L++TGES
Sbjct  123   ANMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQKWLEKFPQYKNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+Y   +    F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAELMLQYKDYQ----FNLKGIALGNPVLEYTTDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKMFTSVCNYSRYVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V      VT          A D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  299   VLLPQQQVT---------EAIDVCVEDEIVNYLNRPDVQKALHARLVGVR-QWAVCSNIL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L L     +
Sbjct  349   DYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q++G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  409   RVWFEGQQVGGWTQAYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGQP  460

Query  1258  PPRT  1269
              P  
Sbjct  461   LPEV  464



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 271/422 (64%), Gaps = 23/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAEA +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  65    LFYYFAEAEA-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFPQY N  L++TGES
Sbjct  123   ANMLYLETPVGVGFSYSTDSSSYEGVNDKITARDNLVFLQRWFLKFPQYLNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK  +  F L+ IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAQLMIQYNKKHKL--FNLRGIALGNPVLEFATDFNSRAEFFWSHGLISDST  240

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S  C  V      E    +D  D+ L +C+ S      
Sbjct  241   YKMFTSYCNYSRYVSEYYRGTVSAMCSKVMSQVSVETSRFVDKYDVTLDVCIPS------  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +V+   ++ + V   D C+ D   +YL R +VQ++LHA    +   W  CS  L
Sbjct  295   VLSQSKVVSPQQQVGETV---DVCVEDETVSYLNRRDVQRSLHARLVGVR-KWAVCSNVL  350

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ N LA EL+L     +
Sbjct  351   DYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIPLTGSRTLVNRLAEELRLRTTVPY  410

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AF+ G+P
Sbjct  411   RVWFAGQQVGGWTQVYG--------NILSFATVRGASHEVPFSQPQRSLVLFKAFINGHP  462

Query  1258  PP  1263
              P
Sbjct  463   LP  464



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 269/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  62    LFYYFAEAEL-DPPTKPLVLWLNGGPGCSSVGVGAFSENGPFRPS-EQVLVRNEYSWNEE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSY+N +S Y   ND  TA+DNL F+L WF KFPQY++ DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSYANDTSCYEGVNDKMTARDNLVFLLRWFTKFPQYKDRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADLM+K    K  + F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLADLMVK--FNKKKKIFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +    CN +R + E  +G++S+ C  V G   +E    +D  D+ L +C+SS   Q  
Sbjct  238   YKIFTLACNYSRYVSEYYRGSLSSVCARVMGQVTKETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D    YL R +VQ ALHA  T +P  W  CS  L
Sbjct  298   VLSPQQVTENI----------DVCVEDETVNYLNRKDVQDALHARLTGVP-KWTVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  +++  IPIL++SGDQD+ IP+T +RT+   LA+ELKL     +
Sbjct  347   EYELLNLEVPTISVVGSLVRSGIPILVYSGDQDSVIPLTGSRTLVQRLAKELKLNTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G          LTFA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  407   RVWFVGKQVGGWTQVYG--------DILTFATIRGASHEAPFSQPERSLVLFRAFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/423 (47%), Positives = 270/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE + P S PL LWLNGGPGCSS+G GAF+EHGPF+P  +G L+KN++SWN E
Sbjct  61    LFYYFVEAEVE-PASKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEFSWNKE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF KFP+++NSD ++TGES
Sbjct  119   ANMLYLESPAGVGFSYSANKSFYDYVNDEMTARDNLVFLQRWFTKFPEFKNSDFFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IALGNPLL+ +   ++ AEF WSHG ISD  
Sbjct  179   YAGHYVPQLAQLIVQTKTK-----FNLKGIALGNPLLEFNTDFNSRAEFFWSHGLISDST  233

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN ++   ++  G ++  C  VN     EV   +D+ D+ L +CLSS  +Q  
Sbjct  234   YEIFTKVCNYSQIRRQHQSGKLTPICSGVNKLVSTEVSRYVDTYDVTLDVCLSSVDQQAY  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N +T L +  K     D C+ D   AYL R +VQ+ALHA    +  +W  CS TL
Sbjct  294   VL---NQLTQLQEGGKI----DVCVEDETTAYLNRKDVQEALHAKLEGIT-SWSVCSDTL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y +QN+    +P L  + K  I +L++SGDQD+ IP+  TR++ N LA++  L     +
Sbjct  346   GYDLQNLEIPTIPILGALAKSGIRVLVYSGDQDSVIPLIGTRSLVNGLAKDFGLNTTVSY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+AGW+Q +G          L+FA+VRGAAHE PF+ P ++L L +AFL+G P
Sbjct  406   RTWFEGKQVAGWTQEYG--------DILSFATVRGAAHEAPFSQPERSLVLLKAFLEGKP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 269/424 (63%), Gaps = 25/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N++SWN E
Sbjct  65    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNRE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+  W +KFPQY+N  L++TGES
Sbjct  123   ANMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQNWLEKFPQYKNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+Y + +    F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAELMLQYKEYQ----FNLKGIALGNPVLEYTTDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKMFTSVCNYSRYVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V      VT          A D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  299   VLLPQQQVT---------EAIDVCVEDEIVNYLNRPDVQKALHARLVGVR-QWAVCSNIL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++       + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L L     +
Sbjct  349   DYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q++G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  409   RVWFEGQQVGGWTQAYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  460

Query  1258  PPRT  1269
              P  
Sbjct  461   LPEV  464



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 270/422 (64%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LWLNGGPGCSS+G GAF E+GPF+P R   LV+N+YSWN E
Sbjct  62    LFYYFVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYSN +S Y   ND  TA+DNL F+L WF+KFPQYR S+L+LTGES
Sbjct  120   ANMLYLESPIGVGFSYSNNTSSYETVNDEVTARDNLVFLLRWFQKFPQYRKSNLFLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ I  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAKLMMVFNKKQQI--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D   + L +C+SS      
Sbjct  238   YRMFSSACNYSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISS------  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++    ++K     D C+ D I  YL R +V++ALHA    +   W  CS  L
Sbjct  292   VLSQSKIISPQENVEKL----DVCVEDEIINYLNRKDVRRALHAELVGVR-RWAVCSNIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ IP+  +R   + LAR ++L     +
Sbjct  347   DYQLLDIEIPTISIIGMLVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMQLNTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+  +         + L+FA++RGA+HE PF+ P ++L LFR+FL+G P
Sbjct  407   RVWFAGQQVGGWTHVYD--------NILSFATIRGASHEAPFSQPERSLVLFRSFLEGRP  458

Query  1258  PP  1263
              P
Sbjct  459   LP  460



>ref|XP_002971138.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ27736.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=475

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/437 (46%), Positives = 276/437 (63%), Gaps = 30/437 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNG----------GPGCSSLGYGAFMEHGPFQPGRDGN-  147
             LFYYFVE E   P S PLTLWLNG          GPGCSS+G GAF E GPF P   G  
Sbjct  56    LFYYFVEVEGGAPQSKPLTLWLNGEFLSGTKKKKGPGCSSIGCGAFTELGPFYPNASGTG  115

Query  148   LVKNKYSWNLESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQY  327
             L++N  SWN  SN+L+L+SP GVG+SYSNTSSDY N  D KTAQD L F+L WF+KFP++
Sbjct  116   LLRNPQSWNKVSNLLFLDSPAGVGWSYSNTSSDYDNVTDEKTAQDTLLFLLGWFRKFPEF  175

Query  328   RNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EF  504
             R+SDLY+TGESYAGHY+PQLA ++L +N++      +LK IA+GNPLL++ I   A  E+
Sbjct  176   RSSDLYITGESYAGHYVPQLASVILGHNERNRQEELRLKGIAIGNPLLNLGIDTAAMYEY  235

Query  505   LWSHGAISDDLLAMKRSICN-DTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLL  681
              WSHG ISDD  A  +  CN +   +    Q N+SN+C ++ G + +EVG  I++ D++L
Sbjct  236   FWSHGLISDDTFAAVKGACNFEDYELGAEKQHNVSNQCDVIMGKSDDEVGDFINNYDVIL  295

Query  682   PICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTY  861
              +CL S   Q++   ++        I ++    D C+ D    YL    VQ+ALHAN T 
Sbjct  296   DVCLPSLFLQELRLKQH--------ITQKSYGVDVCIDDERDLYLNDYRVQQALHANVTG  347

Query  862   LPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANML  1041
             L + W  C G +QY +Q+ + +I+P L  I+K  + + +FSGDQD+ +P+T TRTI N L
Sbjct  348   LNYKWTMCDGPVQYYLQDGSIDIVPLLQNIVKTGLRVWVFSGDQDSVVPLTGTRTIINGL  407

Query  1042  ARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQA  1221
              + L L A   +  WY G Q+AGW+Q +G          LT+A++RGAAH VP+  P++A
Sbjct  408   GKSLNLPATVPYTAWYLGGQVAGWTQVYGN---------LTYATIRGAAHMVPYAQPARA  458

Query  1222  LTLFRAFLKGYPPPRTS  1272
             L LF+ FL G   P+ S
Sbjct  459   LLLFQTFLSGQTLPKNS  475



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 266/422 (63%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAEA +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  65    LFYYFAEAEA-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFPQY N  L++TGES
Sbjct  123   ANMLYLETPVGVGFSYSTDSSSYEGVNDKITARDNLVFLQRWFLKFPQYLNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK  +  F L+ IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAQLMIQYNKKHKL--FNLRGIALGNPVLEFATDFNSRAEFFWSHGLISDST  240

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S  C  V      E    +D  D+ L +C+ S   Q  
Sbjct  241   YKMFTSYCNYSRYVSEYYRGTVSAMCSKVMSQVSVETSRFVDKYDVTLDVCIPSVLSQSK  300

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D   +YL R +VQ++LHA    +   W  CS  L
Sbjct  301   VVSPQQVGETV----------DVCVEDETVSYLNRRDVQRSLHARLVGVR-KWAVCSNVL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ N LA EL+L     +
Sbjct  350   DYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIPLTGSRTLVNRLAEELRLRTTVPY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AF+ G+P
Sbjct  410   RVWFAGQQVGGWTQVYG--------NILSFATVRGASHEVPFSQPQRSLVLFKAFINGHP  461

Query  1258  PP  1263
              P
Sbjct  462   LP  463



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   382 bits (980),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/422 (48%), Positives = 265/422 (63%), Gaps = 18/422 (4%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  + L  PL +WLNGGPGCSS G GA  E+GPF P R G L  N+YSWN E
Sbjct  54    LFYYFVEAETDSNLK-PLVVWLNGGPGCSSFGVGALSENGPFHP-RGGKLFGNEYSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYSN ++ Y   ND KTA+DNL+F+  WF KFP+Y+  DLYLTGES
Sbjct  112   ANMLYLETPAGVGFSYSNDTTYYLGANDAKTAEDNLQFLHGWFDKFPEYKTRDLYLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQ A+L+++ N+K+ I  F LK IA+GNPLLD     +A AE+LWSHG ISD  
Sbjct  172   YAGHYIPQWAELIVEANRKEKI--FNLKGIAIGNPLLDFFTDFNARAEYLWSHGLISDPT  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                 ++ CN TR + E  +G +S+ C  V      E+   ID  D+ L ICLSS   Q  
Sbjct  230   YNNMKTGCNYTRYVDEYYRGTVSSTCEDVYSTVSMELSQYIDRYDVTLDICLSSVGTQ--  287

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                ++ ++   T   +     D C+ +   AYL   +VQKA HA        WD CS  L
Sbjct  288   ---KSKMLGVKTIGTRLAVQPDVCVENEATAYLNMVDVQKAFHARLVGNVKRWDSCSDVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y   N+    +P L ++    I +L++SGDQD+ IP+T TRT+ N LA  LKL +   +
Sbjct  345   TYDHHNLEIPTVPLLGKLAMTGIRVLIYSGDQDSVIPLTGTRTLVNNLAASLKLNSTVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+AGW Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL+G  
Sbjct  405   SVWFQGKQVAGWVQVYG--------NILSFATVRGASHEVPFSQPERSLVLFKAFLQGQT  456

Query  1258  PP  1263
             PP
Sbjct  457   PP  458



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score =   382 bits (981),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 275/425 (65%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  66    LFYYFVEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  122

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS +SS Y   +D  TA+DNL F+  WF KFPQY++ DL+LTGE
Sbjct  123   EANMLYLETPVGVGFSYSKSSSSYVAVDDETTARDNLVFLQRWFNKFPQYKHRDLFLTGE  182

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA+LM++ N+K+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  183   SYAGHYIPQLANLMVEINRKEKL--FSLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  240

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + ++S  C  V     +E    +D  D+ L +C+SS   Q 
Sbjct  241   TYNMFTSVCNYSRYVSEYYRDSVSPSCSKVMSQVSKETSKFVDKYDVTLDVCISSVLSQS  300

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V   N +   +          D C+ D+I  YL R +VQKALHA    +   WD CS  
Sbjct  301   KVISPNQMTERI----------DVCVEDKIVNYLNRKDVQKALHARLVGVR-RWDVCSNI  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LAREL L     
Sbjct  350   LDYQVLNMEIPTISLVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVP  409

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  410   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLRLFKSFLEGR  461

Query  1255  PPPRT  1269
             P P  
Sbjct  462   PLPEV  466



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/425 (47%), Positives = 268/425 (63%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LW+NGGPGCSS+G GAF EHGPF+P    NLV+N+YSWN E
Sbjct  101   LFYYFVEAET-NPASKPLVLWVNGGPGCSSIGTGAFSEHGPFRPS-GKNLVRNEYSWNKE  158

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYS  +S Y+  ND  TA+DNL F+  W  KFP+++N DL++TGES
Sbjct  159   ANMLYLETPAGVGFSYSTNTSYYYGVNDEMTARDNLVFMQRWLDKFPEHKNKDLFITGES  218

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+++N +K    F LK IALGNPLL+     ++ AEFLWSHG ISD  
Sbjct  219   YAGHYVPQLAQLMIQFNDQK---LFNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDST  275

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  S CN +R + +  +G++S+ C+ V      E+   ID  D+ L +C+SS   Q  
Sbjct  276   YGFFTSDCNYSRFLSKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSK  335

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG--  891
                            K V + D C+ D  Y YL R +VQK+LHA+   +   W  C+   
Sbjct  336   AL----------TPQKVVESTDVCVEDETYNYLNRDDVQKSLHAHLVGVS-GWIACTNYR  384

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              ++Y M N+  + +P LS + +  I IL++SGDQD+ IP+T TRT+ + LA EL L    
Sbjct  385   VIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTV  444

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+Q +G          LTFA++RG +HE PF+ P ++L LF +FLKG
Sbjct  445   PYRVWFEGKQVGGWTQVYG--------DILTFATIRGGSHEAPFSQPQRSLVLFNSFLKG  496

Query  1252  YPPPR  1266
              P P 
Sbjct  497   KPLPE  501



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   382 bits (980),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 266/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LV+N+YSWN E
Sbjct  62    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NML+LE+PIGVGFSYS  +S Y    D  TA+DNL F+  WF KFPQYRN  L++TGES
Sbjct  120   ANMLFLETPIGVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLADLML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLADLMLEFNKKEEL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDAT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YTMFTSFCNYSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T           D C+ D    YL R +VQKALHA    +  +W  CS  L
Sbjct  298   VLTPKQVGETTV---------DVCVEDETVNYLNRKDVQKALHARLVGVR-SWAVCSNIL  347

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++K  IP++++SGDQD+ IP+T +R + N LA+ELKL     +
Sbjct  348   DYELLDLEIPTITVVGKLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPY  407

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL   P
Sbjct  408   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLDSRP  459

Query  1258  PPR  1266
              P 
Sbjct  460   LPE  462



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   381 bits (979),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 266/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LV+N+YSWN E
Sbjct  62    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NML+LE+PIGVGFSYS  +S Y    D  TA+DNL F+  WF KFPQYRN  L++TGES
Sbjct  120   ANMLFLETPIGVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLADLML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLADLMLEFNKKEEL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDAT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YTMFTSFCNYSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T           D C+ D    YL R +VQKALHA    +  +W  CS  L
Sbjct  298   VLTPKQVGETTV---------DVCVEDETVNYLNRKDVQKALHARLVGVR-SWAVCSNIL  347

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++K  IP++++SGDQD+ IP+T +R + N LA+ELKL     +
Sbjct  348   DYELLDLEIPTITIVGKLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPY  407

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL   P
Sbjct  408   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLDSRP  459

Query  1258  PPR  1266
              P 
Sbjct  460   LPE  462



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   381 bits (979),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 269/424 (63%), Gaps = 26/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N++SWN E
Sbjct  65    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNRE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+ +W +KFPQY+N  L++TGES
Sbjct  123   ANMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQKWLEKFPQYKNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+Y   +    F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAELMLQYKDYQ----FNLKGIALGNPVLEYTTDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKMFTSVCNYSRYVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  299   VLLPQQVTEAI----------DVCVEDEIVNYLNRPDVQKALHARLVGVR-QWAVCSNIL  347

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L L     +
Sbjct  348   DYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPY  407

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q++G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  408   RVWFEGQQVGGWTQAYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGQP  459

Query  1258  PPRT  1269
              P  
Sbjct  460   LPEV  463



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score =   381 bits (979),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 199/425 (47%), Positives = 275/425 (65%), Gaps = 23/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN++SWN E
Sbjct  66    LFYYFVESEI-DPPSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNEHSWNKE  123

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNW-NDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             +NMLYLE+PIGVGFSY+  SS Y    ND +TA+DNL F+  WF KFPQYRN DL+LTGE
Sbjct  124   ANMLYLETPIGVGFSYAKGSSSYTTTVNDEETARDNLVFLQRWFNKFPQYRNRDLFLTGE  183

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA LM++ NK+  I  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  184   SYAGHYVPQLAKLMIEMNKRNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDS  241

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  ++CN +R + E  + ++S  C  V G   +E    +D  D+ L +C+SS   Q 
Sbjct  242   TYNMFTTVCNYSRYVSEYNRDSVSPLCSKVMGLVSKETSKFVDKYDVTLDVCISSVLSQS  301

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V     +     + ++R+   D C+ D++  YL R +VQ+ALHA    +   WD CS  
Sbjct  302   KV-----INPQPQQANERI---DVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNI  352

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y + N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L     
Sbjct  353   LDYDVLNLEVPTLPIVGSLIKSGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVS  412

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++  Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF++FL+G 
Sbjct  413   YRVWFESQQVGGWTQVYG--------NMLSFATVRGAAHEVPFSQPERSLVLFKSFLEGR  464

Query  1255  PPPRT  1269
             P P  
Sbjct  465   PLPEV  469



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   381 bits (978),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 266/424 (63%), Gaps = 25/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             +FYY  EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  63    MFYYLAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNTE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y    D  TA+DNL F+ +W +KFPQYRN  LY+TGES
Sbjct  121   ANMLYLETPIGVGFSYSTDTSSYEGVTDRITARDNLLFLQKWLEKFPQYRNRSLYITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++ K+     F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAELMLQFKKEYQ---FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDAT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C +V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YNMFTSVCNYSRYVSEYYRGSLSPICAMVMSQVSRETSKFVDKYDVTLDVCISSVVSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +  T+          D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  298   ALLPQEVADTI----------DVCVDDEIVNYLNRPDVQKALHARLVGVR-QWAVCSTIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ  ++    +  + +++K  IP+L++SGDQD+ IP+T +R + N LA +L+L     +
Sbjct  347   DYQQLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTGSRKLVNGLAEQLRLSTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  407   RVWFGGQQVGGWTQVYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  458

Query  1258  PPRT  1269
              P  
Sbjct  459   LPEV  462



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 267/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN+YSWN E
Sbjct  62    LFYYFAEAEV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQYRN  L++TGES
Sbjct  120   ANMLYLEAPIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+LML++N+K  +  F LK IALGNP+L+  I  ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLAELMLQFNRKDKL--FNLKGIALGNPVLEFAIDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  + CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YKMFTTSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  298   VLTPQQVGETI----------DVCVEDETANYLNRQDVQKALHARLVGVR-KWAVCSNVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP++++SGDQD+ IP+T +RT+ N LA+EL L     +
Sbjct  347   DYELLDLEIPTITIVGSLVKAGIPVMVYSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL+G P
Sbjct  407   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLEGRP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 268/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE + P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  60    LFYYFAEAETE-PTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y + ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  118   ANMLYLETPVGVGFSYSTQSSSYESVNDKITARDNLVFLERWFLKFPHYLNRSLFITGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADLM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  178   YAGHYVPQLADLMIQYNKKHHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDST  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+SS   Q  
Sbjct  236   FKLFTSYCNYSRYVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSK  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+AL A    +   W  CS  L
Sbjct  296   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALQARLVGVR-EWTVCSNVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQM ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  345   DYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF+AFL G+P
Sbjct  405   RVWFAGQQVGGWTQVYG--------NVLSFATVRGAAHEVPFSQPERSLVLFKAFLDGHP  456

Query  1258  PPR  1266
              P 
Sbjct  457   LPE  459



>ref|XP_002961948.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37208.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=480

 Score =   381 bits (979),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 203/442 (46%), Positives = 276/442 (62%), Gaps = 35/442 (8%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNG---------------GPGCSSLGYGAFMEHGPFQPG  135
             LFYYFVE E   P S PLTLWLNG               GPGCSS+G GAF E GPF P 
Sbjct  56    LFYYFVEVEGGAPQSKPLTLWLNGVVSLTQSSCLAPKKKGPGCSSIGCGAFTELGPFYPN  115

Query  136   RDGN-LVKNKYSWNLESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFK  312
               G  L++N  SWN  SN+L+L+SP GVG+SYSNTSSDY N  D KTAQD L F+L WF+
Sbjct  116   ASGTGLLRNPQSWNKVSNLLFLDSPAGVGWSYSNTSSDYDNVTDEKTAQDTLLFLLGWFR  175

Query  313   KFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISID  492
             KFP++R+SDLY+TGESYAGHY+PQLA ++L +N++      +LK IA+GNPLL++ I   
Sbjct  176   KFPEFRSSDLYITGESYAGHYVPQLASVILGHNERNRQEELRLKGIAIGNPLLNLGIDTA  235

Query  493   AA-EFLWSHGAISDDLLAMKRSICN-DTRAILENIQGNMSNECILVNGATGEEVGSDIDS  666
             A  E+ WSHG ISDD  A  +  CN +   +    Q N+SN+C ++ G + +EVG  I++
Sbjct  236   AMYEYFWSHGLISDDTFAAVKGACNFEDYELGAEKQHNVSNQCDVIMGKSDDEVGDFINN  295

Query  667   SDLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALH  846
              D++L +CL S   Q++   ++        I ++    D C+ D    YL    VQ+ALH
Sbjct  296   YDVILDVCLPSLFLQELRLKQH--------ITQKSYGVDVCIDDERDLYLNDYRVQQALH  347

Query  847   ANTTYLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRT  1026
             AN T L + W  C G +QY +Q+ + +I+P L  I+K  + + +FSGDQD+ +P+T TRT
Sbjct  348   ANVTGLNYKWTMCDGPVQYYLQDGSIDIVPLLQSIVKTGLRVWVFSGDQDSVVPLTGTRT  407

Query  1027  IANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFT  1206
             I N L + L L A   +  WY G Q+AGW+Q +G          LT+A++RGAAH VP+ 
Sbjct  408   IINGLGKSLNLPATVPYTAWYLGGQVAGWTQVYGN---------LTYATIRGAAHMVPYA  458

Query  1207  SPSQALTLFRAFLKGYPPPRTS  1272
              P++AL LF+ FL G   P+ S
Sbjct  459   QPARALLLFQTFLSGQTLPKNS  480



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/425 (48%), Positives = 275/425 (65%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  59    LFYYFVEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  115

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS +SS Y + +D  TA+DNL F+  WF KFPQY++ DL+LTGE
Sbjct  116   EANMLYLETPVGVGFSYSKSSSSYVSVDDEATARDNLVFLQRWFNKFPQYKHRDLFLTGE  175

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA+LM++ N+K+ +  F +K IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  176   SYAGHYIPQLANLMVEINRKEKL--FSIKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  233

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  234   TYNMFTSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQS  293

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V   N +   +          D C+ D+I  YL R +VQKALHA    +   WD CS  
Sbjct  294   KVISPNQMTERI----------DVCVEDKIVNYLNRKDVQKALHARLVGVR-RWDVCSNI  342

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L YQ+ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LAREL L     
Sbjct  343   LDYQVLNLEIPTISLVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVP  402

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  403   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLRLFKSFLEGR  454

Query  1255  PPPRT  1269
             P P  
Sbjct  455   PLPEV  459



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   380 bits (977),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 268/424 (63%), Gaps = 26/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N++SWN E
Sbjct  65    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNRE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+  W +KFPQY+N  L++TGES
Sbjct  123   ANMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQNWLEKFPQYKNRSLFITGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+Y + +    F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  183   YAGHYVPQLAELMLQYKEYQ----FNLKGIALGNPVLEYTTDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKMFTSVCNYSRYVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +   +          D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  299   VLLPQQVTEAI----------DVCVEDEIVNYLNRPDVQKALHARLVGVR-QWAVCSNIL  347

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++       + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L L     +
Sbjct  348   DYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPY  407

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q++G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  408   RVWFEGQQVGGWTQAYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  459

Query  1258  PPRT  1269
              P  
Sbjct  460   LPEV  463



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score =   380 bits (977),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/423 (48%), Positives = 268/423 (63%), Gaps = 29/423 (7%)
 Frame = +1

Query  4     FYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNLE  180
             FYYFVEAE + P S PL LWLNGGPGCSS+G GAF EHGPFQP   GN LV+N YSWN  
Sbjct  62    FYYFVEAETE-PASKPLVLWLNGGPGCSSVGAGAFSEHGPFQP--SGNVLVRNNYSWNKA  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + +D  TA+DNL F+ +WF KFP+Y+N + Y+TGES
Sbjct  119   ANMLYLESPAGVGFSYSANKSFYESVDDEMTARDNLNFLEKWFDKFPEYKNREFYITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             Y GHY+PQLA+L+++   K     F LK IA+GNPLL+ D   ++ AEFLWSHG ISD  
Sbjct  179   YGGHYVPQLANLIIQSKAK-----FNLKGIAIGNPLLEFDTDFNSRAEFLWSHGLISDAT  233

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  S+CN ++   +   G ++  C  V      E+   ID+ D+ L +CLSS   Q  
Sbjct  234   YYQFTSVCNYSQIRRQAASGALTPVCSRVIKLVSSEISRFIDTYDVTLDVCLSSVMLQAE  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N V    KID        C+ D   AYL R +VQ+ALHA    +   W  CS  L
Sbjct  294   VL---NQVQDEPKIDV-------CVEDEANAYLNRKDVQQALHARLVGVS-RWSICSDIL  342

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+MQN+    +  L  ++K  + +L++SGDQD+ +P+T TR + N LA++LKL   E +
Sbjct  343   HYEMQNLEIPTIGILGLLVKSGVRVLVYSGDQDSVLPLTGTRALVNGLAKDLKLNTSEPY  402

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
             G W++G Q+AGW+QS+G         FL+FA++RGA+HE PF+ P ++L LF +F+ G P
Sbjct  403   GAWFEGRQVAGWTQSYG--------EFLSFATIRGASHEAPFSQPERSLVLFSSFVGGKP  454

Query  1258  PPR  1266
              PR
Sbjct  455   LPR  457



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   381 bits (979),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/424 (46%), Positives = 275/424 (65%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  93    LFYYFVEAEI-DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNSE  150

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQY++ DL++TGES
Sbjct  151   ANMLYLETPVGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHRDLFITGES  210

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLADLM+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  211   YAGHYIPQLADLMIQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDST  268

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V     +E    +D  D+ L +C+SS   Q  
Sbjct  269   YRLFTSACNYSRYVSEYYRGSVSSVCSKVMNQVSKETSRFVDKYDVTLDVCISSVLSQSK  328

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        +  ++ +R+   D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  329   VL-------SPQQVTERI---DVCVEDETVNYLNRRDVQKALHARLVGVR-RWAVCSNIL  377

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  378   NYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAKDLGLNTTVPY  437

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  438   RVWFAGQQVGGWTQVYG--------NVLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  489

Query  1258  PPRT  1269
              P  
Sbjct  490   LPEV  493



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 269/424 (63%), Gaps = 26/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  63    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y    D  TA+DNL F+ +WF+KFPQYRN  LY+TGES
Sbjct  121   ANMLYLETPIGVGFSYSTDTSSYEAVADHITARDNLLFLQKWFEKFPQYRNRSLYITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGH++PQLA+LML++ +      F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHFVPQLAELMLQFKEHH----FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YKMFSSVCNYSRFVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +  ++          D C+ D +  YL RP+VQKALHA    +   W  CS  L
Sbjct  297   ALLPQQVADSI----------DVCVEDEVVNYLNRPDVQKALHARLVGVR-QWAVCSNIL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L+L     +
Sbjct  346   DYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAEQLRLNTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FLKG P
Sbjct  406   RVWFEGQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLKGRP  457

Query  1258  PPRT  1269
              P  
Sbjct  458   LPEV  461



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   380 bits (976),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 269/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  D  LV+N+YSWN E
Sbjct  72    LFYYFAEAEL-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGDA-LVRNEYSWNRE  129

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+  WF KFPQY+NS+L++TGES
Sbjct  130   ANMLYLEAPIGVGFSYSTDTSSYEAVNDKITARDNLVFLQGWFVKFPQYKNSNLFITGES  189

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+ N+K+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  190   YAGHYVPQLAELMLQINRKEKM--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  247

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  SICN +R + E  +G++S  C  V     +E    +D+ D+ L +C++S   Q  
Sbjct  248   YKMFTSICNYSRYVREYAEGSVSPICSRVMSQVNKETSKFVDNYDVTLDVCIASVMSQSR  307

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +  T+          D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  308   RLSPQQVTDTI----------DVCVEDETVNYLNRQDVQKALHARLVGVR-KWAVCSDVL  356

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y + N+    +  L +++K  IP+L++SGDQD+ IP+T +R + + LA +L L     +
Sbjct  357   DYDLTNLEIPTITILGKLIKAGIPVLVYSGDQDSVIPLTGSRRLVHGLAEKLGLNTTIPY  416

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  417   RVWFQGQQVGGWTQVYG--------NVLSFATIRGASHEAPFSQPQRSLVLFKSFLQGQP  468

Query  1258  PPRT  1269
              P  
Sbjct  469   LPEV  472



>ref|XP_004975453.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=522

 Score =   382 bits (980),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 267/425 (63%), Gaps = 24/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN LV+N+YSWN 
Sbjct  118   LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNVLVRNEYSWNK  174

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   S Y    D+ TA+DNL+F+  WF KFPQY+  DLY+TGE
Sbjct  175   EANMLYLESPAGVGFSYSTDPSFYQGVGDSMTARDNLKFLQGWFAKFPQYKGRDLYITGE  234

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  235   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  292

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E   G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  293   TYNIFTTVCNYSRYVSEYYHGSLSASCDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQS  352

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              +         L          D C+ D   +YL R +VQ+A+HA  +     W  CS  
Sbjct  353   QILSPQQGSREL----------DVCVEDETMSYLNRKDVQQAMHARLSGGVQRWTVCSSV  402

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  IP+L++SGDQD+ IP+T +RT+ + LA  L+L A   
Sbjct  403   LEYKQLDLQIPTINTVGALVKSGIPVLVYSGDQDSVIPLTGSRTLVSRLASRLRLNATAP  462

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW++ FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G 
Sbjct  463   YRAWFQGKQVGGWTRVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAGR  515

Query  1255  PPPRT  1269
             P P +
Sbjct  516   PLPES  520



>gb|ABR16719.1| unknown [Picea sitchensis]
Length=460

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/422 (47%), Positives = 270/422 (64%), Gaps = 20/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE +  L  PL +WLNGGPGCSS G GA  E+GPF P + G L++N  SWN E
Sbjct  54    LFYYFVEAETEPDLK-PLVVWLNGGPGCSSFGVGALSENGPFYP-KAGKLIRNSCSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYSN  S Y   ND+KTA DNL F+  WF KFP+Y+  +LYLTGES
Sbjct  112   ANMLYLESPAGVGFSYSNDPSYYMGANDSKTAVDNLLFLHGWFNKFPEYKTRELYLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+L+++ N+KK  ++F LK I++GNPLLD    ++A AEFLWSHG +SD  
Sbjct  172   YAGHYIPQLAELIVEENRKK--KSFNLKGISIGNPLLDFITDLNARAEFLWSHGLVSDPT  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M ++ CN +R + E  +G +S+ C  +      E+   ID  D+ L  CLSS     +
Sbjct  230   YNMMKTGCNYSRLLDEAFRGGVSSTCEHIYLTVSMEISKFIDKYDVTLESCLSS-----L  284

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +  ++ ++  +T+        D C+ D   +YL   +VQKA HA       TW+ CS  L
Sbjct  285   LMQKSKMMIGVTR--TATVKPDVCVQDEATSYLNMADVQKAFHARLVGNVKTWEACSDVL  342

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y   N     +P L +++K  I +L++SGDQD+ IP+T TRT+ N LA  L+L     +
Sbjct  343   EYDDLNWEIPTIPLLGKLVKAGIRVLIYSGDQDSIIPLTGTRTLVNNLAASLQLNTTVPY  402

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+AGW Q +G +        L+FA+VRGA HEVPF+ P ++L LF+AFL+G P
Sbjct  403   RVWFQGKQVAGWVQVYGNT--------LSFATVRGAGHEVPFSQPERSLVLFKAFLQGQP  454

Query  1258  PP  1263
             PP
Sbjct  455   PP  456



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 264/423 (62%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LV+N+YSWN E
Sbjct  62    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NML+LE+PIGVGFSYS  +S Y    D  TA+DNL F+  WF KFPQYRN  L++TGES
Sbjct  120   ANMLFLETPIGVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLADLML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLADLMLEFNKKEEL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDAT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YTMFTSFCNYSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T           D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  298   VLTPKQVGETTV---------DVCVEDETVNYLNRKDVQKALHARLVGVR-GWAVCSNIL  347

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++K  IP++++SGDQD+ IP+T +R + N LA+ELKL     +
Sbjct  348   DYELLDLEIPTITVVGKLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPY  407

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF AFL   P
Sbjct  408   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFEAFLDSRP  459

Query  1258  PPR  1266
              P 
Sbjct  460   LPE  462



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 269/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  57    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNRE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS  +S Y   ND  TA+DNL F+ +WF KFPQYRN  L++TGES
Sbjct  115   ANMLYLESPIGVGFSYSVDTSFYEAVNDKTTARDNLVFLQKWFVKFPQYRNRSLFITGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LML++NKK+ +  F LK +ALGNP+L+     ++ AEF WSHG ISD  
Sbjct  175   YAGHYVPQLAQLMLEFNKKQKL--FNLKGVALGNPVLEFATDFNSRAEFFWSHGLISDTT  232

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E  +G++S  C  V G    E    +D  D+ L +C+SS   Q  
Sbjct  233   YKLFTSVCNYSRYVSEYYRGSVSPLCSRVMGQVSRETSKFVDKYDVTLDVCISSVLSQSK  292

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +   + +   +          D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  293   ILSPHVIADNV----------DVCVEDETVNYLNRLDVQMALHARLVGV-HQWTVCSSIL  341

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + ++++  +P+L++SGDQD+ IP+T +RT+ + LA EL L     +
Sbjct  342   DYELLDLEIPTISIVGKLIEAGVPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLKTTVPY  401

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL+G P
Sbjct  402   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLEGQP  453

Query  1258  PPR  1266
              P 
Sbjct  454   LPE  456



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   379 bits (974),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 273/423 (65%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +  S PL LWLNGGPGCSSLG GAF E+GPF+P  +G LVKN+YSWN E
Sbjct  61    LFYYFAEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNRE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQY++  L++TGES
Sbjct  119   ANMLYLETPIGVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEFLWSHG ISD  
Sbjct  179   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEYSTDFNSRAEFLWSHGLISDTT  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  +G++S +C  V      E    +D  D+ L +C+SS      
Sbjct  237   YKMFTTVCNYSRYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISS------  290

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ ++T   ++   V   D C+ D    YL RP+VQ ALHA    +   W  CS  L
Sbjct  291   VLSQSKVLTPQQQVGDNV---DVCVEDETVNYLNRPDVQMALHARLVGVR-RWAVCSNIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +R + + L+ EL L     +
Sbjct  347   DYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL G P
Sbjct  407   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>gb|KEH33274.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=457

 Score =   379 bits (973),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 271/422 (64%), Gaps = 27/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE + P S P+ LWLNGGPGCSS+G GAF+EHGPF+P ++G L+KN YSWN E
Sbjct  59    LFYYFVEAEVE-PASKPVVLWLNGGPGCSSVGAGAFVEHGPFKPTKNG-LIKNDYSWNKE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + ND  TA+DNL F+  WF KF +Y+N++ ++TGES
Sbjct  117   ANMLYLESPAGVGFSYSTNESFYDSVNDYLTARDNLIFLQHWFTKFSEYKNNEFFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPLL+ +   ++ AE+LWSHG ISD  
Sbjct  177   YAGHYVPQLAQLIVQTKSK-----FNLKGIAIGNPLLEFNTDFNSRAEYLWSHGLISDST  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                   ICN ++   +   G ++  C  VN     EV   IDS D+ L +CLS+  +Q  
Sbjct  232   YDSFTKICNFSQIRRQYANGALTTVCARVNRLVSMEVSRYIDSYDVTLDVCLSTVEQQTY  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V      +T L + +K     D C+ D  + YL R EVQ+ALHA    +  TW  CSG L
Sbjct  292   V------LTQLQEGEKI----DVCVEDETFTYLNRKEVQEALHAKLVGIT-TWTTCSGVL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y MQN+    +  L  ++K  + +L++SGDQD+ +P+  TR++ N LA+++ L   E +
Sbjct  341   KYNMQNLEIPTINILGTLVKSGVRVLVYSGDQDSVLPLIGTRSLVNGLAKDIGLNTTESY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+AGW+Q +G          L+FA++RGA+HE PF+ P ++L L +AFL+G  
Sbjct  401   RTWFNGRQVAGWTQVYG--------DMLSFATIRGASHEAPFSQPGRSLVLLKAFLEGKS  452

Query  1258  PP  1263
              P
Sbjct  453   LP  454



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 266/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAEA+ P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  62    LFYYLAEAEAK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WFK+FPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKKHHL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YRMFTSYCNYSRFVSEYYRGDVSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  298   VVSPQQVGETV----------DVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCSNVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA++L L     +
Sbjct  347   DYELLDVEVPTINIVGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKQLAQQLGLSTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P ++L LF+AFL G P
Sbjct  407   RVWFAGQQVGGWTQVYG--------NVLAFATVRGAAHEVPFSQPERSLVLFKAFLGGNP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   379 bits (972),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 268/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  58    LFYYFAEAET-DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  116   ANMLYLETPVGVGFSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+ +   ++ AE+ WSHG ISD  
Sbjct  176   YAGHYVPQLAQLMIQYNKKHHL--FNLRGIAIGNPVLEFETDFNSRAEYFWSHGLISDST  233

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  234   YKMFTSYCNYSRYVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  294   VVSPNQVGESV----------DVCVEDETVKYLNRRDVQEALHARLIGVR-EWTVCSNVL  342

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  343   DYQLLDVEIPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTTVPY  402

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF+AFL G+P
Sbjct  403   RVWFAGQQVGGWTQVYG--------NVLSFATVRGAAHEVPFSQPERSLVLFKAFLDGHP  454

Query  1258  PPR  1266
              P 
Sbjct  455   LPE  457



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   379 bits (972),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 270/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +  S PL LWLNGGPGCSSLG GAF E+GPF+P  +G LVKN+YSWN E
Sbjct  61    LFYYFAEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNRE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQY++  L++TGES
Sbjct  119   ANMLYLETPIGVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEFLWSHG ISD  
Sbjct  179   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEYSTDFNSRAEFLWSHGLISDTT  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  +G++S +C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YKMFTTVCNYSRYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSVLSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        T  ++   V   D C+ D    YL RP+VQ ALHA    +   W  CS  L
Sbjct  297   VL-------TPQQVGDNV---DVCVEDETVNYLNRPDVQMALHARLVGVR-RWAVCSNIL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +R + + L+ EL L     +
Sbjct  346   DYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL G P
Sbjct  406   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   378 bits (971),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 199/423 (47%), Positives = 272/423 (64%), Gaps = 26/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN++SWN E
Sbjct  62    LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNQHSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+ +WF KFPQYRN  L+++GES
Sbjct  120   ANMLYLETPIGVGFSYSTDTSSYETVNDKITARDNLVFLQKWFIKFPQYRNRSLFISGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK  +  F LK IALGNP+LD     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAELMLEFNKKHKL--FNLKGIALGNPVLDFATDFNSRAEFFWSHGLISDTT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V G    E    +D  D+ L +C+SS      
Sbjct  238   YKMFTSVCNYSRYVNEYYRGSVSPICSRVMGQVSRETSRFVDKYDVTLDVCISS------  291

Query  718   VFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
             V  ++N ++      K+V    D C+ D    YL R +VQKALHA    +   W  CS  
Sbjct  292   VLAQSNALSP-----KQVGDNIDVCVEDETVNYLNRQDVQKALHARLVGVR-RWTVCSNI  345

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y++ ++    +  +  +++  IP+L++SGDQD+ IP+T +RT+   LA +L L     
Sbjct  346   LDYELLDLEIPTIAIVGRLIRAGIPVLVYSGDQDSVIPLTGSRTLVRGLAEKLGLKTSVP  405

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL+G 
Sbjct  406   YRVWFGGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLEGR  457

Query  1255  PPP  1263
             P P
Sbjct  458   PLP  460



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   378 bits (970),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 268/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +  S PL LWLNGGPGCSSLG GAF E+GPF+P  +G LVKN+YSWN E
Sbjct  53    LFYYFAEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNRE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQYR+  L++TGES
Sbjct  111   ANMLYLETPIGVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYRSRSLFITGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  171   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEYSTDFNSRAEFFWSHGLISDTT  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  229   YKMFTSVCNYSRYVSEYYRGSVSPLCSRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSK  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        T  ++   V   D C+ D    YL RP+VQ ALHA    +   W  CS  L
Sbjct  289   VL-------TPQQVGDNV---DVCVEDETVNYLNRPDVQMALHARLVGVR-RWAVCSNIL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +R + + L+ EL L     +
Sbjct  338   DYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL G P
Sbjct  398   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQP  449

Query  1258  PPR  1266
              P 
Sbjct  450   LPE  452



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score =   378 bits (971),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 271/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YFVEA+  + +S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN++SWN E
Sbjct  59    LFFYFVEAK-NDAVSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGEA-LVKNQFSWNTE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS  +S Y   ND  TA+DNL F+  WF KFP+YRN  L++ GES
Sbjct  117   ANMLYLESPIGVGFSYSTDTSSYEGVNDKITARDNLIFLQNWFVKFPEYRNRSLFIVGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  177   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDLT  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E   G +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  235   FKMFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTN  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ ALHA+   +   W  CS  L
Sbjct  295   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSALHAHLIGV-HRWSPCSSVL  343

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA++L++     +
Sbjct  344   DYELRDLEIPTITVVGKLVKAGIPVLVYSGDQDSVIPLTGSRTLVHQLAKQLRMNTTVPY  403

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF++FL+G P
Sbjct  404   RVWFAGQQVGGWTQVYG--------NILSFATVRGASHEVPFSQPERSLVLFKSFLEGRP  455

Query  1258  PPR  1266
              P 
Sbjct  456   LPE  458



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score =   378 bits (971),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 267/424 (63%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  54    LFYYFVEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQV-LVKNEYSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS  +S Y   ND  TA+DN+ F+  WF KFPQYRNS+L+LTGES
Sbjct  112   ANMLYLESPIGVGFSYSTNTSSYETVNDVTTARDNVVFLQRWFNKFPQYRNSNLFLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ N+ K +  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  172   YAGHYVPQLAKLMIELNQMKKL--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDST  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  + N+S  C  V      E    +D  D+ L +CLSS      
Sbjct  230   YRMFTSFCNYSRYVSEYYRDNVSPMCSRVMSLVSRETSKFVDKYDVTLDVCLSS------  283

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             VF ++ ++      D      D C+ D+   YL R +V++ALHA    +   WD CS  L
Sbjct  284   VFSQSKIICPQENADAEKI--DVCIDDKTVNYLNREDVRRALHAKLVGVR-RWDVCSNIL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ +P+T +RT+ + LA+ + L     +
Sbjct  341   DYQLLDIEIPTISIVGLLVKERIPVLIYSGDQDSVVPLTGSRTVIHQLAKRMGLNTTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+  +         + L+FA+VRGA+HEVPF+ P ++L LF++FL+G  
Sbjct  401   RVWFAGQQVGGWTVVYD--------NILSFATVRGASHEVPFSQPERSLVLFKSFLEGRA  452

Query  1258  PPRT  1269
              P  
Sbjct  453   LPEV  456



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   378 bits (971),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 269/424 (63%), Gaps = 26/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  63    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y    D  TA+DNL F+ +WF+KFPQYRN  LY+TGES
Sbjct  121   ANMLYLETPIGVGFSYSTDTSSYEAVTDHITARDNLLFLQKWFEKFPQYRNRSLYITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++ +      F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAELMLQFKEHH----FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YKMFSSVCNYSRFVSEYYRGSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +  ++          D C+ D +  YL RP+VQKALHA    +   W  CS  L
Sbjct  297   ALLPQQVADSI----------DVCVEDEVVNYLNRPDVQKALHARLVGVR-HWAVCSNIL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA +L+L     +
Sbjct  346   GYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTGSRTLIHGLAEQLRLNTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  406   RVWFEGQQVGGWTQVYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  457

Query  1258  PPRT  1269
              P  
Sbjct  458   LPEV  461



>ref|XP_009778790.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=457

 Score =   378 bits (970),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 201/424 (47%), Positives = 268/424 (63%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  54    LFYYFVEAET-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQV-LVKNEYSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS  +S Y   ND  TA+DN+ F+  WF KFPQYRN++L+LTGES
Sbjct  112   ANMLYLESPIGVGFSYSTNTSAYETVNDETTARDNVVFLQRWFNKFPQYRNNNLFLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ N+KK +  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  172   YAGHYVPQLAKLMIELNQKKKL--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDST  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  + N+S  C  V      E    +D  D+ L +CLSS   Q  
Sbjct  230   YKMFTSFCNYSRYVSEYYRENVSPMCSRVMSLVTRETSKFVDKYDVTLDVCLSSVLSQSK  289

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +        T  KID        C+ D+   YL R +V++ALHA    +   WD CS  L
Sbjct  290   IISPQENADT-EKIDV-------CIDDKTVNYLNRQDVRRALHAKLVGVR-RWDVCSNVL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ +P+T +RT+ + LA+ + L     +
Sbjct  341   DYQLLDIEIPTIYIVGLLVKERIPVLIYSGDQDSVVPLTGSRTVVHQLAKRMGLNTTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW      +I+  N+  L+FA+VRGAAHEVPF+ P ++L LF++FL+G  
Sbjct  401   RVWFAGQQVGGW------TIVYDNI--LSFATVRGAAHEVPFSQPERSLVLFKSFLEGRA  452

Query  1258  PPRT  1269
              P  
Sbjct  453   LPEV  456



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 269/425 (63%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EA+  NP S PL LWLNGGPGCSSLG GAF E+GPF+P  DG  LV+N+YSWN 
Sbjct  67    LFYYFAEADI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNR  123

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS ++S Y   +D  TA+ NL F+  W  KFPQYR+ DL+L GE
Sbjct  124   EANMLYLETPVGVGFSYSKSNSSYMAVDDEATARXNLVFLQRWLNKFPQYRHMDLFLAGE  183

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA L+++ N+K+    F LK IALGNP+L+    +++ AEFLWSHG ISD 
Sbjct  184   SYAGHYIPQLAKLIVEINRKEK---FNLKGIALGNPVLEFATDLNSQAEFLWSHGLISDS  240

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  + ++S  C  V     +E    +D  D+ L +C+SS   Q 
Sbjct  241   TYNMFTSVCNYSRYVSEYYRRSVSPVCSRVVSQVTKETSQFVDKYDVTLDVCISSVLSQS  300

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                  N +   +          D C+ D+   YL R +VQKALHA    +   WD CS  
Sbjct  301   KFISPNQMTERI----------DVCVEDKTVIYLNRKDVQKALHARLVGVR-RWDVCSSI  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+YQM N+    +  +  ++K  I +L++SGDQD+ IP+T +R + + LAREL L     
Sbjct  350   LEYQMLNLEIPTISLVGSLVKQGIQVLVYSGDQDSVIPLTGSRRLVSRLARELGLNTTVP  409

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  410   YRVWFEGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLRLFKSFLEGR  461

Query  1255  PPPRT  1269
             P P  
Sbjct  462   PLPEV  466



>gb|KFK44682.1| hypothetical protein AALP_AA1G289900 [Arabis alpina]
Length=463

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 265/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  61    LFYYFAEAET-NPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  119   ANMLYLETPVGVGFSYSTQSSSYEGVNDKITAKDNLVFLQRWFLKFPHYLNRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK +   F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  179   YAGHYVPQLAQLMIQYNKKHH-HLFNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YKMFTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D   +YL R +VQ ALHA    +   W  CS  L
Sbjct  298   VVSPNQVGESV----------DVCVEDETVSYLNRRDVQAALHARLIGVR-EWTVCSNVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  347   DYELLDVEKPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  407   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 268/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  60    LFYYFAEAET-NPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  118   ANMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  178   YAGHYVPQLAELMIQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  236   YKMFTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  296   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLIGVR-EWTVCSNVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  345   DYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  405   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHP  456

Query  1258  PPR  1266
              P 
Sbjct  457   LPE  459



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 273/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSS+G GAF E+GPF+P +   LV+N+YSWN E
Sbjct  62    LFYYFAEAE-MDPSSKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGEVLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFS+S+ SSDY   ND  TA+DNL F+  WF KFP+Y+  DLY+TGES
Sbjct  120   ANMLYLETPAGVGFSFSSDSSDYEGVNDRITARDNLVFLQRWFTKFPRYKGRDLYITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMVDFNKKEKV--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDTT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V      E    +D  D+ L +C+SS   Q M
Sbjct  238   YRIFTSACNYSRYVSEYYRGSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSM  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        +  ++ +RV   D C+ D   +YL R +VQ ALHAN   +   W  CS  +
Sbjct  298   VL-------SPQQVTERV---DVCVEDETVSYLNRKDVQAALHANLVGVT-KWTVCSSVI  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  347   EYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA+VRGA+HE PF+ P ++L LFRAFL+G P
Sbjct  407   RAWFEGEQVGGWTQVYG--------DVLSFATVRGASHEAPFSQPERSLVLFRAFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score =   377 bits (969),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 266/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN YSWN E
Sbjct  67    LFYYFAEAET-DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKE  124

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQY++ DL+LTGES
Sbjct  125   ANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLVFLLRWFNKFPQYKSRDLFLTGES  184

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ N K  I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  185   YAGHYVPQLAKLMVEMNTKNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  242

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M   +CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  243   YNMFTRVCNYSRYVSEYYRDSVSPLCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSK  302

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +   + D C+ D++  YL R +VQ+ALHA    +   W+ CS  L
Sbjct  303   VI--------CPQSQEANESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWEVCSNIL  353

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +  +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L +   +
Sbjct  354   DYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARKLGLNSTVPY  413

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  414   RVWFEGQQVGGWTQGYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEGRP  465

Query  1258  PP  1263
              P
Sbjct  466   LP  467



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   377 bits (968),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 277/424 (65%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEA+  +P S PL LWLNGGPGCSSLG GAF E+GPF+P   GN LVKN++SWN 
Sbjct  71    LFYYFVEAQV-DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRP--KGNILVKNEHSWNT  127

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS  ++ Y   +D  TA+DNL F+  WF KFPQY++ DL++TGE
Sbjct  128   EANMLYLETPVGVGFSYSIDTTGYDAVSDAVTARDNLVFLRRWFNKFPQYKHRDLFITGE  187

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLADLM+ +NKK+ +  F LK IALGNP+L+     ++ AE+ WSHG ISD 
Sbjct  188   SYAGHYIPQLADLMVAFNKKEKL--FNLKGIALGNPVLEFANDFNSRAEYFWSHGLISDS  245

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  S CN +R + E  +G +S  C  V    G E    +D  D+ L +C+SS     
Sbjct  246   TYKIFTSACNYSRYVSEYYRGYVSPICSKVMRQVGRETSKFVDKYDVTLDVCISS-----  300

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V  ++ +++   + +    + D C+ D   +YL R +VQKALHA    +   W+ CS  
Sbjct  301   -VLSQSKIISPQEQTEAGGESVDVCIEDETVSYLNRQDVQKALHARLVNVR-RWEVCSNI  358

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+ + LA EL L A   
Sbjct  359   LDYELLDVEIPTITIVGSLVKSGVPVLVYSGDQDSVIPLTGSRTLVHRLAMELGLNATTP  418

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW++ +G        + L+FA+VRGAAHEVP++ P+++L LF++FL+  
Sbjct  419   YRVWFAGEQVGGWTEVYG--------NILSFATVRGAAHEVPYSQPARSLVLFKSFLESR  470

Query  1255  PPPR  1266
             P P 
Sbjct  471   PLPE  474



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 268/423 (63%), Gaps = 25/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  60    LFYYFAEAET-NPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS T   Y + +D  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  118   ANMLYLETPVGVGFSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADLM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  177   YAGHYVPQLADLMIQYNKKHHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDST  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+SS   Q  
Sbjct  235   FKLFTSYCNYSRYVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSK  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  295   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLVGVR-EWTVCSNVL  343

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQM ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  344   DYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  403

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF+AFL G+P
Sbjct  404   RVWFAGQQVGGWTQVYG--------NVLSFATVRGAAHEVPFSQPERSLVLFKAFLDGHP  455

Query  1258  PPR  1266
              P 
Sbjct  456   LPE  458



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 263/422 (62%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S  L LWLNGGPGCSSLG GAF E+GPF+P +  +LV+N++SWNLE
Sbjct  61    LFYYLAEAETE-PISKSLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSDLVRNQHSWNLE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF +FPQY N  L+LTGES
Sbjct  119   ANMLYLETPVGVGFSYATESSLYEGVNDKITAKDNLVFLQKWFLRFPQYLNRSLFLTGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  179   YAGHYVPQLAELMIQYNKKHNL--FNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  237   YKMFTSYCNYSRYVSEYYRGQVSSMCSKVMTQVSTETSRFVDKYDVTLDVCIPSVLSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  297   VVNPQQVGETV----------DVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCSNVL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  346   DYELLDVEVPTVNIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G          L FA+VRGAAHEVPF+ P ++L LF+AFL G P
Sbjct  406   RVWFAGQQVGGWTQVYG--------EILAFATVRGAAHEVPFSQPERSLVLFKAFLGGRP  457

Query  1258  PP  1263
              P
Sbjct  458   LP  459



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   376 bits (966),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 268/423 (63%), Gaps = 25/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  60    LFYYFAEAET-NPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS T   Y + +D  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  118   ANMLYLETPVGVGFSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADLM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  177   YAGHYVPQLADLMIQYNKKHHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDST  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+SS   Q  
Sbjct  235   FKLFTSYCNYSRYVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSK  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  295   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLVGVR-EWTVCSNVL  343

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQM ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  344   DYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  403

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF+AFL G+P
Sbjct  404   RVWFAGQQVGGWTQVYG--------NVLSFATVRGAAHEVPFSQPERSLVLFKAFLDGHP  455

Query  1258  PPR  1266
              P 
Sbjct  456   LPE  458



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   376 bits (966),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 268/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YFVEA+ Q+ +S PL LWLNGGPGCSS+G GAF E+GPF+P  +G LV+N++SWN E
Sbjct  61    LFFYFVEAQ-QDSVSKPLVLWLNGGPGCSSIGVGAFSENGPFRPKGEG-LVRNQFSWNTE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS  +S Y   ND  TA+DNL F+  WF +FPQYRN  L++ GES
Sbjct  119   ANMLYLESPIGVGFSYSTDTSSYGGVNDKITARDNLIFLQNWFVQFPQYRNRSLFIVGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  179   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFSADFNSRAEFFWSHGLISDLT  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E   G +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YKMFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +     +  T+          D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  297   ILNPKQVTETI----------DVCVEDETVNYLNRKDVQSALHARLVGVQ-RWTPCSNVL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y + ++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL++     +
Sbjct  346   DYDLHDLEIPTITVVGKLVKAGIPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+   Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  406   RVWFQKQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEGRP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   377 bits (968),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 273/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSS+G GAF E+GPF+P +   LV+N+YSWN E
Sbjct  84    LFYYFAEAE-MDPSSKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGEVLVRNEYSWNKE  141

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFS+S+ SSDY   ND  TA+DNL F+  WF KFP+Y+  DLY+TGES
Sbjct  142   ANMLYLETPAGVGFSFSSDSSDYEGVNDRITARDNLVFLQRWFTKFPRYKGRDLYITGES  201

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  202   YAGHYVPQLAQLMVDFNKKEKV--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDTT  259

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V      E    +D  D+ L +C+SS   Q M
Sbjct  260   YRIFTSACNYSRYVSEYYRGSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSM  319

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        +  ++ +RV   D C+ D   +YL R +VQ ALHAN   +   W  CS  +
Sbjct  320   VL-------SPQQVTERV---DVCVEDETVSYLNRKDVQAALHANLVGVT-KWTVCSSVI  368

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  369   EYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPY  428

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA+VRGA+HE PF+ P ++L LFRAFL+G P
Sbjct  429   RAWFEGEQVGGWTQVYG--------DVLSFATVRGASHEAPFSQPERSLVLFRAFLQGRP  480

Query  1258  PPRT  1269
              P T
Sbjct  481   LPET  484



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   376 bits (966),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 264/423 (62%), Gaps = 25/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  63    LFYYLAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-QGEVLVRNEHSWNTE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y    D  TA+DNL F+ +W +KFPQYRN  LY+TGES
Sbjct  121   ANMLYLETPIGVGFSYSTDTSSYEGVTDHITARDNLLFLQKWLEKFPQYRNRSLYITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++ K+     F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAELMLQFKKEYQ---FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YNMFTSVCNYSRYVSEYYRGSLSPICARVMSQVSTETSKFVDKYDVTLDVCISSVFSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +  T+          D C+ D I  YL RP+VQKALHA    +   W  CS  L
Sbjct  298   ALLPQEVADTI----------DVCVEDEIVNYLNRPDVQKALHARLVGVR-QWAVCSTIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ  ++    +  +  ++K  IP+L++SGDQD+ IP+T +R + N LA +L+L     +
Sbjct  347   DYQHLDVEIPTITIIGNLIKAGIPVLVYSGDQDSVIPLTGSRKLVNGLAEQLRLSTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  407   RVWFGGQQVGGWTQVYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   376 bits (965),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 264/423 (62%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  61    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WFK+FPQY N  L++TGES
Sbjct  119   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  179   YAGHYVPQLAQLMIQYNKKHHL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPT  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  237   YKMFTSYCNYSRFVSEYYRGEVSSMCSKVMSQVSTETSRFVDKYDVTLDLCIPSVLSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  297   VVSPQQVGETV----------DVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCSNVL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA++L L     +
Sbjct  346   DYELLDVEVPTINVVGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAQQLGLSTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P ++L LF+AFL G P
Sbjct  406   RVWFAGQQVGGWTQVYG--------NVLAFATVRGAAHEVPFSQPERSLVLFKAFLGGNP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   377 bits (968),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 272/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  97    LFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNRE  154

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQY++ DL++TGES
Sbjct  155   ANMLYLETPVGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHKDLFITGES  214

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+L++++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  215   YAGHYVPQLAELIIQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDST  272

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V     +E    +D  D+ L +C+SS   Q  
Sbjct  273   YKLFTSACNYSRYVGEYYRGSISSVCSRVMSRVSKETSRFVDKYDVTLDVCISSVLSQSK  332

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           ++ +R+   D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  333   VL-------NPQQVTERI---DVCVEDETVNYLNRRDVQKALHARLVGVR-RWAVCSNIL  381

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA EL L     +
Sbjct  382   DYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVHELAMELGLNTTVPY  441

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  442   RVWFAGQQVGGWTQDYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  493

Query  1258  PPRT  1269
              P  
Sbjct  494   LPEV  497



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score =   376 bits (965),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 269/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE + P S PL LWLNGGPGCSS+G GAF+EHGPF+P  +G L+KN++SWN E
Sbjct  62    LFYYFVEAEVE-PASKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF KFP+ +N+D ++TGES
Sbjct  120   ANMLYLESPAGVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPL++ +   ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAQLIVQTKTK-----FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDST  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN ++   ++  G ++  C  VN     EV   ID+ D+ L +CLSS  +Q  
Sbjct  235   YEIFTKVCNYSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAY  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N +T L    +  A  D C+ D   AYL R +VQ+ALHA    +  +W  CS  L
Sbjct  295   VL---NQLTQL----QEGAKIDVCVEDETIAYLNRKDVQEALHAKLVGIT-SWSTCSDVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y MQN+    +  L  + K  I +L++SGDQD+ IP+T TR++ N LA++  L     +
Sbjct  347   KYDMQNLEIPTISILGALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+AGW+Q +G          L+FA++RGAAHE PF+ P ++L L +AFL+G P
Sbjct  407   RAWFEGRQVAGWTQVYG--------DILSFATIRGAAHEAPFSQPERSLVLLKAFLEGKP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   375 bits (964),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 270/423 (64%), Gaps = 25/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE + P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N+YSWN E
Sbjct  58    LFYYFAEAEVE-PASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNRE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  ++ Y + ND  TA+DNL F+ +W  KFPQYRN  L++TGES
Sbjct  116   ANMLYLETPIGVGFSYSTDTASYESVNDRITARDNLMFLQKWLDKFPQYRNRSLFITGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML+++K+ +   F LK IALGNP+L+     ++ +EF WSHG ISD  
Sbjct  176   YAGHYVPQLAELMLQFSKEYH---FNLKGIALGNPVLEYATDFNSRSEFFWSHGLISDST  232

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  233   YKMFTSVCNYSRYVSEYYRGSVSPICSKVMSQVSRETSKFVDKYDVTLDVCISSVFSQSK  292

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  ++          D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  293   VLSPQQVTESI----------DVCVEDETVNYLNRLDVQKALHARLVGVR-KWAVCSNVL  341

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++K  I +L++SGDQD+ IP+T +RT+ + LA ELKL     +
Sbjct  342   DYELLDLEIPTISIVGKLIKAGISVLVYSGDQDSVIPLTGSRTLVHGLAEELKLNTTVPY  401

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  402   RVWFEGQQVGGWTQVYG--------NMLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  453

Query  1258  PPR  1266
              P 
Sbjct  454   LPE  456



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   375 bits (964),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 269/423 (64%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +  S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  61    LFYYFAEAEL-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNRE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+ +WF  FP YRN  L++TGES
Sbjct  119   ANMLYLETPIGVGFSYSANASSYEGVNDKITARDNLVFLQKWFVNFPHYRNRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADLML++N+K+ +  F LK IA+GNP+L+     ++ AEF WSHG ISD  
Sbjct  179   YAGHYVPQLADLMLQFNRKEKL--FNLKGIAMGNPVLEYSTDFNSRAEFFWSHGLISDTT  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  ++CN +R + E  +G++S +C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YKMFTTVCNYSRYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSALSQ--  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                 + +++   ++   +   D C+ D    YL RP+VQKALHA    +   W  CS  L
Sbjct  295   ----SKILSPQQQLGDNI---DVCVEDETVNYLNRPDVQKALHARLVGVR-RWAVCSNIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA EL L     +
Sbjct  347   DYELLDLEIPTISIVGRLIKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLQTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL G P
Sbjct  407   RVWFGGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   375 bits (964),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 272/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQP-GRDGNLVKNKYSWNL  177
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P GR   L++N++SWN 
Sbjct  62    LFYYFVEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGR--VLIRNEHSWNR  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQYRN DL++TGE
Sbjct  119   EANMLYLETPVGVGFSYSTDNSSYVAVDDEATARDNLVFLQGWFHKFPQYRNKDLFITGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ NKK+  R   LK IALGNP+L+    +++ AE+ WSHG ISD 
Sbjct  179   SYAGHYIPQLAKLMVEINKKE--RLVNLKGIALGNPVLEFATDLNSRAEYFWSHGLISDS  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S CN +R + E  + ++S+ C LV      E    +D  D+ L +C+ S   Q 
Sbjct  237   TYKMFTSACNYSRYVSEYYRDSVSSVCSLVMKQVSTETSRFVDKYDVTLDVCIPSVLSQS  296

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V        +  ++ +R+   D C+ D    YL R +V+KALHA    +   W+ CS  
Sbjct  297   KVI-------SPKQVSERI---DVCIEDETVNYLNREDVRKALHARLIGVR-RWEVCSNI  345

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y++ NI    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     
Sbjct  346   LDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIPLTGSRTLVHRLAKELGLNTTVP  405

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  406   YRAWFAGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLMLFKSFLQGK  457

Query  1255  PPPRT  1269
               P  
Sbjct  458   HLPEV  462



>ref|XP_004513403.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   375 bits (964),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 266/425 (63%), Gaps = 28/425 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             L+YYFVEAE  +P S P+ LWLNGGPGCSS+G GAF+EHGPF+P + G L+KN YSWN E
Sbjct  63    LYYYFVEAEV-DPASKPVVLWLNGGPGCSSIGVGAFVEHGPFKPAKKG-LMKNDYSWNKE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF KF +Y+N+D +LTGES
Sbjct  121   ANMLYLESPAGVGFSYSVNESFYDLVNDEMTARDNLIFLQHWFTKFSEYKNNDFFLTGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPL++ +   ++ AE+ WSHG ISD  
Sbjct  181   YAGHYVPQLAQLIIQTKTK-----FNLKGIAIGNPLMEFNTDFNSRAEYFWSHGLISDST  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +    CN ++   +   G +S+ C  VN     E+   ID  D+ L +CL S  +Q  
Sbjct  236   YEIFTKSCNYSQIRRQYQSGTLSSICARVNRLVSMEISRYIDLYDVTLDVCLPSEKQQAY  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V      +T L + +K     D C+ D  Y YL R EVQKALHA    +  TW  CSG L
Sbjct  296   V------LTQLQEGEKI----DVCVEDETYIYLNRKEVQKALHAKLVGIT-TWLTCSGVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y M+N+    +  L  ++K  + +L++SGDQD+ IP+  TR++ N LA+E  L   E +
Sbjct  345   KYNMKNLEIPTISVLGSLVKSGVRVLVYSGDQDSVIPLLGTRSLVNKLAKEFGLNTTESY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+AGW+Q +G          L+FA++RGA+HE PF+ P ++L L + FLKG  
Sbjct  405   RAWFKGRQVAGWTQVYGD---------LSFATIRGASHEAPFSQPERSLVLLKTFLKGKS  455

Query  1258  PPRTS  1272
              P +S
Sbjct  456   LPVSS  460



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   376 bits (966),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 266/422 (63%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN +SWN E
Sbjct  90    LFYYFAEAET-DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNHHSWNQE  147

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  LY+TGES
Sbjct  148   ANMLYLETPVGVGFSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLYITGES  207

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  208   YAGHYVPQLAQLMIQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  265

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  266   YKMFTSYCNYSRYVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  325

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  326   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLIGV-REWTVCSNVL  374

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  375   DYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPY  434

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  435   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLGGHP  486

Query  1258  PP  1263
              P
Sbjct  487   LP  488



>ref|XP_010099600.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB79994.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=464

 Score =   375 bits (964),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 271/423 (64%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE ++P S PL LWLNGGPGCSSLG GAF E+GPF+P  +G  L++NKYSWN 
Sbjct  60    LFYYFVEAE-KDPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGKILLRNKYSWNR  116

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSYS  SS Y   +D  TA+ NL F+  WF+KFPQYR  DL+LTGE
Sbjct  117   EANMLYLETPVGVGFSYSTNSSSYVAVDDKATARANLIFLRGWFRKFPQYRKRDLFLTGE  176

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ N+K+ +  F LK IALGNP+L+     ++ AE+LWSHG ISD 
Sbjct  177   SYAGHYIPQLAKLMVEVNRKRKV--FNLKGIALGNPVLEYATDFNSRAEYLWSHGLISDT  234

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S+CN +R + E  +  +S  C+ V      E  + +D  D+ L +C+SS   Q 
Sbjct  235   TYKMFNSVCNYSRYVSEYYRDAVSPTCLRVINQVNAETSNFVDKYDVTLDVCISSVLSQS  294

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V     L     K+  +    D C+ D++  YL R +VQ+ALHA    +   WD CS  
Sbjct  295   KV-----LNPKPQKVSDQTI--DVCVDDKVVKYLNRRDVQRALHARLVGVR-QWDACSNI  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y++ N+    +  +  ++K  I +L++SGDQD+ IP+  +RT+ + LA EL L     
Sbjct  347   LDYEVLNVELPTISIVGSLVKAGISVLVYSGDQDSVIPLMGSRTLVDKLASELGLKTTVP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G +        L+FA++R A+HE PF+ P ++L LF++FL+G 
Sbjct  407   YRVWFQGKQVGGWTQVYGNA--------LSFATIRDASHEAPFSQPERSLILFKSFLQGN  458

Query  1255  PPP  1263
             P P
Sbjct  459   PLP  461



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 269/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAE ++ LS PL LWLNGGPGCSSLG GAF E+GPF+P  +G LV+N++SWN E
Sbjct  60    LFFYFAEAE-KDALSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGEG-LVRNQFSWNKE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA DNL F+  WF KFP+YRN  L++ GES
Sbjct  118   ANMLYLETPIGVGFSYSTDTSSYEGVNDKITAGDNLVFLQNWFMKFPEYRNRSLFIVGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++N+K+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  178   YAGHYVPQLAELMLRFNRKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +  + E   G +S  C  V      E    +D  D+ L +CLSS   Q  
Sbjct  236   YKMFTSVCNYSTYVREYYNGAVSPICSSVMSQVSTETSRFVDKYDVTLDVCLSSVFSQTK  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ ALHA+   +   W  CS  L
Sbjct  296   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSALHAHLVGVQ-RWSACSNVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  345   DYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  405   RVWFEKQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGGP  456

Query  1258  PPR  1266
              P+
Sbjct  457   LPQ  459



>ref|XP_004503800.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=466

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 266/423 (63%), Gaps = 22/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE++  NP S PL LWLNGGPGCSS+G GAF E+GPF+P  +  L+KN +SWN E
Sbjct  63    LFYYFVESKT-NPSSKPLVLWLNGGPGCSSIGIGAFSENGPFRPNGEV-LIKNDHSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  +  Y   ND  TA+DNL F+L WF KFPQY++ DL+LTGES
Sbjct  121   ANMLYLETPVGVGFSYAKGTFSYMKVNDEMTARDNLVFLLGWFNKFPQYKHRDLFLTGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA LM+  NKKK I  F LK IALGNPLL+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYIPQLAKLMIGINKKKKI--FNLKGIALGNPLLEYATDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKMFTAGCNYSRYVSEYYRNSISPLCSKVMRKVSRETSKFVDKYDVTLDVCISSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +   + D C+ D++  YL R +VQKALHA    +P TWD C+  L
Sbjct  299   VI--------CPQTHQANESIDVCVDDKVTNYLNRRDVQKALHAELVGVP-TWDVCNNVL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +  +  ++K  + +L++SGDQD+ IP+T +R++   LAR+L L     +
Sbjct  350   DYNMLNLEVPTLHVVGSLIKAGVRVLIYSGDQDSVIPLTGSRSLVQKLARQLSLNTTVPY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF +FL+  P
Sbjct  410   RVWFEGHQVGGWTQVYG--------NILSFATIRGASHEAPFSQPQRSLVLFNSFLEDRP  461

Query  1258  PPR  1266
              P 
Sbjct  462   LPE  464



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 264/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  62    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YKMFTSYCNYSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R N      +  +   A D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  298   ---RVN-----PQPQQMGEAVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWSVCSNVL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  349   DYEVLDVEVPTINIVGRLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLADELGLRTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  409   RVWFAGQQVGGWTQVYG--------NILAFATVRGAAHEVPFSQPARALVLFKAFLGGRP  460

Query  1258  PP  1263
              P
Sbjct  461   LP  462



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 267/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  61    LFYYFAEAET-NPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  119   ANMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  179   YAGHYVPQLAQLMIQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  237   YKMFTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  297   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLIGVR-EWTVCSNVL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  ++K  +P+L++SGDQD+ IP+T +R + + LA++L L     +
Sbjct  346   DYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRILVSRLAKQLGLRTSVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P+++L LF+AFL G+P
Sbjct  406   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPARSLVLFKAFLDGHP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>ref|XP_007159977.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31971.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=466

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 268/423 (63%), Gaps = 22/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN+YSWN E
Sbjct  63    LFYYFVESET-HPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGE-VLIKNEYSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+   S Y   ND  TA+DNL F+  WF KFPQ+RN DL+L GES
Sbjct  121   TNMLYLETPVGVGFSYAKGGSSYETVNDETTARDNLVFLQRWFNKFPQFRNRDLFLAGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ NKK+ +  F LK IALGNP+L+    +++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAKLMIEINKKEKL--FNLKGIALGNPVLEYATDLNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKLFTTGCNYSRYVSEYYRDSISPVCSKVLRHVARETSRFVDKYDVTLDVCISSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +     KI++ +   D C+ D++  YL R +VQ+ALHA    +   WD CS  L
Sbjct  299   A-----ICPQGQKINESI---DVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCSNIL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L     +
Sbjct  350   DYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        S L+FA+VRGA+HE PF+ P ++  LF++FL+  P
Sbjct  410   RVWFEGQQVGGWTQVYG--------SILSFATVRGASHEAPFSQPERSFVLFKSFLEDRP  461

Query  1258  PPR  1266
              P 
Sbjct  462   LPE  464



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 267/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  62    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+N SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYANESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V    G E    ID  D+ L +C+ S   Q  
Sbjct  238   YKLFTSSCNYSRFLSEYHRGSVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +     ++ + V   D CL D    YL R +VQKALHA        W  CS  L
Sbjct  298   V-----VSPQPQQVGETV---DVCLEDETVNYLNRRDVQKALHARLVGTR-KWTVCSDVL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+ ++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  349   DYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G +        L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  409   RVWFAGQQVGGWTQVYGNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRP  460

Query  1258  PP  1263
              P
Sbjct  461   LP  462



>gb|KCW64995.1| hypothetical protein EUGRSUZ_G02537, partial [Eucalyptus grandis]
Length=477

 Score =   375 bits (964),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 262/459 (57%), Gaps = 97/459 (21%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGG------------------------PGCSSLGYGAF  108
             LFYYFVEA+A++PLS PLTLW NGG                        PGCSSLG+GAF
Sbjct  55    LFYYFVEADARDPLSYPLTLWFNGGMVVLVLVHYCLRHCLPILIYFGLGPGCSSLGFGAF  114

Query  109   MEHGPFQPGRDGNLVKNKYSWNLESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNL  288
              EHGPF+P  DG L KN++SWN  SNMLY+ESPIGVGFSYSNT+SDY NW D  T     
Sbjct  115   EEHGPFRPAGDGGLTKNEFSWNKVSNMLYVESPIGVGFSYSNTTSDYVNWTDADTG----  170

Query  289   RFVLEWFKKFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPL  468
                            SDL++T              + L     +++ AF L+   LGNPL
Sbjct  171   --------------TSDLFVT--------------IFLLLESNESLAAFALR---LGNPL  199

Query  469   LDIDISIDAAEFLWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEV  648
             LDI IS+DAA FLWSHG ISD+ L +K ++CND+R + + I   +S EC  V     EE+
Sbjct  200   LDIQISVDAATFLWSHGVISDETLKLKETVCNDSRYLTQQIHNKISMECAEVFQKQVEEM  259

Query  649   GSDIDSSDLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPE  828
             G+  D  D+L P C S  A  Q    R+       K+ +R+   DPCL D I++YL  P+
Sbjct  260   GNFTDPDDVLEPYCFSGTAVVQSAS-RSMWDAYHAKLARRMVLTDPCLGDFIFSYLNNPQ  318

Query  829   VQKALHANTTYLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIP  1008
             VQKALHAN T LP  W+FCSG L Y   +I  +I+P LS +++ H+ +LLFSGDQD+K+P
Sbjct  319   VQKALHANITKLPSVWNFCSGPLSYHDVDIGIDIIPLLSALIEKHLRVLLFSGDQDSKVP  378

Query  1009  VTQTRTIANMLARELKLIAFERHGPWYDGV------------------------------  1098
             + QTR IANM+A++LK  +  ++ PWYD +                              
Sbjct  379   LMQTRMIANMIAQDLKFTSLGKYAPWYDKMQTHHGAKERECFRPLLNMLPNLTVYILKNI  438

Query  1099  -------QIAGWSQSFGGSILGKNVSFLTFASVRGAAHE  1194
                    Q+ GW+QSFG S  GKNV+ LTFA+VRGAAHE
Sbjct  439   SDARVINQVGGWTQSFGSSREGKNVTHLTFATVRGAAHE  477



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 274/423 (65%), Gaps = 25/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE+ +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L++N+YSWN E
Sbjct  62    LFYYFVEAES-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LLRNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS + + Y   +D  TA+DNL F+  WF KFPQY++ DL++TGES
Sbjct  120   ANMLYLETPVGVGFSYS-SDTPYVTVDDKITARDNLAFLQRWFLKFPQYKHRDLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM+++NKK+ +  F LK IALGNP+L+    +++ AE+ WSHG ISD  
Sbjct  179   YAGHYVPQLAELMIRFNKKEKL--FNLKGIALGNPVLEFATDLNSRAEYFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  + ++S+ C  V      E    +D  D+ L +CLSS   Q  
Sbjct  237   YRLFTSACNYSRYVSEYYRDSVSSVCSRVMAQVSRETSKFVDKYDVTLDVCLSSVLSQSK  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D+   YL R +VQKALHA    +  +W  CS  L
Sbjct  297   VISPQQVAETI----------DVCIDDKTVNYLNRKDVQKALHARLVGIR-SWTVCSDIL  345

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  346   DYELLNLEIPTISIVGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVHNLAKELGLNTTVPY  405

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW++ +G        + L+FA++RGA+HE PF+ P ++L LF++FL+  P
Sbjct  406   RVWFEGKQVGGWTRVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEARP  457

Query  1258  PPR  1266
              P 
Sbjct  458   LPE  460



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 262/422 (62%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  62    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVKNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDLT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YKMFTSYCNYSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +     D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  298   V--------VNPQPQQMGETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCSNVL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  349   DYEVLDVEVPTINIVGSLVKARVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTGPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  409   RVWFAGQQVGGWTQVYG--------NILAFATVRGAAHEVPFSQPARALVLFKAFLGGRP  460

Query  1258  PP  1263
              P
Sbjct  461   LP  462



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 270/425 (64%), Gaps = 23/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF E+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  D  L+KN++SWN E
Sbjct  44    LFYYFAESET-DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGDF-LIKNEHSWNKE  101

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNW-NDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             +NMLYLE+P GVGFSY   SS Y    ND +TA+DNL F+  WF KFPQYRN DL+LTGE
Sbjct  102   ANMLYLETPAGVGFSYVKGSSAYTTTVNDDETARDNLVFLERWFNKFPQYRNRDLFLTGE  161

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA LM++ NK+  I  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  162   SYAGHYVPQLAKLMIEMNKRNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDA  219

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M   +CN +R + E  + ++S  C  V G   +E    +D  D+ L +C+SS   Q 
Sbjct  220   TYNMFTRVCNYSRYVSEYNRDSVSPLCSKVMGLVSKETSRFVDKYDVTLDVCISSVLSQS  279

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V     +     + ++ +   D C+ D++  YL R +VQ+ALHA    +   WD CS  
Sbjct  280   KV-----ISPQPQQANEMI---DVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNV  330

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y + N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L     
Sbjct  331   LDYDVLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVP  390

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA+VRGAAHE PF+ P ++L LF++FL+G 
Sbjct  391   YRVWFEGQQVGGWTQVYG--------NVLSFATVRGAAHEAPFSQPERSLVLFKSFLEGR  442

Query  1255  PPPRT  1269
             P P  
Sbjct  443   PLPEV  447



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 269/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE + P S PL LWLNGGPGCSS+G GAF+EHGPF+P  +G L+KN++SWN E
Sbjct  62    LFYYFVEAEVE-PASKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF KFP+ +N+D ++TGES
Sbjct  120   ANMLYLESPAGVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPL++ +   ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAQLIVQTKTK-----FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDST  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN ++   ++  G ++  C  VN     EV   ID+ D+ L +CLSS  +Q  
Sbjct  235   YEIFTKVCNYSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAY  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N +T L    +  A  D C+ D   AYL R +VQ+ALHA    +  +W  CS  L
Sbjct  295   V---PNQLTQL----QEGAKIDVCVEDETIAYLNRKDVQEALHAKLVGIT-SWSTCSDVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y MQN+    +  L  + K  I +L++SGDQD+ IP+T TR++ N LA++  L     +
Sbjct  347   KYDMQNLEIPTISILGALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+AGW+Q +G          L+FA++RGAAHE PF+ P ++L L +AFL+G P
Sbjct  407   RAWFEGRQVAGWTQVYG--------DILSFATIRGAAHEAPFSQPERSLVLLKAFLEGKP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 196/422 (46%), Positives = 265/422 (63%), Gaps = 29/422 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N++SWN E
Sbjct  62    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+N SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYANESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V    G E    ID  D+ L +C+ S   Q  
Sbjct  238   YKLFTSSCNYSRFLSEYHRGSVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQS-  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                         ++ + V   D CL D    YL R +VQKALHA        W  CS  L
Sbjct  297   -----------KQVGETV---DVCLEDETVNYLNRRDVQKALHARLVGTR-KWTVCSDVL  341

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+ ++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  342   DYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  401

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G +        L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  402   RVWFAGQQVGGWTQVYGNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRP  453

Query  1258  PP  1263
              P
Sbjct  454   LP  455



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 269/423 (64%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAE ++ LS PL LWLNGGPGCSSLG GAF E+GPF+P   G LV+N++SWN E
Sbjct  60    LFFYFAEAE-KDALSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGKG-LVRNQFSWNRE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+  WF KFP+YRN  L++ GES
Sbjct  118   ANMLYLETPIGVGFSYSTDTSSYEGVNDKITARDNLVFLQSWFIKFPEYRNRSLFIVGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  178   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +  + E   G +S  C  V      E    +D  D+ L +CLSS   Q  
Sbjct  236   YKMFTSVCNYSTYVREYYNGAVSPICSSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTK  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ A+HA+   +   W  CS  L
Sbjct  296   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSAMHAHLVGVQ-RWSACSNVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  345   DYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  405   RVWFEKQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGGP  456

Query  1258  PPR  1266
              P+
Sbjct  457   LPQ  459



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score =   374 bits (961),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 263/425 (62%), Gaps = 25/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN L +N+YSWN 
Sbjct  68    LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALTRNEYSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   + Y    D+ TA+DNL+F+  WF +FPQY+  DLY+TGE
Sbjct  125   EANMLYLESPAGVGFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGE  184

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  185   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  242

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  243   TYNIFTTVCNYSRYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQS  302

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V         L          D C+ D    YL R +VQ+A+HA    +   W  CS  
Sbjct  303   QVLVPQQGSREL----------DVCVEDETMRYLNRKDVQQAMHARLDGVQ-RWTVCSSV  351

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  IP L++SGDQD+ IP+T +RT+   LA  L+L A   
Sbjct  352   LEYKQLDLQIPTVNTVGALVKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAP  411

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G 
Sbjct  412   YRAWFQGKQVGGWTQVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAGQ  464

Query  1255  PPPRT  1269
               P +
Sbjct  465   QLPES  469



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 267/425 (63%), Gaps = 23/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN LV+N+YSWN 
Sbjct  60    LFYYFAEAEL-DPATKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALVRNEYSWNK  116

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   S Y    D+ TA+DNL+F+  WF KFP+Y+  DLY+TGE
Sbjct  117   EANMLYLESPAGVGFSYSTDPSFYGGVGDSMTARDNLKFLQGWFAKFPRYKGRDLYITGE  176

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  ++++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  177   SYAGHYVPQLAQRIVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  234

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +   +CN +R + E   G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  235   TYNIFSRVCNYSRYVSEYYHGSISPVCDRVMSQVTRETSRFVDKYDVTLDVCISSVLAQS  294

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                       T     +     D C+ D    YL R +VQ+A+HA    +P  W  CS  
Sbjct  295   KTL-------TPQSTQQLSRELDVCVEDETMNYLNRKDVQQAMHARLNGVP-KWTVCSSV  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  IP+L++SGDQD+ IP+T +RT+ + LA+ L+L A   
Sbjct  347   LEYKQLDLQIPTINTVGMLVKSGIPVLVYSGDQDSVIPLTGSRTLVHRLAKRLRLNATVP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q FG +        L+FA++RGA+HE PF+ P ++L LFRAFL G 
Sbjct  407   YRVWFEGKQVGGWTQVFGDA--------LSFATIRGASHEAPFSQPERSLVLFRAFLAGR  458

Query  1255  PPPRT  1269
             P P +
Sbjct  459   PLPES  463



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score =   374 bits (959),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 267/423 (63%), Gaps = 29/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  NP S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  60    LFYYFAEAET-NPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  118   ANMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  178   YAGHYVPQLAELMIQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S      
Sbjct  236   YKMFTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPS------  289

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                       L++  +   + D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  290   ---------VLSQSKQVGESVDVCVEDETVNYLNRRDVQEALHARLIGVR-EWTVCSNVL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  340   DYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  400   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHP  451

Query  1258  PPR  1266
              P 
Sbjct  452   LPE  454



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 264/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSS+G GAF E+GPF+P +   LVKN++SWN E
Sbjct  63    LFYYLAEAETK-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  121   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  181   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPT  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  239   YKMFTSYCNYSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R N      +  +   A D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  299   ---RVN-----PQPQQVGEAVDVCVEDETVNYLNRRDVQKALHARLVGTR-NWAVCSNVL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  350   DYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P++AL LF+AF+ G P
Sbjct  410   RVWFAGQQVGGWTQVYG--------NILAFATVRGAAHEVPFSQPARALVLFKAFMGGRP  461

Query  1258  PP  1263
              P
Sbjct  462   LP  463



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   374 bits (960),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 267/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LWLNGGPGCSS+G GAF E+GPF+P R   LV+N++SWN E
Sbjct  62    LFYYFVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYSN +S Y   ND  TA+DNL F+L WF KFP YR S+L+LTGES
Sbjct  120   ANMLYLESPIGVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ I  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAKLMMAFNKKQQI--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D   + L +C+SS      
Sbjct  238   YRMFSSACNYSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISS------  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++    ++K     D C+ D I  YL R +V++ALHA    +   W  CS  L
Sbjct  292   VLSQSKIISPQENVEKL----DVCVEDEIVNYLNRKDVRRALHAELVGVR-RWAVCSSIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ IP+  +R   + LAR ++L     +
Sbjct  347   DYQLLDIEIPTISIIGMLVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+  +         + L+FA++RGA+HE PF+ P ++L LF++FL+  P
Sbjct  407   RVWFAGQQVGGWTHVYD--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEDRP  458

Query  1258  PPRT  1269
              P  
Sbjct  459   LPEV  462



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score =   374 bits (960),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 265/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN LV+N+YSWN 
Sbjct  62    LFYYFAEAEL-DPDTKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNVLVRNEYSWNK  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NM+YLESP GVGFSYS   S Y    D++TA+DNLRF+  WF KFPQY+  DLY+TGE
Sbjct  119   EANMMYLESPAGVGFSYSTDPSFYGGVGDSRTARDNLRFLQGWFAKFPQYKGRDLYITGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  179   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDA  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   ++CN +R + E  +G++S  C  V GA   E    +D  D+ L +C+SS + Q 
Sbjct  237   TYRSFTAVCNYSRYVSEYYRGSLSAACDAVMGAGATETSRFVDKYDVTLDVCVSSLSMQS  296

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
             +          L          D C+ D    YL R +VQ+A+HA        W  CS  
Sbjct  297   LSLAPQRGSREL----------DVCVEDETMGYLNRKDVQEAMHARLDGGVAKWTVCSSV  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  +P+L++SGDQD+ IP+T +RT+   LA  L+L     
Sbjct  347   LEYRQLDLQIPTINTVGGLVKSGVPVLVYSGDQDSVIPLTGSRTLVQRLAARLRLNTTAP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q++GG         L FA+VRGA+HE PF+ P ++L LFRAFL G 
Sbjct  407   YRVWFQGRQVGGWTQAYGGG------GTLAFATVRGASHEAPFSQPERSLVLFRAFLAGR  460

Query  1255  PPP  1263
             P P
Sbjct  461   PLP  463



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 265/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  62    LFYYFAEAEI-DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y    D  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYSTQSSSYEGVTDKITAKDNLVFLQRWFLKFPHYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIEYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YKMFTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  298   VVSPNQVGESV----------DVCVEDETVKYLNRRDVQEALHARLIGVR-EWTVCSNVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  347   DYQLLDVEIPTINIVGSLVQAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGAAHEVPF+ P ++L LF+AFL G+P
Sbjct  407   RVWFAGQQVGGWTQVYG--------NVLSFATVRGAAHEVPFSQPERSLVLFKAFLDGHP  458

Query  1258  PPR  1266
              P 
Sbjct  459   LPE  461



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   374 bits (961),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/422 (46%), Positives = 266/422 (63%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN +SWN E
Sbjct  90    LFYYFAEAET-DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNYHSWNQE  147

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  148   ANMLYLETPVGVGFSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  207

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  208   YAGHYVPQLAQLMIQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  265

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  266   YKMFTSYCNYSRYVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  325

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  326   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQEALHARLIGVR-EWTVCSNVL  374

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  375   DYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPY  434

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  435   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLNGHP  486

Query  1258  PP  1263
              P
Sbjct  487   LP  488



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   373 bits (958),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 193/422 (46%), Positives = 264/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN YSWN E
Sbjct  54    LFYYFAEAET-DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+L WF KFPQY++ DL+LTGES
Sbjct  112   ANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLVFLLRWFNKFPQYKSRDLFLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ N K  I  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  172   YAGHYVPQLAKLMVEMNTKNKI--FNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M   +C  +R + E  +  +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  230   YNMFTKVCYYSRYVSEYYRDLVSPLCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSK  289

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           +  +   + D C+ D++  YL R +VQ+ALHA    +   W+ CS  L
Sbjct  290   VI--------CPQSQEANESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWEVCSNIL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +  +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L +   +
Sbjct  341   DYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARKLGLNSTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  401   RVWFEGQQVGGWTQGYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEGRP  452

Query  1258  PP  1263
              P
Sbjct  453   LP  454



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   373 bits (958),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 267/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAE ++  S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV+N++SWN E
Sbjct  60    LFFYFAEAE-KDAASKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGEA-LVRNQFSWNRE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   ND  TA+DNL F+  WF KFP+YRN  L++ GES
Sbjct  118   ANMLYLETPIGVGFSYSTDTSSYEGVNDEITARDNLVFLKNWFIKFPEYRNRSLFIVGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  178   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G +S  C  V      E    +D  D+ L +CLSS   Q  
Sbjct  236   YKVFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCLSSVFSQTK  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  296   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSALHARLVGVQ-RWSACSNVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++    +  + ++++  IP+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  345   DYELRDLEIPTITVVGKLVQEGIPVLVYSGDQDSVIPLTGSRTLVHKLAKKLGLKTTVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G          L+FA++RGA+HE PF+ P +AL LF++FL+G P
Sbjct  405   RVWFEKQQVGGWTQVYG--------DILSFATIRGASHEAPFSQPERALVLFKSFLEGRP  456

Query  1258  PPR  1266
              P+
Sbjct  457   MPQ  459



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   373 bits (958),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 195/424 (46%), Positives = 267/424 (63%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E   P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN++SWN E
Sbjct  62    LFYYFVESET-GPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEV-LIKNEHSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  S      ND  TA+DNL F+L WF KFPQY+++DL+LTGES
Sbjct  120   ANMLYLETPVGVGFSYAKGSFSNIKVNDEVTARDNLVFLLHWFNKFPQYKHTDLFLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+LM+  N K+ I  F LK IALGNPLL+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLANLMIGINNKEKI--FNLKGIALGNPLLEYATDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  + CN ++ + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YKMFTAGCNYSQYVSEYYRNSISLLCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N             + D C+ D +  YL R +VQKALHA    +P  W+ CS  L
Sbjct  298   VICPQN--------HHANESIDVCVDDEVTNYLNRRDVQKALHAELIGVP-KWNVCSNIL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +  +  I+K  + +L++SGDQD+ IP+T +RT+ + LAR+L L     +
Sbjct  349   DYNMLNLEVPTLHVVGSIIKAGVRVLIYSGDQDSVIPLTGSRTLVHKLARQLALKTTIPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G +        LTFA++RGA+HE PF+ P ++L LF++FL+  P
Sbjct  409   RVWFEGHQVGGWTQVYGNT--------LTFATIRGASHEAPFSQPERSLVLFKSFLENKP  460

Query  1258  PPRT  1269
              P++
Sbjct  461   LPKS  464



>ref|NP_001151474.1| LOC100285107 precursor [Zea mays]
 gb|ACG42988.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=480

 Score =   374 bits (959),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 268/424 (63%), Gaps = 21/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  75    LFYYFVEADVVDPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  133

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   +D  TA DN+ F+  W +KFPQY+  DLY+ GES
Sbjct  134   ANVIYLETPAGVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLQKFPQYKGRDLYIAGES  193

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+ M+++NKK  I  F L+ +ALGNP+L+     +A AE+ WSHG ISD  
Sbjct  194   YAGHYIPQLAEAMVEFNKKDRI--FNLRGVALGNPVLEFATDFNARAEYFWSHGLISDAT  251

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E   G++S  C  V      E    +D  D+ L +CLSS      
Sbjct  252   YRVFTSACNYSRYVTEYYGGSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSS------  305

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++   ++ +R+   D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  306   VLSQSKILSPHEQVGQRI---DVCVEDETVRYLNRRDVQAALHARLVGVD-KWAVCSSVL  361

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LAR++ L     +
Sbjct  362   EYELLNLQIPTINVVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDMGLKTTTPY  421

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +GG         L+FA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  422   RVWFEGQQVGGWTQVYGGGA-------LSFATIRGASHEAPFSQPGRSLVLFRAFLQGQP  474

Query  1258  PPRT  1269
              P T
Sbjct  475   LPET  478



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score =   373 bits (958),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 263/425 (62%), Gaps = 25/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN L +N+YSWN 
Sbjct  68    LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALTRNEYSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   + Y    D+ TA+DNL+F+  WF +FPQY+  DLY+TGE
Sbjct  125   EANMLYLESPAGVGFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGE  184

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  185   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  242

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  243   TYNIFTTVCNYSRYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQS  302

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V         L          D C+ D    YL R +VQ+A+HA    +   W  CS  
Sbjct  303   QVLVPQQGSREL----------DVCVEDETMRYLNRKDVQQAMHARLDGVQ-RWTVCSSV  351

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  IP L++SGDQD+ IP+T +RT+   LA  L+L +   
Sbjct  352   LEYKQLDLQIPTVNTVGALVKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNSTAP  411

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G 
Sbjct  412   YRAWFQGKQVGGWTQVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAGQ  464

Query  1255  PPPRT  1269
               P +
Sbjct  465   QLPES  469



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 261/424 (62%), Gaps = 25/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN LV+N+YSWN 
Sbjct  65    LFYYFAEAEL-DPATKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNVLVRNEYSWNK  121

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   S Y    D++TA+DNLRF+  WF KFPQY+  DLY+TGE
Sbjct  122   EANMLYLESPAGVGFSYSTDPSFYGGVGDSRTARDNLRFLQGWFAKFPQYKGRDLYITGE  181

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  182   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDS  239

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   ++CN +R + E   G++S+ C  V      E    +D  D+ L +C+SS   Q 
Sbjct  240   TYHSFTTVCNYSRYVSEYYHGSLSSACDTVMTQVARETSRFVDKYDVTLDVCVSSVLMQS  299

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                        L          D C+ D    YL R +VQ+A+HA        W  CS  
Sbjct  300   KSLAPQRGSREL----------DVCVEDETMGYLNRKDVQEAMHARLEGGVPKWTVCSSV  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKL-IAFE  1071
             L+Y+  ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA  L+L     
Sbjct  350   LEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDSVIPLTGSRTVVQRLAGRLRLGTTAA  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+QSFGG         L+FA+VRGA+HE PF+ P ++L LF AFL G
Sbjct  410   GYRVWFEGRQVGGWTQSFGGGA-------LSFATVRGASHEAPFSQPERSLVLFAAFLAG  462

Query  1252  YPPP  1263
              P P
Sbjct  463   RPLP  466



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 267/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +G LVKN++SWN E
Sbjct  62    LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVKNEHSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS+ +S Y   ND  TA+DN+ F+L WF KFPQY  S+L+LTGES
Sbjct  120   ANMLYLESPIGVGFSYSSDTSSYETVNDEVTARDNVVFLLRWFHKFPQYSKSNLFLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ +  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAKLMMAFNKKQQL--FNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS      
Sbjct  238   YRMFSSACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISS------  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++     +K     D C+ D +  YL R +V++ALHA    +   W  CS  L
Sbjct  292   VLSQSKIISPQENAEKL----DVCVEDEVVNYLNRKDVRRALHAELVGVR-RWSVCSSIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ +P+  +R     LAR+++L     +
Sbjct  347   DYQLLDIEIPTISIIGTLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+  +         + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  407   RVWFAGQQVGGWTHVYD--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGKP  458

Query  1258  PPRT  1269
              P  
Sbjct  459   LPEV  462



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 268/422 (64%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N+YSWN E
Sbjct  59    LFYYFVEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGKVLVRNEYSWNKE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   +D  TA+DNL F+  W+ +FPQYR+ DL++TGES
Sbjct  117   ANMLYLETPVGVGFSYATDSSSYLAVDDEATARDNLVFLKHWYNRFPQYRHRDLFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA LM++ NKK+ +  F LK IALGNP+L+     ++ AE+LWSHG ISD  
Sbjct  177   YAGHYIPQLAKLMVEINKKEKL--FHLKGIALGNPVLEFATDFNSRAEYLWSHGLISDST  234

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  235   FKMFTAACNYSRYVSEYYRDSLSTICSRVMSRVNTETSRFVDKYDVTLDVCISSILSQSK  294

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V           ++ +R+   D C+ D    YL R +VQKALHA    +   W+ CS  L
Sbjct  295   VL-------RPQQVSERI---DVCVDDETMNYLNRKDVQKALHARLVGVG-RWEVCSNIL  343

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ N+    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  344   DYELLNLEIPTISVVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAKELGLNTTVPY  403

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+   Q+ GW+Q +           L+FA++RGAAHEVP++ P ++L LF++FL+G  
Sbjct  404   RVWFAEKQVGGWTQVYS--------DILSFATIRGAAHEVPYSQPERSLVLFKSFLEGKH  455

Query  1258  PP  1263
              P
Sbjct  456   LP  457



>gb|EEC68261.1| hypothetical protein OsI_36290 [Oryza sativa Indica Group]
Length=472

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/424 (45%), Positives = 271/424 (64%), Gaps = 23/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P + PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  69    LFYYFVEAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  126

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   +D  TA DN+ F+  W +KFPQY+  +LY++GES
Sbjct  127   ANVIYLETPAGVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGES  186

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLAD+M+++NKK  I  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  187   YAGHYIPQLADVMVEFNKKNKI--FNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDST  244

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G+++  C  V      E    +D  D+ L +CLSS      
Sbjct  245   YRIFTSVCNYSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSS------  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ ++T   ++ +R+   D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  299   VLSQSKILTPHQQVGQRI---DVCVEDETVNYLNRKDVQEALHAKLIGVK-NWAVCSSVL  354

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LAR+L L     +
Sbjct  355   EYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPY  414

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  415   RVWFEGQQVGGWTQVYG--------DMLSFATIRGASHEAPFSQPERSLVLFRAFLQGRP  466

Query  1258  PPRT  1269
              P T
Sbjct  467   LPET  470



>ref|NP_001176565.1| Os11g0522900 [Oryza sativa Japonica Group]
 gb|ABA93967.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52189.1| hypothetical protein OsJ_34064 [Oryza sativa Japonica Group]
 dbj|BAH95293.1| Os11g0522900 [Oryza sativa Japonica Group]
Length=472

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/424 (45%), Positives = 271/424 (64%), Gaps = 23/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P + PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  69    LFYYFVEAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  126

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   +D  TA DN+ F+  W +KFPQY+  +LY++GES
Sbjct  127   ANVIYLETPAGVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGES  186

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLAD+M+++NKK  I  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  187   YAGHYIPQLADVMVEFNKKNKI--FNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDST  244

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G+++  C  V      E    +D  D+ L +CLSS      
Sbjct  245   YRIFTSVCNYSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSS------  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ ++T   ++ +R+   D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  299   VLSQSKILTPHQQVGQRI---DVCVEDETVNYLNRKDVQEALHAKLIGVK-NWAVCSSVL  354

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LAR+L L     +
Sbjct  355   EYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPY  414

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  415   RVWFEGQQVGGWTQVYG--------DMLSFATIRGASHEAPFSQPERSLVLFRAFLQGRP  466

Query  1258  PPRT  1269
              P T
Sbjct  467   LPET  470



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score =   372 bits (955),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 267/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +G LV N++SWN E
Sbjct  54    LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKE  111

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYS+ +S Y   ND  TA+DN+ F+L WF KFPQYR S+L+LTGES
Sbjct  112   ANMLYLESPIGVGFSYSSDTSSYETVNDEITARDNVVFLLRWFHKFPQYRKSNLFLTGES  171

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ +  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  172   YAGHYVPQLAKLMMAFNKKQQL--FNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPT  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS      
Sbjct  230   YRMFSSACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISS------  283

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++     +K     D C+ D +  YL R +V++ALHA    +   W  CS  L
Sbjct  284   VLSQSKIISPQENSEKL----DVCVEDEVVNYLNRKDVKRALHAELVGV-HRWSVCSSIL  338

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ +P+  +R     LAR+++L     +
Sbjct  339   DYQLLDIEIPTISIIGTLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPY  398

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+  +         + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  399   RVWFAGQQVGGWTHVYD--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGKP  450

Query  1258  PPRT  1269
              P  
Sbjct  451   LPEV  454



>ref|XP_010499305.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
 ref|XP_010499306.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=489

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 265/422 (63%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             +FYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN +SWN E
Sbjct  88    MFYYFAEAET-DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNLHSWNQE  145

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  SS Y   ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  146   ANMLYLETPVGVGFSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  205

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  206   YAGHYVPQLAQLMMQYNKKHHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDST  263

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  264   YKMFTSYCNYSRYVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  323

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  324   VVSPNQVGESV----------DVCVEDETVNYLNRRDVQGALHARLVGVR-EWTVCSNVL  372

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA++L L     +
Sbjct  373   DYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLSTSVPY  432

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  433   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPERSLVLFKAFLGGHP  484

Query  1258  PP  1263
              P
Sbjct  485   LP  486



>ref|XP_003532390.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
 gb|KHN16877.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=466

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 266/423 (63%), Gaps = 22/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN+YSWN E
Sbjct  63    LFYYFVESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEV-LIKNEYSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+   S Y   ND  TA+DNL F+  WF KFP YR++DL+L GES
Sbjct  121   TNMLYLETPVGVGFSYAKGGSSYDTVNDETTARDNLVFLQRWFNKFPHYRHTDLFLAGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ NKK+  + F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAKLMIEINKKE--KMFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKLFTTGCNYSRYVSEYYRDSISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                  +  T          + D C+ D++  YL R +VQ+ALHA    +   W+ CS  L
Sbjct  299   AICPQSQQTN--------ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVQ-KWNVCSTIL  349

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L+L     +
Sbjct  350   DYDMLNLEVPTLPIVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLRLNTTIHY  409

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+  P
Sbjct  410   RVWFEGQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLEDRP  461

Query  1258  PPR  1266
              P 
Sbjct  462   LPE  464



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 263/422 (62%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSS+G GAF E+GPF+P +   LVKN++SWN E
Sbjct  62    LFYYLAEAETK-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  120   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNK+ N+  F LK IA+GNP+++     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMIQYNKQHNL--FNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G +S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  238   YKMFTSYCNYSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R N      +  +     D C+ D    YL R +VQKALHA        W  CS  L
Sbjct  298   ---RVN-----PQPQEMGETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWSVCSNVL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  349   DYEVLDVEVPTINIVGTLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  409   RVWFAGQQVGGWTQVYG--------NILAFATVRGAAHEVPFSQPARALVLFKAFLGGLP  460

Query  1258  PP  1263
              P
Sbjct  461   LP  462



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score =   371 bits (953),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 261/424 (62%), Gaps = 28/424 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P     L+KN YSWN E
Sbjct  58    LFYYFVEAET-DPSSKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS-GKILLKNDYSWNRE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSY    S Y + ND  TA DNL F+  WF KFP+YRN D ++TGES
Sbjct  116   ANMLYLESPAGVGFSYCANKSFYNSVNDEMTAIDNLAFLERWFSKFPEYRNRDFFITGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K N     LK IA+GNPLL+ D   ++ AEF WSHG ISD  
Sbjct  176   YAGHYVPQLAQLIVESKSKLN-----LKGIAIGNPLLEFDTDFNSRAEFFWSHGLISDAT  230

Query  538   LAMKRSICNDTRAILE-NIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
               +   ICN ++   +    G++S +C  V+     EV   +D+ D+ L +CLSS   Q 
Sbjct  231   YEIFTRICNYSQIRRQYQTSGSLSPDCSRVSREVSREVSKFVDTYDITLDVCLSSIQSQS  290

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V    N +    KI       D C+ D    YL R +VQ+ALHA    +   W  CS  
Sbjct  291   HVL---NQMEYAGKI-------DVCVEDETVKYLNRKDVQEALHAQLFGVN-GWTVCSDV  339

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y MQN+  +  P L +++K  I +L++SGDQD+ IP+T TR + N LA+EL L     
Sbjct  340   LKYNMQNLEISTTPLLGKLIKSGIRVLIYSGDQDSVIPLTGTRALVNGLAKELTLNTTVP  399

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+AGW+Q FG          L++A++RGA+HE PF+ P +++ LF AFL G 
Sbjct  400   YRAWFGGKQVAGWTQVFG--------DILSYATIRGASHEAPFSQPERSIVLFSAFLGGV  451

Query  1255  PPPR  1266
             P P 
Sbjct  452   PLPE  455



>ref|XP_011040747.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=467

 Score =   371 bits (953),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 266/424 (63%), Gaps = 21/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF EHGPF+P  +  L+KN YSWN E
Sbjct  59    LFYYFAEAEI-DPATKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y    D  TAQDNL F+  WF +FP+Y+  D ++TGES
Sbjct  117   ANMLYLESPAGVGFSYSANDSFYTYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPLL+ +   ++ AEF WSHG ISDD 
Sbjct  177   YAGHYVPQLATLIVQSQTK-----FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDT  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN ++   +   G++S  C  VN     EV   +D+ D+ L +CLSS   Q  
Sbjct  232   YEIFTTVCNYSQIRRQYQSGSLSLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQ  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  +   ++  + + +     D C+ D    YL R +V +ALHA    +   W  CS  +
Sbjct  292   VLKQMAFLS--SPVQEYTGTIDVCVEDETIKYLNRKDVLEALHAQLVGVD-QWTVCSDVI  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+M+N+  + +P L+++LK  I + ++SGDQD+ IP+T TRTI N LA+EL L     +
Sbjct  349   KYEMENLEISTVPLLAKLLKSGIRVHVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG--  1251
               W+ G Q+AGW+Q +G        + L+FA++R A+HE PF+ P ++  LF AFL+G  
Sbjct  409   RTWFQGKQVAGWTQVYG--------NILSFATIRAASHEAPFSQPERSFVLFNAFLEGKQ  460

Query  1252  YPPP  1263
              PPP
Sbjct  461   LPPP  464



>gb|EYU28449.1| hypothetical protein MIMGU_mgv1a004999mg [Erythranthe guttata]
Length=501

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 267/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LV N++SWN E
Sbjct  99    LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGNA-LVTNEFSWNKE  156

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESPIGVGFSYS  SS Y   ND  TA+DNL F+  WF KFPQY++  L++TGES
Sbjct  157   ANVLYLESPIGVGFSYSANSSSYDGVNDKITAEDNLVFLQNWFLKFPQYKDRSLFITGES  216

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQL +L+L++NKK+ I  F LK IALGNP+L+     ++ AEFLWSHG ISD  
Sbjct  217   YAGHYIPQLTELILQFNKKEKI--FNLKGIALGNPVLEFATDFNSRAEFLWSHGLISDTT  274

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  275   FKVFTSACNYSRYVSEYYRASLSPICSKVMSLVTIETSKFVDKYDVTLDVCISSVLSQSK  334

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                   +   +          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  335   ALVPQQMTDKV----------DVCVEDETVNYLNRRDVQRALHARLLGVN-RWLVCSNIL  383

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  I++  IP+L++SGDQD+ IP+T +R + + LAREL+L     +
Sbjct  384   DYELLDLEIPTINIVGRIVEAGIPVLVYSGDQDSVIPLTGSRKLVHRLARELRLRTSTPY  443

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G+Q+ GW+Q +G +        L+FA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  444   RVWFAGMQVGGWTQVYGNNK-------LSFATIRGASHEAPFSQPERSLVLFRAFLQGKP  496

Query  1258  PPR  1266
              P+
Sbjct  497   LPQ  499



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score =   371 bits (952),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 263/425 (62%), Gaps = 30/425 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN L +N+YSWN 
Sbjct  68    LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALTRNEYSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   + Y    D+ TA+DNL+F+  WF +FPQY+  DLY+TGE
Sbjct  125   EANMLYLESPAGVGFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGE  184

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  185   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  242

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS     
Sbjct  243   TYNIFTTVCNYSRYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISS-----  297

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                        L +  +     D C+ D    YL R +VQ+A+HA    +   W  CS  
Sbjct  298   ----------VLMQSQQGSRELDVCVEDETMRYLNRKDVQQAMHARLDGVQ-RWTVCSSV  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+  ++    + T+  ++K  IP L++SGDQD+ IP+T +RT+   LA  L+L A   
Sbjct  347   LEYKQLDLQIPTVNTVGALVKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G 
Sbjct  407   YRAWFQGKQVGGWTQVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAGQ  459

Query  1255  PPPRT  1269
               P +
Sbjct  460   QLPES  464



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   371 bits (952),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 266/422 (63%), Gaps = 26/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE ++P S P+ LWLNGGPGCSS+G GA +EHGPF+PG +  LVKN YSWN  
Sbjct  62    LFYYFVEAE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKV  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS+ +S Y    D  TA+DNL F+  WF +FP+Y  +D ++TGES
Sbjct  121   ANVLYLESPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY PQLA L+++   K N   F LK +A+GNPL++ D  +++ AEF WSHG ISD  
Sbjct  181   YAGHYAPQLAQLIVQ--TKTN---FNLKGVAIGNPLMEFDTDLNSKAEFFWSHGLISDST  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN +    + IQGN+S+ C  +NG    EV + ID  D+ L +CLSS  +Q  
Sbjct  236   YDLFTRVCNYSTIRRQTIQGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQAY  295

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N +    KI       D C+ D+   YL R +VQKALHA    +   W  CS  L
Sbjct  296   VL---NQMQETQKI-------DVCVDDKAVTYLNRKDVQKALHAKLVEVS-KWSACSRVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y  +N+    +  L  ++  +I +L++SGDQD+ IP+  +R++ N LA+EL L     +
Sbjct  345   HYDRRNLEIPTVSILGSLVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+AGW+Q +G          L++A++RGA+HE PFT P ++L L +AFL+G P
Sbjct  405   RAWFERKQVAGWTQVYG--------ELLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKP  456

Query  1258  PP  1263
              P
Sbjct  457   LP  458



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score =   370 bits (951),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 268/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF E+GPF+P R   LVKN++SWN E
Sbjct  56    LFYYFVEAET-DPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVKNEHSWNKE  113

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP+GVGFSYS  +S Y   ND  TA+DN+ F+  WF KFPQYR ++L+LTGES
Sbjct  114   ANMLYLESPVGVGFSYSTNTSSYETVNDEITARDNVVFLQRWFNKFPQYRENNLFLTGES  173

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ N KK +  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  174   YAGHYVPQLAKLMIELNNKKKL--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDST  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS      
Sbjct  232   YRMFTSVCNYSRYVSEYYRDGVSPMCSRVMSLVSRETSKFVDKYDVTLDVCMSS------  285

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++N+++     +K     D C+ D    YL R +V+ ALHA    +  +WD CS  L
Sbjct  286   VLSQSNIISPQENGEKI----DVCIDDETVNYLNRQDVRTALHARLVGV-HSWDVCSTIL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ +P+T +R++ + LA ++ L     +
Sbjct  341   DYQLLDIEIPTISIVGLLVKERIPVLIYSGDQDSVVPLTGSRSVVHQLANQMGLNTTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +         + L+FA++RGAAHE PF+ P ++L LFR+FL+G  
Sbjct  401   RVWFSGQQVGGWTQVYD--------NILSFATIRGAAHEAPFSQPERSLVLFRSFLQGKA  452

Query  1258  PPRT  1269
              P  
Sbjct  453   LPEV  456



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   370 bits (951),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/422 (46%), Positives = 264/422 (63%), Gaps = 22/422 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P +   LV+N +SWN E
Sbjct  53    LFYYLAEAETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNLHSWNQE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+  SS Y   ND  TA+DNL F+ +WF KFPQY N  L++TGES
Sbjct  111   ANMLYLETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++YNKK N+  F LK IA+GNP+++     ++  E+ WSHG ISD  
Sbjct  171   YAGHYVPQLAQLMIQYNKKHNL--FNLKGIAIGNPVMEFATDFNSRGEYFWSHGLISDPT  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  229   YKMFTSYCNYSRYVSEYYRGSVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSK  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +     ++ + V   D C+ D    YL R +VQ+ALHA        W  CS  L
Sbjct  289   V-----VNPQPQQVGETV---DVCVEDETVNYLNRRDVQRALHARLVGTR-KWAVCSNVL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  340   DYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G +        L FA+VRGAAHEVPF+ P++AL LF+AFL G P
Sbjct  400   RVWFAGQQVGGWTQVYGNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRP  451

Query  1258  PP  1263
              P
Sbjct  452   LP  453



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   371 bits (952),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 261/424 (62%), Gaps = 25/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN LV+N+YSWN 
Sbjct  65    LFYYFAEAEL-DPATKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNVLVRNEYSWNK  121

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   S Y    D++TA+DNLRF+  WF KFPQY+  DLY+TGE
Sbjct  122   EANMLYLESPAGVGFSYSTDPSFYGGVGDSRTARDNLRFLQGWFAKFPQYKGRDLYITGE  181

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  182   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDS  239

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   ++CN +R + E   G++S+ C  V      E    +D  D+ L +C+SS   Q 
Sbjct  240   TYHSFTTVCNYSRYVSEYYHGSLSSACDTVMTQVARETSRFVDKYDVTLDVCVSSVLMQS  299

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                        L          D C+ D    YL R +VQ+A+HA        W  CS  
Sbjct  300   KSLAPQRGSREL----------DVCVEDETMGYLNRKDVQEAMHARLEGGVPKWTVCSSV  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKL-IAFE  1071
             L+Y+  ++    +  +  ++K  +P+L++SGDQD+ IP+T +RT+   LA  L+L     
Sbjct  350   LEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDSVIPLTGSRTVVQRLAGWLRLGTTAA  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+QSFGG         L+FA+VRGA+HE PF+ P ++L LF AFL G
Sbjct  410   GYRVWFEGRQVGGWTQSFGGGA-------LSFATVRGASHEAPFSQPERSLVLFAAFLAG  462

Query  1252  YPPP  1263
              P P
Sbjct  463   RPLP  466



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   370 bits (951),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 272/426 (64%), Gaps = 30/426 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE  +PLS PL LWLNGGPGCSS+G GAF E+GPF+P  +G  L++N+YSWN 
Sbjct  57    LFYYFVEAEI-DPLSKPLVLWLNGGPGCSSIGVGAFSENGPFRP--NGQVLLRNEYSWNR  113

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYL++PIGVGFSYS  +S Y   ND  TA+DNL F+  WF KFPQYRNS L++TGE
Sbjct  114   EANMLYLDTPIGVGFSYSTGASSYVTVNDEMTAKDNLVFLQRWFLKFPQYRNSSLFITGE  173

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA L+++ NKK+  +   LK IALGNPLL+     ++ AE+ WSHG ISD 
Sbjct  174   SYAGHYVPQLAKLVIELNKKR--KMINLKGIALGNPLLEFTTDYNSRAEYFWSHGLISDS  231

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  S+CN +R + E  + ++S  C  V      E    ++  D+ L +C+ S   Q 
Sbjct  232   TYNLFTSVCNYSRYVREYYRDSLSVLCSRVMSLVNRESSRFVNKYDVTLDVCIPSVLSQS  291

Query  715   MVFF--RNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
              +    RN+         +R+   D C+ D   +YL R +VQKALHA    +   WD CS
Sbjct  292   KIIAPQRNS---------ERI---DVCVEDETVSYLNRRDVQKALHARLVGVR-RWDVCS  338

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
               L Y M ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA++L L   
Sbjct  339   NILDYDMLDLEIPTISIIGSLIKEGIPVLIYSGDQDSVIPLTGSRTLVHRLAKQLGLNTT  398

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++  LF++FL 
Sbjct  399   VPYRVWFEGQQVGGWTQVYG--------NLLSFATIRGASHEAPFSQPERSFVLFKSFLD  450

Query  1249  GYPPPR  1266
             G P P+
Sbjct  451   GRPLPQ  456



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score =   370 bits (951),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 194/426 (46%), Positives = 264/426 (62%), Gaps = 26/426 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN L +N+YSWN 
Sbjct  68    LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALTRNEYSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   + Y    D+ TA+DNL+F+  WF +FPQY+  DLY+TGE
Sbjct  125   EANMLYLESPAGVGFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGE  184

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  185   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  242

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E  +G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  243   TYNIFTTVCNYSRYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQS  302

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V         L          D C+ D    YL R +VQ+A+HA    +   W  CS +
Sbjct  303   QVLVPQQGSREL----------DVCVEDETMRYLNRKDVQQAMHARLDGVQ-RWTVCSSS  351

Query  895   -LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L+Y+  ++    + T+  ++K  IP L++SGDQD+ IP+T +RT+   LA  L+L A  
Sbjct  352   VLEYKQLDLQIPTVNTVGALVKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATA  411

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W+ G Q+ GW+Q FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G
Sbjct  412   PYRAWFQGKQVGGWTQVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAG  464

Query  1252  YPPPRT  1269
                P +
Sbjct  465   QQLPES  470



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 268/425 (63%), Gaps = 24/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN+YSWN E
Sbjct  63    LFYYFVESET-HPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGE-VLIKNEYSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+   S Y   ND  TA+DNL F+  WF KFPQ+RN DL+L GES
Sbjct  121   TNMLYLETPVGVGFSYAKGGSSYETVNDETTARDNLVFLQRWFNKFPQFRNRDLFLAGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ NKK+ +  F LK IALGNP+L+    +++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAKLMIEINKKEKL--FNLKGIALGNPVLEYATDLNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKLFTTGCNYSRYVSEYYRDSISPVCSKVLRHVARETSRFVDKYDVTLDVCISSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS--G  891
                   +     KI++ +   D C+ D++  YL R +VQ+ALHA    +   WD CS   
Sbjct  299   A-----ICPQGQKINESI---DVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCSNNS  349

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L L    
Sbjct  350   ILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTV  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+Q +G        S L+FA+VRGA+HE PF+ P ++  LF++FL+ 
Sbjct  410   PYRVWFEGQQVGGWTQVYG--------SILSFATVRGASHEAPFSQPERSFVLFKSFLED  461

Query  1252  YPPPR  1266
              P P 
Sbjct  462   RPLPE  466



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 265/424 (63%), Gaps = 29/424 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF EHGPF+P  +  L+KN YSWN E
Sbjct  59    LFYYFAEAEI-DPATKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILLKNDYSWNKE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y    D  TAQDNL F+  WF +FP+Y+  D ++TGES
Sbjct  117   ANMLYLESPAGVGFSYSANDSFYTYVTDGITAQDNLVFLERWFDEFPEYKGRDFFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPLL+ +   ++ AEFLWSHG ISD+ 
Sbjct  177   YAGHYVPQLATLIVQSKAK-----FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDNT  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN ++   +   G++S  C  VN     EV   +D+ D+ L +CLSS   Q  
Sbjct  232   YEIFTTVCNYSQIRRQYQSGSLSLPCSAVNSQVSREVSKYVDAYDVTLDVCLSSIESQSQ  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  +     T+          D C+ D    YL R +V +ALHA    +   W  CS  +
Sbjct  292   VLKQMEYTGTI----------DVCVEDETIKYLNRKDVLEALHAQLVGVD-QWTVCSDVV  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+M+N+  + +P L+++LK  I + ++SGDQD+ IP+T TRT+ N LA+EL L     +
Sbjct  341   KYEMENLEISTVPLLAKLLKSGIRVHVYSGDQDSVIPLTGTRTVVNGLAKELGLNTTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG--  1251
               W+ G Q+AGW+Q +G        + L+FA++RGA+HE PF+ P ++  LF AFL+G  
Sbjct  401   RTWFQGKQVAGWTQVYG--------NILSFATIRGASHEAPFSQPERSFVLFNAFLEGKQ  452

Query  1252  YPPP  1263
              PPP
Sbjct  453   LPPP  456



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 262/426 (62%), Gaps = 25/426 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAEA +P + PL LWLNGGPGCSS+G GAF E+GPF+P   GN L +N+YSWN 
Sbjct  69    LFYYFAEAEA-DPAAKPLVLWLNGGPGCSSVGVGAFSENGPFRP--SGNALTRNEYSWNK  125

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS   + Y    D+ TA+DNL+F+  WF KFPQY+  DLY+TGE
Sbjct  126   EANMLYLESPAGVGFSYSTDPAFYEGVGDSMTARDNLKFLQGWFAKFPQYKGRDLYITGE  185

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA  M+++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD 
Sbjct  186   SYAGHYVPQLAQRMVEFNKKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDS  243

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  ++CN +R + E   G++S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  244   TYNIFTTVCNYSRYVSEYYHGSLSTACDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQS  303

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              +         L          D C+ D    YL R +VQ+A+HA  T     W  CS  
Sbjct  304   QILAPQQGSREL----------DVCVEDETMNYLNRKDVQQAMHARLTDGVQRWTVCSSV  353

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKL-IAFE  1071
             L+Y+  ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA  L+L     
Sbjct  354   LEYKQLDLQIPTVNIVGALVKSGIPVLVYSGDQDSVIPLTGSRTLVSRLAGRLRLNTTAA  413

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W+ G Q+ GW+Q FGG         L+FA+VRGA+HE PF+ P ++L LFRAFL G
Sbjct  414   PYRAWFQGKQVGGWTQVFGGGA-------LSFATVRGASHEAPFSQPERSLGLFRAFLAG  466

Query  1252  YPPPRT  1269
                P +
Sbjct  467   QQLPES  472



>ref|XP_006662960.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=470

 Score =   370 bits (949),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 270/424 (64%), Gaps = 23/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P + PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  67    LFYYFVEAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  124

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS+ ++ Y   +D  TA DN+ F+  W +KFPQY+  +LY++GES
Sbjct  125   ANVIYLETPAGVGYSYSSDAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGES  184

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA++M+++NKK  I  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  185   YAGHYIPQLAEVMVEFNKKNKI--FNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDST  242

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G+++  C  V      E    +D  D+ L +CLSS      
Sbjct  243   YRIFTSVCNYSRYVTEYYGGSLTPLCTRVMNQVTRETSRFVDKYDVTLDVCLSS------  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ ++T   +  +R+   D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  297   VLSQSKILTPHQQAGQRI---DVCVEDETVNYLNRKDVQEALHAKLIGVK-NWAVCSSVL  352

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LAR L L     +
Sbjct  353   EYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARNLGLKTTVPY  412

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LFRAFL+G P
Sbjct  413   RVWFEGQQVGGWTQVYG--------DMLSFATIRGASHEAPFSQPERSLVLFRAFLQGRP  464

Query  1258  PPRT  1269
              P T
Sbjct  465   LPET  468



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 263/424 (62%), Gaps = 29/424 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF EHGPF+P  +  L+KN YSWN E
Sbjct  59    LFYYFAEAEI-DPATKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y    D  TAQDNL F+  WF +FP+Y+  D ++TGES
Sbjct  117   ANMLYLESPAGVGFSYSANDSFYTYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGES  176

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK IA+GNPLL+ +   ++ AEF WSHG ISDD 
Sbjct  177   YAGHYVPQLATLIVQSQTK-----FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDT  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN ++   +   G++S  C  VN     EV   +D+ D+ L +CLSS   Q  
Sbjct  232   YEIFTTVCNYSQIRRQYQSGSLSLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQ  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  +     T+          D C+ D    YL R +V +ALHA    +   W  CS  +
Sbjct  292   VLKQMEYTGTI----------DVCVEDETIKYLNRKDVLEALHAQLVGVD-QWTVCSDVI  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+M+N+  + +P L+++LK  I + ++SGDQD+ IP+T TRTI N LA+EL L     +
Sbjct  341   KYEMENLEISTVPLLAKLLKSGIRVHVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG--  1251
               W+ G Q+AGW+Q +G        + L+FA++R A+HE PF+ P ++  LF AFL+G  
Sbjct  401   RTWFQGKQVAGWTQVYG--------NILSFATIRAASHEAPFSQPERSFVLFNAFLEGKQ  452

Query  1252  YPPP  1263
              PPP
Sbjct  453   LPPP  456



>ref|XP_009615670.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 267/425 (63%), Gaps = 25/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LWLNGGPGCSS+G GAF E+GPF+P R   LV+N++SWN E
Sbjct  62    LFYYFVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESPIGVGFSYSN +S Y   ND  TA+DNL F+L WF KFP YR S+L+LTGES
Sbjct  120   ANMLYLESPIGVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+ +NKK+ I  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAKLMMAFNKKQQI--FNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPT  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G++S  C  V      E    +D   + L +C+SS      
Sbjct  238   YRMFSSACNYSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISS------  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++    ++K     D C+ D I  YL R +V++ALHA    +   W  CS  L
Sbjct  292   VLSQSKIISPQENVEKL----DVCVEDEIVNYLNRKDVRRALHAELVGVR-RWAVCSSIL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  IP+L++SGDQD+ IP+  +R   + LAR ++L     +
Sbjct  347   DYQLLDIEIPTISIIGMLVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPY  406

Query  1078  GPWYDGVQIA-GWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
               W+ G Q+  GW+  +         + L+FA++RGA+HE PF+ P ++L LF++FL+  
Sbjct  407   RVWFAGQQVVGGWTHVYD--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEDR  458

Query  1255  PPPRT  1269
             P P  
Sbjct  459   PLPEV  463



>gb|KHN08897.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=451

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 269/423 (64%), Gaps = 29/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE ++P S P+ LWLNGGPGCSS+G GA +EHGPF+P  D N LVKN +SWN 
Sbjct  53    LFYYFVEAE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKP--DSNVLVKNHFSWNK  109

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +N+LYLESP GVGFSYS+ +S Y    D  TA+DNL F+  WF +FP+Y N+D ++TGE
Sbjct  110   VANVLYLESPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGE  169

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY PQLA L+++   K N   F LK IA+GNPL++ D  +++ AEFLWSHG ISD 
Sbjct  170   SYAGHYAPQLAQLIVQ--TKTN---FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDS  224

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +   +CN +    + I GN+S+ C  +NG    EV + ID  D+ L +CLSS  +Q 
Sbjct  225   TYDLFTRVCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQS  284

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                +  N +    KI       D C+ D+   YL R +VQKALHA    +   W  CS  
Sbjct  285   ---YELNQMQETQKI-------DVCVDDKAVTYLNRKDVQKALHAKLVGVS-KWSTCSRV  333

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y  +N+    +  L  ++  +I +L++SGDQD+ IP+  +R++ N LA+EL L     
Sbjct  334   LHYDRRNLEIPTISILGALVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVA  393

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+AGW+Q +GG         L++A++RGA+HE PFT P ++L L +AFL+G 
Sbjct  394   YRAWFEGKQVAGWTQVYGG--------MLSYATIRGASHEAPFTQPQRSLVLLKAFLEGK  445

Query  1255  PPP  1263
             P P
Sbjct  446   PLP  448



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 263/424 (62%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             +FYYFVEAE + P+S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+ N YSWN E
Sbjct  72    MFYYFVEAETE-PVSKPLVLWLNGGPGCSSLGVGAFSENGPFRPAGN-RLIINHYSWNKE  129

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFS+S   S Y   ND  TA+DNL+F+ +WF KFP Y+N  LY+TGES
Sbjct  130   ANMLYLETPAGVGFSHSTNISSYETANDHTTARDNLKFLQKWFLKFPHYQNRSLYITGES  189

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  190   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFITDFNSRAEYFWSHGLISDST  247

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G +S  C  V      E    +D  D+ L +CL S   Q  
Sbjct  248   YNVFTSACNYSRYVGEYYRGFVSPMCSKVMSLVSRETSRFVDKYDVTLDVCLPSIFSQSK  307

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                 + +  T+          D C+ D    YL R +VQKALHA    +  +W  CS  L
Sbjct  308   FLTPHQVGETI----------DVCVEDETVGYLNRRDVQKALHARLVGVN-SWTVCSRIL  356

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+M ++    +  +  ++K  IP+L++SGDQD+ +P+T +RT+   LA ELKL     +
Sbjct  357   DYEMLDLERPTIHLIGNLVKAGIPVLIYSGDQDSVVPLTGSRTLVKRLAEELKLNTTVPY  416

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW++  G          L+FA+VRGA+HE PF+ P ++L LF++FL+G P
Sbjct  417   RVWFVGKQVGGWTEVHG--------DLLSFATVRGASHEAPFSQPERSLVLFKSFLEGKP  468

Query  1258  PPRT  1269
              P  
Sbjct  469   LPEV  472



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score =   369 bits (948),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 264/424 (62%), Gaps = 20/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+A +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  73    LFYYFVEADAPDPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  131

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   +D  TA DN+ F+  W +KFPQYR  DLY+ GES
Sbjct  132   ANVIYLETPAGVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLQKFPQYRGRDLYIAGES  191

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+ M+++N K+  R F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  192   YAGHYIPQLAEAMVEFNNKEE-RIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDAT  250

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  S CN +R + E   G +S  C  V      E    +D  D+ L + LSS      
Sbjct  251   FRAFTSACNYSRYVAEYYGGALSPLCARVMNRVTRETSRFVDKYDVTLDVFLSS------  304

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++  ++   ++ +RV   D C+ D    YL R +VQ ALHA    +   W  CS  L
Sbjct  305   VLSQSKTLSPHEQVGQRV---DVCVEDETVRYLNRRDVQAALHARLVGVD-KWAVCSSVL  360

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY++ N+    +  +  +++  I +L++SGDQD+ IP+T +RT+   LAR + L     +
Sbjct  361   QYELLNLQIPTINVVGSLVRSGIRVLVYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPY  420

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +GG         L+FA+VRGA+HE PF+ P ++L LFRAFL+G P
Sbjct  421   RVWFEGQQVGGWTQVYGGGA-------LSFATVRGASHEAPFSQPGRSLVLFRAFLQGQP  473

Query  1258  PPRT  1269
              P T
Sbjct  474   LPET  477



>ref|XP_003554111.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=460

 Score =   369 bits (946),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 270/423 (64%), Gaps = 29/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE ++P S P+ LWLNGGPGCSS+G GA +EHGPF+P  D N LVKN +SWN 
Sbjct  62    LFYYFVEAE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKP--DSNVLVKNHFSWNK  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +N+LYLESP GVGFSYS+ +S Y    D  TA+DNL F+  WF +FP+Y N+D ++TGE
Sbjct  119   VANVLYLESPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY PQLA L+++   K N   F LK IA+GNPL++ D  +++ AEFLWSHG ISD 
Sbjct  179   SYAGHYAPQLAQLIVQ--TKTN---FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDS  233

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +   +CN +    + I GN+S+ C  +NG    EV + ID  D+ L +CLSS A QQ
Sbjct  234   TYDLFTRVCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSS-ANQQ  292

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                +  N +    KID        C+ D+   YL R +VQKALHA    +   W  CS  
Sbjct  293   A--YELNQMQETQKIDV-------CVDDKAVTYLNRKDVQKALHAKLVGVS-KWSTCSRV  342

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y  +N+    +  L  ++  +I +L++SGDQD+ IP+  +R++ N LA+EL L     
Sbjct  343   LHYDRRNLEIPTISILGALVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVA  402

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+AGW+Q +GG         L++A++RGA+HE PFT P ++L L +AFL+G 
Sbjct  403   YRAWFEGKQVAGWTQVYGG--------MLSYATIRGASHEAPFTQPQRSLVLLKAFLEGK  454

Query  1255  PPP  1263
             P P
Sbjct  455   PLP  457



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   369 bits (947),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 270/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+ Q P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +NK SWN 
Sbjct  62    LFYYFVEADKQ-PDKKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNR  120

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  TA+D   F+L+W++KFP +R+ +L+LTGE
Sbjct  121   ASNLLFVESPAGVGWSYSNTSSDY-NSGDASTARDMHAFLLKWYEKFPTFRSRELFLTGE  179

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +A+GNPLL +D    A+ E+ WSHG ISD+
Sbjct  180   SYAGHYIPQLAIAILDHNKQSTGFKFNLKGVAIGNPLLRLDRDAPASYEYFWSHGMISDE  239

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  N   N+S EC        + VG  ID+ D++L +C  S  +Q+
Sbjct  240   IGLTIMNECDFDDYVFANTH-NLSLECNKAISQANQIVGYYIDNYDVILDVCYPSIVEQE  298

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     YL  PEVQKALHAN T LP+TW  CS 
Sbjct  299   L---------RLRKMATKISVGVDVCMTYERSFYLNLPEVQKALHANRTNLPYTWSMCSX  349

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L+ I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  350   VLNYSNTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAXDLKFPITV  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  410   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  461

Query  1252  YPPPRTS  1272
                P T+
Sbjct  462   RRLPNTT  468



>ref|XP_011002097.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   368 bits (945),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/423 (45%), Positives = 274/423 (65%), Gaps = 26/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQP-GRDGNLVKNKYSWNL  177
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P GR   L++N++SWN 
Sbjct  62    LFYYFVEAEI-DPESRPLVLWLNGGPGCSSLGLGAFSENGPFRPEGR--VLIRNEHSWNR  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSY+  SS +   +D  TA+DNL F+  WF KFPQYR++DL++ GE
Sbjct  119   EANMLYLETPVGVGFSYATNSSSFVAVDDEATARDNLLFLQGWFHKFPQYRSTDLFIAGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM+  NKK+ +  F LK IALGNP+LD    +++ AE+ WSHG ISD 
Sbjct  179   SYAGHYIPQLAKLMIGINKKEKL--FNLKGIALGNPVLDFATDLNSRAEYFWSHGLISDS  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S CN +R + E  + ++S+ C +V      E    +D  D+ L +C+S+     
Sbjct  237   TYKMFTSACNYSRYVSEYYRDSVSSICSIVMNQVNTETSRFVDKYDVTLDVCVST-----  291

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              VF ++  ++   ++ +R+   D C+ D    YL R +V++ALHA    +   W+ CS  
Sbjct  292   -VFSQSKFISP-KQVSERI---DVCIEDETVNYLNRKDVRRALHARLIGVR-RWEVCSNI  345

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y+  NI       +  ++K  IP+L++SGDQD+ IP+T +RT+ + +A+EL L     
Sbjct  346   LDYEFLNIEIPTFNIVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVHRVAKELGLNTTVP  405

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  406   YRVWFAGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLMLFKSFLEGK  457

Query  1255  PPP  1263
               P
Sbjct  458   HLP  460



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   368 bits (945),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 267/424 (63%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P +   LV+N+YSWN E
Sbjct  62    LFYYFAEAEV-DPSTKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGAVLVRNEYSWNKE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYS+ SS Y   ND  TA DNL F+  WF KFPQY   DLY+ GES
Sbjct  120   ANMLYLETPAGVGFSYSSDSSYYEGVNDRMTATDNLVFLQRWFTKFPQYEGRDLYIAGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ + K+  R F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  180   YAGHYVPQLAQLMVESDDKQ--RVFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +G++S+ C  V      E    +D  D+ L +C+SS   Q M
Sbjct  238   YRIFTSACNYSRYVSEYYRGSLSSVCQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSM  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V        +  ++ +RV   D C+ D    YL R +VQ ALHA+   +   W  CS  L
Sbjct  298   VL-------SPQQVTERV---DVCVEDETVRYLNRRDVQSALHAHLDGVT-KWTVCSSVL  346

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ ++    +  +  ++K  IP+L++SGDQD+ IP+T +RT+   LA EL L     +
Sbjct  347   EYELLDLEVPTISVVGSLVKSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTVPY  406

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA+VRGA+HE PF+ P ++L LFRAFL+G P
Sbjct  407   RVWFEGEQVGGWTQVYG--------DVLSFATVRGASHEAPFSQPERSLVLFRAFLQGRP  458

Query  1258  PPRT  1269
              P T
Sbjct  459   LPET  462



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score =   367 bits (942),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/420 (45%), Positives = 258/420 (61%), Gaps = 31/420 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P   G+LV+N YSWN E
Sbjct  51    LFYYFVEAET-DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKE  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   NDT T QDN  F+  WF KFP+Y+N DL++TGES
Sbjct  110   ANMLYLESPAGVGFSYSANQSFYDLVNDTITVQDNFVFLQNWFLKFPEYKNRDLFITGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADL++K   K     F LK IALGNPLL+     ++  +F WSHG IS+  
Sbjct  170   YAGHYVPQLADLIVKSGLK-----FNLKGIALGNPLLEFSTDFNSEGDFYWSHGLISNPT  224

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN ++   E I  ++S  C  VN     E+   ID  D+   +CLS  A    
Sbjct  225   YELLSAVCNTSQLWRERIGNSLSASCSKVNDQLNAEIPDAIDKYDVTANVCLSFGA----  280

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                     + L K  + +   DPC+ +  + YL R +VQ++ HA     P  W FCSG +
Sbjct  281   --------SLLGKAQENI---DPCVQEETFVYLNRKDVQESFHAKLVGTP-KWTFCSGVV  328

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y ++N+    +  +  ++   + +L++SGDQD+ IP T +RT+   LA++L L A   +
Sbjct  329   NYDLRNLEIPTIDVVGSLVNSGVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPY  388

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
              PW++  Q+ GW+Q +G        + LTF+++RG +H  PF+SP ++L LF AFL G P
Sbjct  389   TPWFEDKQVGGWTQVYG--------NILTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKP  440



>ref|XP_007043818.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 ref|XP_007043819.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99649.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99650.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
Length=462

 Score =   367 bits (943),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 264/424 (62%), Gaps = 27/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN+YSWN E
Sbjct  62    LFYYFAEAEV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y   +D  TA+DNL F+  WF KFPQYRN  L++TGES
Sbjct  120   ANMLYLEAPIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGES  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA+LML++N+K  +  F LK IALGNP+L+  I  ++ AEF WSHG ISD  
Sbjct  180   YAGHYIPQLAELMLQFNRKDKL--FNLKGIALGNPVLEFAIDFNSRAEFFWSHGLISDST  237

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  + CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  238   YKMFTTSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSK  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  298   VLTPQQVGETI----------DVCVEDETANYLNRQDVQKALHARLVGVR-KWAVCSNVL  346

Query  898   QYQ-MQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
              Y+ ++N    I+  L  +L  +  +L  SGDQD+ IP+T +RT+ N LA+EL L     
Sbjct  347   DYELLENTEHVIVIWLIVVLITY--VLKCSGDQDSVIPLTGSRTLVNRLAKELGLKTTVT  404

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF+AFL+G 
Sbjct  405   YRVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKAFLEGR  456

Query  1255  PPPR  1266
             P P 
Sbjct  457   PLPE  460



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 262/425 (62%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P  +  LV N YSWN  
Sbjct  52    LFYYFVEAET-DPASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKV  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS  +S Y   ND  TA+DNL+F+  WF KFP+Y+N DL+LTGES
Sbjct  110   ANMLYLESPAGVGFSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK +A+GNPLL+ +   ++ AE++WSHG ISD  
Sbjct  170   YAGHYVPQLAQLIVQSKVK-----FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDIT  224

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                   ICN ++   E + G++S  C  V      E+G  IDS D+ L +CL S   Q  
Sbjct  225   YEAFTVICNYSQVRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSE  284

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R N      KID        C+ D    YL R +VQKALHA+   +   W  CS  L
Sbjct  285   ---RLNQPRGTEKIDV-------CVEDETIKYLNRKDVQKALHAHLKGVS-RWSICSEVL  333

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+ +N+    +  +  +LK  I +L++SGDQD+ +P+T TRT+ N LA++L L     +
Sbjct  334   KYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPY  393

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LF  FL+G P
Sbjct  394   RNWFQGRQVGGWTQVYGDK--------LSFATIRGASHEAPFSQPERSLVLFNTFLQGKP  445

Query  1258  PPRTS  1272
              P  +
Sbjct  446   LPEAT  450



>ref|XP_006584695.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=468

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/425 (45%), Positives = 266/425 (63%), Gaps = 24/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVE+E  +P S PL LWLNGGPGCSSLG GAF E+GPF+P  +  L+KN+YSWN E
Sbjct  63    LFYYFVESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEV-LIKNEYSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSY+   S Y   ND  TA+DNL F+  WF KFP YR++DL+L GES
Sbjct  121   TNMLYLETPVGVGFSYAKGGSSYDTVNDETTARDNLVFLQRWFNKFPHYRHTDLFLAGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM++ NKK+  + F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  181   YAGHYVPQLAKLMIEINKKE--KMFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDST  238

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  + CN +R + E  + ++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  239   YKLFTTGCNYSRYVSEYYRDSISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSK  298

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS--G  891
                  +  T          + D C+ D++  YL R +VQ+ALHA    +   W+ CS   
Sbjct  299   AICPQSQQTN--------ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVQ-KWNVCSTNS  349

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y M N+    +P +  ++K  + +L++SGDQD+ IP+T +RT+   LAR+L+L    
Sbjct  350   ILDYDMLNLEVPTLPIVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLRLNTTI  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W++G Q+ GW+Q +G        + L+FA+VRGA+HE PF+ P ++L LF++FL+ 
Sbjct  410   HYRVWFEGQQVGGWTQVYG--------NILSFATVRGASHEAPFSQPERSLVLFKSFLED  461

Query  1252  YPPPR  1266
              P P 
Sbjct  462   RPLPE  466



>ref|XP_009113703.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
 emb|CDY46627.1| BnaA09g27540D [Brassica napus]
Length=454

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/422 (45%), Positives = 267/422 (63%), Gaps = 27/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE  +P++ PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  56    LFYYLAEAET-DPINKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQE  113

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS   + Y + ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  114   ANMLYLETPVGVGFSYS---TQYESVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++YN+K ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  171   YAGHYVPQLAELMIQYNQKHHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDST  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  229   YKMFTSYCNYSRYVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  289   VVSPNQVGESV----------DVCVEDETVKYLNRRDVQEALHARLVGVR-EWTVCSNVL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ N LA+ L L     +
Sbjct  338   DYQLLDVEIPTINIVGSLVQAGVPVLVYSGDQDSVIPLTGSRTLVNRLAKRLGLRTSVPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL G+P
Sbjct  398   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPHRSLVLFKAFLDGHP  449

Query  1258  PP  1263
              P
Sbjct  450   LP  451



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 263/422 (62%), Gaps = 28/422 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAEA +P   PL LWLNGGPGCSS+G GAF EHGPF+P  D  L+KN YSWN E
Sbjct  64    LFYYFTEAEA-DPALKPLVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKE  121

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLY+ESP GVGFSYS  +S Y   +D  TA+DNL F+  WF+KFPQYR  DL++TGES
Sbjct  122   ANMLYIESPAGVGFSYSVNNSFYNLVDDKMTARDNLAFLCNWFEKFPQYRERDLFITGES  181

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++       + F LK IA+GNPLL+ D  I++ AEFLWSHG ISD  
Sbjct  182   YAGHYVPQLAKLIVQS------KLFNLKGIAIGNPLLEFDTDINSRAEFLWSHGLISDAT  235

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  +ICN ++   +   G ++  C  V      E+   +D  D+ L +CLS+      
Sbjct  236   YESFNTICNFSKIQRQRRSGALTPVCSHVFTEALREISKFVDGYDVTLDVCLST------  289

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             VF ++ ++  L +  K     D C+ +  Y YL R EVQ+ALHA    +   W  CS  L
Sbjct  290   VFSQSAVLNKLQETQKI----DVCVQEETYKYLNRKEVQEALHARLIGIS-AWTTCSSVL  344

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+MQN+    +  L E+ K  I +L++SGDQD  IP+  TRTI N LA++L L     +
Sbjct  345   KYEMQNLEIPTVSILGELAKSGIHVLVYSGDQDAAIPLLGTRTIVNNLAKQLGLNTTVPY  404

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+   Q+AGW+Q +G          L+FA++RGA+HE PF+ P ++L LF +FL G P
Sbjct  405   RVWFKERQVAGWTQVYG--------DILSFATIRGASHEAPFSQPERSLVLFSSFLGGRP  456

Query  1258  PP  1263
              P
Sbjct  457   LP  458



>ref|XP_007028221.1| Serine carboxypeptidase 45 [Theobroma cacao]
 gb|EOY08723.1| Serine carboxypeptidase 45 [Theobroma cacao]
Length=470

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/432 (45%), Positives = 267/432 (62%), Gaps = 29/432 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE   P S PL LWLNGGPGCSS+G GA  EHGPF+P  +  + KNKYSWN E
Sbjct  57    LFYYFVEAETM-PASKPLVLWLNGGPGCSSIGAGALTEHGPFKPNGE-TMEKNKYSWNKE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS  +S Y N ND   A+DNL F+  WF KFP+Y+N D Y+TGES
Sbjct  115   ANMLYLESPAGVGFSYSANNSFYANLNDEVAARDNLVFLERWFVKFPEYKNRDFYITGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDDL  537
             YAGHY+PQLA L++  N K N     LK IA+GNPLL+    +++  ++ WSHG ISD  
Sbjct  175   YAGHYVPQLAQLIIHSNLKLN-----LKGIAIGNPLLEFATDMNSVDQYYWSHGLISDSA  229

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E I+ ++S++CI V      E+   ID  D++  +CLSS  +  M
Sbjct  230   YELLTSFCNSSRLMREVIRRSISSDCISVYSEVSTELTKSIDQYDVIADVCLSS-GQSPM  288

Query  718   VFFRNNLVT---------TLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPW  870
                 ++L++          L++    V   DPC+ D+   YL R +VQKALHA       
Sbjct  289   AILSHSLLSGPQHSSQADGLSQQQVSVKE-DPCIQDKTTKYLNRKDVQKALHAQLVGTT-  346

Query  871   TWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARE  1050
             +W+ C+  +QY M N+ +  +  +  I+K  IP++++SGDQD+ IP T TRT+   LA+ 
Sbjct  347   SWNLCNKFVQY-MDNLETPTIHIVGSIVKSGIPVMVYSGDQDSVIPFTGTRTLVYKLAKA  405

Query  1051  LKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTL  1230
             L L     + PW++G Q+ GW+Q +G          L+FA++RGA+H  P + P ++L L
Sbjct  406   LGLNTTVPYRPWFEGKQVGGWTQVYG--------DILSFATIRGASHTAPASQPERSLAL  457

Query  1231  FRAFLKGYPPPR  1266
             F+A L G P P 
Sbjct  458   FKAVLAGKPLPE  469



>ref|XP_010673054.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 262/426 (62%), Gaps = 28/426 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE  NP S PL LWLNGGPGCSS+G GAF EHGPF P   GN LVKN YSWN 
Sbjct  64    LFYYFVEAET-NPSSKPLVLWLNGGPGCSSIGAGAFSEHGPFHPS--GNVLVKNDYSWNK  120

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLESP GVGFSYS  +S Y   ND  TA+DNL F+  W + FP+Y+N D ++TGE
Sbjct  121   EANMLYLESPAGVGFSYSVNTSFYDGVNDEITAKDNLVFLQNWLEIFPEYKNRDFFITGE  180

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SY GHY+PQLA+L+LK + K N     LK IALGNPLL+ +   ++  E+LWSHG ISD 
Sbjct  181   SYGGHYVPQLANLILKSSLKSN-----LKGIALGNPLLEFNTDFNSRPEYLWSHGLISDA  235

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                + + +CN ++   +  +G +S  C LVN     E+G  IDS D+ L +C  S AKQ 
Sbjct  236   TYELSQKVCNFSQIRRQAQKGFLSPSCALVNSHMSSEIGKFIDSYDVTLDVCYHSIAKQA  295

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V         L ++D++    D CL D    Y+ R +VQK ++A    +   W  CSG 
Sbjct  296   HVL-------DLNQMDEQQI--DVCLDDETTQYINRKDVQKVMNAQLVGVT-QWSMCSGV  345

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             + Y M ++    +P L    K  + +L++SGDQD+ +P+T +R + + LA+EL L     
Sbjct  346   VNYHMDDLEVPTLPLLGTFAKSGVRVLVYSGDQDSVLPLTGSRMLVDSLAKELGLKTTVS  405

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W    Q+ GW+Q +G          L +A++RGAAHE PF+ P+++L LFR+FL G 
Sbjct  406   YRTWLSDKQVGGWTQVYG--------DILAYATIRGAAHEAPFSQPARSLVLFRSFLNGS  457

Query  1255  PPPRTS  1272
             P P  +
Sbjct  458   PLPDVT  463



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   367 bits (941),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 262/425 (62%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P  +  LV N YSWN  
Sbjct  60    LFYYFVEAET-DPASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKV  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS  +S Y   ND  TA+DNL+F+  WF KFP+Y+N DL+LTGES
Sbjct  118   ANMLYLESPAGVGFSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LK +A+GNPLL+ +   ++ AE++WSHG ISD  
Sbjct  178   YAGHYVPQLAQLIVQSKVK-----FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDIT  232

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                   ICN ++   E + G++S  C  V      E+G  IDS D+ L +CL S   Q  
Sbjct  233   YEAFTVICNYSQVRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSE  292

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R N      KID        C+ D    YL R +VQKALHA+   +   W  CS  L
Sbjct  293   ---RLNQPRGTEKIDV-------CVEDETIKYLNRKDVQKALHAHLKGVS-RWSICSEVL  341

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+ +N+    +  +  +LK  I +L++SGDQD+ +P+T TRT+ N LA++L L     +
Sbjct  342   KYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPY  401

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L LF  FL+G P
Sbjct  402   RNWFQGRQVGGWTQVYGDK--------LSFATIRGASHEAPFSQPERSLVLFNTFLQGKP  453

Query  1258  PPRTS  1272
              P  +
Sbjct  454   LPEAT  458



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score =   367 bits (941),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 266/423 (63%), Gaps = 28/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAEA +P S PL LWLNGGPGCSS+G GAF EHGPF+P  D  L+KN YSWN E
Sbjct  61    LFYYFAEAEA-DPASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-VLLKNDYSWNKE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS  +S Y + +D  TA+DNL F+  WF+KFP+Y+  DL++TGES
Sbjct  119   ANMLYLESPAGVGFSYSVNTSYYSSVDDKMTARDNLAFLRNWFEKFPEYKERDLFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++       + F LK IA+GNPLL+ +   ++ AEF WSHG ISD  
Sbjct  179   YAGHYVPQLALLIVQS------KLFNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDAT  232

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  ++CN ++   +   G ++  C  VN     ++   ID+ D+ L +CLS+ + Q  
Sbjct  233   YESFNTMCNYSQIRRQAQSGTLTPVCSRVNSEANRQISKFIDTYDVTLDVCLSTVSSQSA  292

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N +    KID        C+ D+   YL R EVQ+ALHA    +  +W  CS  L
Sbjct  293   VL---NKLQQAEKIDV-------CVEDKTLKYLNRKEVQEALHARLVGIS-SWTVCSYVL  341

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+ QN+    +  L E++K  I +L++SGDQD+ IP+  TRT+ N LA++L L     +
Sbjct  342   KYEYQNLEIPTISILGELVKSGIQVLVYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVPY  401

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+AGW+Q +G          L++A++RGA+HE PF+ P ++L LF +FL G P
Sbjct  402   RVWFEESQVAGWTQVYGDK--------LSYATIRGASHEAPFSQPERSLLLFSSFLGGRP  453

Query  1258  PPR  1266
              P 
Sbjct  454   LPE  456



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 268/441 (61%), Gaps = 42/441 (10%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LW+NGGPGCSS+G GAF EHGPF+P    NLV+N+YSWN E
Sbjct  101   LFYYFVEAET-NPASKPLVLWVNGGPGCSSIGTGAFSEHGPFRPS-GKNLVRNEYSWNKE  158

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKT---------AQDN-------LRFVLEWFK  312
             +NMLYLE+P GVGFSYS  +S Y+  ND  T         AQ +       LR    W  
Sbjct  159   ANMLYLETPAGVGFSYSTNTSYYYGVNDEMTGPGKNYSIEAQKSYSYTSWFLRTSSRWLD  218

Query  313   KFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISID  492
             KFP+++N DL++TGESYAGHY+PQLA LM+++N +K    F LK IALGNPLL+     +
Sbjct  219   KFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQK---LFNLKGIALGNPLLEFTTDFN  275

Query  493   A-AEFLWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSS  669
             + AEFLWSHG ISD       S CN +R + +  +G++S+ C+ V      E+   ID  
Sbjct  276   SRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVVSLVNREISRFIDEY  335

Query  670   DLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHA  849
             D+ L +C+SS   Q            LT   K V + D C+ D  Y YL R +VQK+LHA
Sbjct  336   DVTLSVCVSSILSQSKA---------LTPQQKVVESTDVCVEDETYNYLNRDDVQKSLHA  386

Query  850   NTTYLPWTWDFCSG--TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTR  1023
             +   +   W  C+    ++Y M N+  + +P LS + +  I IL++SGDQD+ IP+T TR
Sbjct  387   HLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPLTGTR  445

Query  1024  TIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPF  1203
             T+ + LA EL L     +  W++G Q+ GW+Q +G          LTFA++RG +HE PF
Sbjct  446   TLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYG--------DILTFATIRGGSHEAPF  497

Query  1204  TSPSQALTLFRAFLKGYPPPR  1266
             + P ++L LF +FLKG P P 
Sbjct  498   SQPQRSLVLFNSFLKGKPLPE  518



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   366 bits (940),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 202/430 (47%), Positives = 269/430 (63%), Gaps = 21/430 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEA+ Q P    LTLWLNGGPGCSS+G GAF E GPF P  DG  L +NK SWN 
Sbjct  61    LFYYFVEADKQ-PDKKSLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNR  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  TA+D   F+L+W++KFP +R+ +L+LTGE
Sbjct  120   ASNLLFVESPAGVGWSYSNTSSDY-NSGDASTAKDMHTFLLKWYEKFPTFRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +A+GNPLL +D+   A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLAIAILDHNKQSTGFKFNLKGVAIGNPLLRLDLDAAATYEYFWSHGMISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  N   N+S EC        + VG  I++ D++L +C  S  +Q+
Sbjct  239   IGLTIMNECDFDDYVFANPH-NVSLECNKAISKANQIVGDYINNYDVILDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
             +      L    TKI   V   D C+T     Y   PEVQKALHAN T LP+TW  CSG 
Sbjct  298   L-----RLRKKATKISVGV---DVCMTYERSFYFNLPEVQKALHANRTNLPYTWSMCSGV  349

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y   +   NI+P L+ I+++HIP+ +FSGDQD+ +P   +RT+   LA +LK      
Sbjct  350   LNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPFLGSRTLIRELAHDLKFPITVP  409

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +G W+   Q+AGW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G 
Sbjct  410   YGAWFHKGQVAGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVLGQ  461

Query  1255  PPPRTS*GPL  1284
               P T+  P+
Sbjct  462   RLPNTTRPPI  471



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   366 bits (939),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 272/433 (63%), Gaps = 23/433 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVK-NKYSWNL  177
             LFYYFVEA+ Q P    LTLWLNGGPGCSS+G GAF E GPF P  DG  V+ NK SWN 
Sbjct  61    LFYYFVEADKQ-PDKKSLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGVRSNKMSWNR  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  TA+D   F+L+W++KFP +R+ +L+LTGE
Sbjct  120   ASNLLFVESPAGVGWSYSNTSSDY-NSGDASTAKDMHTFLLKWYEKFPTFRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +A+GNPLL +D    A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLAIAILDHNKESTGFKFNLKGVAIGNPLLRLDRDAAATYEYFWSHGMISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  N   N+S EC        + VG  I++ D++L +C  S  +Q+
Sbjct  239   IGLTIMNECDFDDYVYANPH-NVSLECNKAISKANQIVGDYINNYDVILDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     YL  PEVQKALHAN T LP+TW  CSG
Sbjct  298   L---------RLRKMATKISVGVDVCMTYERSFYLNLPEVQKALHANRTNLPYTWSMCSG  348

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L+ I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  349   VLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAXDLKFPITV  408

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  409   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  460

Query  1252  YPPPRTS*GPLLE  1290
                P T+  P+ E
Sbjct  461   RRLPNTTRPPIDE  473



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   365 bits (937),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 267/423 (63%), Gaps = 31/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAE ++ LS PL LWLNGGPGCSSLG GAF E+GPF+P  +G LV+N++SWN E
Sbjct  60    LFFYFAEAE-KDALSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGEG-LVRNQFSWNKE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y        A DNL F+  WF KFP+YRN  L++ GES
Sbjct  118   ANMLYLETPIGVGFSYSTDTSSY-------EAGDNLVFLQNWFMKFPEYRNRSLFIVGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++N+K+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  171   YAGHYVPQLAELMLRFNRKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +  + E   G +S  C  V      E    ++  D+ L +CLSS   Q  
Sbjct  229   YKMFTSVCNYSTYVREYYNGAVSPTCSSVMSQVSTETSRFVEKYDVTLDVCLSSVFSQTK  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ ALHA+   +   W  CS  L
Sbjct  289   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSALHAHLVGVQ-RWSACSNVL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++ +  +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  338   DYELRDLETPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  398   RVWFEKQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGGP  449

Query  1258  PPR  1266
              P+
Sbjct  450   LPQ  452



>gb|EMS58238.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=455

 Score =   365 bits (936),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 188/424 (44%), Positives = 265/424 (63%), Gaps = 23/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P + PL LWLNGGPGCSSLG GAF E+GPF+P     LV+N+YSWN E
Sbjct  52    LFYYFVEAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQA-LVRNEYSWNKE  109

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVGFSYS  ++ Y   ND  TA  N+ F+  W +KFPQY+  +LY+ GES
Sbjct  110   ANVIYLETPAGVGFSYSADAAYYQGVNDNMTAMGNMVFMQRWLEKFPQYKGRELYIAGES  169

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA++M+++NKK NI  F LK +ALGNP+L      ++ AE+ WSHG ISD  
Sbjct  170   YAGHYIPQLAEVMVEFNKKDNI--FNLKGLALGNPVLHFTTDFNSRAEYFWSHGLISDST  227

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G++S  C  V      E    +D  D+ L +CLSS   Q M
Sbjct  228   YRIFTSVCNYSRYVSEYYGGSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSM  287

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +      ++   ++  R+   D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  288   I------LSPHKRVGHRI---DVCVEDETVNYLNRKDVQEALHAKLIGVK-NWAVCSSVL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LAR+L L     +
Sbjct  338   EYELLNLQIPTIDIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSIPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L L RAFL+  P
Sbjct  398   RVWFEGKQVGGWTQVYGDK--------LSFATIRGASHEAPFSQPERSLVLIRAFLQDRP  449

Query  1258  PPRT  1269
              P T
Sbjct  450   LPET  453



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   365 bits (938),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 269/434 (62%), Gaps = 24/434 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE + P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  66    LFYYFVEAEVE-PHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRALRRNSMSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY N  D  TA+D   F++ W++KFP++++ +L+LTGE
Sbjct  125   ASNLLFVESPAGVGWSYSNTTSDY-NCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGE  183

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLAD++L +N       F +K +A+GNPLL +D  + A  EF WSHG ISD+
Sbjct  184   SYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDE  243

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     S C D    +     NM+N CI       + VG  I++ D++L +C  +  +Q+
Sbjct  244   IGLTIMSDC-DFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQE  302

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T   + YL  PEVQKALHAN T LP+ W  CSG
Sbjct  303   L---------RLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSG  353

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L  I+++ IP+ +FSGDQD+ +P+  +RT+   LAR+L      
Sbjct  354   VLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTV  413

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G        + LTF +VRGAAH VP+  PS+AL LF +F+ G
Sbjct  414   PYGAWFHKQQVGGWGTEYG--------NLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG  465

Query  1252  YPPPRTS*GPLLED  1293
                P  +  P ++D
Sbjct  466   RRLPNNT-RPAIQD  478



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 266/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+  +  + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  61    LFYYFVEADNDHH-NKPLTLWLNGGPGCSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNR  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+LESP GVG+SYSNT+SDY +  D  TA D L F+L+W++KFP YR+ +L+LTGE
Sbjct  120   ASNLLFLESPAGVGWSYSNTTSDYSS-GDASTANDTLLFLLKWYEKFPSYRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L +N   N   F +K +A+GNPLL +D    A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLANVLLDHNAHSNGFKFNIKGVAIGNPLLKLDRDAQATYEYFWSHGLISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  N   N+S  C        E VG  I++ D++L +C  S  +Q+
Sbjct  239   IGLAIANDCDFDDYVFANTH-NVSKSCNHAINEANEIVGEYINNYDVILDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+      YL  PEVQKALHAN T LP+ W  CSG
Sbjct  298   L---------RLKKMATKISIGVDVCMNYENGFYLNLPEVQKALHANRTNLPYEWSMCSG  348

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L  I+++HIP+ +FSGDQD+ +P+  +RT+   LA ELK     
Sbjct  349   VLNYSDTDPNIDILPVLKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELKFKITV  408

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G        + LTFA+VRGAAH VPF  PS+AL LF +F++G
Sbjct  409   PYGAWFHQGQVGGWVTEYG--------NLLTFATVRGAAHMVPFAQPSRALRLFSSFVRG  460

Query  1252  YPPPRTS  1272
                P T+
Sbjct  461   MRLPNTT  467



>ref|XP_004979352.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=472

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/424 (44%), Positives = 265/424 (63%), Gaps = 22/424 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  68    LFYYFVEAEV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  125

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   +D  TA DN+ F+  W +KFPQY+  DLY+ GES
Sbjct  126   ANVIYLETPAGVGYSYSADAAYYQGVDDKMTATDNMVFLQRWLQKFPQYKGRDLYIAGES  185

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA++M+++NKK  I  F LK IALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  186   YAGHYIPQLAEVMVEFNKKDKI--FNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDGT  243

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN +R + E   G +S  C  V      E    +D  D+ L +CLSS      
Sbjct  244   YRVFTSVCNYSRYVAEYYGGALSPLCARVMNQVTRETSRFVDKYDVTLDVCLSS------  297

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ ++T   +   R+   D C+ D    YL R +VQ A+HA    +   W  CS  L
Sbjct  298   VLSQSKVLTPHQQAGNRI---DVCVEDETVRYLNRRDVQAAMHARLVGVD-KWAVCSSVL  353

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LA ++ L     +
Sbjct  354   EYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLAHDMGLKTTTPY  413

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +GG         L+FA++RGA+HE PF+ P ++L L R+FL+G P
Sbjct  414   RVWFEGQQVGGWTQVYGGGT-------LSFATIRGASHEAPFSQPERSLVLVRSFLQGQP  466

Query  1258  PPRT  1269
              P T
Sbjct  467   LPET  470



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   364 bits (935),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/423 (45%), Positives = 266/423 (63%), Gaps = 31/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAE ++ LS PL LWLNGGPGCSSLG GAF E+GPF+P   G LV+N++SWN E
Sbjct  60    LFFYFAEAE-KDALSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGKG-LVRNQFSWNRE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+PIGVGFSYS  +S Y        A+DNL F+  WF KFP+YRN  L++ GES
Sbjct  118   ANMLYLETPIGVGFSYSTDTSSY-------EARDNLVFLQSWFIKFPEYRNRSLFIVGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LML++NKK+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  171   YAGHYVPQLAELMLQFNKKEKL--FNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDTT  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +  + E   G +S  C  V      E    +D  D+ L +CLSS   Q  
Sbjct  229   YKMFTSVCNYSTYVREYYNGAVSPICSSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTK  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V     +  T+          D C+ D    YL R +VQ A+HA+   +   W  CS  L
Sbjct  289   VLNPQQVTETI----------DVCVEDETVNYLNRKDVQSAMHAHLVGVQ-RWSACSNVL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y+++++    +  + +++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  338   DYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  398   RVWFEKQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLEGGP  449

Query  1258  PPR  1266
              P+
Sbjct  450   LPQ  452



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 268/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+ Q P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +NK SWN 
Sbjct  79    LFYYFVEADKQ-PDRKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNR  137

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  TA+D   F+L+W++KFP +R+ +L+LTGE
Sbjct  138   ASNLLFVESPAGVGWSYSNTSSDY-NSGDASTARDMHTFLLKWYEKFPTFRSRELFLTGE  196

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +A+GNPLL +D    A  E+ WSHG ISD+
Sbjct  197   SYAGHYIPQLAIAILDHNKQSTGFKFNLKGVAIGNPLLRLDHDARATYEYFWSHGMISDE  256

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+       N   N+S EC        + VG  I+  D++L +C  S  +Q+
Sbjct  257   IGLTIMNECDFDYYFSANTH-NLSLECNKAVSQAKQIVGDYINDYDVILDVCYPSIVEQE  315

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     YL  PEVQ+ALHAN T LP+TW  CSG
Sbjct  316   L---------RLRKMATKISVGVDVCMTYERRFYLNLPEVQEALHANRTNLPYTWSMCSG  366

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L+ I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  367   ILNYSDTDWNINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFPITV  426

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  427   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALRLFSSFVHG  478

Query  1252  YPPPRTS  1272
                P T+
Sbjct  479   RRLPNTT  485



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/423 (44%), Positives = 267/423 (63%), Gaps = 23/423 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P+S PL LWLNGGPGCSSLG GAF E+GPF+P     LVKN+YSWN E
Sbjct  65    LFYYFVEAEL-DPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKE  122

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N++YLE+P GVG+SYS  ++ Y   ND  TA DN+ F+  W +KFPQY+  +LY+ GES
Sbjct  123   ANVIYLETPAGVGYSYSADAAYYQGVNDKMTAMDNMVFMQRWLEKFPQYKGRELYIAGES  182

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHYIPQLA++M+++NK + I  F LK +ALGNP+L+     ++ AE+ WSHG ISD  
Sbjct  183   YAGHYIPQLAEVMVEFNKNEKI--FNLKGLALGNPVLEFTTDFNSRAEYFWSHGLISDST  240

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN ++ + E   G++S  C  V      E    +D  D+ L +CL+S   Q M
Sbjct  241   YRIFTSVCNYSQYVSEYYGGSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLASVLSQSM  300

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +      ++    + +R+   D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  301   I------LSPHRHVGQRI---DVCIEDETVNYLNRKDVQEALHAKLIGVK-NWAVCSSVL  350

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             QY++ N+    +  +  ++K  I +L++SGDQD+ IP+T +RT+   LA +L L     +
Sbjct  351   QYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLAHDLGLKTSTPY  410

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA++RGA+HE PF+ P ++L L+RAFL+G P
Sbjct  411   RVWFEGKQVGGWTQVYG--------DMLSFATIRGASHEAPFSQPKRSLVLYRAFLQGRP  462

Query  1258  PPR  1266
              P 
Sbjct  463   LPE  465



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 266/423 (63%), Gaps = 28/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE ++P S PL LWLNGGPGCSS+G GAF EHGPF+P  +  L +N YSWN  
Sbjct  54    LFYYFVEAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKV  112

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS+  S Y +  D  TA+DNL F+  WF KFP+Y N+D ++TGES
Sbjct  113   ANVLYLESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             Y GHY+PQL+ L+++   K N   F LK IA+GNPLL+ +   ++ +E+ WSHG ISD  
Sbjct  173   YGGHYVPQLSQLIVQ--TKTN---FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDST  227

Query  538   LAMKRSICNDTRAILENIQ-GNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
               +   +CN + +I   IQ GN+   C+  N     E+ + ID  D+ L +CLSS  +Q 
Sbjct  228   YEVLTRVCNFS-SIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSSVNQQA  286

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V    N +    KID        C+ D+   YL R +VQKALHAN   +   W  CS  
Sbjct  287   YVL---NQLQETQKIDV-------CIGDKTTTYLNRKQVQKALHANLVGVT-KWSTCSSV  335

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y  QN+    +P L  ++K  I +L++SGDQD+ IP+  +R++ N LA+E+ L     
Sbjct  336   LHYDYQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVA  395

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+AGW++ +G        + L++A++RGA+HE PF+ P ++L L +AFL+G 
Sbjct  396   YRAWFEGKQVAGWTKVYG--------NILSYATIRGASHEAPFSQPQRSLLLLKAFLEGK  447

Query  1255  PPP  1263
             P P
Sbjct  448   PLP  450



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 267/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+  +P S PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  65    LFYYFVEAK-NDPHSKPLTLWLNGGPGCSSMGGGAFTELGPFFPSGDGRGLRRNSMSWNK  123

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  +A+D L F++ WF+KFP++++ DL+LTGE
Sbjct  124   ASNLLFVESPAGVGWSYSNTSSDY-NTGDAASAKDMLTFLVNWFEKFPEFKSRDLFLTGE  182

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +N        KLK +A+GNPLL +D  + A  E+ WSHG ISD+
Sbjct  183   SYAGHYIPQLAVAVLDHNAHSRASKMKLKGVAIGNPLLKLDRDVPATYEYFWSHGMISDE  242

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+       +   N S+ C          VG  I++ D++L +C  S  +Q+
Sbjct  243   IGLSIMNQCDFEDYTFASPH-NESDSCNNAISQANSIVGDYINNYDVILDVCYPSIVEQE  301

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     Y   PEVQKALHAN T LP+ W  CS 
Sbjct  302   L---------RLKKMATKMSLGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEWSMCSS  352

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   + + +++P L +IL HHIPI +FSGDQD+ +P+  +RT+   LA +LK  A  
Sbjct  353   ILNYSDNDGSLDMLPLLKKILSHHIPIWVFSGDQDSVVPLLGSRTLVRELAHDLKFKATV  412

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+T PS+AL LF +F++G
Sbjct  413   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYTQPSRALHLFSSFIRG  464

Query  1252  YPPPRTS  1272
                P T+
Sbjct  465   RRLPSTT  471



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 267/423 (63%), Gaps = 24/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P  D  LV+N YSWN E
Sbjct  64    LFYYFVEAET-DPASKPLVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-ILVRNDYSWNRE  121

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P GVGFSYS  SS Y N ND  TA DNL F+  WF KFPQYR+ DL++TGES
Sbjct  122   ANMLYLETPAGVGFSYSTNSSYYSNVNDEMTAMDNLIFLQRWFIKFPQYRDRDLFITGES  181

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA LM+++N+K+ +  F LK IALGNPLL+     +A AEF+WSHG ISD  
Sbjct  182   YAGHYVPQLALLMIQFNEKEKL--FNLKGIALGNPLLEFATDFNARAEFMWSHGLISDPT  239

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN ++   E+ +G++S  C+ V     +E+   +D  D+ L ICLSS  +Q  
Sbjct  240   YGIFTSSCNYSQYKSESYRGSVSPICLGVISQVEKEISKYVDQYDVTLDICLSSIVQQTK  299

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
                R  +V  +          D C+ D  +AYL R +VQKALHA    +   W+ CS  L
Sbjct  300   SLTRPQIVENI----------DVCVGDETFAYLNRADVQKALHARLLGVK-GWEVCSEVL  348

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M N+    +  +  +++  + +L++SGDQD+ IP+T +R + + LA EL L     +
Sbjct  349   NYDMLNLEVPTIHVVGSVIRSGVRVLVYSGDQDSVIPLTGSRMLVHRLANELGLNTTIAY  408

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+   Q+ GW+Q +           L+FA++RGA+HE PF+ P ++L LF+AFL+  P
Sbjct  409   RVWFQDKQVGGWTQVYS--------DILSFATIRGASHEAPFSQPERSLLLFKAFLEDKP  460

Query  1258  PPR  1266
              P 
Sbjct  461   LPE  463



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   364 bits (934),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 266/423 (63%), Gaps = 28/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE ++P S PL LWLNGGPGCSS+G GAF EHGPF+P  +  L +N YSWN  
Sbjct  63    LFYYFVEAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKV  121

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS+  S Y +  D  TA+DNL F+  WF KFP+Y N+D ++TGES
Sbjct  122   ANVLYLESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGES  181

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             Y GHY+PQL+ L+++   K N   F LK IA+GNPLL+ +   ++ +E+ WSHG ISD  
Sbjct  182   YGGHYVPQLSQLIVQ--TKTN---FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQ-GNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
               +   +CN + +I   IQ GN+   C+  N     E+ + ID  D+ L +CLSS  +Q 
Sbjct  237   YEVLTRVCNFS-SIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSSVNQQA  295

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V    N +    KID        C+ D+   YL R +VQKALHAN   +   W  CS  
Sbjct  296   YVL---NQLQETQKIDV-------CIGDKTTTYLNRKQVQKALHANLVGVT-KWSTCSSV  344

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y  QN+    +P L  ++K  I +L++SGDQD+ IP+  +R++ N LA+E+ L     
Sbjct  345   LHYDYQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVA  404

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+AGW++ +G        + L++A++RGA+HE PF+ P ++L L +AFL+G 
Sbjct  405   YRAWFEGKQVAGWTKVYG--------NILSYATIRGASHEAPFSQPQRSLLLLKAFLEGK  456

Query  1255  PPP  1263
             P P
Sbjct  457   PLP  459



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score =   363 bits (933),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 266/423 (63%), Gaps = 27/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYY  EAE  +P++ PL LWLNGGPGCSSLG GAF E+GPF+P +   LVKN++SWN E
Sbjct  58    LFYYLAEAET-DPINKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS   + Y + ND  TA+DNL F+  WF KFP Y N  L++TGES
Sbjct  116   ANMLYLETPVGVGFSYS---TQYESVNDEITARDNLVFLQRWFLKFPHYLNRSLFITGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++YN+K ++  F L+ IA+GNP+L+     ++ AE+ WSHG ISD  
Sbjct  173   YAGHYVPQLAELMIQYNQKHHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S CN +R + E  +G+MS+ C  V      E    +D  D+ L +C+ S   Q  
Sbjct  231   YKMFTSYCNYSRYVSEYYRGSMSSICAKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSK  290

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V   N +  ++          D C+ D    YL R +VQ+ALHA    +   W  CS  L
Sbjct  291   VVSPNQVGESV----------DVCVEDETVKYLNRRDVQEALHARLVGVR-EWTVCSNVL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ ++    +  +  +++  +P+L++SGDQD+ IP+T +RT+ + LA+ L L     +
Sbjct  340   DYQLLDVEIPTINIVGSLVQAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA+VRGA+HEVPF+ P ++L LF+AFL  +P
Sbjct  400   RVWFAGQQVGGWTQVYG--------NVLSFATVRGASHEVPFSQPQRSLVLFKAFLDSHP  451

Query  1258  PPR  1266
              P 
Sbjct  452   LPE  454



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   364 bits (935),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/434 (45%), Positives = 269/434 (62%), Gaps = 24/434 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE + P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  67    LFYYFVEAEVE-PHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNK  125

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY N  D  TA+D   F++ W++KFP++++ +L+LTGE
Sbjct  126   ASNLLFVESPAGVGWSYSNTTSDY-NCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGE  184

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLAD++L +N       F +K +A+GNPLL +D  + A  EF WSHG ISD+
Sbjct  185   SYAGHYIPQLADVLLHHNAHSKGFKFNIKGVAIGNPLLRLDQDVSATYEFFWSHGMISDE  244

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     S C D    +     NM+N CI       + VG  I++ D++L +C  +  +Q+
Sbjct  245   IGLTIMSDC-DFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPAIVEQE  303

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T   + YL  PEVQKALHAN T LP+ W  CS 
Sbjct  304   L---------RLRKMATKMSVGVDVCMTYERFFYLNLPEVQKALHANRTNLPYGWSMCSR  354

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L  I+++ IP+ +FSGDQD+ +P+  +RT+   LAR+L      
Sbjct  355   VLNYSDADSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTV  414

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTF +VRGAAH VP+  PS+AL LF +F+ G
Sbjct  415   PYGAWFHKQQVGGWATEYG--------NILTFVTVRGAAHMVPYAQPSRALHLFSSFVHG  466

Query  1252  YPPPRTS*GPLLED  1293
                P  +  P ++D
Sbjct  467   RRLPNNT-RPAIQD  479



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score =   364 bits (934),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 262/433 (61%), Gaps = 31/433 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF EHGPF+P   G+LV+N YSWN E
Sbjct  59    LFYYFVEAET-DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   NDT T QDN  F+  WF+KFP+Y+N DL++TGES
Sbjct  118   ANMLYLESPAGVGFSYSANQSFYDLVNDTITVQDNFVFLQNWFQKFPEYKNRDLFITGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLADL++K   K     F LK IALGNPLL+     ++  +F WSHG IS+  
Sbjct  178   YAGHYVPQLADLIVKSGLK-----FNLKGIALGNPLLEFGTDFNSEGDFYWSHGLISNPT  232

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN ++   E I  ++S  C  VN     E+   ID  D+   +CLS  A   +
Sbjct  233   YELLSAVCNTSQLWRERIGNSLSASCSKVNDQLHAEISYAIDKYDVTANVCLSFGAS--L  290

Query  718   VFFRNNLVTTLTKI-------------DKRVAAGDPCLTDRIYAYLQRPEVQKALHANTT  858
             +  +NN +T   ++              K     DPC+ +  + YL R +VQ++ HA   
Sbjct  291   LGVQNNPLTPRFRLFSSAESLQEALSQQKAQENIDPCVQEETFVYLNRKDVQESFHAKLV  350

Query  859   YLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANM  1038
               P  W FCSG + Y ++N+    +  +  ++   + +L++SGDQD+ IP T +RT+   
Sbjct  351   GTP-KWTFCSGVVNYDLRNLEIPTIDVVGSLVTSGVRVLVYSGDQDSVIPFTGSRTLVEG  409

Query  1039  LARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQ  1218
             LA++L L A   +  W++  Q+ GW+Q +G          LTF+++RG +H  PF+SP +
Sbjct  410   LAKKLGLNATVPYTAWFEDKQVGGWTQVYG--------DILTFSTIRGGSHMAPFSSPGR  461

Query  1219  ALTLFRAFLKGYP  1257
             +L LF AFL G P
Sbjct  462   SLALFAAFLSGKP  474



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   364 bits (934),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 198/434 (46%), Positives = 267/434 (62%), Gaps = 24/434 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE   P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L  N  SWN 
Sbjct  61    LFYYFVEAE-NVPDKKPLTLWLNGGPGCSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNK  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY N  D+ TA D L F+L+W++KFP YR+ +L+LTGE
Sbjct  120   ASNLLFVESPAGVGWSYSNTTSDY-NSGDSSTATDMLLFLLKWYQKFPSYRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L YN       F +K +A+GNPLL +D    A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLANVLLDYNVHSTSFKFNIKGVAIGNPLLKLDRDAQATYEYFWSHGMISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  +   NMS  C        E VG  I++ D++  +C  S  +Q+
Sbjct  239   IGLAITNDCDFDDYVFASAH-NMSKSCNEAINEANEIVGDYINNYDVIFDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L KI  +++ G D C+T     Y   PEVQKALHAN T LP+ W  CSG
Sbjct  298   L---------RLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQWSMCSG  348

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L +I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  349   VLNYSDTDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITV  408

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  409   PYGAWFHKGQVGGWVTEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  460

Query  1252  YPPPRTS*GPLLED  1293
                P T+  P ++D
Sbjct  461   RRLPNTT-SPSIDD  473



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   363 bits (931),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 263/425 (62%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE  +P+  PL +WLNGGPGCSSLG GAF E+GPF+P   GN LVKN YSWN 
Sbjct  59    LFYYFAEAET-DPVLKPLVIWLNGGPGCSSLGVGAFSENGPFRP--SGNVLVKNHYSWNR  115

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLY+E+P GVGFSYS   S Y   +D KTA+DNL F+  WF KFP+YR  DL++TGE
Sbjct  116   EANMLYIETPAGVGFSYSTDISFYEGVDDEKTARDNLVFLKRWFIKFPEYRTRDLFITGE  175

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA+LM++ NK + +  F LK IALGNPLLD     ++ AEF WSHG ISD 
Sbjct  176   SYAGHYIPQLAELMIEANKGEKL--FNLKGIALGNPLLDFSTDFNSRAEFFWSHGLISDP  233

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +  S CN +R + E  + N+S  C  V      E    +D  D+ L +C+SS   Q 
Sbjct  234   AYRIFTSSCNYSRYVSEYYRENVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSILMQS  293

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                    +   +          D C+ D    YL R +VQ+ALHA  +    TW  CS +
Sbjct  294   KALRPMQVSEPI----------DVCVEDETVNYLNRKDVQRALHARLSG-DETWSVCS-S  341

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             + Y   N+    +  L  ++K  IP+L++SGDQD+ IP+T +RT+ + LA +L L     
Sbjct  342   MNYNRLNLEIPTISLLGLVVKSGIPVLVYSGDQDSVIPLTGSRTLVHGLAAKLHLNTTVP  401

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LFRAFL+G 
Sbjct  402   YRVWFEGEQVGGWTQVYG--------NILSFATIRGASHEAPFSQPQRSLGLFRAFLQGR  453

Query  1255  PPPRT  1269
             P P T
Sbjct  454   PLPET  458



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   363 bits (931),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 190/426 (45%), Positives = 266/426 (62%), Gaps = 20/426 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE +   S PLTLWLNGGPGCSS+G GAF E GPF P   G  L+ N+ +WN 
Sbjct  56    LFYYFAEAETRAS-SQPLTLWLNGGPGCSSIGGGAFTELGPFYPNASGQGLLVNRRAWNK  114

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SNML+LE+P GVG+SYSN SSDY    D  TA D L F+L W  KFP+Y+  D Y+TGE
Sbjct  115   VSNMLFLEAPAGVGWSYSNKSSDYEQVTDRITAVDTLNFLLGWMDKFPEYQTRDFYITGE  174

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHY+PQLA+L++K+++     AF+LK +A+GNPLL++ +   A  E+ WSHG ISD+
Sbjct  175   SYAGHYVPQLAELIIKHSQVPGNYAFRLKGVAIGNPLLNLAVDTSAMYEYFWSHGLISDE  234

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   + C      L     N+SN C      +  EVG  I++ D++L +CL S     
Sbjct  235   TFQALSNSCKFEDYELGLADHNVSNACNDGILQSNTEVGRFINNYDVILDVCLPS-----  289

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              +F +   V    ++ ++    D C+      Y   PEVQ+ LHANTT LP++W  C+G 
Sbjct  290   -IFLQE--VRLKQQMAQKSYGVDICIDKERDVYFNLPEVQRELHANTTGLPYSWSMCTGP  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             + Y MQ+ ++N++P L +ILK  + + +FSGDQD+ +P+T TR++   LA+ L +   + 
Sbjct  347   VDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLGMQTTQP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  WY G Q+AGW+QS+G          LT+A++RGAAH VP+  P +AL LFR+F++G 
Sbjct  407   YTAWYQGGQVAGWTQSYGN---------LTYATIRGAAHMVPYAQPERALLLFRSFIRGN  457

Query  1255  PPPRTS  1272
               P  S
Sbjct  458   ALPIKS  463



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   362 bits (930),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 272/424 (64%), Gaps = 24/424 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +  S PL LWLNGGPGCSSLG GAF E+GPF+P   G LV+N++SWN E
Sbjct  53    LFYYFVEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQG-LVRNEHSWNRE  110

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLE+P+GVGFS+++ SS Y   +D  TA+DNL F+  WF +FPQYR+ +L++TGES
Sbjct  111   ANVLYLETPVGVGFSFADDSSSYDAVSDAITARDNLVFLQRWFLQFPQYRDRNLFITGES  170

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM+++NKK+ +  F LK IALGNP+L+    +++ AE+ WSHG ISD  
Sbjct  171   YAGHYVPQLAELMIQFNKKEKL--FNLKGIALGNPVLEYATDLNSRAEYFWSHGLISDST  228

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  +  +S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  229   YKLFTSFCNYSRYVSEYYRDAVSPICSKVMSQVSRETSRFVDKYDVTLDVCISSVLSQSR  288

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +        +  +  +R+   D C+ D    YL R +VQKALHA    +   W  CS  L
Sbjct  289   II-------SPQQNAERI---DVCIEDETVNYLNRQDVQKALHARLVGVR-RWLVCSDIL  337

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              YQ+ +I    +  +  ++K  I +L++SGDQD+ IP+T +R++ + LA++L+L A   +
Sbjct  338   DYQLLDIEIPTISIVGSLIKEGITVLVYSGDQDSVIPLTGSRSLVHGLAKQLRLNATTPY  397

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G P
Sbjct  398   RVWFAGQQVGGWTQVYG--------NLLSFATIRGASHEAPFSQPERSLVLFKSFLEGRP  449

Query  1258  PPRT  1269
              P  
Sbjct  450   LPEV  453



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score =   364 bits (935),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 198/441 (45%), Positives = 266/441 (60%), Gaps = 43/441 (10%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  NP S PL LW+NGGPGCSS+G GAF EHGPF+P    NLV+N+YSWN E
Sbjct  101   LFYYFVEAET-NPASKPLVLWVNGGPGCSSIGTGAFSEHGPFRPS-GKNLVRNEYSWNKE  158

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKT---------AQDN-------LRFVLEWFK  312
             +NMLYLE+P GVGFSYS  +S Y+  ND  T         AQ +       LR    W  
Sbjct  159   ANMLYLETPAGVGFSYSTNTSYYYGVNDEMTGPGKNYSIEAQKSYSYTSWFLRTSSRWLD  218

Query  313   KFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISID  492
             KFP+++N DL++TGESYAGHY+PQLA LM+++N +K    F LK IALGNPLL+     +
Sbjct  219   KFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQK---LFNLKGIALGNPLLEFTTDFN  275

Query  493   A-AEFLWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSS  669
             + AEFLWSHG ISD       S CN +R + +  +G++S+ C+ V      E+   ID  
Sbjct  276   SRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVVSLVNREISRFIDEY  335

Query  670   DLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHA  849
             D+ L +C+SS   Q                 K V + D C+ D  Y YL R +VQK+LHA
Sbjct  336   DVTLSVCVSSILSQSKAL----------TPQKVVESTDVCVEDETYNYLNRDDVQKSLHA  385

Query  850   NTTYLPWTWDFCSG--TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTR  1023
             +   +   W  C+    ++Y M N+  + +P LS + +  I IL++SGDQD+ IP+T TR
Sbjct  386   HLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPLTGTR  444

Query  1024  TIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPF  1203
             T+ + LA EL L     +  W++G Q+ GW+Q +G          LTFA++RG +HE PF
Sbjct  445   TLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYG--------DILTFATIRGGSHEAPF  496

Query  1204  TSPSQALTLFRAFLKGYPPPR  1266
             + P ++L LF +FLKG P P 
Sbjct  497   SQPQRSLVLFNSFLKGKPLPE  517



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   363 bits (931),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 192/427 (45%), Positives = 266/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE + P   PLTLWLNGGPGCSS+G G+F E GPF P  DG  L +N  SWN 
Sbjct  58    LFYYFVEAEGE-PEKKPLTLWLNGGPGCSSVGGGSFTELGPFFPRGDGRGLQRNTKSWNK  116

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY    D  TA+D   F L+WF+K+P+Y++ DL+LTGE
Sbjct  117   ASNLLFVESPAGVGWSYSNTTSDY-TCGDASTARDMHIFFLKWFEKYPEYKSRDLFLTGE  175

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L +NK      F +K +A+GNPLL +D  I A  EF WSHG ISD+
Sbjct  176   SYAGHYIPQLANVLLDHNKHSRGFKFNIKGVAIGNPLLKLDRDIPATYEFFWSHGMISDE  235

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  +   N+S+ C        + VG  I+  D++L +C  S  +Q+
Sbjct  236   IGLTITNECDFDDYVFSSPH-NVSHSCNKAIAEANQVVGDYINPYDVILDVCYPSIVEQE  294

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C++     Y   P VQ+ALHAN T LP++W  CS 
Sbjct  295   L---------RLRKLATKISIGVDVCMSYERRFYFNLPSVQQALHANRTKLPYSWTMCSD  345

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L  I+KHHIP+ +FSGDQD+ +P+  +RT+   LAR+L      
Sbjct  346   LLNYSGTDGNINILPILKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELARDLNFKVTV  405

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F++G
Sbjct  406   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFIRG  457

Query  1252  YPPPRTS  1272
                P T+
Sbjct  458   RRLPNTT  464



>gb|KDP37690.1| hypothetical protein JCGZ_06347 [Jatropha curcas]
Length=467

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 261/424 (62%), Gaps = 28/424 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  N  S PL LWLNGGPGCSS+G GAF EHGPF+P  D  L+KN +SWN E
Sbjct  60    LFYYFVEAEI-NSASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-ILLKNDFSWNKE  117

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + ND  TAQDNL F+  WF KFP+Y++ D ++TGES
Sbjct  118   ANMLYLESPAGVGFSYSANDSFYASVNDEITAQDNLAFLEHWFSKFPEYKDRDFFITGES  177

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY PQLA L+++ N K N     LK IA+GNPLL+ D   ++ AE+ WSHG ISD  
Sbjct  178   YAGHYAPQLAQLIVQSNAKIN-----LKGIAIGNPLLEFDTDFNSRAEYFWSHGLISDAT  232

Query  538   LAMKRSICNDTRAILE-NIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
               +  +ICN ++   E    G +S  C  VN     EV   +D+ D+ L +CLSS   Q 
Sbjct  233   YQIFTTICNYSQIRREYEASGFLSPACSKVNSEVSREVSKFVDTYDITLDVCLSSVQSQA  292

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              +  +      +          D C+ D+   YL R +VQ+ALHA    +   W  C+  
Sbjct  293   HLLNQMEYAGQI----------DVCVEDKTVKYLNRKDVQEALHAQLLGVN-AWTVCTDV  341

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             ++Y  QN+    +P + +++K  I + ++SGDQD+ IP+T TR++ N LA++L L     
Sbjct  342   VKYNTQNLEIPTIPIIGKLVKSGIRVFVYSGDQDSVIPLTGTRSLVNGLAKQLGLNTTVP  401

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+AGW+Q +G          L+FA++RGA+HE PF+ P ++L LF +FL+G 
Sbjct  402   YRTWFEGKQVAGWTQVYG--------DILSFATIRGASHEAPFSQPERSLVLFSSFLEGK  453

Query  1255  PPPR  1266
               P 
Sbjct  454   QLPE  457



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/427 (45%), Positives = 264/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE + P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  57    LFYYFVEAEGE-PEKKPLTLWLNGGPGCSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNK  115

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY    D  +A+D   F+++WF+K+P+Y++ DL+LTGE
Sbjct  116   ASNLLFVESPAGVGWSYSNTTSDY-TCGDASSARDMHMFLMKWFQKYPEYKSRDLFLTGE  174

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L YN+      F +K +A+GNPLL +D  I A  EF WSHG ISD+
Sbjct  175   SYAGHYIPQLANVLLDYNEHSTDFKFNIKGVAIGNPLLKLDRDIPATYEFFWSHGMISDE  234

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + CN    +  N   N+S  C        + VG  I++ D++L +C  S  +Q+
Sbjct  235   IGLTIMNECNFDDYVFSNSH-NVSQSCNQAIAGANQVVGDYINNYDVILDVCYPSIVEQE  293

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C++     Y   P VQ+ALHAN T LP+ W  CS 
Sbjct  294   L---------RLRKLATKISIGVDVCMSYERRFYFNLPRVQQALHANRTNLPYGWSMCSN  344

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L  I+KHHIP+ +FSGDQD+ +P+  +RT+   LA +L      
Sbjct  345   ILNYNETDGNISILPLLKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFEVTV  404

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  405   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  456

Query  1252  YPPPRTS  1272
                P T+
Sbjct  457   RRLPNTT  463



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 190/422 (45%), Positives = 265/422 (63%), Gaps = 24/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF E+GPF+P  +  L++N+YSWN E
Sbjct  56    LFYYFVEAEI-DPPSKPLVLWLNGGPGCSSIGVGAFSENGPFRPNVE-VLLRNEYSWNRE  113

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYL++P+GVGFSYS  +S Y   ND  TA+DNL F+ +WF  FPQYRNS L++TGES
Sbjct  114   ANMLYLDTPVGVGFSYSTGASSYETVNDEITAKDNLVFLQKWFLDFPQYRNSSLFITGES  173

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+L+++ NKKK I    L  IALGNPLL+     ++ AE+ WSHG ISD  
Sbjct  174   YAGHYVPQLANLIIQLNKKKKI--INLTGIALGNPLLEFSTDYNSRAEYFWSHGLISDST  231

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E  + ++S  C  V      E    +D  D+ L +C+ S   Q  
Sbjct  232   YNVFTSGCNYSRYVSEYYRDSVSVLCSRVMSLVNRESSRFVDKYDVTLDVCIPSVLSQSK  291

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +   +       +  +R+   D C+ D I  YL R +VQ ALHA    +   WD CS  L
Sbjct  292   IIAPH-------QNSERI---DVCVEDEITKYLNRRDVQMALHARLVGVR-KWDVCSNIL  340

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y M ++    +  +  ++K  IP+L++SGDQD+ IP+T TRT+ + LA++L L     +
Sbjct  341   DYDMLDLEIPTISIIGSLVKEGIPVLIYSGDQDSVIPLTGTRTLVHKLAKQLGLNTTVTY  400

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+F +VRGA+HE PF+ P ++  LF++FL G P
Sbjct  401   RVWFEGQQVGGWTQVYG--------NILSFGTVRGASHEAPFSQPERSFVLFKSFLSGKP  452

Query  1258  PP  1263
              P
Sbjct  453   LP  454



>ref|XP_011040750.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=499

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/435 (44%), Positives = 264/435 (61%), Gaps = 29/435 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE+ +P S PL LWLNGGPGCSS+G GAF+EHGPF+P    NLV+N+YSWN E
Sbjct  78    LFYYFVEAES-SPASKPLVLWLNGGPGCSSVGAGAFVEHGPFRPTTGNNLVRNEYSWNKE  136

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS   + Y   ND  TA+DNL F+  WF KFPQY+  D ++ GES
Sbjct  137   ANLLYLESPAGVGFSYSANQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGES  196

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAE-FLWSHGAISDDL  537
             YAGHY+PQLA L+++   K N   F LK IA+GNPLLD D  ++A + F WSHG ISD  
Sbjct  197   YAGHYVPQLARLIIR--SKVN---FNLKGIAIGNPLLDFDTDLNAQDHFYWSHGLISDST  251

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN+++ + E I   +S+ C+ V     +E+   +D  D+   ICLSSN  Q  
Sbjct  252   YQLLTSVCNNSKLMREAITSTVSSACLGVYTLVQKELSESVDPYDVTGDICLSSNQSQLK  311

Query  718   VFFRNNLVTTLTKIDKRV-------------AAGDPCLTDRIYAYLQRPEVQKALHANTT  858
             +F +  L + L  +  +V                D CL +    YL R +VQ ALHA   
Sbjct  312   IFNQQLLRSRLPYLSPQVLEMDSVKQQQQVMGTVDVCLLEETTKYLNRKDVQMALHARLV  371

Query  859   YLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANM  1038
              +   W  CS  L+Y   N     +  +  ++K  + +L++SGDQD+ IP T TR++ + 
Sbjct  372   GVT-NWHVCSVVLEYDRSNEERPTIHVVRSLVKSGLKVLVYSGDQDSVIPFTGTRSLVSK  430

Query  1039  LARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQ  1218
             LA++L+L     +  W  G Q+ GW+Q +G +        L+FA++RGA+H  P T P +
Sbjct  431   LAKDLRLKTTVPYRAWLSGNQVGGWTQVYGDN--------LSFATIRGASHTAPSTQPKR  482

Query  1219  ALTLFRAFLKGYPPP  1263
             +L LF+AFL+  P P
Sbjct  483   SLLLFKAFLEKKPLP  497



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   362 bits (929),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 267/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYF EA+ Q P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L  NK SWN 
Sbjct  62    LFYYFAEADKQ-PDKKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRTNKMSWNR  120

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N  D  TA+D   F+L+W++KFP +R+ +L+LTGE
Sbjct  121   ASNLLFVESPAGVGWSYSNTSSDY-NSGDASTARDMHTFLLKWYEKFPTFRSRELFLTGE  179

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDI-SIDAAEFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +A+GNPLL +D  ++   E+ WSHG ISD+
Sbjct  180   SYAGHYIPQLAVAILDHNKQSTGFKFNLKGVAIGNPLLRLDRDALATYEYFWSHGMISDE  239

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  N   N+S EC        + VG  I++ D++L +C  S  +Q+
Sbjct  240   IGLTITNECDFDDYVSANTH-NLSLECNEAISQANQIVGDYINNYDVILDVCYPSIVEQE  298

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     YL  PEVQKALHAN T L +TW  CSG
Sbjct  299   L---------KLRKMATKISVGVDVCMTYERRFYLNLPEVQKALHANRTNLAYTWSMCSG  349

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L+ I+++HIP+ +FSGDQD+ +P   +RT+   LA +LK     
Sbjct  350   VLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPFLGSRTLIRELAHDLKFPITV  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  410   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  461

Query  1252  YPPPRTS  1272
                P T+
Sbjct  462   RRLPNTT  468



>ref|XP_004152156.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004169817.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN52977.1| hypothetical protein Csa_4G008800 [Cucumis sativus]
Length=456

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/423 (43%), Positives = 265/423 (63%), Gaps = 26/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EA+  +P S PL LWLNGGPGCSSLG GAF E+GPF+P R   LV+N++SWN E
Sbjct  57    LFYYFAEAQV-DPPSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-RGEVLVRNEHSWNTE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  +S Y    D  TA+DNL F+ +WF +FP YRN  L++TGES
Sbjct  115   ANMLYLETPVGVGFSYSTDTSSYEAVGDKITARDNLEFLEKWFVRFPHYRNRSLFITGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++ NK     +F L+ IA+GNP+L+     ++ AEFLWSHG ISD  
Sbjct  175   YAGHYVPQLAELMVQSNKT----SFNLRGIAIGNPVLEFATDFNSRAEFLWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V     +E    +D  D+ L +C+SS   Q  
Sbjct  231   FKMFTSMCNYSRYVGEYYRGSVSPICSRVMSQVSKETSRFVDKYDVTLDVCISSVFSQSK  290

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +     +  ++          D C+ D    YL R +V KALHA    +   W  CS  L
Sbjct  291   ILNPQQVTESV----------DVCVEDETVNYLNRQDVHKALHARLVGVR-RWAVCSSIL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++   I +L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  340   DYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIPLTGSRTLVHKLAKELGLQTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+  P
Sbjct  400   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLQSQP  451

Query  1258  PPR  1266
              P 
Sbjct  452   LPE  454



>ref|XP_006380972.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58769.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=467

 Score =   362 bits (928),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/424 (44%), Positives = 262/424 (62%), Gaps = 18/424 (4%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF+EHGPF+P    NLV+N+YSWN E
Sbjct  57    LFYYFVEAET-SPASKPLVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   + Y   ND  TA+DNL F+  WF KFPQY+  D ++ GES
Sbjct  116   ANMLYLESPAGVGFSYSANQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAE-FLWSHGAISDDL  537
             YAGHY+PQLA L+++   K N   F LK IA+GNPLL+ +  ++A + F WSHG ISD  
Sbjct  176   YAGHYVPQLAQLIIR--SKVN---FNLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN ++ + E + G +S+ C+ V     +E+   ID  D+   ICLSSN  Q  
Sbjct  231   YQLLTSVCNSSKLMREALTGTVSSACLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLK  290

Query  718   VFFRNNLVTTLTKIDKRVAAG--DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +F +  L + L  +  +   G  D CL +    YL R +VQ ALHA    +   W  CS 
Sbjct  291   IFHQQLLRSRLPYLSPQQVMGKVDVCLLEETTNYLNRKDVQMALHARLVGVT-NWHVCSV  349

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L+Y   N     +  +  ++K  + +L++SGDQD+ I  T TR++ + +A++L+L    
Sbjct  350   VLEYDRSNEERPTIHVVRSLVKSGLAVLVYSGDQDSIIAFTGTRSLVSKIAKDLRLKTTV  409

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W  G Q+ GW+Q +G +        L+FA++RGA+H  P T P ++L LF++FL+ 
Sbjct  410   PYRAWLSGNQVGGWTQVYGDN--------LSFATIRGASHTAPSTQPKRSLLLFKSFLEK  461

Query  1252  YPPP  1263
              P P
Sbjct  462   KPLP  465



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/428 (46%), Positives = 268/428 (63%), Gaps = 38/428 (9%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +P S PL LWLNGGPGCSS+G GAF E+GPFQP  D NL+KN +SWN E
Sbjct  63    LFYYFVEAQT-DPASKPLVLWLNGGPGCSSIGVGAFNENGPFQPSED-NLLKNDFSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TAQDNL F+  WF +FP+Y+N DL++TGES
Sbjct  121   ANMLYLESPAGVGFSYSANKSFYGFVNDDITAQDNLEFLQRWFDEFPEYKNRDLFITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LKA+A+GNPL +    I++ AE+LWSHG ISD  
Sbjct  181   YAGHYVPQLAQLIIQSKLK-----FNLKAVAIGNPLFEFSTDINSRAEYLWSHGLISDAT  235

Query  538   LAMKRSICNDTRAILENI--QGNMSNECILVNGATGEEV-GSDIDSSDLLLPICLSSNAK  708
                  S+CN +    + +   G +S  C  V      EV G  I+  D+ L +CLSS   
Sbjct  236   FENLTSVCNYSEIFRQEVIRGGPLSPACDEVANQFEREVPGHLINQYDVTLDVCLSSVEA  295

Query  709   QQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             Q             +++ K V   D C+ D I  YL RP++Q+ALHA  T     W  CS
Sbjct  296   QS------------SQLRKTVKI-DVCIGDEIVTYLNRPDLQEALHARLT----NWTTCS  338

Query  889   --GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLI  1062
               G L+Y M+N+   ++P L +++K  I +L++SGDQD+ IP+T TRT+ + LA++L L 
Sbjct  339   NGGVLEYDMKNLEIPMLPVLGDLVKSGIRVLIYSGDQDSVIPLTSTRTLVSGLAKDLGLQ  398

Query  1063  AFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAF  1242
                 +  W++  Q+AGW+Q +  +        L++A++RGA HE P + P ++L LF +F
Sbjct  399   TNVPYRVWFEEKQVAGWTQVYSDA--------LSYATIRGAGHEAPISQPERSLLLFTSF  450

Query  1243  LKGYPPPR  1266
             L+G P P+
Sbjct  451   LRGKPLPK  458



>ref|XP_008454133.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=456

 Score =   361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/423 (43%), Positives = 265/423 (63%), Gaps = 26/423 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EA+  +P S PL LWLNGGPGCSSLG GAF E+GPF+P R   LV+N++SWN E
Sbjct  57    LFYYFAEAQV-DPPSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-RGEVLVRNEHSWNTE  114

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLE+P+GVGFSYS  +S Y    D  TA+DNL F+ +WF +FP YRN  L++TGES
Sbjct  115   ANMLYLETPVGVGFSYSTDTSSYEAVGDKITARDNLEFLEKWFVRFPHYRNRSLFITGES  174

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA+LM++ NK     +F L+ IA+GNP+L+     ++ AEFLWSHG ISD  
Sbjct  175   YAGHYVPQLAELMVQSNKT----SFNLRGIAIGNPVLEFATDFNSRAEFLWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               M  S+CN +R + E  +G++S  C  V     +E    +D  D+ L +C+SS   Q  
Sbjct  231   FKMFTSMCNYSRYVGEYYRGSVSPICSRVMSQVSKETSRFVDKYDVTLDVCISSVFSQSK  290

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +     +  ++          D C+ D    YL R +V KALHA    +   W  CS  L
Sbjct  291   ILNPQQVTESV----------DVCVEDETVNYLNRQDVHKALHARLVGVR-RWAVCSSIL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y++ ++    +  + +++   I +L++SGDQD+ IP+T +RT+ + LA+EL L     +
Sbjct  340   DYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIPLTGSRTLVHKLAKELGLQTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+  P
Sbjct  400   RVWFEGQQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLVLFKSFLQSQP  451

Query  1258  PPR  1266
              P 
Sbjct  452   LPE  454



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   362 bits (929),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 203/435 (47%), Positives = 269/435 (62%), Gaps = 24/435 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q P S PLTLWLNGGPGCSS+G GAF E GPF P  DG  L KN  SWN 
Sbjct  66    LFYYFVEAENQ-PHSKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRKNSKSWNK  124

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY N +D  TA+D L F+L WFKKFP+++   L+L+GE
Sbjct  125   ASNLLFVESPAGVGWSYSNTSSDY-NTDDATTAKDMLVFMLRWFKKFPEFKTRQLFLSGE  183

Query  358   SYAGHYIPQLADLMLKYN-KKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHY+PQLAD++L+YN ++ N   F LK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  184   SYAGHYVPQLADIILQYNARRSNEFKFNLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  243

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + C D      +   N+S  C       G  +   ++  D+LL +C  S  +Q
Sbjct  244   ELGLTIMNQC-DFEDYSFSSSHNISKSCEAAMSEAGTIITRFVNYYDVLLDVCYPSLFEQ  302

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQKALHAN T L + W  CS
Sbjct  303   EL---------RLKKMGTKMSVGVDVCISYEEQLYLTLPEVQKALHANRTQLTYPWSMCS  353

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +  +NI+P L  I+K  IP+ +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  354   GLLNYNNTDGNTNILPILKRIVKSKIPVWVFSGDEDSVIPLLGSRTLIRELADDLNFNTT  413

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  414   VPYGAWFHKGQVGGWAIEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFTSFVL  465

Query  1249  GYPPPRTS*GPLLED  1293
             G   P  +  P +ED
Sbjct  466   GRRLPNKTPPPPIED  480



>ref|XP_009355272.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Pyrus 
x bretschneideri]
Length=461

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 264/426 (62%), Gaps = 36/426 (8%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  NP S PL LWLNGGPGCSS+G GAF E+GPFQP  D  L+KN +SWN E
Sbjct  63    LFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNRE  120

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS   S Y   ND  TA+DN+ F+  WF +FP Y+N D ++TGES
Sbjct  121   ANILYLESPAGVGFSYSANKSFYGFVNDDITARDNIEFLQRWFDEFPAYKNRDFFITGES  180

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LKAIA+GNPLL+ +   +A AE+LWSHG ISD  
Sbjct  181   YAGHYVPQLAQLIIQSKLK-----FNLKAIAIGNPLLEFNSDNNAQAEYLWSHGLISDAT  235

Query  538   LAMKRSICNDTRAILE-NIQGN-MSNECILVNGATGEEV-GSDIDSSDLLLPICLSSNAK  708
                  S+CN++  I +  I+G  ++  C  V      EV G  ID  D+   +CLSS   
Sbjct  236   FENLTSVCNNSEIIRQVRIRGGPLTPACDAVATQVESEVPGYLIDQYDVTHDVCLSSVEA  295

Query  709   QQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             Q                 ++ A  D C+ D   +YL RP+VQ+ALHA  T     W  CS
Sbjct  296   QSFQL-------------QKTAKIDVCIADETVSYLNRPDVQEALHARVT----NWTTCS  338

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
               L+Y M+N+   ++P L +++K  I +L++SGDQD+ IP+T TRT+AN LA++L L   
Sbjct  339   NVLKYDMKNVEVPMLPVLGDLVKSGIRVLIYSGDQDSVIPLTSTRTLANGLAKDLGLQTN  398

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +  W    Q+AGW+Q +  +        L++A++RGA HE P + P ++L LF +FLK
Sbjct  399   VPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGHEAPISQPERSLLLFTSFLK  450

Query  1249  GYPPPR  1266
             G P P+
Sbjct  451   GKPLPK  456



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   362 bits (930),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 191/427 (45%), Positives = 264/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE + P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  93    LFYYFVEAEGE-PEKKPLTLWLNGGPGCSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNK  151

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY    D  +A+D   F+++WF+K+P+Y++ DL+LTGE
Sbjct  152   ASNLLFVESPAGVGWSYSNTTSDY-TCGDASSARDMHMFLMKWFQKYPEYKSRDLFLTGE  210

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L YN+      F +K +A+GNPLL +D  I A  EF WSHG ISD+
Sbjct  211   SYAGHYIPQLANVLLDYNEHSTDFKFNIKGVAIGNPLLKLDRDIPATYEFFWSHGMISDE  270

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + CN    +  N   N+S  C        + VG  I++ D++L +C  S  +Q+
Sbjct  271   IGLTIMNECNFDDYVFSNSH-NVSQSCNQAIAGANQVVGDYINNYDVILDVCYPSIVEQE  329

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C++     Y   P VQ+ALHAN T LP+ W  CS 
Sbjct  330   L---------RLRKLATKISIGVDVCMSYERRFYFNLPRVQQALHANRTNLPYGWSMCSN  380

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L  I+KHHIP+ +FSGDQD+ +P+  +RT+   LA +L      
Sbjct  381   ILNYNETDGNISILPLLKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFEVTV  440

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  441   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  492

Query  1252  YPPPRTS  1272
                P T+
Sbjct  493   RRLPNTT  499



>ref|XP_006482059.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=455

 Score =   360 bits (924),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 189/422 (45%), Positives = 263/422 (62%), Gaps = 27/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA A    S PL LWLNGGPGCSS+G GAF EHGPF+P  D  L++N+YSWN E
Sbjct  58    LFYYFVEA-ATEAASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + ND   A+DNL F+  W++KFP+Y+N + ++TGES
Sbjct  116   ANMLYLESPAGVGFSYSANKSFYGSVNDAIAARDNLAFLEGWYEKFPEYKNREFFITGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++ N K N     LK IA+GNPLL+ +   ++ AEFLWSHG ISD  
Sbjct  176   YAGHYVPQLAQLIIQSNMKLN-----LKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN ++   +   G+++  C  V      E+   +D+ D+ L +CL S      
Sbjct  231   YDIFTRVCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPS------  284

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++ L   ++     D C+ D    YL R +VQKALHA    +  +W  CS  L
Sbjct  285   VLLQSKMLSQLQDKEEI----DVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSEVL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y MQN+    +  L ++ K  I +L++SGDQD+ +P+T TRT+ N LA+E+ L     +
Sbjct  340   KYDMQNLEIPTIHVLGKLAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W +G Q AGW+Q +G          L+FA++RGA+HE P + P ++L LF AFL G P
Sbjct  400   RTWVEGRQAAGWTQVYG--------DILSFATIRGASHEAPLSQPRRSLALFNAFLGGKP  451

Query  1258  PP  1263
              P
Sbjct  452   LP  453



>ref|XP_003621641.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=489

 Score =   361 bits (926),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 193/452 (43%), Positives = 270/452 (60%), Gaps = 53/452 (12%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YFVEA+  + +S PL LWLNGGPGCSSLG GAF E+GPF+P  +  LVKN++SWN E
Sbjct  59    LFFYFVEAK-NDAVSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGEA-LVKNQFSWNTE  116

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQ---------------------------  279
             +NMLYLESPIGVGFSYS  +S Y   ND  T +                           
Sbjct  117   ANMLYLESPIGVGFSYSTDTSSYEGVNDKITGKFSIFILLFDLRMILNFILLNGQAPFNS  176

Query  280   --DNLRFVLEWFKKFPQYRNSDLYLTGESYAGHYIPQLADLMLKYNKKKNIRAFKLKAIA  453
               DNL F+  WF KFP+YRN  L++ GESYAGHY+PQLA+LML++NKK+ +  F LK IA
Sbjct  177   TRDNLIFLQNWFVKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKEKL--FNLKGIA  234

Query  454   LGNPLLDIDISIDA-AEFLWSHGAISDDLLAMKRSICNDTRAILENIQGNMSNECILVNG  630
             LGNP+L+     ++ AEF WSHG ISD    M  S+CN +R + E   G +S  C  V  
Sbjct  235   LGNPVLEFATDFNSRAEFFWSHGLISDLTFKMFTSVCNYSRYVREYYNGAVSPVCSSVMS  294

Query  631   ATGEEVGSDIDSSDLLLPICLSSNAKQQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYA  810
                 E    +D  D+ L +C+SS   Q  V     +  T+          D C+ D    
Sbjct  295   QVSTETSRFVDKYDVTLDVCISSVFSQTNVLNPQQVTETI----------DVCVEDETVN  344

Query  811   YLQRPEVQKALHANTTYLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGD  990
             YL R +VQ ALHA+   +   W  CS  L Y+++++    +  + +++K  IP+L++SGD
Sbjct  345   YLNRKDVQSALHAHLIGV-HRWSPCSSVLDYELRDLEIPTITVVGKLVKAGIPVLVYSGD  403

Query  991   QDTKIPVTQTRTIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFA  1170
             QD+ IP+T +RT+ + LA++L++     +  W+ G Q+ GW+Q +G        + L+FA
Sbjct  404   QDSVIPLTGSRTLVHQLAKQLRMNTTVPYRVWFAGQQVGGWTQVYG--------NILSFA  455

Query  1171  SVRGAAHEVPFTSPSQALTLFRAFLKGYPPPR  1266
             +VRGA+HEVPF+ P ++L LF++FL+G P P 
Sbjct  456   TVRGASHEVPFSQPERSLVLFKSFLEGRPLPE  487



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   360 bits (924),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 263/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVK-NKYSWNL  177
             LFYYFVEAE +NPL  PLTLWLNGGPGCSS+G GAF E GPF P  DG  ++ N  SWN 
Sbjct  59    LFYYFVEAE-KNPLDKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNPMSWNK  117

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSN +SDY N  D  TA+D L F+L WFKKFP++++ DL+LTGE
Sbjct  118   ASNLLFVESPAGVGWSYSNRTSDY-NTGDASTAKDMLVFLLRWFKKFPEFKSRDLFLTGE  176

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLAD++L YN + +   F +K IA+GNPLL +D  + A  EF WSHG ISD+
Sbjct  177   SYAGHYIPQLADVILNYNARSSGFKFNVKGIAIGNPLLKLDRDVPATYEFFWSHGMISDE  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             L     + CN       +   N S  C    G  G  V   ++  D++L +C  S  +Q+
Sbjct  237   LGLTITAQCNFEDYTFSSPH-NESKACDDALGEVGSIVSEYVNYYDVILDVCYPSIVEQE  295

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     Y   PEVQKALHAN T LP+ W  CS 
Sbjct  296   L---------RLKKMATKMSLGVDVCMTYERQFYFNLPEVQKALHANRTLLPYQWSMCSS  346

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +++P L  I+++ I + +FSGDQD+ +P+  +RT+   LA+EL      
Sbjct  347   QLNYSDTDGNLDMLPILKRIVQNKIYVWIFSGDQDSVVPLLGSRTLVRELAQELDFKNTV  406

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  407   PYGAWFHKGQVGGWVTEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVSG  458

Query  1252  YPPPRTS  1272
                P T+
Sbjct  459   QRLPNTT  465



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=480

 Score =   360 bits (925),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 194/434 (45%), Positives = 267/434 (62%), Gaps = 24/434 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EA+ Q+P  LPLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  68    LFYYFAEAQ-QDPHLLPLTLWLNGGPGCSSVGGGAFTELGPFYPKGDGRGLRRNSMSWNK  126

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSN +SDY    D  TA+D L F+L+W+ KFP +++   +LTGE
Sbjct  127   ASNLLFVESPAGVGWSYSNRTSDY-TCGDDSTARDMLTFMLKWYDKFPAFKDRSFFLTGE  185

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLAD +L YN       F +K +A+GNPLL++D    A  EF WSHG ISD+
Sbjct  186   SYAGHYIPQLADAILDYNIHSKAFKFNIKGVAIGNPLLNLDRDAQATYEFFWSHGMISDE  245

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +       CN    +L N   N++  C          VG  I++ D+LL +C  S  +Q+
Sbjct  246   VWFAITRDCNFDDYVLTNPH-NVTKSCNEAIADANGIVGEYINNYDVLLDVCYPSIVEQE  304

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     Y   PEVQKALHAN T LP+ W  CS 
Sbjct  305   L---------RLKKLATKISMGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEWSMCSD  355

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
             TL Y   +   N++P L  I+++HIP+ ++SGD+D+ +P+  +RT+   LA +LKL    
Sbjct  356   TLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDSVVPLLGSRTLVRELAHDLKLKVTV  415

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G +        LTFA+VRGA+H VPF  PS+AL LF +F++G
Sbjct  416   PYGAWFHKGQVGGWAIEYGNT--------LTFATVRGASHMVPFAQPSRALHLFSSFVRG  467

Query  1252  YPPPRTS*GPLLED  1293
                P ++  P ++D
Sbjct  468   RRLPNST-RPSIDD  480



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   360 bits (924),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/427 (45%), Positives = 263/427 (62%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EA++ N    PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +NK SWN 
Sbjct  60    LFYYFAEADS-NASKKPLTLWLNGGPGCSSIGGGAFTELGPFYPRGDGRGLRRNKKSWNK  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP+GVG+SYSN SSDY    D  TA D   F+L W+ KFP++++ DL+LTGE
Sbjct  119   ASNLLFVESPVGVGWSYSNRSSDY-TCGDESTANDMHVFLLRWYDKFPEFKSRDLFLTGE  177

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L +NK      FK+K +A+GNPLL +D    A  EF WSHG ISD+
Sbjct  178   SYAGHYIPQLANVLLNHNKHSTGFKFKIKGVAIGNPLLKLDRDAAATYEFFWSHGMISDE  237

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  +   N+S  C        E VG  I++ D+++ +C  +  +Q+
Sbjct  238   IGLTIMNQCDFEDYVFLSPH-NVSESCNDAIEKANEIVGDYINNYDVIIDVCYPAIVEQE  296

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K   +++ G D C+T   + Y   PEVQ ALHAN T LP++W  CSG
Sbjct  297   L---------RLRKYATKISVGVDVCMTYERHFYFNLPEVQHALHANRTKLPYSWSMCSG  347

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L  I+KHHIP+ +FSGDQD+ +P   +RT+   LA +LK     
Sbjct  348   VLNYSDTDPNIDILPLLKRIIKHHIPVWIFSGDQDSVVPFLGSRTLVRELAHDLKFGVTV  407

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W+   Q+ GW+  +G        + LTFA+VRGAAH VPF  P++AL LFR+F+ G
Sbjct  408   PYSAWFYKGQVGGWATEYG--------NLLTFATVRGAAHMVPFAQPARALRLFRSFVNG  459

Query  1252  YPPPRTS  1272
                P T+
Sbjct  460   QRLPNTT  466



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   359 bits (922),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 265/426 (62%), Gaps = 20/426 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYF EAE +   S PLTLWLNGGPGCSS+G GAF E GPF P   G  L+ N+ +WN 
Sbjct  56    LFYYFAEAETRAS-SQPLTLWLNGGPGCSSIGGGAFTELGPFYPNASGQGLLVNRQAWNK  114

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SNML+LE+P GVG+SYSN SSDY    D  TA D L F+L W  KFP+Y+  D Y+TGE
Sbjct  115   VSNMLFLEAPAGVGWSYSNKSSDYEQVTDRITAVDTLNFLLGWMDKFPEYQTRDFYITGE  174

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHY+PQLA+L++K+++     AF+LK +A+GNPLL++ +   A  E+ WSHG ISD+
Sbjct  175   SYAGHYVPQLAELIIKHSQVPGNYAFRLKGVAIGNPLLNLAVDTSAMYEYFWSHGLISDE  234

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   + C      L     N+SN C      +  EVG  I++ D++L +CL S     
Sbjct  235   TFQALSNSCKFEDYELGLADHNVSNACNDGILQSNTEVGRFINNYDVILDVCLPS-----  289

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              +F +   V    ++ ++    D C+      Y   PEVQ+ LHANTT L ++W  C+G 
Sbjct  290   -IFLQE--VRLKQQMAQKSYGVDICIDKERDVYFNLPEVQRELHANTTGLSYSWSMCTGP  346

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             + Y MQ+ ++N++P L +ILK  + + +FSGDQD+ +P+T TR++   LA+ L +   + 
Sbjct  347   VDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLGMQTTQP  406

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  WY G Q+AGW+QS+G          LT+A++RGAAH VP+  P +AL LFR+F++G 
Sbjct  407   YTAWYQGGQVAGWTQSYGN---------LTYATIRGAAHMVPYAQPERALLLFRSFIRGN  457

Query  1255  PPPRTS  1272
               P  S
Sbjct  458   ALPIKS  463



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 263/431 (61%), Gaps = 24/431 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q P + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  65    LFYYFVEAEKQ-PHTKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  123

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  124   ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  182

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLAD++L+YN + + R FKLK IA+GNPLL +D  + A  EF WSHG ISD+
Sbjct  183   SYAGHYIPQLADVILEYNSRHSNR-FKLKGIAVGNPLLKLDRDVPATYEFFWSHGMISDE  241

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q+
Sbjct  242   LGLTIMNQCNFEDYTFSSSH-NISKPCEDAMSEAGTIITQYVNYYDVLLDICYPTLVEQE  300

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CSG
Sbjct  301   L---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCSG  351

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L      
Sbjct  352   LLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFNTTV  411

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ G
Sbjct  412   PYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVLG  463

Query  1252  YPPPRTS*GPL  1284
                P  S  PL
Sbjct  464   RRLPNKSPPPL  474



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 267/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+ Q P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  61    LFYYFVEADEQ-PDKKPLTLWLNGGPGCSSVGGGAFTELGPFYPTGDGRGLRRNPMSWNR  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNTSSDY +  D  TA+D   F++EW++KFP +R+ +L+LTGE
Sbjct  120   ASNLLFVESPAGVGWSYSNTSSDY-DSGDASTARDMHTFLMEWYEKFPTFRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA  +L +NK+     F LK +ALGNPLL +D    A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLAIAILDHNKQSTGFKFNLKGVALGNPLLRLDRDAPATYEYFWSHGMISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   + C+    +L N   N+S+ C        + VG  I++ D++L +C  S  +Q+
Sbjct  239   TGLTIMNECDFDDYVLGNPH-NVSHPCNKAISQANQMVGEYINNYDVILDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     YL  PEVQK LHAN T LP+ W  CS 
Sbjct  298   L---------RLRKMATKISVGVDVCMTFERRFYLNLPEVQKVLHANRTNLPYPWSMCSR  348

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   + + NI+P L+ I+++ IP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  349   VLNYSDTDGSINILPLLTRIVQNRIPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFPITV  408

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF AF++G
Sbjct  409   PYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSAFVRG  460

Query  1252  YPPPRTS  1272
                P T+
Sbjct  461   RRLPNTA  467



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/427 (46%), Positives = 262/427 (61%), Gaps = 25/427 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEA+  +P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +NK SWN 
Sbjct  62    LFYYFVEAD-HDPHKKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNKKSWNR  120

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY N++DT TA D L F+L+W++KFP YR+  L+LTGE
Sbjct  121   ASNLLFVESPAGVGWSYSNTTSDYNNYDDTSTANDTLLFMLKWYEKFPSYRSRGLFLTGE  180

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGH+IPQLA+ +L YN   +    F +K +A+GNPLL       A  E+ WSHG ISD
Sbjct  181   SYAGHFIPQLANTILDYNAHHSTGFKFNIKGVAIGNPLLQFSRDTQATYEYYWSHGMISD  240

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             ++     + CN      +    N+S  C        + V   ID+ D++L +C  S A+Q
Sbjct  241   EIGLTIMNDCN-----FDASYDNLSKSCKDAMVDAQDIVSDYIDNYDVILDVCYPSIAEQ  295

Query  712   QMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             ++      L    TKI   V   D C+   IY YL  PEVQKALHAN T LP+ W  CSG
Sbjct  296   EL-----RLKRMATKISLTV---DICMDSEIYFYLNLPEVQKALHANRTNLPYPWSMCSG  347

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   NI+P L  I+++HIP+ ++SGDQD+ +P+  +R     LA +L     +
Sbjct  348   VLNYNDADHDINILPVLKRIVQNHIPVWVYSGDQDSIVPLLGSRRHIRELAHDLNFNITD  407

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +  W+   Q+ GW   +G        + LTFA+VRGA H VP+  PS+AL LF +F++G
Sbjct  408   SYRVWFHRDQVGGWVTEYG--------NLLTFATVRGAGHIVPYAQPSKALHLFSSFVRG  459

Query  1252  YPPPRTS  1272
                P+T+
Sbjct  460   RRLPKTT  466



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 269/435 (62%), Gaps = 25/435 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEAE + P + PLTLWLNGGPGCSS+G GAF E GPF P  +G  L +N  SWN 
Sbjct  60    LFYYFVEAEKE-PHTKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGNGLGLRRNPKSWNK  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY N  D KTA+D L F+L W +KFPQ++  +L+L GE
Sbjct  119   ASNLLFVDSPAGVGWSYSNTTSDY-NTGDEKTAKDMLMFMLRWLEKFPQFKTRNLFLAGE  177

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHY+PQLAD++L+YN +++ R  F LK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  178   SYAGHYVPQLADVILEYNTRQSNRFKFNLKGIAIGNPLLKLDRDVPAIFEFFWSHGMISD  237

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L A  ++ C+           N+S  C       G  +   I+  D+LL IC  S  +Q
Sbjct  238   ELGATIKNQCDFEDYSFSRTH-NISKPCETAMNEAGTIITQYINYYDILLDICYPSLVEQ  296

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQKALHAN T LP+ W  CS
Sbjct  297   EL---------RLKKMGTKMSNGVDVCMSYEEQIYLTLPEVQKALHANRTQLPYEWSICS  347

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
               + Y   + ++NI+P L  I+K  +P+ +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  348   SLVNYNYNDGSTNILPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKELASDLNFNTT  407

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G        + LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  408   VPYGAWFHKGQVGGWVIEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFTSFVL  459

Query  1249  GYPPPRTS*GPLLED  1293
             G   P  S  P L D
Sbjct  460   GRRLPHKS-PPALHD  473



>gb|KHG30064.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=472

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/435 (43%), Positives = 266/435 (61%), Gaps = 31/435 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE   P S PL LWLNGGPGCSS+G GAF+EHGPF+P     L KN  SWN E
Sbjct  55    LFYYFVEAETM-PASKPLVLWLNGGPGCSSVGAGAFIEHGPFKP-NGKTLTKNANSWNKE  112

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS  +S Y + ND   A+DN  F+  W   FPQY+N D Y+TGES
Sbjct  113   ANMLYLESPAGVGFSYSANNSFYTDLNDEVVARDNFVFLERWLLIFPQYKNRDFYITGES  172

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDDL  537
             YAGHY+PQL   ++  N K N     LK IA+GNPLL+    +++A ++ WSHG ISD  
Sbjct  173   YAGHYVPQLTLHIIHSNLKLN-----LKGIAIGNPLLEFVTDMNSADQYYWSHGLISDSA  227

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R + E +  + S++C+ V G   +E+G  +D  D++  +CLSS      
Sbjct  228   YELLLSFCNSSRLMREALTQSFSSDCLSVYGEVAKELGKSVDKYDVIADVCLSSGQSSMA  287

Query  718   VF---------FRNNL---VTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTY  861
             +F         F ++L   V   ++   +V A DPC+ D+   YL R +VQKALHA    
Sbjct  288   IFSHPMFLGPQFSSSLHSQVDGFSQQQVKVEA-DPCIEDKTTKYLNRKDVQKALHAKLVG  346

Query  862   LPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANML  1041
             +  +W+ C+  +QY M ++ +  + T+ +I+K  IP++++SGDQD+ IP T TR +   L
Sbjct  347   IT-SWNLCNKIVQY-MDDLETPTIYTVGKIVKSGIPVMVYSGDQDSVIPFTGTRNLVYKL  404

Query  1042  ARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQA  1221
             A+ L L     + PW++G Q+ GW+Q +G          L+FA++RGA+H  P + P ++
Sbjct  405   AKALGLKTTVPYRPWFEGKQVGGWTQVYG--------DILSFATIRGASHTAPASQPKRS  456

Query  1222  LTLFRAFLKGYPPPR  1266
             + LF+A L G P P 
Sbjct  457   MALFKAVLSGKPLPE  471



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   358 bits (920),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 195/428 (46%), Positives = 262/428 (61%), Gaps = 25/428 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA+   P + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L  N  SWN 
Sbjct  58    LFYYFVEAD-HKPQNKPLTLWLNGGPGCSSIGGGAFTELGPFFPAGDGRGLRTNSMSWNR  116

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSNT+SDY N  D  TA D L F L+WF+KFP Y++  L+LTGE
Sbjct  117   ASNLLFIESPAGVGWSYSNTTSDY-NIGDASTANDMLSFFLKWFEKFPTYKSRALFLTGE  175

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+ +L YN       F LK +A+GNPLL++D    A  ++ WSHG ISD+
Sbjct  176   SYAGHYIPQLANAILDYNAHSTGYKFNLKGVAIGNPLLNLDRDAQATYDYFWSHGMISDE  235

Query  535   L-LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             + LA+ +    D          N+S  C        E VG  I++ D++L +C  S  +Q
Sbjct  236   IGLAITKDCDFDDYTFAS--PHNVSASCNTAINDANEVVGDYINNYDVILDVCYPSIVEQ  293

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     Y   PEVQKALHAN T LP++W  CS
Sbjct  294   EL---------RLKKMATKISVGVDVCMSYERKFYFNLPEVQKALHANRTNLPYSWSMCS  344

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   N++P L  I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK    
Sbjct  345   GVLNYSDTDPNINMLPILKRIVQNHIPVWIFSGDQDSVVPLLGSRTLIRELADDLKFKVT  404

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW+  +G        + LTFA+VRGAAH VP+  PS+AL LF  F+ 
Sbjct  405   VPYGAWFHKGQVGGWATEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSNFVN  456

Query  1249  GYPPPRTS  1272
             G   P T+
Sbjct  457   GRRLPNTT  464



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score =   360 bits (923),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 268/456 (59%), Gaps = 45/456 (10%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYF EAE  +P + PL LWLNGGPGCSS+G GAF E+GPF+P  +  LV N+YSWN E
Sbjct  61    LFYYFAEAEL-DPATKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LVGNEYSWNKE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y    D+ TA+DNLRF+  WF KFPQY+  DLY+ GES
Sbjct  119   ANMLYLESPAGVGFSYSTDPSFYGGVGDSMTARDNLRFLEGWFAKFPQYKGRDLYIAGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA  M++++ K+ +  F LK IALGNP+L+     ++ AEF WSHG ISD  
Sbjct  179   YAGHYVPQLAQRMVEFDDKEKL--FNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  ++CN +R + E   G++S  C  V      E    +D  D+ L +C+SS   Q  
Sbjct  237   YNIFTTVCNYSRYVSEYYHGSISTVCDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQSQ  296

Query  718   VF------------FRNNLVTTLTKIDKRVA-------AGDPCLTDRIYAYLQRPEVQKA  840
             V             F   +  TL+  D  +        A D C+ D    YL R +VQKA
Sbjct  297   VLTPSPNVSFFSITFAKEMYVTLSLTDNFLQSTEQLNRALDVCVEDETMNYLNRKDVQKA  356

Query  841   LHANTTYLP-WTWDF----C--------SGTLQYQMQNIASNIMPTLSEILKHHIPILLF  981
             +HA    +P WT  F    C        S  L+Y+  ++    +  +  ++K  IP+L++
Sbjct  357   MHAQLNGVPKWTLHFLQQGCDFTECFALSSVLEYKQLDLQIPTINIVGALVKSGIPVLVY  416

Query  982   SGDQDTKIPVTQTRTIANMLARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFL  1161
             SGDQD+ IP+T +RT+ + LA+ L+L A   +  W+ G Q+ GW+Q F           L
Sbjct  417   SGDQDSVIPLTGSRTLVHRLAKRLRLNATVPYRVWFQGKQVGGWTQVFS--------DVL  468

Query  1162  TFASVRGAAHEVPFTSPSQALTLFRAFLKGYPPPRT  1269
             +FA++RGA+HE PF+ P ++L LFRAFL   P P +
Sbjct  469   SFATIRGASHEAPFSQPERSLVLFRAFLASRPLPES  504



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 262/432 (61%), Gaps = 24/432 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q   + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  36    LFYYFVEAEKQQH-TKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  94

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  95    ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  153

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHYIPQLAD++L+YN + + R  FKLK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  154   SYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  213

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q
Sbjct  214   ELGLTIMNQCNFDDYTFSSSH-NISKPCEAAMSEAGTIITQYVNYYDVLLDICYPTLVEQ  272

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CS
Sbjct  273   EL---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCS  323

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  324   GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTT  383

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  384   VPYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVL  435

Query  1249  GYPPPRTS*GPL  1284
             G   P  S  PL
Sbjct  436   GRRLPNKSPPPL  447



>ref|XP_006430527.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
 gb|ESR43767.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
Length=455

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 262/422 (62%), Gaps = 27/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA A    S PL LWLNGGPGCSS+G GAF EHGPF+P  D  L++N+YSWN E
Sbjct  58    LFYYFVEA-ATEAASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + ND   A+DNL F+  W++KF +Y+N + ++TGES
Sbjct  116   ANMLYLESPAGVGFSYSANKSFYGSINDAIAARDNLAFLEGWYEKFTEYKNREFFITGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++ N K     F LK IA+GNPLL+ +   ++ AEFLWSHG ISD  
Sbjct  176   YAGHYVPQLAQLIIQSNMK-----FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN ++   +   G+++  C  V      E+   +D+ D+ L +CL S      
Sbjct  231   YDIFTRVCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPS------  284

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  ++ +++ L   ++     D C+ D    YL R +VQKALHA    +  +W  CS  L
Sbjct  285   VLLQSKMLSQLQDKEEI----DVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSEVL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y MQN+    +  L ++ K  I +L++SGDQD+ +P+T TRT+ N LA+E+ L     +
Sbjct  340   KYDMQNLEIPTIHVLGKLAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W +G Q AGW+Q +G          L+FA++RGA+HE P + P ++L LF AFL G P
Sbjct  400   RTWVEGRQAAGWTQVYG--------DILSFATIRGASHEAPLSQPRRSLALFNAFLGGKP  451

Query  1258  PP  1263
              P
Sbjct  452   LP  453



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 262/432 (61%), Gaps = 24/432 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q   + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  41    LFYYFVEAEKQQH-TKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  99

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  100   ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  158

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHYIPQLAD++L+YN + + R  FKLK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  159   SYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  218

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q
Sbjct  219   ELGLTIMNQCNFDDYTFSSSH-NISKPCEAAMSEAGTIITQYVNYYDVLLDICYPTLVEQ  277

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CS
Sbjct  278   EL---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCS  328

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  329   GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTT  388

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  389   VPYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVL  440

Query  1249  GYPPPRTS*GPL  1284
             G   P  S  PL
Sbjct  441   GRRLPNKSPPPL  452



>ref|XP_011042948.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   357 bits (917),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 270/425 (64%), Gaps = 26/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQP-GRDGNLVKNKYSWNL  177
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P GR   L++N++SWN 
Sbjct  62    LFYYFVEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGRI--LIRNEHSWNR  118

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSY+  +S Y   +D  TA+DNL F+  WF KFPQYRN DL++TGE
Sbjct  119   EANMLYLETPVGVGFSYATDNSSYVAVDDEATARDNLVFLQGWFHKFPQYRNKDLFITGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ NKKK      LK IALGNP+L+    +++ AE+ WSHG ISD 
Sbjct  179   SYAGHYIPQLAKLMVEINKKKK--LVNLKGIALGNPVLEFATDLNSRAEYFWSHGLISDS  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S CN +R + E  + ++S+ C LV      E    +D  D+ L +C+ S   Q 
Sbjct  237   TYKMFTSACNYSRYVSEYYRDSVSSVCSLVMKQVSTETSRFVDKYDVTLDVCIPSVLSQS  296

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V        +  ++ +R+   D C+ D    YL R +V+KA HA    +   W+ CS  
Sbjct  297   KVI-------SPKQVSERI---DVCIEDETVNYLNREDVRKAFHARLIGVR-RWEVCSNI  345

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y++ NI    +  +  ++K  IP+L++SGDQD+ IP+T +RT+ + LA+EL L     
Sbjct  346   LDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIPLTGSRTLVHRLAKELGLNTTVP  405

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q+ GW+Q +G        + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  406   YRAWFAGKQVGGWTQVYG--------NILSFATIRGASHEAPFSQPERSLMLFKSFLQGK  457

Query  1255  PPPRT  1269
               P  
Sbjct  458   HLPEV  462



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score =   357 bits (917),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 262/432 (61%), Gaps = 24/432 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q   + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  51    LFYYFVEAEKQQH-TKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  109

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  110   ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  168

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHYIPQLAD++L+YN + + R  FKLK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  169   SYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  228

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q
Sbjct  229   ELGLTIMNQCNFDDYTFSSSH-NISKPCEAAMSEAGTIITQYVNYYDVLLDICYPTLVEQ  287

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CS
Sbjct  288   EL---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCS  338

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  339   GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTT  398

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  399   VPYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVL  450

Query  1249  GYPPPRTS*GPL  1284
             G   P  S  PL
Sbjct  451   GRRLPNKSPPPL  462



>ref|XP_002277400.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=455

 Score =   357 bits (916),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 254/422 (60%), Gaps = 32/422 (8%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
              FYYFVEAE       PL +W +GGPGCSS+G GAF +HGPF+P  D  L+ NKYSWN E
Sbjct  63    FFYYFVEAENDTTTLKPLVVWFSGGPGCSSVGGGAFAQHGPFRPSGD-ILLTNKYSWNRE  121

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLY ESP G GFSYS  +S Y N ND  TA+DNL F+  WF KFPQY+NS+L++ GES
Sbjct  122   ANMLYPESPAGTGFSYSANTSFYTNLNDEITARDNLVFLKNWFIKFPQYKNSELFIAGES  181

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDDL  537
             YAGH++PQLA L+L+   K     F LK I +G+PL+D D + ++   F WSHG ISD  
Sbjct  182   YAGHFVPQLAQLILESRVK-----FNLKGILMGDPLMDFDTNYNSVPHFYWSHGLISDST  236

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R   E   G++S  C+ V     +EVG  +D  D+ L  CL S   Q  
Sbjct  237   YNLFSSKCNYSRMNREQTSGSLSPACLAVRSQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ  296

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N+              D C+ D +  YL R +VQK+LHA    +   W  CSG L
Sbjct  297   V--TENV--------------DVCIGDEVNKYLNREDVQKSLHARLVGVA-NWSMCSGAL  339

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y +++    ++P +  ++K  I   ++SGDQD+ IP+  TRT+ + LA+EL+L     +
Sbjct  340   RYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGTRTLVDGLAKELRLNTTVPY  399

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA+VRG +H VP T P++AL LF AFLKG P
Sbjct  400   RNWFEGEQVGGWTQVYG--------DILSFATVRGGSHTVPGTQPARALVLFTAFLKGQP  451

Query  1258  PP  1263
             PP
Sbjct  452   PP  453



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score =   357 bits (916),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 264/423 (62%), Gaps = 28/423 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEA+ ++P S P+ LWLNGGPGCSS+G GA +EHGPF+P RD N LVKN YSWN 
Sbjct  60    LFYYFVEAQ-KDPTSKPVVLWLNGGPGCSSIGVGALIEHGPFKP-RDSNVLVKNHYSWNK  117

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +N+LYLESP GVGFSYS+ +S Y    D  TA+DNL F+  WF +FP+Y N+D ++TGE
Sbjct  118   VANVLYLESPAGVGFSYSSNTSFYTLVTDEITARDNLVFLQRWFIEFPEYSNNDFFITGE  177

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY PQLA L+++   K NI    LK IA+GNPL++ D  +++ AEFLWSHG ISD 
Sbjct  178   SYAGHYAPQLAQLIVQ--TKTNI---NLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDS  232

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                +   +CN +    + I GN+S  C  +N     E+ + ID  D+ L +CLSS  +Q 
Sbjct  233   TYGLFTRVCNYSTIRRQMISGNLSEICDNINTLVFTELSNYIDQYDVTLDVCLSSANQQA  292

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V    N +  + KI       D C+ D+   YL R +VQKALHA    +   W  CS  
Sbjct  293   YVL---NQMQKIQKI-------DVCVDDKAVNYLNRKDVQKALHAKLVGVS-KWLTCSRV  341

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y   N+    +  L  ++   I +L++SGDQD+ IP+  +R++ N LA+EL L     
Sbjct  342   LHYDRTNLEIPTISILGSLVNSKIRVLVYSGDQDSVIPLMGSRSLVNGLAKELGLNTTVA  401

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++G Q+ GW+Q +G          L++A++RGA+HE PF  P ++L L +AFL+G 
Sbjct  402   YRAWFEGKQVGGWTQVYG--------DILSYATIRGASHEAPFNQPRRSLGLLKAFLEGK  453

Query  1255  PPP  1263
             P P
Sbjct  454   PLP  456



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/430 (45%), Positives = 265/430 (62%), Gaps = 32/430 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LF+YF EAEA +P S PL LWLNGGPGCSS+G G+F EHGPF+P R   L+KN YSWN E
Sbjct  61    LFFYFAEAEA-DPASKPLVLWLNGGPGCSSIGLGSFSEHGPFKP-RGDVLLKNDYSWNKE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQ-DNLRFVLEWFKKFPQYRNSDLYLTGE  357
             +NMLYLESP GVGFSYS  +S Y + +D  T Q DNL F+  WF+KFP+Y+  D ++TGE
Sbjct  119   ANMLYLESPAGVGFSYSVHTSYYSSVDDEMTEQRDNLAFLRSWFEKFPEYKERDFFITGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY+PQLA L+++       + F LK IA+GNPLL+ +   ++ AEF WSHG ISD 
Sbjct  179   SYAGHYVPQLAMLIVQS------KLFNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDA  232

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                   ++CN ++   +   G ++  C  VN     E+   ID+ D+ L +CLS+ + Q 
Sbjct  233   TYESFNTMCNYSQIRRQAQSGTLTPVCSRVNSEANREISKFIDTYDVTLDVCLSTVSSQS  292

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              V    N +    KID        C+ D    YL R EVQ+ALHA    +  +W  CS  
Sbjct  293   AVL---NKLQQTEKIDV-------CVQDETLKYLNRKEVQEALHARLVGIS-SWTVCSDV  341

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L+Y+ QN+    +  L E++K  I +L++SGDQD+ IP+  TRT+ N LA++L L     
Sbjct  342   LEYEYQNLEIPTITILGELVKSGIHVLVYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVP  401

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W++  Q+AGW+Q +G          L++A++RGA+H  PF+ P ++L LF +FL G 
Sbjct  402   YRVWFEESQVAGWTQVYG--------DILSYATIRGASHVAPFSQPERSLVLFSSFLGGR  453

Query  1255  PPPRTS*GPL  1284
             P P    GPL
Sbjct  454   PLPE---GPL  460



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 262/432 (61%), Gaps = 24/432 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q   + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  64    LFYYFVEAEKQQH-TKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  122

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  123   ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  181

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHYIPQLAD++L+YN + + R  FKLK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  182   SYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  241

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q
Sbjct  242   ELGLTIMNQCNFDDYTFSSSH-NISKPCEAAMSEAGTIITQYVNYYDVLLDICYPTLVEQ  300

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CS
Sbjct  301   EL---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCS  351

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  352   GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTT  411

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  412   VPYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVL  463

Query  1249  GYPPPRTS*GPL  1284
             G   P  S  PL
Sbjct  464   GRRLPNKSPPPL  475



>emb|CBI32795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 254/422 (60%), Gaps = 32/422 (8%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
              FYYFVEAE       PL +W +GGPGCSS+G GAF +HGPF+P  D  L+ NKYSWN E
Sbjct  57    FFYYFVEAENDTTTLKPLVVWFSGGPGCSSVGGGAFAQHGPFRPSGD-ILLTNKYSWNRE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLY ESP G GFSYS  +S Y N ND  TA+DNL F+  WF KFPQY+NS+L++ GES
Sbjct  116   ANMLYPESPAGTGFSYSANTSFYTNLNDEITARDNLVFLKNWFIKFPQYKNSELFIAGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDDL  537
             YAGH++PQLA L+L+   K     F LK I +G+PL+D D + ++   F WSHG ISD  
Sbjct  176   YAGHFVPQLAQLILESRVK-----FNLKGILMGDPLMDFDTNYNSVPHFYWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S CN +R   E   G++S  C+ V     +EVG  +D  D+ L  CL S   Q  
Sbjct  231   YNLFSSKCNYSRMNREQTSGSLSPACLAVRSQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ  290

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V    N+              D C+ D +  YL R +VQK+LHA    +   W  CSG L
Sbjct  291   V--TENV--------------DVCIGDEVNKYLNREDVQKSLHARLVGVA-NWSMCSGAL  333

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y +++    ++P +  ++K  I   ++SGDQD+ IP+  TRT+ + LA+EL+L     +
Sbjct  334   RYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGTRTLVDGLAKELRLNTTVPY  393

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++G Q+ GW+Q +G          L+FA+VRG +H VP T P++AL LF AFLKG P
Sbjct  394   RNWFEGEQVGGWTQVYG--------DILSFATVRGGSHTVPGTQPARALVLFTAFLKGQP  445

Query  1258  PP  1263
             PP
Sbjct  446   PP  447



>ref|XP_007028219.1| Serine carboxypeptidase-like 45 [Theobroma cacao]
 gb|EOY08721.1| Serine carboxypeptidase-like 45 [Theobroma cacao]
Length=585

 Score =   361 bits (926),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 265/425 (62%), Gaps = 27/425 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPG SS+G GAF EHGPF+P  D  L+KN+YSWN E
Sbjct  178   LFYYFVEAEI-DPASKPLVLWLNGGPGYSSVGAGAFCEHGPFRPSAD-ILLKNEYSWNKE  235

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y + ND  TA+DNL F+ +W  KFP+Y+N DL++TGES
Sbjct  236   ANMLYLESPAGVGFSYSANKSFYTSVNDEMTARDNLAFLEKWLAKFPEYKNRDLFITGES  295

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             Y GHY+PQLA+L+ +   K     F L+ IA+GNPLL+ +   ++ AEF WSHG ISD  
Sbjct  296   YGGHYVPQLAELVSQSTNK-----FNLRGIAIGNPLLEYNADFNSRAEFYWSHGLISDTT  350

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
                  S+CN ++   E   G+++  C  V      E+ S +D  D+ L +CLSS      
Sbjct  351   YEALTSVCNYSQYRRERDSGSLTPVCSAVANQVSREISSFVDIYDVTLDVCLSS------  404

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             +F ++ ++T L   ++     D C+ D+   YL R +VQ+A HA    +   W  CS  L
Sbjct  405   LFSQSKILTELEPEEEV----DVCVEDKTVQYLNRKDVQEAFHAQLVGIT-AWTVCSDVL  459

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
             +Y+MQ++    +  L  +++  I + ++SGDQD+ IP+  TR + N LA+EL L     +
Sbjct  460   KYKMQDLEIPTIHILDRLVRSGIRVWVYSGDQDSVIPLIGTRILINGLAKELGLNTSVAY  519

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W+ G Q+A W+Q +G          LTFA++RGA+HE PF+ P ++L LF+AFL G P
Sbjct  520   RVWFAGRQVASWTQGYG--------DILTFATIRGASHEAPFSQPQRSLVLFKAFLAGKP  571

Query  1258  PPRTS  1272
              P TS
Sbjct  572   LPETS  576



>ref|XP_009355268.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=461

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 266/427 (62%), Gaps = 38/427 (9%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +P S PL LWLNGGPGCSS+G GAF+EHGPFQP  D  L+K  +SWN E
Sbjct  63    LFYYFVEAQT-DPASKPLVLWLNGGPGCSSVG-GAFIEHGPFQPSGD-ILLKKDFSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF +FP+Y+N DL++TG S
Sbjct  120   ANMLYLESPAGVGFSYSANKSFYGFVNDDITARDNLEFLQRWFDEFPEYKNRDLFITGVS  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LKA+A+GNPLL+ +  I++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLIIQSKLK-----FNLKAVAIGNPLLEFNTDINSRAEYWWSHGLISDAT  234

Query  538   LAMKRSICNDTRAIL-ENIQGN-MSNECILVNGATGEEV-GSDIDSSDLLLPICLSSNAK  708
              A   S+CN +     E I+G  ++  C  V      EV G  I+  D+ L +CLSS   
Sbjct  235   FANLTSVCNYSEIFRQERIRGGPLTPACDAVANQFEREVPGHLINRYDVTLDVCLSSVEA  294

Query  709   QQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             Q                 ++    D CL D I +YL RP+VQ+ALHA  T     W FCS
Sbjct  295   QSFQL-------------RKTVKIDVCLVDEIVSYLNRPDVQEALHARIT----NWTFCS  337

Query  889   -GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIA  1065
                +QY ++N+ + ++P L E++K  I +L++SGDQD+ IP+T TRT+ N LA++L L  
Sbjct  338   KAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIPLTSTRTLVNGLAKDLGLQT  397

Query  1066  FERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFL  1245
                +  W    Q+AGW+Q +  +        L++A++RGA HE P + P ++L LF +FL
Sbjct  398   NVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGHEAPISQPERSLLLFASFL  449

Query  1246  KGYPPPR  1266
             +G P P+
Sbjct  450   RGKPLPK  456



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score =   357 bits (916),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 262/432 (61%), Gaps = 24/432 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE Q   + PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  64    LFYYFVEAEKQQH-TKPLTLWLNGGPGCSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNK  122

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L+++SP GVG+SYSNT+SDY    D  TA+D L F+L W +KFP++R  +L+L GE
Sbjct  123   ASNLLFVDSPAGVGWSYSNTTSDYTT-GDESTAKDMLVFLLRWLEKFPEFRTRNLFLAGE  181

Query  358   SYAGHYIPQLADLMLKYNKKKNIR-AFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISD  531
             SYAGHYIPQLAD++L+YN + + R  FKLK IA+GNPLL +D  + A  EF WSHG ISD
Sbjct  182   SYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIGNPLLKLDRDVPATYEFFWSHGMISD  241

Query  532   DLLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQ  711
             +L     + CN       +   N+S  C       G  +   ++  D+LL IC  +  +Q
Sbjct  242   ELGLTIMNQCNFDDYTFSSSH-NISKPCEAAMSEAGTIITQYVNYYDVLLDICYPTLVEQ  300

Query  712   QMVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             ++          L K+  +++ G D C++     YL  PEVQ+ALHAN T LP++W  CS
Sbjct  301   EL---------RLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSWSMCS  351

Query  889   GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAF  1068
             G L Y   +   NI+P L  IL   IPI +FSGD+D+ IP+  +RT+   LA +L     
Sbjct  352   GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFNTT  411

Query  1069  ERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLK  1248
               +G W+   Q+ GW   +G          LTFA+VRGAAH VP+  PS+AL LF +F+ 
Sbjct  412   VPYGAWFHKGQVGGWVIEYG--------DILTFATVRGAAHMVPYAQPSRALHLFSSFVL  463

Query  1249  GYPPPRTS*GPL  1284
             G   P  S  PL
Sbjct  464   GRRLPNKSPPPL  475



>ref|XP_006380973.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58770.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=478

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 262/435 (60%), Gaps = 29/435 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE  +P S PL LWLNGGPGCSS+G GAF+EHGPF+P    NLV+N+YSWN E
Sbjct  57    LFYYFVEAET-SPASKPLVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKE  115

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   + Y   ND  TA+DNL F+  WF KFPQY+  D ++ GES
Sbjct  116   ANMLYLESPAGVGFSYSANQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGES  175

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAAE-FLWSHGAISDDL  537
             YAGHY+PQLA L+++   K N   F LK IA+GNPLL+ +  ++A + F WSHG ISD  
Sbjct  176   YAGHYVPQLAQLIIR--SKVN---FNLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDST  230

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +  S+CN ++ + E + G +S+ C+ V     +E+   ID  D+   ICLSSN  Q  
Sbjct  231   YQLLTSVCNSSKLMREALTGTVSSACLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLK  290

Query  718   VFFRNNLVTTLTKIDKRV-------------AAGDPCLTDRIYAYLQRPEVQKALHANTT  858
             +F +  L + L  +  +V                D CL +    YL R +VQ ALHA   
Sbjct  291   IFHQQLLRSRLPYLSPQVLELDSVKQQQQVMGKVDVCLLEETTNYLNRKDVQMALHARLV  350

Query  859   YLPWTWDFCSGTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANM  1038
              +   W  CS  L+Y   N     +  +  ++K  + +L++SGDQD+ I  T TR++ + 
Sbjct  351   GVT-NWHVCSVVLEYDRSNEERPTIHVVRSLVKSGLAVLVYSGDQDSIIAFTGTRSLVSK  409

Query  1039  LARELKLIAFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQ  1218
             +A++L+L     +  W  G Q+ GW+Q +G +        L+FA++RGA+H  P T P +
Sbjct  410   IAKDLRLKTTVPYRAWLSGNQVGGWTQVYGDN--------LSFATIRGASHTAPSTQPKR  461

Query  1219  ALTLFRAFLKGYPPP  1263
             +L LF++FL+  P P
Sbjct  462   SLLLFKSFLEKKPLP  476



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/425 (44%), Positives = 257/425 (60%), Gaps = 20/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA +    S PL LWLNGGPGCSS+G GAF E GPF P   G  LVKN  SWN 
Sbjct  58    LFYYFVEAHSHAS-SKPLALWLNGGPGCSSIGGGAFTELGPFYPNGTGRGLVKNSNSWNK  116

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +N+L+LESP GVG+SYSN S DY  +ND KTA+D++ F+L WF  FP+Y++ + Y+TGE
Sbjct  117   AANILFLESPAGVGWSYSNRSEDYSIYNDAKTAKDSVTFLLRWFDAFPEYKSREFYITGE  176

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHY+PQLA  +L YNK      F +K IA+GNP L++ I   +  +FLWSHG ISD 
Sbjct  177   SYAGHYVPQLAAALLDYNKAAGHSVFNVKGIAIGNPALNLAIDTASTYDFLWSHGLISDK  236

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                     C  +     +   N+S EC      +  E+G  ++  D++L +C+ S  +Q+
Sbjct  237   TYEGLGRSCYWSDYDHGSGNNNVSAECNQFISNSALEMGDHVNPYDIILDVCVPSIVEQE  296

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                 +        ++  R    D C++   Y Y   PEVQKALHANTT LP+ W  C G 
Sbjct  297   FRLKK--------RMGHRSIGVDVCMSYERYYYFNLPEVQKALHANTTGLPYPWTNCDGP  348

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             +QY + ++  +I+P L ++LK+ + + +FSGD+D  +P   TR   N LA+ELKL     
Sbjct  349   VQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELKLRTTAS  408

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+   Q+ GW++SFG          LTFA+VRGAAH VP   P++AL LF+ F+ G 
Sbjct  409   YKAWFLRTQVGGWAESFGN---------LTFATVRGAAHMVPLAQPARALLLFQKFISGQ  459

Query  1255  PPPRT  1269
             P P +
Sbjct  460   PLPAS  464



>ref|XP_009355267.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=462

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 196/428 (46%), Positives = 266/428 (62%), Gaps = 39/428 (9%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEA+  +P S PL LWLNGGPGCSS+G GAF+EHGPFQP  D  L+K  +SWN E
Sbjct  63    LFYYFVEAQT-DPASKPLVLWLNGGPGCSSVG-GAFIEHGPFQPSGD-ILLKKDFSWNRE  119

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +NMLYLESP GVGFSYS   S Y   ND  TA+DNL F+  WF +FP+Y+N DL++TG S
Sbjct  120   ANMLYLESPAGVGFSYSANKSFYGFVNDDITARDNLEFLQRWFDEFPEYKNRDLFITGVS  179

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             YAGHY+PQLA L+++   K     F LKA+A+GNPLL+ +  I++ AE+ WSHG ISD  
Sbjct  180   YAGHYVPQLAQLIIQSKLK-----FNLKAVAIGNPLLEFNTDINSRAEYWWSHGLISDAT  234

Query  538   LAMKRSICNDTRAIL-ENIQGN-MSNECILVNGATGEEV-GSDIDSSDLLLPICLSSNAK  708
              A   S+CN +     E I+G  ++  C  V      EV G  I+  D+ L +CLSS   
Sbjct  235   FANLTSVCNYSEIFRQERIRGGPLTPACDAVANQFEREVPGHLINRYDVTLDVCLSSVEA  294

Query  709   QQMVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCS  888
             Q                 ++    D CL D I +YL RP+VQ+ALHA  T     W FCS
Sbjct  295   QSFQL-------------RKTVKIDVCLVDEIVSYLNRPDVQEALHARIT----NWTFCS  337

Query  889   --GTLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLI  1062
                 +QY ++N+ + ++P L E++K  I +L++SGDQD+ IP+T TRT+ N LA++L L 
Sbjct  338   NRAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIPLTSTRTLVNGLAKDLGLQ  397

Query  1063  AFERHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAF  1242
                 +  W    Q+AGW+Q +  +        L++A++RGA HE P + P ++L LF +F
Sbjct  398   TNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGHEAPISQPERSLLLFASF  449

Query  1243  LKGYPPPR  1266
             L+G P P+
Sbjct  450   LRGKPLPK  457



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/422 (44%), Positives = 253/422 (60%), Gaps = 26/422 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGNLVKNKYSWNLE  180
             LFYYFVEAE ++P S PL LWLNGGPGCSS+G GAF EHGPF+P  +  L KN YSWN E
Sbjct  60    LFYYFVEAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEKNDYSWNKE  118

Query  181   SNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGES  360
             +N+LYLESP GVGFSYS+  S Y    D  TA+DNL F+  WF KFP+Y N+D ++TGES
Sbjct  119   ANVLYLESPAGVGFSYSSNKSFYILVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGES  178

Query  361   YAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDDL  537
             Y GHY+PQLA L+++         F LK IA+GNPLL+ +   +A +E+ WSHG ISD  
Sbjct  179   YGGHYVPQLAQLIVQTKTH-----FNLKGIAIGNPLLEFNTDFNARSEYFWSHGLISDST  233

Query  538   LAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQM  717
               +   +CN +    +   GN+   C   +     EV   +D  D+ L +CLSS  +Q  
Sbjct  234   FEILTRVCNYSSIRRQRQNGNLGGVCEKASKQLYAEVSDYVDEYDVTLDVCLSSVNQQAY  293

Query  718   VFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGTL  897
             V  +   +    KID        C+ D+   YL R EVQ+ALHA    +   W  CS  L
Sbjct  294   VLHQ---LQETQKIDV-------CVGDKTITYLNRKEVQEALHAKLVGVT-KWSTCSSVL  342

Query  898   QYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFERH  1077
              Y   N+    +P L  ++K  I +L++SGDQD+ IP+  +R + N LA+E+ L     +
Sbjct  343   HYDYSNLEIPTIPILGSLVKSGIRVLVYSGDQDSVIPLISSRYLVNGLAKEIGLETTVAY  402

Query  1078  GPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGYP  1257
               W++  Q+AGW+Q++G          L++A++RGA+HE PFT P ++L L +AFL G  
Sbjct  403   RAWFEEKQVAGWTQTYG--------DMLSYATIRGASHEAPFTQPQRSLVLLKAFLDGKQ  454

Query  1258  PP  1263
              P
Sbjct  455   LP  456



>ref|XP_002321745.2| hypothetical protein POPTR_0015s11610g [Populus trichocarpa]
 gb|EEF05872.2| hypothetical protein POPTR_0015s11610g [Populus trichocarpa]
Length=494

 Score =   357 bits (917),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 272/425 (64%), Gaps = 22/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQP-GRDGNLVKNKYSWNL  177
             LFYYFVEAE  +P S PL LWLNGGPGCSSLG GAF E+GPF+P GR   L++N++SWN 
Sbjct  89    LFYYFVEAEI-DPESKPLVLWLNGGPGCSSLGLGAFSENGPFRPEGR--VLIRNEHSWNR  145

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
             E+NMLYLE+P+GVGFSY+  SS +   +D  TA+DNL F+  WF KFP+YR++DL++ GE
Sbjct  146   EANMLYLETPVGVGFSYATNSSSFVAVDDEATARDNLLFLQGWFHKFPRYRSTDLFIAGE  205

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHYIPQLA LM++ NKK+ +  F LK IALGNP+LD    +++ AE+ WSHG ISD 
Sbjct  206   SYAGHYIPQLAKLMIEVNKKEKL--FNLKGIALGNPVLDFATDLNSRAEYFWSHGLISDS  263

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                M  S CN +R + E  + ++S+ C +V      E    +D  D+ L +C+SS     
Sbjct  264   TYKMFTSACNYSRYVSEYYRDSVSSICSIVMKQVNTETSRFVDKYDVTLDVCVSS-----  318

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
              VF ++  ++   ++ +R+   D C+ D    YL R +V++ALHA    +   W+ CS  
Sbjct  319   -VFSQSKFISP-KQVSERI---DVCIEDETVNYLNRKDVRRALHARLIGVR-RWEVCSNI  372

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             L Y+  NI       +  ++K  IP+L++SGDQD+ IP+T +RT+ + +A+EL L     
Sbjct  373   LDYEFLNIEKPTFNIVGSLIKAEIPVLVYSGDQDSVIPLTGSRTLVHRVAKELGLNTTVP  432

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+ G Q  G +  +       N + L+FA++RGA+HE PF+ P ++L LF++FL+G 
Sbjct  433   YRVWFAGKQWWGIANKWQ----YPNSNILSFATIRGASHEAPFSQPERSLMLFKSFLEGK  488

Query  1255  PPPRT  1269
               P  
Sbjct  489   HLPEV  493



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/425 (44%), Positives = 257/425 (60%), Gaps = 20/425 (5%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVEA +    S PL LWLNGGPGCSS+G GAF E GPF P   G  LVKN  SWN 
Sbjct  62    LFYYFVEAHSHAS-SRPLALWLNGGPGCSSIGGGAFTELGPFYPNGTGRGLVKNSNSWNK  120

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +N+L+LESP GVG+SYSN S DY  +ND KTA+D++ F+L WF  FP+Y++ + Y+TGE
Sbjct  121   AANILFLESPAGVGWSYSNRSEDYSIYNDAKTAKDSVTFMLRWFDAFPEYKSREFYITGE  180

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHY+PQLA  +L YNK      F +K +A+GNP L++ I   +  +FLWSHG ISD 
Sbjct  181   SYAGHYVPQLAAALLDYNKAAGHSVFNVKGVAIGNPALNLAIDTASTYDFLWSHGLISDK  240

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
                     C  +     +   N+S EC      +  E+G  ++  D++L +C+ S  +Q+
Sbjct  241   TYEGLGRSCYWSDYDHGSGNNNVSAECNQFISNSALEMGDHVNPYDIILDVCVPSIVEQE  300

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
                 +        ++  R    D C++   Y Y   PEVQKALHANTT LP+ W  C G 
Sbjct  301   FRLKK--------RMGHRSIGVDVCMSYERYYYFNLPEVQKALHANTTGLPYPWTNCDGP  352

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             +QY + ++  +I+P L ++LK+ + + +FSGD+D  +P   TR   N LA+ELKL     
Sbjct  353   VQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELKLRTTAS  412

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+   Q+ GW++SFG          LTFA+VRGAAH VP   P++AL LF+ F+ G 
Sbjct  413   YKAWFLRTQVGGWAESFGN---------LTFATVRGAAHMVPLAQPARALLLFQKFISGQ  463

Query  1255  PPPRT  1269
             P P +
Sbjct  464   PLPAS  468



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 194/434 (45%), Positives = 266/434 (61%), Gaps = 24/434 (6%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDGN-LVKNKYSWNL  177
             LFYYFVEAE   P   PLTLWLNGGPGCSS+G GAF E GPF P  DG  L +N  SWN 
Sbjct  61    LFYYFVEAE-NGPDKKPLTLWLNGGPGCSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNR  119

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              SN+L++ESP GVG+SYSN +SDY N  D+ TA D L F+ +W++KFP YR+ +L+LTGE
Sbjct  120   ASNLLFVESPAGVGWSYSNKTSDY-NSGDSSTATDMLLFLRKWYEKFPSYRSRELFLTGE  178

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDAA-EFLWSHGAISDD  534
             SYAGHYIPQLA+++L YN       F +K +A+GNPLL +D    A  E+ WSHG ISD+
Sbjct  179   SYAGHYIPQLANVLLDYNAHSTGFKFNIKGVAIGNPLLKLDRDAQATYEYFWSHGMISDE  238

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
             +     + C+    +  +   N+S  C        E VG  I++ D++L +C  S  +Q+
Sbjct  239   IGLAITNDCDFDDYVFASTH-NVSKSCNEAINEANEIVGDYINNYDVILDVCYPSIVEQE  297

Query  715   MVFFRNNLVTTLTKIDKRVAAG-DPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSG  891
             +          L K+  +++ G D C+T     Y   PEVQKALHAN T LP+ W  CSG
Sbjct  298   L---------RLKKMATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQWSMCSG  348

Query  892   TLQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFE  1071
              L Y   +   +I+P L +I+++HIP+ +FSGDQD+ +P+  +RT+   LA +LK     
Sbjct  349   VLNYSDTDPNIDILPVLKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITV  408

Query  1072  RHGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKG  1251
              +G W+   Q+ GW   +G        + LTFA+VRGAAH VP+  PS+AL LF +F+  
Sbjct  409   PYGAWFHKGQVGGWVTEYG--------NLLTFATVRGAAHMVPYAQPSRALHLFSSFVLR  460

Query  1252  YPPPRTS*GPLLED  1293
                P T+  P ++D
Sbjct  461   KRLPNTT-HPSIDD  473



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 260/425 (61%), Gaps = 29/425 (7%)
 Frame = +1

Query  1     LFYYFVEAEAQNPLSLPLTLWLNGGPGCSSLGYGAFMEHGPFQPGRDG-NLVKNKYSWNL  177
             LFYYFVE+   +P S PL LWLNGGPGCSS+G GAF EHGPF+P   G  LV+N YSWN 
Sbjct  67    LFYYFVES-TTDPASKPLVLWLNGGPGCSSIGQGAFTEHGPFKPTAMGLGLVENPYSWNR  125

Query  178   ESNMLYLESPIGVGFSYSNTSSDYFNWNDTKTAQDNLRFVLEWFKKFPQYRNSDLYLTGE  357
              +NMLYL+SP GVGFSYS  SSDY+  ND  TA+DN+ F+L WF KFP+Y+NS+ ++TGE
Sbjct  126   VANMLYLDSPTGVGFSYSANSSDYYLVNDEMTARDNMMFLLGWFSKFPKYQNSEFFITGE  185

Query  358   SYAGHYIPQLADLMLKYNKKKNIRAFKLKAIALGNPLLDIDISIDA-AEFLWSHGAISDD  534
             SYAGHY PQLA L+L+   + NI   KLK I +GNPLLD D   ++ AE+LWSHG ISD 
Sbjct  186   SYAGHYAPQLAQLILQ--TQPNI---KLKGIMIGNPLLDFDTDFNSRAEYLWSHGLISDS  240

Query  535   LLAMKRSICNDTRAILENIQGNMSNECILVNGATGEEVGSDIDSSDLLLPICLSSNAKQQ  714
               +     CN      +   GN+S  C  V           ID+ D+   +CL       
Sbjct  241   TYSRFTKACNFATYKRQKRIGNISTICSDVYHEVVTSTSRFIDTFDVTSDVCLD------  294

Query  715   MVFFRNNLVTTLTKIDKRVAAGDPCLTDRIYAYLQRPEVQKALHANTTYLPWTWDFCSGT  894
               F + + +      +K     D CL D    YL R +VQKALH+    +P+ W  C+  
Sbjct  295   --FLQAHRLLHPHSGEKM----DVCLEDHTAKYLNRQDVQKALHSRVVGMPY-WSTCTSV  347

Query  895   LQYQMQNIASNIMPTLSEILKHHIPILLFSGDQDTKIPVTQTRTIANMLARELKLIAFER  1074
             + Y  QN+ +  +  L  ++K  + +L +SGDQD+ IP+T TRT+   LA++L L   E 
Sbjct  348   MLYDFQNLENPTLSLLGTLVKAGVRVLAYSGDQDSFIPLTGTRTLVKGLAKDLGLNTTEV  407

Query  1075  HGPWYDGVQIAGWSQSFGGSILGKNVSFLTFASVRGAAHEVPFTSPSQALTLFRAFLKGY  1254
             +  W+DG Q+AGW++ +GG        FL+FA++RGAAH  PF+ P + L LF++F++G 
Sbjct  408   YRVWFDGKQVAGWTEVYGG--------FLSFATIRGAAHAAPFSQPERLLVLFKSFVEGK  459

Query  1255  PPPRT  1269
              PP +
Sbjct  460   SPPTS  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5368531198704