BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25235_g4_i2 len=901 path=[6414:0-289 6704:290-397 6812:398-422
12517:423-438 12533:439-469 12564:470-547 12642:548-576
18094:577-609 12704:610-667 12762:668-671 12766:672-713
12807:714-746 7808:747-816 12908:817-821 7944:822-900]

Length=901
                                                                      Score     E

dbj|BAF95866.1|  pectin methylesterase isoform alpha                    251   1e-78   Vitis hybrid cultivar
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     256   6e-78   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          258   7e-78   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          256   7e-77   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     254   3e-76   Vitis vinifera
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     253   9e-76   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     253   1e-75   
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     243   1e-75   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     253   2e-75   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   247   4e-75   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     250   1e-74   
ref|NP_001042866.1|  Os01g0312500                                       245   3e-74   Oryza sativa Japonica Group [Japonica rice]
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               242   5e-74   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             249   6e-74   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            248   6e-74   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     248   7e-74   
gb|AHB84678.1|  pectin methylesterase                                   248   7e-74   
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     238   1e-73   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     248   1e-73   
emb|CDP15270.1|  unnamed protein product                                248   1e-73   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         244   1e-73   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    248   1e-73   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 247   1e-73   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     246   3e-73   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    245   1e-72   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     245   1e-72   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          245   1e-72   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70505.1|  hypothetical protein OsI_01594                          245   1e-72   Oryza sativa Indica Group [Indian rice]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     243   2e-72   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    244   3e-72   
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     234   3e-72   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     243   5e-72   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     243   5e-72   
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    236   1e-71   Actinidia deliciosa [Chinese gooseberry]
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     240   1e-71   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           234   1e-71   Vigna radiata var. radiata [golden gram]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    243   2e-71   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     242   2e-71   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     241   2e-71   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             241   3e-71   
gb|EPS62329.1|  pectinesterase                                          241   4e-71   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    240   7e-71   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    240   9e-71   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     240   1e-70   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   235   1e-70   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     240   1e-70   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    240   2e-70   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     238   2e-70   
emb|CBI38888.3|  unnamed protein product                                230   2e-70   
gb|KGN44975.1|  Pectinesterase                                          240   2e-70   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    239   3e-70   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    238   7e-70   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     238   9e-70   
gb|AAN84553.1|  methyl pectinesterase                                   227   1e-69   Lolium perenne [perennial ryegrass]
gb|AGG23325.1|  pectin methylesterase 1                                 237   2e-69   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     237   2e-69   
gb|ACQ85264.1|  pectin methylesterase                                   237   2e-69   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     236   2e-69   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     237   2e-69   
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    236   2e-69   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     236   2e-69   
ref|XP_002322401.1|  putative pectin methylesterase family protein      235   3e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     235   3e-69   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   233   6e-69   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             234   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             235   1e-68   
dbj|BAJ96804.1|  predicted protein                                      234   1e-68   
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         233   1e-68   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   231   2e-68   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    232   2e-68   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     234   2e-68   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        233   2e-68   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     234   2e-68   
emb|CBI24582.3|  unnamed protein product                                225   3e-68   
ref|XP_007038413.1|  Pectinesterase                                     232   4e-68   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               230   6e-68   Ricinus communis
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    231   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     231   1e-67   
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   231   1e-67   
emb|CDO97717.1|  unnamed protein product                                223   1e-67   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        231   1e-67   Vitis vinifera
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   230   2e-67   
gb|EMT27728.1|  Pectinesterase                                          227   2e-67   
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                231   2e-67   
gb|ABK94644.1|  unknown                                                 224   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   228   3e-67   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    230   3e-67   
gb|ACN40984.1|  unknown                                                 231   3e-67   Picea sitchensis
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        229   3e-67   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             229   4e-67   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               230   5e-67   Ricinus communis
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        229   5e-67   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                     229   5e-67   Vitis vinifera
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   230   6e-67   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     228   6e-67   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               229   7e-67   Ricinus communis
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          230   8e-67   Sorghum bicolor [broomcorn]
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    229   8e-67   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    227   1e-66   
emb|CBI24284.3|  unnamed protein product                                220   2e-66   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   228   2e-66   
emb|CDP20891.1|  unnamed protein product                                228   2e-66   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   228   2e-66   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     227   2e-66   
emb|CBI24285.3|  unnamed protein product                                226   2e-66   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     228   2e-66   
gb|KHN35618.1|  Pectinesterase 2                                        223   2e-66   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             226   2e-66   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                228   3e-66   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   227   3e-66   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     227   3e-66   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   227   3e-66   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        227   3e-66   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             227   4e-66   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   227   4e-66   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   227   4e-66   
gb|EMS45437.1|  Pectinesterase                                          221   4e-66   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     227   4e-66   
ref|XP_002318285.1|  putative pectin methylesterase family protein      226   5e-66   Populus trichocarpa [western balsam poplar]
emb|CAN76835.1|  hypothetical protein VITISV_043176                     226   5e-66   Vitis vinifera
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   218   5e-66   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   226   6e-66   Vitis vinifera
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   226   6e-66   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   226   6e-66   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 227   8e-66   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        226   9e-66   
gb|KHN25547.1|  Pectinesterase 2                                        221   1e-65   
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40     223   1e-65   
ref|NP_001060620.1|  Os07g0675100                                       227   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        225   1e-65   Vitis vinifera
gb|EEC82670.1|  hypothetical protein OsI_27314                          227   1e-65   Oryza sativa Indica Group [Indian rice]
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     225   2e-65   
gb|KHN42767.1|  Pectinesterase 2                                        223   2e-65   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       226   2e-65   
emb|CDP20872.1|  unnamed protein product                                225   2e-65   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   225   2e-65   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            226   2e-65   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   224   2e-65   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   225   2e-65   
ref|XP_002317208.1|  pectin methylesterase family protein               225   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     223   3e-65   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     224   3e-65   Vitis vinifera
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   225   3e-65   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   228   4e-65   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 225   4e-65   
gb|AHC69829.1|  pectin methylesterase PME2.1                            225   4e-65   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   228   5e-65   
gb|EMT05022.1|  Pectinesterase 3                                        223   5e-65   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   224   5e-65   
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    224   6e-65   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             226   6e-65   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     225   6e-65   
gb|AGV54687.1|  pectinesterase                                          225   7e-65   
gb|EPS67066.1|  pectinesterase                                          229   8e-65   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    223   8e-65   Populus trichocarpa [western balsam poplar]
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    223   9e-65   
gb|ABQ42392.1|  pectin methylesterase-like protein                      225   1e-64   Taiwania cryptomerioides
ref|XP_011000694.1|  PREDICTED: pectinesterase                          224   1e-64   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 221   2e-64   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   222   2e-64   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   222   2e-64   
gb|KHN35620.1|  Pectinesterase 2                                        218   3e-64   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   222   3e-64   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    222   3e-64   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          223   3e-64   
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     223   4e-64   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         222   4e-64   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          221   5e-64   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          222   5e-64   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    222   6e-64   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        221   6e-64   
gb|AFW03479.1|  pectin methylesterase 5                                 221   6e-64   
emb|CBI36882.3|  unnamed protein product                                222   7e-64   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   221   7e-64   
ref|NP_001146685.1|  pectinesterase precursor                           222   8e-64   Zea mays [maize]
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   8e-64   
gb|KCW73024.1|  hypothetical protein EUGRSUZ_E01466                     221   8e-64   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      221   8e-64   
ref|XP_002268492.2|  PREDICTED: probable pectinesterase/pectinest...    221   8e-64   Vitis vinifera
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   221   8e-64   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   220   1e-63   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   1e-63   
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   220   1e-63   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    221   1e-63   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   221   2e-63   
gb|EPS67025.1|  pectinesterase                                          211   2e-63   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             220   2e-63   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     219   2e-63   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     219   3e-63   
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             220   3e-63   
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    216   4e-63
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     219   4e-63   
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    220   4e-63   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   219   4e-63   
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                218   5e-63   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   219   5e-63   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   218   5e-63   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         218   5e-63   
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    219   6e-63   
gb|ACN40878.1|  unknown                                                 221   7e-63   Picea sitchensis
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   218   7e-63   
emb|CDP17208.1|  unnamed protein product                                218   7e-63   
gb|ABK24761.1|  unknown                                                 219   8e-63   Picea sitchensis
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   218   8e-63   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     218   9e-63   
emb|CAN60506.1|  hypothetical protein VITISV_022717                     211   1e-62   Vitis vinifera
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          218   1e-62   
ref|XP_010058469.1|  PREDICTED: pectinesterase 2-like                   219   1e-62   
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    219   1e-62   
ref|XP_010098938.1|  Pectinesterase 2                                   218   1e-62   
gb|KDO40320.1|  hypothetical protein CISIN_1g048471mg                   207   2e-62   
dbj|BAM05619.1|  pectin methylesterase 3                                207   2e-62   
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    218   2e-62   
dbj|BAM05618.1|  pectin methylesterase 3                                207   2e-62   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     217   2e-62   
ref|XP_009389951.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-62   
gb|AAF23891.1|  pectin methyl esterase                                  217   2e-62   Solanum tuberosum [potatoes]
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   217   2e-62   
gb|AFC98398.1|  pectin methylesterase                                   218   2e-62   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             216   2e-62   
ref|NP_001274785.1|  pectin methyl esterase                             217   3e-62   
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    218   3e-62   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   216   3e-62   
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             208   3e-62   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     213   3e-62   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 217   3e-62   Ricinus communis
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   216   3e-62   
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   216   3e-62   
gb|AFW03484.1|  pectin methylesterase 5                                 216   4e-62   
gb|AAQ21126.1|  pectinesterase                                          207   4e-62   Fragaria x ananassa
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 217   4e-62   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          216   4e-62   
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    218   5e-62   
ref|XP_010269594.1|  PREDICTED: probable pectinesterase/pectinest...    217   5e-62   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    218   5e-62   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    217   5e-62   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        216   5e-62   
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     216   5e-62   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   216   5e-62   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   216   6e-62   
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     217   6e-62   
gb|AAR03544.1|  pectin methylesterase isoform 1                         207   7e-62   Fragaria x ananassa
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     216   8e-62   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   216   9e-62   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   213   9e-62   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     216   9e-62   
ref|XP_007220716.1|  hypothetical protein PRUPE_ppa022308mg             214   9e-62   
emb|CAE76634.1|  pectin methylesterase                                  207   9e-62   Cicer arietinum [garbanzo]
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    209   1e-61   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          215   1e-61   
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-61   
gb|AER38244.1|  PME5                                                    215   1e-61   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    216   1e-61   
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     216   1e-61   
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    216   1e-61   
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    216   1e-61   
ref|XP_003588521.1|  Pectinesterase                                     217   1e-61   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    214   1e-61   Citrus sinensis [apfelsine]
gb|AAF16637.1|AC011661_15  T23J18.24                                    206   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   214   2e-61   
ref|XP_009374496.1|  PREDICTED: probable pectinesterase/pectinest...    214   2e-61   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             215   2e-61   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     215   2e-61   
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            217   2e-61   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     215   2e-61   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            215   2e-61   
ref|NP_001233948.1|  pectinesterase 2.1                                 215   2e-61   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          215   2e-61   
ref|XP_004299718.1|  PREDICTED: probable pectinesterase/pectinest...    215   2e-61   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    215   2e-61   
emb|CBI24581.3|  unnamed protein product                                207   2e-61   
ref|XP_003541559.2|  PREDICTED: probable pectinesterase/pectinest...    215   3e-61   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          215   3e-61   
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             215   3e-61   
ref|XP_010088299.1|  putative pectinesterase/pectinesterase inhib...    215   3e-61   
gb|AFK42744.1|  unknown                                                 207   3e-61   
gb|ACJ02103.1|  pectin methylesterase                                   214   3e-61   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         214   3e-61   
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             215   3e-61   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    214   4e-61   
emb|CAA96436.1|  pectin methylesterase                                  207   4e-61   
emb|CDY22045.1|  BnaA09g00740D                                          214   4e-61   
ref|XP_010674141.1|  PREDICTED: probable pectinesterase/pectinest...    209   4e-61   
ref|XP_006598050.1|  PREDICTED: probable pectinesterase/pectinest...    217   4e-61   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    215   4e-61   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    215   5e-61   
gb|KHN10148.1|  Putative pectinesterase/pectinesterase inhibitor 25     217   5e-61   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          214   5e-61   
ref|XP_003591484.1|  Pectinesterase                                     208   5e-61   
ref|NP_001275775.1|  pectinesterase 2 precursor                         213   5e-61   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  205   5e-61   
ref|XP_009340595.1|  PREDICTED: probable pectinesterase/pectinest...    212   5e-61   
gb|KHN35617.1|  Pectinesterase 2                                        213   6e-61   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    214   6e-61   
gb|AAB67739.1|  pectin methylesterase PME2.1                            214   6e-61   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    214   6e-61   
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             214   7e-61   
gb|AAQ21127.1|  pectinesterase                                          204   7e-61   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     213   8e-61   
ref|XP_004240801.1|  PREDICTED: probable pectinesterase/pectinest...    213   8e-61   
emb|CDY52778.1|  BnaCnng23230D                                          213   8e-61   
gb|KHN10315.1|  Putative pectinesterase/pectinesterase inhibitor 25     216   8e-61   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 213   9e-61   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          213   9e-61   
dbj|BAM05620.1|  pectin methylesterase 3                                203   9e-61   
emb|CAA96434.1|  pectin methylesterase                                  207   1e-60   
ref|XP_008234390.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-60   
emb|CAA96435.1|  pectin methylesterase                                  207   1e-60   
ref|NP_566379.1|  pectinesterase 25                                     205   1e-60   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          213   1e-60   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         207   1e-60   
gb|ABD47734.1|  pectin methylesterase                                   202   1e-60   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                214   1e-60   
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      212   1e-60   
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-60   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    213   2e-60   
emb|CDY18942.1|  BnaC04g04080D                                          205   2e-60   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    213   2e-60   
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    213   2e-60   
gb|KDP30022.1|  hypothetical protein JCGZ_18594                         213   2e-60   
gb|KDO36280.1|  hypothetical protein CISIN_1g027636mg                   203   2e-60   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          213   2e-60   
ref|XP_003591498.1|  Pectinesterase                                     207   2e-60   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          214   2e-60   
ref|XP_008363719.1|  PREDICTED: probable pectinesterase/pectinest...    213   2e-60   
gb|AAM67242.1|  putative pectinesterase                                 204   2e-60   
ref|XP_006369079.1|  pectinesterase family protein                      203   2e-60   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               212   2e-60   
gb|AGR44472.1|  pectin methylesterase 3                                 213   2e-60   
emb|CDP05792.1|  unnamed protein product                                210   2e-60   
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        212   2e-60   
emb|CBI23005.3|  unnamed protein product                                208   2e-60   
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               213   3e-60   
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    211   3e-60   
ref|XP_002872846.1|  predicted protein                                  211   3e-60   
ref|XP_007052106.1|  Pectinesterase 2                                   211   3e-60   
dbj|BAF42040.1|  pectin methylesterase 3                                212   3e-60   
emb|CDO97716.1|  unnamed protein product                                211   4e-60   
ref|XP_008235210.1|  PREDICTED: probable pectinesterase/pectinest...    211   4e-60   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     212   4e-60   
ref|XP_009374495.1|  PREDICTED: probable pectinesterase/pectinest...    210   4e-60   
ref|XP_010096538.1|  Pectinesterase 1                                   203   4e-60   
gb|AAB67740.1|  PME1.9                                                  209   4e-60   
ref|XP_006382446.1|  hypothetical protein POPTR_0005s02250g             209   4e-60   
emb|CDP08022.1|  unnamed protein product                                211   4e-60   
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    212   4e-60   
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             212   4e-60   
ref|NP_563662.1|  pectinesterase 7                                      212   4e-60   
ref|XP_010457268.1|  PREDICTED: probable pectinesterase/pectinest...    212   4e-60   
ref|XP_007199619.1|  hypothetical protein PRUPE_ppa024812mg             210   5e-60   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   212   5e-60   
gb|KHN26434.1|  Putative pectinesterase/pectinesterase inhibitor 47     212   5e-60   
ref|XP_007163133.1|  hypothetical protein PHAVU_001G209200g             211   5e-60   
ref|XP_006357927.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-60   
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   211   5e-60   
ref|XP_002273427.2|  PREDICTED: probable pectinesterase/pectinest...    211   5e-60   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             211   5e-60   
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     211   6e-60   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             211   6e-60   
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     211   6e-60   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    210   7e-60   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             211   7e-60   
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    211   7e-60   
ref|NP_001234151.1|  pectinesterase 1 precursor                         211   7e-60   
ref|XP_007050982.1|  Plant invertase/pectin methylesterase inhibi...    211   7e-60   
ref|XP_002872845.1|  pectinesterase family protein                      209   7e-60   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             212   8e-60   
gb|ABZ89800.1|  pectin methylesterase-like protein                      211   8e-60   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    211   8e-60   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   204   9e-60   
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    210   9e-60   
ref|XP_010481250.1|  PREDICTED: probable pectinesterase/pectinest...    211   9e-60   
ref|XP_003527536.2|  PREDICTED: probable pectinesterase/pectinest...    212   9e-60   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    211   1e-59   
ref|XP_002882002.1|  predicted protein                                  210   1e-59   
ref|XP_006442946.1|  hypothetical protein CICLE_v10023535mg             211   1e-59   
gb|AAB38794.1|  pectin methylesterase                                   208   1e-59   
gb|EYU25227.1|  hypothetical protein MIMGU_mgv1a0032971mg               201   1e-59   
ref|XP_010474855.1|  PREDICTED: probable pectinesterase/pectinest...    211   1e-59   
ref|XP_008376203.1|  PREDICTED: probable pectinesterase/pectinest...    210   1e-59   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     211   1e-59   
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     211   1e-59   
emb|CDP21156.1|  unnamed protein product                                201   1e-59   
ref|NP_001275846.1|  putative thermostable pectinesterase               212   1e-59   
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    210   1e-59   
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    211   1e-59   
ref|XP_010069897.1|  PREDICTED: probable pectinesterase/pectinest...    210   1e-59   
emb|CDY68840.1|  BnaCnng60750D                                          207   2e-59   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    210   2e-59   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    211   2e-59   
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             210   2e-59   
dbj|BAF42038.1|  pectin methylesterase 1                                211   2e-59   
dbj|BAF00855.1|  hypothetical protein                                   210   2e-59   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    210   2e-59   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     209   2e-59   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    209   2e-59   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   201   2e-59   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    209   2e-59   
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   211   2e-59   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-59   
emb|CDY52779.1|  BnaCnng23240D                                          209   2e-59   
ref|NP_172624.1|  methylesterase PCR A                                  209   2e-59   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     209   2e-59   
ref|XP_006306147.1|  hypothetical protein CARUB_v10011654mg             210   2e-59   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    209   2e-59   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     208   3e-59   
emb|CDY34642.1|  BnaC08g42010D                                          207   3e-59   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             209   3e-59   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    210   3e-59   
ref|XP_008446714.1|  PREDICTED: probable pectinesterase/pectinest...    209   3e-59   
gb|AAK59760.1|  At1g11580/T23J18_33                                     209   3e-59   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   210   3e-59   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    208   3e-59   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    203   3e-59   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          209   3e-59   
ref|XP_002523112.1|  Pectinesterase-2 precursor, putative               209   3e-59   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     210   3e-59   
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      209   3e-59   
ref|XP_006480114.1|  PREDICTED: probable pectinesterase/pectinest...    209   3e-59   
emb|CDX95641.1|  BnaC03g25220D                                          207   3e-59   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  203   4e-59   
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    209   4e-59   
ref|XP_004511181.1|  PREDICTED: probable pectinesterase/pectinest...    210   4e-59   
emb|CBI27741.3|  unnamed protein product                                204   4e-59   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   208   4e-59   
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    209   4e-59   
gb|KHN35616.1|  Pectinesterase 2                                        204   4e-59   
ref|XP_004135375.1|  PREDICTED: probable pectinesterase/pectinest...    209   5e-59   
gb|KHN16553.1|  Pectinesterase 2                                        206   5e-59   
ref|XP_003591482.1|  Pectinesterase                                     209   5e-59   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    209   5e-59   
ref|XP_002889876.1|  At1g11580/T23J18_33                                209   6e-59   
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             208   6e-59   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     209   6e-59   
ref|XP_007012502.1|  Pectin methylesterase 3                            209   6e-59   
gb|AFW03480.1|  pectin methylesterase 1                                 209   6e-59   
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               209   6e-59   
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          207   6e-59   
ref|XP_011041973.1|  PREDICTED: probable pectinesterase/pectinest...    209   6e-59   
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    209   6e-59   
emb|CDO97787.1|  unnamed protein product                                201   6e-59   
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     207   6e-59   
ref|XP_011048629.1|  PREDICTED: pectinesterase-like                     209   6e-59   
ref|XP_010040919.1|  PREDICTED: probable pectinesterase/pectinest...    199   7e-59   
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          207   7e-59   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              204   7e-59   
ref|XP_003602238.1|  Pectinesterase                                     209   7e-59   
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    209   7e-59   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative               208   7e-59   
gb|AFB77929.1|  pectin methylesterase                                   209   7e-59   
emb|CDX83392.1|  BnaA03g21140D                                          206   7e-59   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    209   7e-59   
gb|KEH24403.1|  pectinesterase/pectinesterase inhibitor                 208   8e-59   
ref|XP_008375415.1|  PREDICTED: probable pectinesterase/pectinest...    202   8e-59   
gb|KHG08631.1|  Pectinesterase 3                                        209   8e-59   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          208   8e-59   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          208   8e-59   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             209   8e-59   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     208   8e-59   
gb|AFI23415.1|  pectin methylesterase                                   202   8e-59   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    207   9e-59   
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    203   9e-59   
ref|XP_007133557.1|  hypothetical protein PHAVU_011G188900g             209   9e-59   
ref|XP_002304257.2|  pectinesterase family protein                      209   9e-59   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             207   9e-59   
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-58   
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-58   
emb|CDP05321.1|  unnamed protein product                                206   1e-58   
emb|CDY35644.1|  BnaC09g29660D                                          206   1e-58   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             209   1e-58   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-58   
ref|XP_011076333.1|  PREDICTED: probable pectinesterase/pectinest...    206   1e-58   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          209   1e-58   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-58   
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        207   1e-58   
gb|KFK38464.1|  hypothetical protein AALP_AA3G116300                    209   1e-58   
ref|XP_008346152.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-58   
ref|XP_006444394.1|  hypothetical protein CICLE_v10020108mg             205   1e-58   
ref|XP_002320332.1|  pectinesterase family protein                      208   1e-58   
ref|XP_004499739.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    208   1e-58   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-58   
ref|XP_010662407.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-58   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     208   1e-58   
ref|XP_008465623.1|  PREDICTED: probable pectinesterase/pectinest...    198   1e-58   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     208   1e-58   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   207   1e-58   
ref|XP_010556727.1|  PREDICTED: probable pectinesterase/pectinest...    207   2e-58   
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    208   2e-58   
emb|CDX71786.1|  BnaC08g30880D                                          207   2e-58   
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    207   2e-58   
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    206   2e-58   
ref|XP_002322399.1|  putative pectin methylesterase family protein      206   2e-58   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     208   2e-58   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             206   2e-58   
ref|XP_004494387.1|  PREDICTED: probable pectinesterase/pectinest...    207   2e-58   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     207   2e-58   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    199   2e-58   
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    206   3e-58   
ref|XP_004494388.1|  PREDICTED: probable pectinesterase/pectinest...    207   3e-58   



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVV Q CNLY R+P   QKNV TAQGR DP++NTGISI +C+V AAAD
Sbjct  32   VYGTIDFIFGNAAVVLQNCNLYARRPNENQKNVFTAQGRDDPNENTGISIQNCKVAAAAD  91

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S FKSYLGRPW++YSRTV+M S IG LIDPAGWLEW GDFAL TLYYGEYKN+GP
Sbjct  92   LIPVLSSFKSYLGRPWKEYSRTVYMQSNIGDLIDPAGWLEWDGDFALSTLYYGEYKNRGP  151

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FT    I G +WLP T   IPYY  L
Sbjct  152  GSNTSGRVTWPGYRVINSSSVASQFTVGAFIQGDEWLPATG--IPYYSNL  199



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  309  VYGTVDFIFGNAAVVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISILNCKVEAASD  368

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK+YLGRPW++YSRTV + S IGSLIDPAGWLEW GDFAL TLYYGEY N+GP
Sbjct  369  LVPVLSSFKNYLGRPWKQYSRTVILFSNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGP  428

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G++TS RV W GYR+I  +  A  FT  N I G +W+P T+  +P+Y GL  +
Sbjct  429  GSNTSARVKWPGYRVINSSTEASQFTVGNFIQGSEWIPATE--VPFYSGLTSS  479



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY R+P P Q+N+ TAQGR DP+QNTGISI +C+V AAAD
Sbjct  372  VYGTVDFIFGNAAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNTGISIQNCKVAAAAD  431

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRT+FM S IG LIDPAGW EW GDFAL TLYYGEY N+GP
Sbjct  432  LIPVQSSFKNYLGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGP  491

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            GADTSNRV W GYR+I  +  A  FT A+ I G +WLP ++  + +Y GLK
Sbjct  492  GADTSNRVKWPGYRVINSSSEASQFTVASFIQGNEWLPASN--VAFYAGLK  540



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  394  VYGTVDFIFGNAAVVLQNCNLYARKPNPNQKNMFTAQGREDPNQNTGISILNCKVEAASD  453

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK+YLGRPW++YSRTV ++S IGSLIDPAGWLEW GDFAL TLYYGEY N+GP
Sbjct  454  LVPVVSSFKNYLGRPWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGP  513

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G++TS RV W GYR+I  +  A  FT  N I G +W+P T   +P+Y GL  +
Sbjct  514  GSNTSARVKWPGYRVINSSSEASQFTVGNFIQGSEWIPATG--VPFYSGLTSS  564



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVV Q CNLY R+P   QKNV TAQGR DP++NTGISI +C+V AAAD
Sbjct  391  VYGTIDFIFGNAAVVLQNCNLYARRPNANQKNVFTAQGRDDPNENTGISIQNCKVAAAAD  450

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S FKSYLGRPW++YSRTV+M S IG+LIDPAGWLEW GDFAL TLYYGEYKN+GP
Sbjct  451  LIPVLSSFKSYLGRPWKEYSRTVYMQSNIGNLIDPAGWLEWDGDFALSTLYYGEYKNRGP  510

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FT    I G +WLP T   IPYY  L
Sbjct  511  GSNTSGRVTWPGYRVINSSSVASQFTVGAFIQGDEWLPATG--IPYYSNL  558



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   253 bits (647),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V+AAAD
Sbjct  397  VYGTVDFIFGNAAVVLQNCNLYARKPDPNQKNLFTAQGREDPNQNTGISILNCKVEAAAD  456

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRTV + S IGSLI+PAGWLEW GDFALKTLYYGEY N+GP
Sbjct  457  LIPVQSSFKNYLGRPWKEYSRTVVLQSYIGSLIEPAGWLEWNGDFALKTLYYGEYMNRGP  516

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G+ TS RV W GYR+I  +  A  FT  N I GG+WLP T    P+Y  L  +
Sbjct  517  GSSTSARVKWPGYRVINSSIEASQFTVGNFIQGGEWLPPTG--FPFYLNLTSS  567



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  390  VYGTVDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVEAASD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK+YLGRPW++YSRTVF+LS IGSLIDPAGWLEW G+FAL TLYYGEY NKGP
Sbjct  450  LVPVLSSFKNYLGRPWKQYSRTVFLLSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNKGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G++T+ RV W GYR+I  +  A  F   N + G  WLP T    P++ GL  +
Sbjct  510  GSNTNARVKWPGYRVINSSAEASQFNVGNFLQGSQWLPATG--FPFFLGLTSS  560



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFG++AVVFQ CNLY RKP P QKN+ TAQGR DP+QNTGISI  C+V AA+D
Sbjct  72   VYGTVDFIFGDAAVVFQNCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASD  131

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F +YLGRPW++YSRTVFM S +GSLI+PAGWLEW GDFAL TLYYGEY N GP
Sbjct  132  LIPVQSNFSTYLGRPWKQYSRTVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNLGP  191

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  A  A  FT  + I G  WL  T   +P+  GL
Sbjct  192  GSNTSRRVTWPGYRVITSAAEASNFTVQSFIQGDQWLGAT--SVPFTSGL  239



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CNLY RKP P Q+N+ TAQGR DP+QNTGISIL+C+V+AAAD
Sbjct  398  IYGTVDFIFGNAAVVLQNCNLYARKPDPNQRNLFTAQGREDPNQNTGISILNCKVEAAAD  457

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+S FK+YLGRPW++YSRTVF+ S IGSLI+PAGWLEW G+FALKTLYYGEY N+GP
Sbjct  458  LVPVQSSFKNYLGRPWKEYSRTVFLQSYIGSLIEPAGWLEWNGNFALKTLYYGEYMNRGP  517

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYY  400
            G++TS RV W GYR+I  +     FT  N I GG+WLP T    P+Y
Sbjct  518  GSNTSVRVKWPGYRVINSSAETSQFTVGNFIQGGEWLPATG--FPFY  562



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP   QKN+ITAQGR DP+QNTGISIL+C+V AA+D
Sbjct  231  VYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASD  290

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIP +++FK+YLGRPW++YSRTVFMLS +G LI PAGWLEW G FAL TL+YGEYKN+GP
Sbjct  291  LIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGP  350

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FTA   + G +WL  T   IP+Y  L
Sbjct  351  GSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTG--IPFYLNL  398



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP P QKN+ TAQGR DP+QNTGISI  C+V AA+D
Sbjct  390  VYGTVDFIFGNAAVVLQSCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F +YLGRPW++YSRTVFM S +GSLIDPAGWLEW GDFAL TLYYGEY N+GP
Sbjct  450  LIPVQSNFSTYLGRPWKQYSRTVFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  A  A  FT A+ I G  WL  T   +P+  GL
Sbjct  510  GSNTSRRVTWPGYRVITSAAEASNFTVASFIQGDQWLGAT--SVPFTSGL  557



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGNSAVVFQ CNLY R+PLP Q NV TAQGR DP+QNTGISI  C+V AA+D
Sbjct  259  IYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASD  318

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V+S FK+YLGRPW++YSRTVFM S++ S+++PAGWLEW G+FAL TLYYGEY+N GP
Sbjct  319  LLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGP  378

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRV W GYR+I  A  A  FT  N IDG  WL  T   +P+  GL
Sbjct  379  GASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGT--SVPFTVGL  426



>gb|EYU46749.1| hypothetical protein MIMGU_mgv1a0044631mg, partial [Erythranthe 
guttata]
Length=325

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ  NLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  155  VYGTVDFIFGNAAVVFQNSNLYARKPDPNQKNIFTAQGREDPNQNTGISILNCKVAAAAD  214

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F+++LGRPW+ YSRTVFM S + +++DP GWLEW GDFAL T YY EYKN+GP
Sbjct  215  LIPVLSQFRTFLGRPWKLYSRTVFMFSNMEAVVDPKGWLEWDGDFALNTSYYREYKNRGP  274

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G++T+ RVTW GY ++  +  A  FT AN I G  WLP T    P++P L  T
Sbjct  275  GSNTTARVTWTGYAVLNSSTEASQFTVANFIQGNQWLPATG--FPFFPNLTAT  325



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+A V Q CNLY RKP P QKN+ TAQGR DP+QNTGISI++C+V AAAD
Sbjct  433  VYGTVDFIFGNAAAVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISIINCKVAAAAD  492

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+FK+YLGRPW+KYSRTV++ S +  LIDPAGWLEW G+FAL TLYYGEY N+GP
Sbjct  493  LIPVKSEFKNYLGRPWKKYSRTVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGP  552

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RVTW GYR+I  +  A  FT AN I G +WL  T   IP++ GL
Sbjct  553  GANTSRRVTWPGYRVITNSTEASQFTVANFIQGNEWL--TSLGIPFFSGL  600



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP   QKN+ITAQGR DP+QNTGISIL+C+V AA+D
Sbjct  379  VYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASD  438

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIP +++FK+YLGRPW++YSRTVFMLS +G LI PAGWLEW G FAL TL+YGEYKN+GP
Sbjct  439  LIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGP  498

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FTA   + G +WL  T   IP+Y  L
Sbjct  499  GSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTG--IPFYLNL  546



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 133/173 (77%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C+V AA+D
Sbjct  390  VYGTVDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVAAASD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK+YLGRPW++YSRTVF+ S IGSLIDPAGWLEW G+FAL TLYYGEY N GP
Sbjct  450  LVPVLSSFKNYLGRPWKQYSRTVFLRSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNNGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G+ TS RV W GYR+I  +  A  FT  N I G  WLP T    P++  L  +
Sbjct  510  GSITSARVKWPGYRVINSSAEASQFTVGNFIQGSQWLPATG--FPFFLSLTSS  560



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP   QKN+ITAQGR DP+QNTGISIL+C+V AA+D
Sbjct  400  VYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASD  459

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIP +++FK+YLGRPW++YSRTVFMLS +G LI PAGWLEW G FAL TL+YGEYKN+GP
Sbjct  460  LIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGP  519

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FTA   + G +WL  T   IP+Y  L
Sbjct  520  GSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTG--IPFYLNL  567



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V A +D
Sbjct  69   VYGTVDFIFGNAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSD  128

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F +YLGRPW++YSRTV++ S I  L+DPAGWLEW G FAL TLYYGEY N+GP
Sbjct  129  LIPVKSNFTTYLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGP  188

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT    I G DWL  T+  IPY+ GL
Sbjct  189  GSNTSARVTWPGYRVINSSVEASQFTVGEFIQGSDWLNSTN--IPYFLGL  236



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL  ++ +AAD
Sbjct  392  VYGTVDFIFGNAAVVLQNCNLYARKPNDNQKNIFTAQGREDPNQNTGISILSGKIASAAD  451

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPVES FK+YLGRPW++YSRTVFML+ IGSLIDPAG+LEW G FAL TLYYGEY N+GP
Sbjct  452  LIPVESTFKNYLGRPWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFALSTLYYGEYMNRGP  511

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT  N I+G +WLP  D   P+Y  L
Sbjct  512  GSNTSARVTWPGYRVINTSAEASLFTVGNFIEGKEWLP--DTGFPFYVNL  559



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY R+P P Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  417  VYGTVDFIFGNAAVVFQLCNLYARRPNPNQQNLFTAQGREDPNQNTGISILNCKVAAAAD  476

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S F+SYLGRPW++YSRTV++LS + SLIDPAGWL W G FAL TL+YGEYKN+GP
Sbjct  477  LLPVLSSFRSYLGRPWREYSRTVYLLSNMESLIDPAGWLPWNGSFALSTLFYGEYKNRGP  536

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RV W GYR+I    VA  FT  N I G  WLP T   IP+YP L
Sbjct  537  GSNTTARVKWPGYRVITNTTVASQFTVGNFIQGTAWLPNTG--IPFYPNL  584



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ CNLY R+P   QKN++TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  262  VYGTIDFIFGNAAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAAD  321

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRTV++ S I  LIDPAGWLEW GDFALKTLYYGEY N+GP
Sbjct  322  LIPVKSSFKTYLGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGP  381

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G++TS RVTW GYR+I  +  A  F     I G +WL  T   +P+  GL 
Sbjct  382  GSNTSGRVTWPGYRVINNSAEASQFAVEPFIQGSEWLNATG--VPFSLGLN  430



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP   QKN+ITAQGR DP+QNTGISIL+C+V AA+D
Sbjct  400  VYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASD  459

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIP +++FK+YLGRPW++YSRTVFMLS +G LI PAGWLEW G FAL TL+YGEYKN+GP
Sbjct  460  LIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGP  519

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  + VA  FTA   + G +WL  T   IP+Y  L
Sbjct  520  GSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTG--IPFYLNL  567



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY RKP P+QKN+ TAQGR DP+QNTGISIL+C++ AAAD
Sbjct  389  VYGTVDFIFGNAAVVFQNCNLYARKPDPKQKNLFTAQGREDPNQNTGISILNCKIAAAAD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW+KYSRTV++ S I +LIDPAGWLEW G FAL TL+YGEYKN+GP
Sbjct  449  LIPVQSTFKSYLGRPWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GY++I  A  A  FT    I G +WL  T   +P++  L
Sbjct  509  GSNTSARVTWPGYKVITNATEASQFTVRQFIQGNEWLNSTG--VPFFLDL  556



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  393  IYGTVDFIFGNAAVVFQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVAAAAD  452

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRTV+MLS I  ++DPAGWLEW G FAL TLYY EY+N+GP
Sbjct  453  LIPVKSSFKTYLGRPWKEYSRTVYMLSNIEDVVDPAGWLEWNGTFALNTLYYAEYRNQGP  512

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G++TS RVTW GY+++     A  FT ++ I G DWL  T   IPYY GL 
Sbjct  513  GSNTSARVTWPGYKVLTNVTEATQFTVSSFIQGNDWLNGT--SIPYYLGLN  561



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL  ++ +AAD
Sbjct  392  VYGTVDFIFGNAAVVLQNCNLYARKPNDNQKNIFTAQGREDPNQNTGISILSGKIASAAD  451

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPVES FK+YLGRPW++YSRTVFML+ IGSLIDPAG+LEW G FAL TLYYGEY N+GP
Sbjct  452  LIPVESTFKNYLGRPWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFALSTLYYGEYMNRGP  511

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RV W GYR+I  +  A  FT  N I+G +WLP  D   P+Y  L
Sbjct  512  GSNTSARVKWPGYRVINNSAEASLFTVGNFIEGKEWLP--DTGFPFYVNL  559



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ  NLY R+P   Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  393  IYGTIDFIFGNAAVVFQNSNLYARRPNDNQRNIFTAQGREDPNQNTGISILNCKVAAAAD  452

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F+++LGRPW++YSRTVFM SK+ +++DP GWLEW G FAL TLYYGEY N+GP
Sbjct  453  LIPVLSQFRTFLGRPWKQYSRTVFMYSKMENVVDPQGWLEWNGSFALDTLYYGEYMNRGP  512

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT AN I G  WLP T   IP+YP L
Sbjct  513  GSNTSARVTWPGYRVINSSTEASQFTVANFIQGNQWLPAT--AIPFYPNL  560



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGNSAVVFQ CNLY R+PLP Q NV TAQGR DP+QNTGISI  C+V AA+D
Sbjct  417  IYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASD  476

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V+S FK+YLGRPW++YSRTVFM S++ S+++PAGWLEW G+FAL TLYYGEY+N GP
Sbjct  477  LLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGP  536

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRV W GYR+I  A  A  FT  N IDG  WL  T   +P+  GL
Sbjct  537  GASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGT--SVPFTVGL  584



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGNSAVVFQ CNLY R+PLP Q NV TAQGR DP+QNTGISI  C+V AA+D
Sbjct  398  IYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASD  457

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V+S FK+YLGRPW++YSRTVFM S++ S+++PAGWLEW G+FAL TLYYGEY+N GP
Sbjct  458  LLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGP  517

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRV W GYR+I  A  A  FT  N IDG  WL  T   +P+  GL
Sbjct  518  GASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGT--SVPFTVGL  565



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+A V Q CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  313  VYGTVDFIFGNAATVLQNCNLYARKPNENQRNLFTAQGREDPNQNTGISILNCKVAAAAD  372

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW+KYSRTV++ S +  LIDP GWLEW G FAL TLYYGEY N+GP
Sbjct  373  LIPVKSQFKNYLGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGP  432

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYY  400
            G++TS RVTW GYR+IK A  A  FT  N I G +WL  TD  IP++
Sbjct  433  GSNTSARVTWPGYRVIKNATEANQFTVRNFIQGNEWLSSTD--IPFF  477



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP P Q+N+ TAQGR DP+QNTGISI++ ++ AAAD
Sbjct  381  IYGTVDFIFGNAAVVFQNCNLYARKPDPNQQNLFTAQGRQDPNQNTGISIINSKIAAAAD  440

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW++YSRTV++ S I  LIDPAGWL W G FAL TLYYGEYKN+GP
Sbjct  441  LIPVKSSFKSYLGRPWKQYSRTVYLQSLIEDLIDPAGWLPWNGTFALDTLYYGEYKNRGP  500

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I     A  FT  N I G DWL  T   IP++P L
Sbjct  501  GSNTSARVTWPGYRVITNTTEASQFTVRNFIQGNDWLNSTG--IPFFPDL  548



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFG++AVV Q CNLY RKP+  Q+NV TAQGR DP+QNTGISI  C+V AAAD
Sbjct  71   VYGTIDFIFGDAAVVLQNCNLYARKPMSNQQNVFTAQGREDPNQNTGISIHKCKVAAAAD  130

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F +YLGRPW+++SRTVFM S + +LIDPAGWLEW GDFAL TLYYGEY N+GP
Sbjct  131  LIPVQSNFSTYLGRPWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGP  190

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G++T+ RV W GYR+I     A  FT  + I G  WL  T   +P+  GL 
Sbjct  191  GSNTTGRVKWPGYRVINSTAEASNFTVTSFIQGDQWLGST--SVPFTSGLN  239



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C+LY RKP   QKN+ TAQGR DP+QNTGISIL+ ++ AAAD
Sbjct  397  VYGTVDFIFGNAAVVFQNCSLYARKPNENQKNIFTAQGREDPNQNTGISILNSKIAAAAD  456

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+Y+GRPW++YSRTV ML+ IGSLI+PAG+LEW G FAL TLYYGEY+N+GP
Sbjct  457  LIPVQSSFKNYIGRPWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFALDTLYYGEYRNRGP  516

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RV W GYR+I  +  A  FT  N I+G +WLP  D   P+Y  L
Sbjct  517  GSNTSARVNWPGYRVINNSAEASQFTVGNFIEGKEWLP--DTGFPFYLNL  564



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C+LY RKP   QKN+ TAQGR DP+QNTGISIL+ ++ AAAD
Sbjct  396  VYGTVDFIFGNAAVVFQNCSLYARKPNENQKNIFTAQGREDPNQNTGISILNSKIAAAAD  455

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+Y+GRPW++YSRTV ML+ IGSLI+PAG+LEW G FAL TLYYGEY N+GP
Sbjct  456  LIPVQSSFKNYIGRPWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFALDTLYYGEYMNRGP  515

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RV W+GYR+I  +  A  FT  N I+G +WLP  D   P+Y  L
Sbjct  516  GSNTSARVNWSGYRVINNSAEASQFTVGNFIEGKEWLP--DTGFPFYLNL  563



>sp|P85076.1|PME_ACTDE RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Actinidia deliciosa]
Length=321

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+A V QKCNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  153  VYGTIDFIFGNAAAVLQKCNLYARKPNENQKNIFTAQGRDDPNQNTGISILNCKVAAAAD  212

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S FK+YLGRPW++YSRTVF+LS++ SLIDPAGWLEW GDFAL TLYY EYKN GP
Sbjct  213  LIPVLSSFKTYLGRPWKEYSRTVFLLSQMESLIDPAGWLEWSGDFALTTLYYREYKNTGP  272

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RVTW GY +         FT  N I G  WL  T   IP Y  L
Sbjct  273  GSNTTARVTWPGYAVTTNETEVIQFTVGNFIQGSQWL--TSYNIPVYLNL  320



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C++ AAAD
Sbjct  303  IYGTVDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAAD  362

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW+ YSRTV + S +  LIDPAGWLEW   FAL TLYYGEY N+GP
Sbjct  363  LIPVKSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGP  422

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+T+ RVTW GYR+I  +  A  FT    I G DWL  T   IP++ GL
Sbjct  423  GANTNGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTG--IPFFSGL  470



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+A V Q CNLY RKP   Q+N+ TAQGR DP+Q+TGISI++C+V AAAD
Sbjct  109  VYGTVDFIFGNAAAVLQNCNLYARKPNKNQRNLFTAQGREDPNQSTGISIINCKVAAAAD  168

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F++YLGRPW+ YSRTVF+ S +  LI+PAGWLEW G FAL TLYYGEY N+GP
Sbjct  169  LIPVKSEFRNYLGRPWKMYSRTVFLNSLMEDLIEPAGWLEWNGTFALDTLYYGEYNNRGP  228

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RVTW GYR+I  +  A  FT  N I G +WL      IP++ GL
Sbjct  229  GANTSGRVTWPGYRVITNSTEASQFTVQNFIQGNEWL--NSYGIPFFSGL  276



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+A V Q CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  447  VYGTVDFIFGNAATVLQNCNLYARKPNENQRNLFTAQGREDPNQNTGISILNCKVAAAAD  506

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW+KYSRTV++ S +  LIDP GWLEW G FAL TLYYGEY N+GP
Sbjct  507  LIPVKSQFKNYLGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGP  566

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYY  400
            G++TS RVTW GYR+IK A  A  FT  N I G +WL  TD  IP++
Sbjct  567  GSNTSARVTWPGYRVIKNATEANQFTVRNFIQGNEWLSSTD--IPFF  611



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V A +D
Sbjct  410  VYGTVDFIFGNAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSD  469

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S+F +YLGRPW++YSRTV++ S I  L+DPAGWLEW G FAL TLYYGEY N+GP
Sbjct  470  LIPVKSNFTTYLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGP  529

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT    I G DWL  T+  IPY+ GL
Sbjct  530  GSNTSARVTWPGYRVINSSVEASQFTVGEFIQGSDWLNSTN--IPYFLGL  577



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R+P   QKN+ TAQGR DP+QNT ISIL  +V AA+D
Sbjct  393  IYGTVDFIFGNAAVVFQNCNLYARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASD  452

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRTVF+ S +  LIDPAGWLEW GDFAL TLYYGEY N+GP
Sbjct  453  LIPVKSSFKTYLGRPWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGP  512

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS+RV+W GYR+I  +  A  FT A+ I G +WL  T   +PY+ GL
Sbjct  513  GANTSSRVSWPGYRVINSSTEASQFTVASFIQGNEWLSSTG--VPYFSGL  560



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R+P   QKN+ TAQGR DP+QNTGISI +C++ AA+D
Sbjct  385  IYGTVDFIFGNAAVVFQNCNLYARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASD  444

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW+ YSRTV++ S I  LIDPAGWLEW   FAL TLYYGEY N+GP
Sbjct  445  LIPVKSSFKSYLGRPWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGP  504

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYRII  +  A  FT A  I G DWL  T   IP+  GL
Sbjct  505  GSNTSARVTWPGYRIINSSTEASQFTVAQFIQGNDWLNTTG--IPFLSGL  552



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ C+LY R+PL  Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  389  IYGTVDFIFGNAAVVFQNCSLYARRPLDNQQNIFTAQGREDPNQNTGISILNCKVAAAAD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV + F++YLGRPW++YSRTV++LSKI S++DP GWLEW G FAL TLYYGEY+N+GP
Sbjct  449  LLPVVTQFQTYLGRPWKQYSRTVYLLSKIESVVDPKGWLEWNGTFALSTLYYGEYQNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLKKT  382
            G++TS RV W GY +I  +  A  FT  N I G  WLP +   +P+Y  L  T
Sbjct  509  GSNTSGRVNWPGYHVINSSAEASQFTVENFIQGSLWLPSSG--LPFYLNLTAT  559



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C++ AAAD
Sbjct  394  IYGTVDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAAD  453

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW+ YSRTV + S +  LIDPAGWLEW   FAL TLYYGEY N+GP
Sbjct  454  LIPVKSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGP  513

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+T+ RVTW GYR+I  +  A  FT    I G DWL  T   IP++ GL
Sbjct  514  GANTNGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTG--IPFFSGL  561



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  391  VYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASD  450

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F++YLGRPW+ YSRTVF+ S IG LI+P GWLEW G FAL TLYYGEY N+GP
Sbjct  451  LIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGP  510

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RVTW GYR+I  A  A  FT    I G  WL  T+  IP++ GL
Sbjct  511  GSNTTMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTE--IPFFSGL  558



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNLY RKPLP Q+N+ TAQGR DP+QNTGISI  C+V AAAD
Sbjct  399  VYGTVDFIFGNAAVVLQNCNLYARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAAD  458

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+++F +YLGRPW++YSRTVFM S + SLI PAGWLEW G FAL TLYYGEY N+GP
Sbjct  459  LIPVQANFSTYLGRPWKEYSRTVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGP  518

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS+RV W G+R+I  A  A  FTAA  + G  WL  T   +P+  GL
Sbjct  519  GSNTSSRVAWPGFRVIGDAAEASNFTAAAFVQGDQWLGST--SVPFSLGL  566



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGNSAVVFQ CNLY R+PLP Q N  TAQGR DP+QNTGISI  C+V AA+D
Sbjct  239  IYGTVDFIFGNSAVVFQSCNLYARRPLPNQSNAYTAQGREDPNQNTGISIQKCKVAAASD  298

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S FK+YLGRPW++YSRTVFM S++ S+++PAGWLEW G+FAL TLYYGEY+N G 
Sbjct  299  LAAVQSSFKTYLGRPWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGD  358

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+NRV W GYR+I  +  A  FT  + IDG  WL  T   +P+  GL
Sbjct  359  GASTANRVKWKGYRVITSSSEASTFTVGSFIDGDVWLAGT--SVPFSVGL  406



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R+P   QKN+ TAQGR DP+QNTGISIL+C+V  AAD
Sbjct  415  IYGTVDFIFGNAAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNTGISILNCKVTLAAD  474

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S F +YLGRPW++YSRTVF+ S +  LI+PAGWLEW G+F L TLYYGEY NKGP
Sbjct  475  LSPVKSSFHTYLGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYMNKGP  534

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+DT+NRV W GYR+I  +  A  FT A+ I GG WL  T   IPY  GL
Sbjct  535  GSDTTNRVKWPGYRVINSSTEATQFTVASFIQGGGWLSSTG--IPYSAGL  582



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  421  VYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASD  480

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F++YLGRPW+ YSRTVF+ S IG LI+P GWLEW G FAL TLYYGEY N+GP
Sbjct  481  LIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGP  540

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RVTW GYR+I  A  A  FT    I G  WL  T+  IP++ GL
Sbjct  541  GSNTTMRVTWPGYRVITNATEASQFTVEGFIQGSSWLNSTE--IPFFSGL  588



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++AVVFQ C++Y+RKP+  QKN +TAQGR+DP++NTGISI    V AA+D
Sbjct  348  IYGTVDFIFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F++YLGRPWQKYSRTV+M + + SLIDPAGWLEW GDFAL TLYYGEY N G 
Sbjct  408  LKPVQGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGA  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RV W GY +I  A VA  FT  N + GG W+P T   +PY   L
Sbjct  468  GADTSRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIPAT--GVPYTSDL  515



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  93   IYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASD  151

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FALKTLYYGEY N GP
Sbjct  152  LKSVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGP  211

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV WAGY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  212  GSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATN--VPFTSGL  259



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  444  VYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASD  503

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F++YLGRPW+ YSRTVF+ S IG LI+P GWLEW G FAL TLYYGEY N+GP
Sbjct  504  LIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGP  563

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RVTW GYR+I  A  A  FT    I G  WL  T+  IP++ GL
Sbjct  564  GSNTTMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTE--IPFFSGL  611



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP P QKN+ TAQGR DP+QNTGISIL+C++ AAAD
Sbjct  392  IYGTVDFIFGNAAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAAD  451

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+S FK+YLGRPW++YSRTV M S I   +DPAGWLEW G FAL TLYYGEY N+GP
Sbjct  452  LVPVKSSFKTYLGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGP  511

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RVTW GYR+I  +  A  FT    I G +WL  ++  IP+  GL
Sbjct  512  GSSTSARVTWPGYRVINSSTEATQFTIEPFIQGNEWLNSSN--IPFALGL  559



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V AA+D
Sbjct  399  IYGTVDFIFGNAAVVFQNCNLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASD  458

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FK+YLGRPW++YSRTV++ S I   +DPAGWLEW G FAL TLYYGEY N+G 
Sbjct  459  LIPVKSTFKTYLGRPWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGN  518

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+ RVTW GYR+I  +  A  FT    I G +WL  T   IPY+ GL
Sbjct  519  GSGTTARVTWPGYRVINNSTEASQFTVGAFIQGNEWLNSTG--IPYFAGL  566



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+ VV Q CNLY RKPL  QKNV TAQGR DP+QNTGISI +C+V AA+D
Sbjct  398  VYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASD  457

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S+F +YLGRPW+ YSRTV+M S + SLI+PAGWLEW GDFAL TLYYGEY N+GP
Sbjct  458  LAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGP  517

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G+ T+NRV W GYR+I  +  A  FT  + I+G  WL  T   +P+  GL 
Sbjct  518  GSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGST--SVPFTAGLN  566



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DF+FGNSAVV Q CNLY R+PL  Q N+ TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  59   IYGTIDFVFGNSAVVLQSCNLYARRPLASQSNIYTAQGRTDPNQNTGISIQKCKVAAASD  118

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V++ F++YLGRPW++YSRTV++ S++ S++DP GWLEW G FAL TLYYGEY+N G 
Sbjct  119  LAAVQTSFRTYLGRPWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGA  178

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRV W GYR+I  +  A  FT  + IDG  WL  T   IP+  GL
Sbjct  179  GASTSNRVKWKGYRVISSSSEASTFTVGSFIDGDVWLAGT--SIPFSTGL  226



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+ VV Q CNLY RKPL  QKN+ TAQGR DP+QNTGISI +C+V AA+D
Sbjct  398  VYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASD  457

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S+F +YLGRPW+ YSRTV+M S + SLI+PAGWLEW GDFAL TLYYGEY N+GP
Sbjct  458  LAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGP  517

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G+ T+NRV W GYR+I  +  A  FT  + I+G  WL  T   +P+  GL 
Sbjct  518  GSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGST--SVPFTAGLN  566



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ  NLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  390  VYGTIDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAAD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S F+++LGRPW++YSRTVF+ S I  L+DPAGWLEW   FAL TLYYGEY N+GP
Sbjct  450  LIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT    I G  WL  TD  IPY+  L
Sbjct  510  GSNTSARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTD--IPYFLNL  557



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+ VV Q CNLY RKPL  QKN+ TAQGR DP+QNTGISI +C+V AA+D
Sbjct  397  VYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASD  456

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S+F +YLGRPW+ YSRTV+M S + SLI+PAGWLEW GDFAL TLYYGEY N+GP
Sbjct  457  LAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGP  516

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G+ T+NRV W GYR+I  +  A  FT  + I+G  WL  T   +P+  GL 
Sbjct  517  GSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGST--SVPFTAGLN  565



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V AA+D
Sbjct  393  IYGTVDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNCKVAAASD  452

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+S FK+YLGRPW++YSRTV+M S I  L+ PAGWLEW G FAL TLYYGEY N+GP
Sbjct  453  LVPVKSTFKTYLGRPWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGP  512

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RV W GYR+I  +  A  FT    I G +WL  T+  IPY+ GL
Sbjct  513  GSNTSARVKWPGYRVINSSDEANQFTVGPFIQGNEWLNSTN--IPYFIGL  560



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ CNLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V+AA+D
Sbjct  425  IYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASD  484

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV S F++YLGRPW+ +SRTVF+ S IG L++P GWLEW G FAL TLYYGEY N+GP
Sbjct  485  LIPVLSSFRTYLGRPWKLHSRTVFLRSFIGQLVEPVGWLEWNGTFALDTLYYGEYLNRGP  544

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RVTW GYR+I  A  A  FT    I G  WL  T   IP++ GL
Sbjct  545  GSNTTGRVTWPGYRVITNATEASQFTVEEFIQGSSWLNSTG--IPFFSGL  592



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVV Q CN Y R+P P Q N+ TAQGR DP+QNTGISIL+C+V AA+D
Sbjct  385  VYGTIDFIFGNAAVVLQNCNFYARRPNPNQHNIFTAQGREDPNQNTGISILNCKVTAASD  444

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S FK+YLGRPW++YSRTVFM S I  L+DPAGWLEW   FAL TLYYGEY N GP
Sbjct  445  LSPVKSSFKTYLGRPWKEYSRTVFMKSYIDDLVDPAGWLEWNATFALTTLYYGEYMNHGP  504

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  F+    I GG+WL  T  ++PY+  L
Sbjct  505  GSNTSARVTWPGYRVINSSVEASRFSVDAFIQGGEWLNST--QVPYFANL  552



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DFIFGN+AVVFQ  NLY RKP   Q+N+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  390  VYGTIDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAAD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S F+++LGRPW++YSRTVF+ S I  L+DPAGWLEW   FAL TLYYGEY N+GP
Sbjct  450  LIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT    I G  WL  TD  IPY+  L
Sbjct  510  GSNTSARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTD--IPYFLNL  557



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AV+ Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V A++D
Sbjct  350  IYGTVDFIFGNAAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSD  409

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTVF+ + + SL+DPAGWLEW G+FAL TLYYGEY+N GP
Sbjct  410  LRPVLSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGP  469

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T  RV W GYR+I  +  A  FT AN I G  WLP T   +P+YPGL
Sbjct  470  GASTRGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATG--VPFYPGL  517



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++AVV Q CN+++RKP+  QKN +TAQGR+DP++NTGISI    V AA+D
Sbjct  349  IYGTVDFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASD  408

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F++YLGRPWQ+YSRTVFM + + SLIDPAGWLEW G+FAL TLYYGEY N GP
Sbjct  409  LKPVQGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGP  468

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RV W GY +I  A  A  FT  N + G  W+P T+  +P+  GL
Sbjct  469  GADTSQRVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATE--VPFTSGL  516



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y RKP+  QKN ITAQGR+DP+QNTGISI   ++ AAAD
Sbjct  292  IYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAAD  351

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV    K++LGRPW+ YSRTVF+ S + SL+DPAGWLEW G+FALKTLYYGEYKNKGP
Sbjct  352  LAPVIKSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGP  411

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GYR+I  +  A  FT  NLI G  WLP T   +P+  GL
Sbjct  412  GSGTSGRVKWGGYRVITSSSEASKFTVGNLIAGSSWLPATG--VPFTSGL  459



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ  NLY RKP   QKN+ TAQGR DP+QNTGISIL+C+V AAAD
Sbjct  390  IYGTIDFIFGNAAVVFQNSNLYARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAAD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S F+++LGRPW++YSRTVF+ S I  L+DPAGWLEW   FAL TLYY EY N+GP
Sbjct  450  LIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYRII  +  A  FT    I G  WL  TD  IPY+  L
Sbjct  510  GSNTSARVTWPGYRIITNSTEASQFTVGAFIQGNTWLNSTD--IPYFLNL  557



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CNLY RKP   QKN+ TAQGR DP+QNTGISIL+ +V AA+D
Sbjct  409  IYGTVDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNSKVAAASD  468

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV++ FK+YLGRPW++YSRTV+M S I  L++PAGWLEW G FAL TLYYGEY N+GP
Sbjct  469  LVPVKAMFKTYLGRPWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGP  528

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I  +  A  FT    I G +WL  T+  IPY+ GL
Sbjct  529  GSNTSARVTWPGYRVINSSAEANQFTVGPFIQGNEWLNATN--IPYFIGL  576



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DF+FGNSA V Q CNLY R+PLP Q N+ TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  399  IYGTIDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISIQKCKVAAASD  458

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S FK+YLGRPW++YSRTVFM S++ S+++PAGWL W G FAL TLYYGEY+N GP
Sbjct  459  LAAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLAWDGTFALDTLYYGEYQNTGP  518

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RVTW GYR+I  A  A  FT  + IDG  WL  T   IP+  GL
Sbjct  519  GAGTSGRVTWKGYRVITSASEASTFTVGSFIDGDVWLAGT--SIPFSAGL  566



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V A+ D
Sbjct  356  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPD  415

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTV++ + + SL+DPAGWLEW GDFAL TLYYGEYKN GP
Sbjct  416  LKPVLSSFKTYLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGP  475

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RVTW GYR+I  +  A  FT AN I GG WLP +   +P+  GL
Sbjct  476  SASTSGRVTWRGYRVITSSTEANRFTVANFIAGGSWLPAS--SVPFTSGL  523



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ CNLY RKPLP Q N+ TAQGR DP+QNTGISI  C+V AA+D
Sbjct  261  IYGTIDFIFGNAAVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASD  320

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   ES  K+YLGRPW++YSRTVF+ S++ SLIDPAGWLEW G FAL TLYYGEY N G 
Sbjct  321  LAGQESSTKTYLGRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGA  380

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+ RV W GYR+I  A  A  FT  + IDG  WL  T   IP+  GL
Sbjct  381  GAGTAGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGT--SIPFTTGL  428



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V+GTVDFIFGN+AVV Q C +Y R+P+ +QKN ITAQGR+DP+QNTGISI + +V A+AD
Sbjct  308  VFGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASAD  367

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV   F+S+LGRPW++YSRTVFM + + SL+DPAGWLEW G+FAL TLYYGEY+N GP
Sbjct  368  LVPVLGSFRSFLGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGP  427

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GYR+I  A  A  FT AN I G  WLP T   +P+  GL
Sbjct  428  GSSTSRRVRWRGYRVITSAAEAGRFTVANFIAGQSWLPATG--VPFTAGL  475



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R PLP QKNV TAQ R DP+QNTGISIL+C+V  AAD
Sbjct  408  IYGTVDFIFGNAAVVFQLCNLYARTPLPNQKNVYTAQSRKDPNQNTGISILNCKVAPAAD  467

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   ++ +K++LGRPW+ YSRT+FMLS I  ++DPAGWLEW GDFAL TLYYGEYKN+GP
Sbjct  468  LAANKTAYKTFLGRPWKDYSRTIFMLSYIDDVVDPAGWLEWSGDFALSTLYYGEYKNRGP  527

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RVTW GY +I  +  A  FT    I GG+WL      IPYY  L
Sbjct  528  GANTSARVTWPGYNVINNSSDASNFTVGKFILGGEWLQ--SYGIPYYLDL  575



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  348  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGISIHNCKVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQKYSRTVFM + + SLI+ AGW+ W G+FAL TLYYGEY N GP
Sbjct  407  LKSVQSSVKTYLGRPWQKYSRTVFMKTYLDSLINSAGWMPWSGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A VA  FT AN I G +WLP T  K+P+  GL
Sbjct  467  GSSTANRVNWKGYHVITSASVASQFTVANFISGNNWLPAT--KVPFTAGL  514



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDF+FGNSAVV Q C+LY R+PL  Q N  TAQGR+DP+QNTGIS+  C+V AA+D
Sbjct  394  VYGTVDFVFGNSAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNTGISVQRCKVSAASD  453

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S F++YLGRPWQ+YSRTVFM S++ S+++PAGWLEW G+FAL TLYYGEY+N G 
Sbjct  454  LAAVQSSFRTYLGRPWQQYSRTVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGA  513

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRV W GYR+I  A  A  FT  + IDG  WLP T   +P+  GL
Sbjct  514  GAATSNRVKWKGYRVITSASEASAFTVGSFIDGDVWLPRT--SVPFSTGL  561



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V AA D
Sbjct  93   IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATD  152

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTV++ + + +L+D AGWLEW G+FAL TLYYGEYKN GP
Sbjct  153  LKPVLSSFKTYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGP  212

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GYR+I  A  A  F+ AN I G  WLP T   +P+  GL
Sbjct  213  GSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATG--VPFRSGL  260



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKN++TAQGR+DP+QNTGISI + +V AA D
Sbjct  349  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAAND  408

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK++LGRPW++YSRTVFM + + SL+DPAGW EW GDFAL TLYYGEYKN GP
Sbjct  409  LTPVLSSFKTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGP  468

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RVTW GYR+I  A  A  FT  N I G  WLP  D  IP+  GL
Sbjct  469  AAPTSRRVTWKGYRVITSATEASKFTVTNFIAGRSWLP--DTGIPFTSGL  516



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKN ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  288  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASD  347

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK++LGRPW++YSRTVF+ + + SL+DPAGWLEW G+FAL TLYYGEYKN GP
Sbjct  348  LKPVLSSFKTFLGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGP  407

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             + TS RV W GYR+I  A  A  FT AN I G  WLP T   +P+  GL
Sbjct  408  ASSTSGRVKWRGYRVITSATEASQFTVANFIAGRSWLPATG--VPFSSGL  455



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  348  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQKYSRTVFM + + SLI+ AGW+ W G+FAL TLYYGEY N GP
Sbjct  407  LKSVQSSVKTYLGRPWQKYSRTVFMKTDLDSLINSAGWMPWSGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A VA  FT A+ I G +WLP T+  +P+  GL
Sbjct  467  GSSTANRVNWKGYHVITSASVASQFTVASFISGNNWLPATN--VPFTAGL  514



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFG++ VVFQ CN+Y+RKP+  QKN +TAQGR+D   +TGISI    V AA D
Sbjct  348  IYGTIDFIFGDATVVFQNCNIYVRKPMTGQKNTVTAQGRTDERTDTGISIHDSVVTAAPD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S F++YLGRPW+KYSRTV+M + + SLIDPAGWLEW GDFALKTLYYGEY N G 
Sbjct  408  LKPVQSSFQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGA  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RVTW GY +I  A  A  FT  N + G  W+P T   +PY PGL
Sbjct  468  GADTSQRVTWPGYHVITSAAEASQFTVGNFLSGNSWIPAT--GVPYTPGL  515



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNT ISI + +V A++D
Sbjct  350  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTPISIHNSRVMASSD  409

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTVF+ + + SL+DPAGWLEW G+FAL TLYYGEY+N GP
Sbjct  410  LRPVLSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGP  469

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T  RV W GYR+I  +  A  FT AN I G  WLP T   +P+YPGL
Sbjct  470  GASTRGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATG--VPFYPGL  517



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISIL+ +V AA+D
Sbjct  93   IYGTVDFIFGNAAVVFQSCNIYARNP-PNKTNTITAQGRTDPNQNTGISILNSRVTAASD  151

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + +  LI+PAGW+ W G+FAL TLYYGEY N GP
Sbjct  152  LKPVQSSVKTYLGRPWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGP  211

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+ RV W GY +I  A  A  FT  N I G  WLP T+  +P+  GL
Sbjct  212  GSSTAKRVNWKGYHVITSATEASKFTVGNFIAGSSWLPATN--VPFTSGL  259



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASD  405

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FALKTLYYGEY N GP
Sbjct  406  LKSVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGP  465

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV WAGY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  466  GSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATN--VPFTSGL  513



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V A++D
Sbjct  352  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK++LGRPW+ YSRTVF+ + + SL+D AGWLEW G+FAL TLYYGEY+N GP
Sbjct  412  LRPVLSSFKTFLGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  A  A  FTAAN I G  WLP T   +P+  GL
Sbjct  472  GASTSGRVKWRGYRVITSATEASRFTAANFIAGRSWLPATG--VPFSSGL  519



>gb|EMT27728.1| Pectinesterase [Aegilops tauschii]
Length=389

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDF+FG++AVV Q CNLY R+P P QKNV TAQGR DP+QNTGI++  C++ AAAD
Sbjct  221  VYGTVDFVFGDAAVVLQNCNLYARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAAD  280

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+++F SYLGRPW+ YSRTVFM SK+ SL+ P GWLEW G FAL TLYY EY N+GP
Sbjct  281  LVPVQANFSSYLGRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGP  340

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RV W GYR+I  A  A  FTA   I G  WL  T    PY  GL
Sbjct  341  GANTSARVAWPGYRVITTAADAGNFTAQAFIQGDLWLNST--SFPYSLGL  388



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP+  QKN++TAQGR+DP+QNTG SI  C++ A+AD
Sbjct  384  VTGTVDFIFGNAAVVFQKCKLVARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIIASAD  443

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F +YLGRPW++YSRTV M S IG LIDPAGW EW GDFALKTLYYGEY NKG 
Sbjct  444  LAPVKGSFPTYLGRPWKEYSRTVVMQSTIGDLIDPAGWAEWSGDFALKTLYYGEYMNKGG  503

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RV W GY +I  A  A  FT   LI GGDWL  T
Sbjct  504  GAGTSKRVNWTGYHVITDAAEATKFTVKELIQGGDWLGST  543



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C L  RKP+  QKN++TAQGR+DP+QNTG SI  C + A++D
Sbjct  160  ITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSD  219

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S FKS+LGRPW++YSRTV M S IG LIDPAGW  W G+FALKTLYYGEY N+G 
Sbjct  220  LTPVKSSFKSFLGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGA  279

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV WAGY +I  A  AK FT A LI GG WL  T   + Y  GL
Sbjct  280  GAGTSKRVNWAGYHVITSANEAKKFTVAELIQGGVWLKSTG--VSYTEGL  327



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA++
Sbjct  272  IYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCRVTAASE  330

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FALKTLYYGEY N GP
Sbjct  331  LKRVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGP  390

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T NRV W GYR+I  A  A  FT  +LI G  WLP T   +P+  GL
Sbjct  391  GSSTKNRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATG--VPFTSGL  438



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+A V Q C +Y R+P+ +QKN ITAQGR+DP+QNTGISI + +V AAAD
Sbjct  356  IYGTVDFIFGNAAAVLQNCMIYARRPMSKQKNTITAQGRTDPNQNTGISIHNSRVMAAAD  415

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTVFM + + SL+DPAGWLEW GDFAL TLYYGEY+N GP
Sbjct  416  LKPVLSSFKTYLGRPWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGP  475

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
             A TS RV W+GYR+I  +  A  FT AN I G  WLP T
Sbjct  476  AASTSRRVKWSGYRVITSSSEASQFTVANFIAGQSWLPAT  515



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CNL+ RKPL  Q+ V TAQGR DP++NTGISI +CQV AA+D
Sbjct  433  VYGTVDFIFGNAAVVLQNCNLFARKPLANQQIVYTAQGRQDPNENTGISIQNCQVIAASD  492

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+  F +YLGRPW++YSRTVFM S +G LI PAGWLEW G+FAL TLYYGE+ N+GP
Sbjct  493  LIPVKRSFPAYLGRPWRQYSRTVFMQSYLGDLIQPAGWLEWNGNFALNTLYYGEFMNRGP  552

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPK  412
            GA  +NRV W GYR I+ +  AK FT +  I G  WLP T  K
Sbjct  553  GAGVANRVRWPGYRAIRSSNEAKQFTVSQFIKGDSWLPSTGVK  595



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  348  IYGTVDFIFGNAAVVFQNCNIYPRSP-PNKTNTITAQGRTDPNQNTGISIHNCRVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPW++YSRTVFM + + SLI+PAGWL W G+FAL TLYYGEY N GP
Sbjct  407  LKPVQGSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  + VA  FT  + I G +WLP T+  +P+  GL
Sbjct  467  GSSTANRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATN--VPFTAGL  514



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 5/170 (3%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y+      + N ITAQGRSDP+QNTGISI +C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVFQNCNIYVHN---HKTNTITAQGRSDPNQNTGISIHNCRVTAASD  403

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLIDPAGW+EW G+FALKTLYYGEY N GP
Sbjct  404  LKSVQSSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGP  463

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV WAGY +I  A  A  FT  N I G  WLP T+  +P+  GL
Sbjct  464  GSSTSNRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATN--VPFTSGL  511



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ C++Y RKP   Q+N+ TAQGR DP+QNTGISI++ +V AAAD
Sbjct  389  IYGTVDFIFGNAAVVFQNCSIYARKPNSNQQNIFTAQGREDPNQNTGISIMNSKVTAAAD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+  FK+YLGRPW++YSRTVF+ S I  ++DP GWLEW G FAL TLYYGEY N+GP
Sbjct  449  LIPVKKSFKTYLGRPWKEYSRTVFLRSYIDDVVDPVGWLEWNGAFALSTLYYGEYMNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TS RVTW GYR+I     A  FT    I G +WL  T   IP++ GL
Sbjct  509  GSNTSARVTWPGYRVINSTTEASQFTVRPFIQGSEWLNATG--IPFFLGL  556



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  346  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  404

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVF+ + + SLI+ AGWLEW GDFAL TLYYGEY N GP
Sbjct  405  LKPVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGP  464

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FTA N I G  WLP T+  +P+  GL
Sbjct  465  GSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTN--VPFTSGL  512



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  346  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  404

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVF+ + + SLI+ AGWLEW GDFAL TLYYGEY N GP
Sbjct  405  LKPVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGP  464

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FTA N I G  WLP T+  +P+  GL
Sbjct  465  GSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTN--VPFTSGL  512



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++AVV Q CNLY R+P P QKNV TAQGR DP+QNTGI++  C+V AAAD
Sbjct  409  IYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTGIAVQGCKVAAAAD  468

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+++F SYLGRPW+ YSRTVFMLSKI SLI P GWLEW G FAL TLYY EY N+GP
Sbjct  469  LLPVQANFSSYLGRPWKTYSRTVFMLSKIESLIHPRGWLEWNGSFALDTLYYAEYMNRGP  528

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            GADTS RV+W GY ++  A  A  FT  + + G  WL       PY  GL 
Sbjct  529  GADTSARVSWPGYHVLTNASDAANFTVLSFVQGDLWL--NSSSFPYILGLS  577



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CN+Y+R+P+ +QKN ITAQGR+DP+QNTGISI +C+V+AA D
Sbjct  293  VYGTVDFIFGNAAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQYCRVRAAKD  352

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L P +S F+++LGRPW++ SRTV+M + +  LI PAGWLEW G FAL+TL+YGE++N GP
Sbjct  353  LRPAQSSFETFLGRPWKENSRTVYMETYMDDLISPAGWLEWSGGFALETLFYGEFRNTGP  412

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G++TS RV W GY +I     A  FTA NLI G  WLP T
Sbjct  413  GSNTSKRVKWGGYHVITDPSAASEFTARNLIAGEMWLPST  452



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N +TAQGR+DP+QNTGISI + +V AA+D
Sbjct  348  IYGTVDFIFGNAAVVLQNCNIFARNP-PNRTNTLTAQGRTDPNQNTGISIHNSRVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  ++YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FAL TLYYGEY N GP
Sbjct  407  LSPVQSSVRTYLGRPWKEYSRTVFMKTFLDSLINPAGWMEWSGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRVTW GYR+I  A  A  FT  N I G  WLP T+  +P+ PGL
Sbjct  467  GSSTANRVTWKGYRVITSAAEASQFTVQNFISGNSWLPGTN--VPFTPGL  514



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DF+FGN+AVV Q CNLY RKPLP Q N+ TAQGR DP+QNTGISI  C+V AAAD
Sbjct  409  IYGTIDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNTGISIHRCKVAAAAD  468

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+   S  K+YLGRPW++YSRTVF+ S++ SLI PAGWLEW G+FAL TLYYGEY N GP
Sbjct  469  LLQSSSSTKTYLGRPWKQYSRTVFLQSELDSLIAPAGWLEWDGNFALDTLYYGEYMNTGP  528

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  A  A  FT  + IDG  WL  T   IP+  GL
Sbjct  529  GAGTSGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGT--SIPFTTGL  576



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C ++ R+P+ +QK  ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  356  IYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASD  415

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV   FK+YLGRPW++YSRTV M + + SL+DPAGWLEW GDFAL TLYYGEY+N GP
Sbjct  416  LRPVVGTFKTYLGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGP  475

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS+RV W GYR+I  +  A  F+  NLI GG WLP T+  +P+  GL
Sbjct  476  GASTSSRVKWPGYRVITNSNEAARFSVENLIAGGSWLPATN--VPFRAGL  523



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C ++ R+P+ +QK  ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  307  IYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASD  366

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV   FK++LGRPW++YSRTVFM + + SL+DPAGWLEW GDFAL TLYYGEY+N GP
Sbjct  367  LRPVLGTFKTFLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALSTLYYGEYRNAGP  426

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS+RV W+GYR+I  +  A  F+  N I G  WLP T+  +P+  GL
Sbjct  427  GASTSSRVKWSGYRVITNSNEAARFSVENFIAGRSWLPATN--VPFRAGL  474



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  93   IYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  151

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPW++YSRTVF+ + + SLI+ AGWLEW G+FAL TLYYGEY N G 
Sbjct  152  LKPVQGSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGNFALNTLYYGEYMNTGD  211

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  212  GSSTSGRVKWAGYHVITSSTEAAKFTVGNFISGNSWLPSTN--VPFTSGL  259



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA++
Sbjct  349  IYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCRVTAASE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FALKTLYYGEY N GP
Sbjct  408  LKRVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T NRV W GYR+I  A  A  FT  +LI G  WLP T   +P+  GL
Sbjct  468  GSSTKNRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATG--VPFTSGL  515



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKN ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  356  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASD  415

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTVF+ + + SL+DPAGWLEW G+FA  TLYYGEYKN GP
Sbjct  416  LRPVLSSFKTYLGRPWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGP  475

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GY +I     A  FT AN I G  WLP T+  +P+  GL
Sbjct  476  GSSTSRRVKWRGYHVITNPTEASRFTVANFIAGRSWLPATN--VPFAAGL  523



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C ++ R+P+  Q NV+TAQGR+DP+QNTGISI + ++ A++D
Sbjct  360  IYGTVDFIFGNAAVVLQNCMIFARRPMDNQNNVVTAQGRTDPNQNTGISIHNSRIMASSD  419

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTV++ S I +L+DPAGW+EW G+FAL TLYYGEYKN GP
Sbjct  420  LVPVLSSFKTFLGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGP  479

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I ++  A  FT    I G  WLP T   +P+  GL
Sbjct  480  GSSTANRVNWGGYRVITKSSEASQFTVGKFISGDSWLPATG--VPFKSGL  527



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  314  IYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASD  372

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQ+YSRTVFM + + SLI+ AGW+EW G+FAL TLYYGEY N GP
Sbjct  373  LKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGP  432

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T++RVTWAGY +I  A  A  FT  + I GG WLP T   +PY  GL
Sbjct  433  GSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATG--VPYTSGL  480



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  278  IYGTVDFIFGNAAVVFQKCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHDCEVTAASD  336

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVF+ + + SLI+ AGWLEW GDFAL TLYYGEY N GP
Sbjct  337  LKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGP  396

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  397  GSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTN--VPFTSGL  444



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFG++AVV Q C++Y+RKP+  QKN +TAQGR+DP++NTGISI    V AA++
Sbjct  348  VYGTVDFIFGDAAVVLQNCSMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FK+YLGRPW+KYSRTVFM + +  LIDPAGWLEW G+FAL TLYYGEY N G 
Sbjct  408  LKPVQGSFKTYLGRPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGA  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RV W GY +I  A  A  FT AN + G  W+P T   + +  GL
Sbjct  468  GADTSQRVKWPGYHVITSATEASKFTVANFLSGNSWIPATG--VAFTSGL  515



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  193  IYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASD  251

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  ++YLGRPW++YSRTVFM + +  LI+P+GW+EW G+FAL TLYYGEY N GP
Sbjct  252  LRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYGEYMNTGP  311

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T  RV W GYR+I RA  A  F+ AN I G  WLP T  K+PY P L
Sbjct  312  GSSTGRRVKWPGYRVITRASEASKFSVANFIAGNAWLPAT--KVPYTPSL  359



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q C +Y R+P+  QKN ITAQGR+DP+QNTGISI   +V A +D
Sbjct  315  VYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSD  374

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S  K+YLGRPW++YSRTVF+ S + +L+DPAGWLEW G+FALKTLYYGEYKN GP
Sbjct  375  LKPVLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGP  434

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  435  GSSTSGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATN--VPFTAGL  482



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+A V Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V A+ D
Sbjct  363  IYGTIDFIFGNAAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQNTGISIHNSRVMASPD  422

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV   F+S+LGRPW+ YSRTV+M + I SLIDP GWLEW G FAL TLYYGEY+N GP
Sbjct  423  LVPVLGSFRSFLGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGP  482

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RV W+GYR+I  A  A  FT AN I G  WLP T   +P+  GL
Sbjct  483  GSNTTRRVNWSGYRVITNASEASTFTVANFIAGQSWLPATG--VPFTAGL  530



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V AA D
Sbjct  351  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTV+M + + SL+DPAGWLEW G+FAL TL+YGEYKN GP
Sbjct  411  LVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RV W GYR+I  A  A  FT  + I G  WLP T   +P+  GL
Sbjct  471  AASTSGRVKWRGYRVITSATEASKFTVGSFITGNSWLPATG--VPFRSGL  518



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+  QKN ITAQGR+DP+QNTGISI + +V AA D
Sbjct  352  IYGTVDFIFGNAAVVLQNCMIYARRPMSGQKNTITAQGRTDPNQNTGISIHNSRVMAAPD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FKSYLGRPW++YSRTV++ + + +LIDPAGWLEW G+FAL TLYYGEYKN GP
Sbjct  412  LKPVLSSFKSYLGRPWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RV W GYR+I  +  A  FT AN I G  WLP T   +P+ PGL
Sbjct  472  AAWTSGRVKWPGYRVITSSSEASKFTVANFIAGQSWLPSTG--VPFTPGL  519



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  349  IYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQ+YSRTVFM + + SLI+ AGW+EW G+FAL TLYYGEY N GP
Sbjct  408  LKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T++RVTWAGY +I  A  A  FT  + I GG WLP T   +PY  GL
Sbjct  468  GSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATG--VPYTSGL  515



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 128/170 (75%), Gaps = 5/170 (3%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y+      + N +TAQGRSDP+QNTGISI +C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVLQNCNIYVHN---HKTNTVTAQGRSDPNQNTGISIHNCKVTAASD  403

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVFM + + SLIDPAGW+EW G+FALKTLYYGEY N GP
Sbjct  404  LKSVQSSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGP  463

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV WAGY +I  A  A  FT  N I G  WLP T+  +P+  GL
Sbjct  464  GSSTSNRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATN--VPFTSGL  511



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V AA D
Sbjct  351  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTV+M + + SL+DPAGWLEW G+FAL TL+YGEYKN GP
Sbjct  411  LVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RV W GYR+I  A  A  FT  + I G  WLP T   +P+  GL
Sbjct  471  AASTSGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATG--VPFRSGL  518



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  349  IYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQ+YSRTVFM + + SLI+ AGW+EW G+FAL TLYYGEY N GP
Sbjct  408  LKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T++RVTWAGY +I  A  A  FT  + I GG WLP T   +PY  GL
Sbjct  468  GSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATG--VPYTSGL  515



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V AA D
Sbjct  351  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTV+M + + SL+DPAGWLEW G+FAL TL+YGEYKN GP
Sbjct  411  LVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             A TS RV W GYR+I  A  A  FT  + I G  WLP T   +P+  GL
Sbjct  471  AASTSGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATG--VPFRSGL  518



>gb|EMS45437.1| Pectinesterase [Triticum urartu]
Length=311

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDF+FG++AVV Q C+LY R+P P QKNV TAQGR DP+QNTGI++  C++ AAAD
Sbjct  143  VYGTVDFVFGDAAVVLQNCSLYARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAAD  202

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S+F SYLGRPW+ YSRTVFM SK+ SL+ P GWLEW G FAL TLYY EY N+GP
Sbjct  203  LVPVLSNFSSYLGRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGP  262

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RV W GYR+I     A  FTA   I G  WL  T    PY  GL
Sbjct  263  GANTSARVAWPGYRVITSDADAGNFTAQAFIQGDLWLNST--SFPYTLGL  310



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+ VVFQ CNL  RKP+  Q N++TAQGR+DP+QNTGISI  C + A++D
Sbjct  382  ITGTVDFIFGNAGVVFQNCNLVARKPMSGQSNMVTAQGRTDPNQNTGISIQSCNMTASSD  441

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+   KSYLGRPW++YSRTV M S IG  IDP GW  W GDFALKTLYYGEY NKGP
Sbjct  442  LVPVKGSIKSYLGRPWKEYSRTVVMQSNIGDHIDPTGWSVWSGDFALKTLYYGEYMNKGP  501

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I  A  AK FT A LI GG WL  +   + Y  GL
Sbjct  502  GAGTSKRVNWPGYHVITSATEAKKFTVAELIQGGTWLKSSG--VSYTEGL  549



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+D +QNTGISI + +V A++D
Sbjct  353  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSD  412

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK++LGRPW++YSRTVF+ + + SL+D AGWLEW G+FAL TLYYGEY+N GP
Sbjct  413  LRPVLSSFKTFLGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGP  472

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  A  A  FT AN I G  WLP T   +P+  GL
Sbjct  473  GASTSGRVKWRGYRVITSATEASRFTVANFIAGRSWLPATG--VPFSSGL  520



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  331  IYGTVDFIFGNAAVVFQNCNIYXRNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  389

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVF+ + + SLI+ AGW+EW GDFALKTLYYGEY N GP
Sbjct  390  LKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGP  449

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  450  GSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTN--VPFTSGL  497



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  75   VTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  134

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S++K+YLGRPW++YSRTV M S +G LIDPAGW EW GDFALKTLYYGEY N GP
Sbjct  135  LEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGP  194

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RV W+GY II     A  FT A LI GG WL  T
Sbjct  195  GAGTSKRVKWSGYHIITNPAEAMPFTVAELIQGGSWLSST  234



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y+R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  346  IYGTVDFIFGNAAVVFQNCNIYVRNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  404

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVF+ + + SLI+ AGW+EW GDFALKTLYYGEY N GP
Sbjct  405  LKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGP  464

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  465  GSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTN--VPFTSGL  512



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 5/170 (3%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q  N+Y+      + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  346  IYGTVDFIFGNAAVVIQNSNIYVHN---HKTNTITAQGRTDPNQNTGISIHNCKVTAASD  402

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW GDFALKTLYYGEY N GP
Sbjct  403  LKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGP  462

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T NRV+WAGY +I  A  A  F+  N I GG WLP T+  +P+  GL
Sbjct  463  GASTKNRVSWAGYHVITSASEASKFSVGNFIAGGSWLPATN--VPFTSGL  510



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y RKP+  QKN +TAQGR+DP+QNTGISI + +V A  D
Sbjct  359  IYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDD  418

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PVES  K+YLGRPW++YSRTVFM + I SL+DPAGWLEW GDFAL TLYYGEY N GP
Sbjct  419  LKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGP  478

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+  S RV W GY +I     A  FT  N I G  WLP  D ++P+ PGL
Sbjct  479  GSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLP--DTEVPFTPGL  526



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQKC L  RKP+  QKN++TAQGR+DP+QNTG SI  C+++A+ D
Sbjct  383  ITGTVDFIFGNAAVVFQKCKLVARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIRASED  442

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S F +YLGRPW++YSRTV M S IG  IDP GW EW GDFALKTLYYGEY NKGP
Sbjct  443  LEPVKSSFPTYLGRPWKEYSRTVVMQSYIGDHIDPVGWSEWSGDFALKTLYYGEYMNKGP  502

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV WAGY +I  A  A  FT   LI G +WL  T   + Y  GL
Sbjct  503  GAGTSKRVKWAGYHVITNAAEAAKFTVKELIQGVEWLGSTG--VAYTEGL  550



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 5/170 (3%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q  N+Y+      + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVIQNSNIYVHN---HKTNTVTAQGRTDPNQNTGISIHNCKVTAASD  403

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW GDFALKTLYYGEY N GP
Sbjct  404  LKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGP  463

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T NRV+WAGY +I  A  A  F+  N I GG WLP T+  +P+  GL
Sbjct  464  GASTKNRVSWAGYHVITSASEASEFSVGNFIAGGSWLPATN--VPFTSGL  511



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  193  IYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASD  251

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  ++YLGRPW++YSRTVFM + +  LI+PAGW+EW G+FAL TLYYGEY N GP
Sbjct  252  LRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGP  311

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+ RV W+GYR+I  A  A  F+ AN I G  WLP T  K+P+ P L
Sbjct  312  GSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPST--KVPFTPSL  359



>gb|KHN03710.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=415

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKP   QKN+  AQGR DP+QNTGISIL+C++ AAAD
Sbjct  249  IYGTVDFIFGNAAVVFQNCNLYARKPNENQKNLFMAQGREDPNQNTGISILNCKIAAAAD  308

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+S FKSYLGRPW+ YS TV + S +   IDPAGWLEW   FAL TLYYGEY N+GP
Sbjct  309  LIPVKSSFKSYLGRPWKMYSMTVVLKSYVD--IDPAGWLEWNETFALDTLYYGEYMNRGP  366

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             ++TS RVTW GYR+I  +  A  FT    I   DWL   +  IP++ GL
Sbjct  367  CSNTSGRVTWPGYRVINSSIEASQFTVGQFIQDNDWL--NNTGIPFFSGL  414



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++AVV Q CNLY R+P P QKNV TAQGR DP+QNTGI+I  C+V AAAD
Sbjct  411  IYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTGIAIQGCKVAAAAD  470

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+++F SYLGRPW+ YSRTVF+ SKI SLI P GWLEW G FAL TLYY EY N+G 
Sbjct  471  LVPVQANFSSYLGRPWKTYSRTVFLQSKIDSLIHPRGWLEWNGSFALDTLYYAEYMNRGD  530

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            GADTS RV+W GY ++  A  A  FT  N + G  WL       PY  GL 
Sbjct  531  GADTSARVSWPGYHVLTNATDAANFTVLNFVQGDLWL--NSSSFPYILGLS  579



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVFQKCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHDCEVTAASD  405

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPW++YSRTVF+ + + SLI+ AGWLEW GDFAL TLYYGEY N GP
Sbjct  406  LKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGP  465

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  466  GSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTN--VPFTSGL  513



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++AVV Q CNLY R+P P QKNV TAQGR DP+QNTGI+I  C+V AAAD
Sbjct  411  IYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTGIAIQGCKVAAAAD  470

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+++F SYLGRPW+ YSRTVF+ SKI SLI P GWLEW G FAL TLYY EY N+G 
Sbjct  471  LVPVQANFSSYLGRPWKTYSRTVFLQSKIDSLIHPRGWLEWNGSFALDTLYYAEYMNRGD  530

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            GADTS RV+W GY ++  A  A  FT  N + G  WL       PY  GL 
Sbjct  531  GADTSARVSWPGYHVLTNATDAANFTVLNFVQGDLWL--NSSSFPYILGLS  579



>gb|KCW73025.1| hypothetical protein EUGRSUZ_E01468, partial [Eucalyptus grandis]
Length=513

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT DFIFGN+AVVF  CN+Y+R P P + N ITAQGR+DP+QNTGISIL+C+V A ++
Sbjct  349  IYGTTDFIFGNAAVVFHNCNIYVRNP-PNKVNTITAQGRTDPNQNTGISILNCKVIADSE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LI V+S  K+YLGRPWQKYSRTVFM++ +  LID AGWLEW GDFAL TLYYGEY N GP
Sbjct  408  LILVQSSVKTYLGRPWQKYSRTVFMMTYLDGLIDSAGWLEWDGDFALDTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
             + T+NRVTWAGY +I     A  FT  NLI GG WL  T
Sbjct  468  RSSTTNRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLAT  507



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R+P+ +QKN ITAQGR+DP+QNTGI I + +V AA D
Sbjct  275  IYGTVDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAED  334

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTVF+ + +  L+DPAGWLEW+GDFAL TLYYGEYKN GP
Sbjct  335  LVPVLSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGP  394

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
               T  RV W GY  I  A  A  FT  N I G  WLP T   IP+  GL
Sbjct  395  RGSTRGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATG--IPFLFGL  442



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y RKP+  QKN +TAQGR+DP+QNTGISI + +V A  D
Sbjct  404  IYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDD  463

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PVES  K+YLGRPW++YSRTVFM + I SL+DPAGWLEW GDFAL TLYYGEY N GP
Sbjct  464  LKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGP  523

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+  S RV W GY +I     A  FT  N I G  WLP  D ++P+ PGL
Sbjct  524  GSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLP--DTEVPFTPGL  571



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVD+IFGN+AVVFQ CNLY R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  352  VYGTVDYIFGNAAVVFQNCNLYSRNP-PNKINTITAQGRTDPNQNTGISIHNSRVTAASD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPWQ+YSRTVFM + +  LIDPAGWL W G+FAL TLYYGEY N GP
Sbjct  411  LKPVQSSVKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV+W GY +I  A  A  FT  N I G  WLP T+  +P+  GL
Sbjct  471  GSSTANRVSWKGYHLITSATEASKFTVGNFIAGNSWLPATN--VPFTSGL  518



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C ++ R+P+ +QK  ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  357  IYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASD  416

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK++LGRPW++YSRTVFM + + SL+DPAGWLEW G+FAL TLYYGEY+N GP
Sbjct  417  LRPVLSTFKTFLGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGP  476

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  +  A  F+  N I G  WLP T+  +P+  GL
Sbjct  477  GASTSRRVRWRGYRVITNSNEAAKFSVENFIGGRSWLPATN--VPFRAGL  524



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQ C L  RK +  QKN++TAQGR+DP+QNTG SI  C++ A++D
Sbjct  385  VTGTVDFIFGNAAVVFQNCKLVARKGMSGQKNMVTAQGRTDPNQNTGTSIQKCEISASSD  444

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++ +KSYLGRPW++YSRTV M S IG LIDPAGW EW  DFALKTLYYGEY N+GP
Sbjct  445  LEPVKASYKSYLGRPWKEYSRTVVMQSTIGDLIDPAGWAEWDKDFALKTLYYGEYANQGP  504

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV WAGY +I     A+ FT A LI GG WL   +  + Y  GL
Sbjct  505  GAGTSKRVNWAGYHVITSPSEAQKFTVAELIQGGYWLK--NSGVAYTEGL  552



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  342  IYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNCKVTAASD  400

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K+YLGRPWQKYSRTVF+ + + SLID AGWLEW G FAL TL YGEY N GP
Sbjct  401  LTSVQSSVKTYLGRPWQKYSRTVFLKTYLDSLIDSAGWLEWNGSFALTTLNYGEYMNTGP  460

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  N I GG WLP T   +PY   L
Sbjct  461  GSSTTNRVKWIGYHVITSATEASKFTVGNFIAGGSWLPATG--VPYISSL  508



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y R+P+ +QKNV+TAQGR+DP+QNTGISI + +V AA D
Sbjct  353  IYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATD  412

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S FK+YLGRPW++YSRTV++ + + +L+D AGWLEW G+FAL TLYYGEYKN GP
Sbjct  413  LKPVLSSFKTYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGP  472

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GYR+I  A  A  F+ AN I G  WLP T   +P+  GL
Sbjct  473  GSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATG--VPFRSGL  520



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C L  RKP+  QKN++TAQGR+DP+QNTG SI  C + A++D
Sbjct  382  ITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSD  441

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S FKS+LGRPW++YSRTV M S IG LIDPAGW  W G+FALKTLYYGEY N+G 
Sbjct  442  LTPVKSSFKSFLGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGA  501

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV WAGY +I  A  AK FT A LI GG WL  T   + Y  GL
Sbjct  502  GAGTSKRVNWAGYHVITSANEAKKFTVAELIQGGVWLKSTG--VSYTEGL  549



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y+R+P+ +QKN ITAQGR+DP+QNTGISI +C+V AA D
Sbjct  305  IYGTVDFIFGNAAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQNCRVTAAKD  364

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S F+++LGRP ++YSRTV+M + +  LI PAGWLEW GDFAL+TL+YGE++N GP
Sbjct  365  LRPVRSSFQTFLGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALETLFYGEFRNTGP  424

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLP  427
            G++TS RV W GY II     A  FTA  LI G  WLP
Sbjct  425  GSNTSKRVKWGGYHIITDPSTALEFTARILIAGEMWLP  462



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI  C+V AA+D
Sbjct  347  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASD  405

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S  K YLGRPW++YSRTVF+ + + SLI+ AGW+EW GDFALKTLYYGEY N GP
Sbjct  406  LKAVQSSVKIYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGP  465

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV WAGY +I  +  A  FT  N I G  WLP T  K+P+  GL
Sbjct  466  GSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPST--KVPFTSGL  513



>ref|XP_010058471.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=565

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 127/169 (75%), Gaps = 4/169 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT DFIFGN+AVVF  CN+Y+R P P + N ITAQGR+DP+QNTGISIL+C+V A ++
Sbjct  349  IYGTTDFIFGNAAVVFHNCNIYVRNP-PNKVNTITAQGRTDPNQNTGISILNCKVIADSE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LI V+S  K+YLGRPWQKYSRTVFM++ +  LID AGWLEW GDFAL TLYYGEY N GP
Sbjct  408  LILVQSSVKTYLGRPWQKYSRTVFMMTYLDGLIDSAGWLEWDGDFALDTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT---DPKIPY  403
             + T+NRVTWAGY +I     A  FT  NLI GG WL  T   +P + Y
Sbjct  468  RSSTTNRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGY  516



>ref|XP_010058468.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=720

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ CN+Y R P P + N+ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  349  IYGTIDFIFGNAAVVFQNCNIYARNP-PNKVNIITAQGRTDPNQNTGISIHNCKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V+S  K+YLGRPWQ+YSRTVFM + + SLID AGWLEW GDFAL TLYYGEY N GP
Sbjct  408  LLSVQSFAKTYLGRPWQEYSRTVFMTTYLDSLIDSAGWLEWDGDFALSTLYYGEYMNIGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPG  394
            G+ T+NRVTWAGY +I     A  FT  N I GG WL  T   IPY  G
Sbjct  468  GSSTTNRVTWAGYHVITSTIEASKFTIGNFIPGGSWLFATG--IPYTSG  514



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  390  VTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S++K+YLGRPW++YSRTV M S +G LIDPAGW EW GDFALKTLYYGEY N GP
Sbjct  450  LEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RVTW GY +I  A  A+ FT A LI GG WL  T
Sbjct  510  GAGTSKRVTWPGYHVITDAAEARPFTVAELIQGGSWLSST  549



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  390  VTGTVDFIFGNAAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S++K+YLGRPW++YSRTV M S +G LIDPAGW EW GDFALKTLYYGEY N GP
Sbjct  450  LEPVKSEYKTYLGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGP  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RVTW GY +I  A  A+ FT A LI GG WL  T
Sbjct  510  GAGTSKRVTWPGYHVITDAAEARPFTVAELIQGGSWLSST  549



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   228 bits (582),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y RKP+  QKN +TAQGR+DP+QNTGISI + +V A  D
Sbjct  575  IYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDD  634

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PVES  K+YLGRPW++YSRTVFM + I SL+DPAGWLEW GDFAL TLYYGEY N GP
Sbjct  635  LKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGP  694

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+  S RV W GY +I     A  FT  N I G  WLP  D ++P+ PGL
Sbjct  695  GSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLP--DTEVPFTPGL  742



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DF+FGNSA V Q CNLY R+PLP Q N+ TAQGR+DP+QNTGIS+  C+  AA+D
Sbjct  305  IYGTIDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISVQKCRGAAASD  364

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+S F++YLGRPW++YSRTVF+ S++ S++DPAGWL W G FAL TLYY EY+N GP
Sbjct  365  LAAVQSSFRTYLGRPWKQYSRTVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGP  424

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV+W GYR +  A  A  FT  + IDG  WL  T   IP+  GL
Sbjct  425  GAGTSGRVSWMGYRGVISASEASTFTVGSFIDGDVWLAGT--SIPFSGGL  472



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  349  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGISIHNCKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  ++S  K+YLGRPW++YSRT+FM + + SL++ AGW+EW G+FAL TLYYGEY N GP
Sbjct  408  LKSIQSSVKTYLGRPWKQYSRTIFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV WAGY +I  A  A  FT  + + GG WLP T   +PY  GL
Sbjct  468  GSSTTNRVKWAGYHVITSATEAAKFTVGSFLAGGSWLPATG--VPYTSGL  515



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ CNL  RK +  Q+N ITAQGR+DP+QNTG SI +C++ A+AD
Sbjct  376  ITGTVDFIFGNAAVVFQNCNLIPRKQMKGQENTITAQGRTDPNQNTGTSIQNCEIFASAD  435

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PVE  FKSYLGRPW++YSRTV M S I  +IDPAGWLEW  DFALKTL+YGEY+N GP
Sbjct  436  LEPVEDTFKSYLGRPWKEYSRTVVMESYISDVIDPAGWLEWDRDFALKTLFYGEYRNGGP  495

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TS RV W GY +I   +VA+ FT A LI GG WL  T   + Y  GL
Sbjct  496  GSGTSERVKWPGYHVITSPEVAEQFTVAELIQGGSWLGST--GVDYTAGL  543



>ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
 gb|ESW12995.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
Length=609

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y RKP+ +QKN ITAQ R DP+QNTGIS+ +C+++ A D
Sbjct  440  IYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNTGISMHNCRIQPAPD  499

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+  F +YLGRPW+++SRTVFMLS +G  I   GWLEW GDFAL TLYYGEY N GP
Sbjct  500  LVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDHIHSRGWLEWNGDFALDTLYYGEYMNYGP  559

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RV W GYR+I  A  A  FT A  I G  WLP T
Sbjct  560  GAGVGQRVKWPGYRVITSAVEANRFTVAQFISGSAWLPST  599



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +Y RKP+  QKN +TAQGR+DP+QNTGISI + +V A  D
Sbjct  404  IYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDD  463

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PVES  K+YLGRPW++YSRTVFM + I SL+DP GWLEW GDFAL TLYYGEY N GP
Sbjct  464  LKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALNTLYYGEYNNIGP  523

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+  S RV W GY +I  +  A  FT  N I G  WLP T+  +P+ PGL
Sbjct  524  GSPISQRVKWKGYHVISNSTEASEFTVQNFIAGQSWLPNTE--VPFTPGL  571



>gb|AGV54687.1| pectinesterase [Phaseolus vulgaris]
Length=606

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y RKP+ +QKN ITAQ R DP+QNTGIS+ +C+++ A D
Sbjct  437  IYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNTGISMHNCRIQPAPD  496

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+  F +YLGRPW+++SRTVFMLS +G  I   GWLEW GDFAL TLYYGEY N GP
Sbjct  497  LVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDHIHSRGWLEWNGDFALDTLYYGEYMNYGP  556

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RV W GYR+I  A  A  FT A  I G  WLP T
Sbjct  557  GAGVGQRVKWPGYRVITSAVEANRFTVAQFISGSAWLPST  596



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   229 bits (585),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDF+FGN+AVVFQ  NLY R+PL  Q+N+ TAQGR DP+QNTGISIL+C+V A +D
Sbjct  786  IYGTVDFVFGNAAVVFQNSNLYARRPLAVQQNIFTAQGRDDPNQNTGISILNCKVAAGSD  845

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S F +YLGRPW+ YSRTV++LS + S++DPAGWLEW G F L TLYYGEY N+GP
Sbjct  846  LLPVISQFHTYLGRPWKAYSRTVYLLSNMESVVDPAGWLEWNGTFGLSTLYYGEYSNRGP  905

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+ RV W GYR+I  +  A  F   N I G  WLP+T   +P+Y  L
Sbjct  906  GSNTTGRVNWPGYRVINSSTEAGLFAVDNFIQGSQWLPLT--GLPFYLSL  953



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P +   ITAQGR+DP+QNTGISI +C+V AA+D
Sbjct  348  IYGTVDFIFGNAAVVFQNCNIYARSP-PNKIITITAQGRTDPNQNTGISIHNCRVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPW++YSRTVFM + + SLI+PAGW  W G+FAL TLYYGEY N GP
Sbjct  407  LKPVQGSVKTYLGRPWKQYSRTVFMKTFLDSLINPAGWSPWNGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  + VA  FT  + I G +WLP T+  +P+  GL
Sbjct  467  GSSTANRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATN--VPFTAGL  514



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R+P+ +QKN ITAQGR+DP+QNTGI I + +V AA D
Sbjct  359  IYGTVDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAED  418

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV S FK++LGRPW++YSRTVF+ + +  L+DPAGWLEW+GDFAL TLYYGEYKN GP
Sbjct  419  LVPVLSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGP  478

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
               T  RV W GY  I  A  A  FT  N I G  WLP T   IP+  GL
Sbjct  479  RGSTRGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATG--IPFLFGL  526



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY RKPL  Q+ + TAQGR DP+QNTGISI +C+V A +D
Sbjct  427  IYGTVDFIFGNAAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTGISIHNCRVTADSD  486

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            +  V+S FK+YLGRPW++YSRTVF+ S +  LI PAGWLEW   FAL TLYYGEY N GP
Sbjct  487  MAAVKSSFKTYLGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGP  546

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+NRV W GYR+I  A  A  FT    I+G  WLP T   + Y  GL
Sbjct  547  GAGTANRVNWPGYRVITSATEASQFTVNQFIEGDTWLPST--GVEYSSGL  594



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C L  RKP+  QKN++TAQGR+DP+QNTG SI  C + A++D
Sbjct  390  ITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSD  449

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S FKSYLGRPW++YSRTV M S IG LIDPAGW  W G+FALKTLYYGEY N+G 
Sbjct  450  LTPVKSSFKSYLGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGA  509

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I  A  AK FT A LI GG WL  T   + Y  GL
Sbjct  510  GAGTSKRVKWPGYHVITSANEAKKFTVAELIQGGVWLKSTG--VSYTEGL  557



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFG++AVVFQ C L +RKP+ +Q N++TAQGR DP+QNTG SI  C + A++D
Sbjct  310  ITGTVDFIFGDAAVVFQNCKLVVRKPMDKQSNMVTAQGRIDPNQNTGTSIQSCNIIASSD  369

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FKSYLGRPW++YSRTV M S IG  IDP+GW  W GDFALKTLYYGEY NKGP
Sbjct  370  LEPVKGSFKSYLGRPWKEYSRTVVMQSHIGDHIDPSGWSVWTGDFALKTLYYGEYMNKGP  429

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RV W GY +I  A  AK FT A LI GG WL  T
Sbjct  430  GAGTSKRVKWPGYHVITSADEAKKFTVAGLIQGGSWLKPT  469



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA+D
Sbjct  349  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGISIHNCKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  ++S  K+YLGRPW++YSRTVFM + + SL++ AGW+EW G+FAL TLYYGEY N GP
Sbjct  408  LKSIQSSVKTYLGRPWKQYSRTVFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  + + GG WLP T   +PY  GL
Sbjct  468  GSSTANRVKWVGYHVITSATEAAKFTVGSFLVGGSWLPATG--VPYTSGL  515



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q C +Y R+P+  QKN ITAQGR+DP+QNTGISI   +V A +D
Sbjct  350  VYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSD  409

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S  K+YLGRPW++YSRTVF+ S + +L+D AGWLEW G+FALKTLYYGEYKN GP
Sbjct  410  LKPVLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGP  469

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T  RV W GY +I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  470  GSSTRGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATN--VPFTAGL  517



>gb|KHN35620.1| Pectinesterase 2 [Glycine soja]
Length=355

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  193  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASD  251

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V    ++YLGRPWQ+YSRTVFM + + SLI+P GWLEW G+FAL TLYYGEY N GP
Sbjct  252  LMGV----RTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGP  307

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  N I G  WLP T   +P+  GL
Sbjct  308  GSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPAT--SVPFTSGL  355



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C +  R+P+  Q NV+TAQGR+DP+QNTGISI +C+V A++D
Sbjct  361  IYGTVDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRVMASSD  420

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S FK++LGRPW++YSRTV++ + + +L+DPAGW+EW G+FAL TLYYGEY+N GP
Sbjct  421  LKPVQSSFKTFLGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGP  480

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
             + T+ RV W GYR+I     A  FT  N I GG WLP T   +P+  GL
Sbjct  481  ASSTARRVKWRGYRVITNPSEASRFTVGNFISGGSWLPATG--VPFNSGL  528



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C ++ R+P+ +QK  ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  354  IYGTVDFIFGNAAVVLQNCMIFARQPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASD  413

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV + FK+YLGRPW++YSRTVFM + + SL+DPAGWLEW G+FAL TLYYGEY+N G 
Sbjct  414  LRPVLNTFKTYLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGA  473

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  +  A  F+  N I G  WLP T+  +P+  GL
Sbjct  474  GASTSRRVRWRGYRVITNSNEAAKFSVENFIAGRSWLPATN--VPFRAGL  521



>ref|XP_008371117.1| PREDICTED: pectinesterase [Malus domestica]
Length=558

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ C +  RKP+  Q N++TAQGR DP+QNTG SI  C V A++D
Sbjct  391  ITGTVDFIFGNAAVVFQNCKIVARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDVVASSD  450

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   +SYLGRPW++YSRTV M SKIG  IDPAGW  W GDFALKTLYYGEY N GP
Sbjct  451  LEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHIDPAGWSIWSGDFALKTLYYGEYANSGP  510

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV WAGY +I   K A+ FT ANLI GG WL  T   + Y  GL
Sbjct  511  GAGTSKRVKWAGYHVITSPKKAQPFTVANLIQGGSWLKSTG--VTYTEGL  558



>gb|KHN44643.1| Putative pectinesterase/pectinesterase inhibitor 61 [Glycine 
soja]
Length=610

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y RKP+ +QKN ITAQ R DP+QNTGIS+ +C++  A D
Sbjct  441  IYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNTGISLHNCRILPAPD  500

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F +YLGRPW++YSRTV+++S +G  I P GWLEW GDFAL TLYYGEY N GP
Sbjct  501  LAPVKGSFPTYLGRPWKQYSRTVYLVSYMGDHIHPRGWLEWNGDFALNTLYYGEYMNYGP  560

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RV W GYR+IK    A  FT A  I G  WLP T
Sbjct  561  GAAVGQRVQWPGYRVIKSTMEANRFTVAQFISGSAWLPST  600



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ C L  RKP+  QKN++TAQGR DP+QNTG SI  C++ A++D
Sbjct  377  ITGTVDFIFGNAAVVFQNCKLVARKPMNGQKNMVTAQGRIDPNQNTGTSIQKCEIIASSD  436

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  KSYLGRPW++YSRTV M S I   IDPAGW  W+GDFALKTLYYGEY N+G 
Sbjct  437  LEPVKSSVKSYLGRPWKEYSRTVVMQSNIADHIDPAGWSIWEGDFALKTLYYGEYMNRGA  496

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RV WAGYR+I  A  A+ FT A LI GG WL  T
Sbjct  497  GAGTSKRVKWAGYRVITSATEAQKFTVAELIQGGVWLKST  536



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+A V Q CN+Y+RKP+  QKN ITAQGR+DP+QNTG+SI   +V A++D
Sbjct  349  IYGTVDFIFGNAAAVLQNCNIYVRKPMSSQKNTITAQGRTDPNQNTGLSIHDSKVSASSD  408

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V++ FK+YLGRPW++YSRTVFM + + +LIDP+GWL+W G+FAL+TLYYGEY N G 
Sbjct  409  LKAVQNSFKTYLGRPWKEYSRTVFMKTALDNLIDPSGWLQWSGNFALRTLYYGEYMNSGA  468

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T +RV W+G+ ++  ++ AK FT  + I GG W+P T   +PY  GL
Sbjct  469  GAVTKSRVKWSGFHVMSASEAAK-FTVGSFISGGSWIPNTG--LPYTSGL  515



>ref|XP_009364480.1| PREDICTED: pectinesterase [Pyrus x bretschneideri]
Length=558

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ C +  RKP+  Q N++TAQGR DP+QNTG SI  C V A++D
Sbjct  391  ITGTVDFIFGNAAVVFQNCKIVARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDVVASSD  450

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   ++YLGRPW++YSRTV M SKIG  IDPAGW  W GDFALKTLYYGEY N GP
Sbjct  451  LEPVKGTIRTYLGRPWKEYSRTVVMQSKIGDHIDPAGWSIWSGDFALKTLYYGEYANSGP  510

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+ RV WAGY +IK  K A+ FT ANLI GG WL  T   + Y  GL
Sbjct  511  GAGTNKRVKWAGYHVIKSPKKAQPFTVANLIQGGSWLKSTG--VTYTEGL  558



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C +  RKP+ +Q N++TAQGR+DP+QNTG SI  C+V A++D
Sbjct  389  ITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCEVIASSD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   +SYLGRPW++YSRTV M S IG  IDPAGW EW GDFALKTLYYGEY N+GP
Sbjct  449  LEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I   + AK FT A LI GG WL  T   + Y  GL
Sbjct  509  GAGTSKRVKWPGYHVITDPEEAKKFTVAELIGGGSWLKSTG--VAYTEGL  556



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGISI +C+V AA D
Sbjct  365  IYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGISIHNCRVTAAPD  423

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPWQKYSRTVFM + + SLI+PAGW+ W G+FAL TLYYGEY N GP
Sbjct  424  LRPVQGSVKTYLGRPWQKYSRTVFMKTFLDSLINPAGWMPWSGNFALDTLYYGEYANTGP  483

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  + I    W+P T+  +P+  GL
Sbjct  484  GSSTANRVKWKGYHVITSASEASRFTPGSFIAANSWIPATN--VPFTSGL  531



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVD+IFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGI I + +V AA+D
Sbjct  353  IYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW GDFALKTLYY EY N GP
Sbjct  412  LKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV W GY ++K A     FT  N + G  WLP T   +P+  GL
Sbjct  472  GSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTG--VPFTSGL  519



>emb|CBI36882.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R PL  Q N ITAQGR+DP+QNTG SI +C ++AA D
Sbjct  399  IYGTVDFIFGNAAVVFQNCNLYPRLPLSGQFNAITAQGRTDPNQNTGTSIHNCVIRAADD  458

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV+M S +GSLI+P+GW  W GDFAL TLYY EY N GP
Sbjct  459  LAASNGTTKTYLGRPWKEYSRTVYMQSNMGSLINPSGWSIWSGDFALSTLYYAEYNNTGP  518

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TSNRVTW+GY +I  +  A  FT  N + GGDWLP T   +PY  GL
Sbjct  519  GSNTSNRVTWSGYHVIGPSDAAN-FTVGNFLLGGDWLPQT--GVPYTGGL  565



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q C +Y RKP+  QKN ITAQGR+DP+QNTGISI   +V AA D
Sbjct  352  VYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
                    K++LGRPW++YSRTVFM S + +L+DPAGWLEW G+FALKTLYYGEYKN GP
Sbjct  412  FKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  472  GAPTSRRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATN--VPFTAGL  519



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   222 bits (565),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGT+DF+FGN+AVV Q CNLY RKPLP Q N+ TAQGR DP+QNTGISI  C+V AAAD
Sbjct  396  VYGTIDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAAAD  455

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   +S  K+YLGRPW++YSRTV++ S++ SL+DPAGWLEW G FAL TLYYGEY N GP
Sbjct  456  LAAAQSSTKTYLGRPWKQYSRTVYLQSELDSLVDPAGWLEWNGSFALDTLYYGEYMNTGP  515

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  A  A  FT  N IDG  WL  T   IP+  GL
Sbjct  516  GAGTSGRVKWKGYRVITSAAEASAFTVGNFIDGDLWLAGT--SIPFTTGL  563



>ref|XP_004293266.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C +  RKP   Q N++TAQGR+DP+QNTG SI  CQV A++D
Sbjct  361  ITGTVDFIFGNAAVVLQNCKIVARKPASGQNNMVTAQGRTDPNQNTGTSIQKCQVIASSD  420

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   +SYLGRPW++YSRTV M S IG  IDP GW  W GDFALKTLYYGEY N GP
Sbjct  421  LEPVKGTVRSYLGRPWKEYSRTVVMQSTIGDHIDPTGWSIWSGDFALKTLYYGEYANSGP  480

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RVTWAGY +IK A  A+ FT A LI GG WL  T
Sbjct  481  GAGTSKRVTWAGYHVIKTASEAQSFTVAGLIQGGSWLKST  520



>gb|KCW73024.1| hypothetical protein EUGRSUZ_E01466, partial [Eucalyptus grandis]
Length=523

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT DFIFGN+AVVF  CN+Y+R   P + N ITAQGR++P+QNTGISIL+C+V A ++
Sbjct  349  IYGTTDFIFGNAAVVFHNCNIYVRNS-PNKVNTITAQGRTNPNQNTGISILNCKVIADSE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LI V+S  K+YLGRPWQKYSRTVFM +   SLID AGWLEW  DFAL TLYYGEY N GP
Sbjct  408  LILVQSSVKTYLGRPWQKYSRTVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT---DPKIPY  403
            G+ T+NRVTWAGY +I     A  FT  NLI GG WL  T   +P + Y
Sbjct  468  GSSTANRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGY  516



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVD+IFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGI I + +V AA+D
Sbjct  353  IYGTVDWIFGNAAVVFQDCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + + SLI+PAGW+EW GDFALKTLYY EY N GP
Sbjct  412  LKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV W GY ++K A     FT  N + G  WLP T   +P+  GL
Sbjct  472  GSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTG--VPFTSGL  519



>ref|XP_002268492.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Vitis vinifera]
Length=556

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R PL  Q N ITAQGR+DP+QNTG SI +C ++AA D
Sbjct  389  IYGTVDFIFGNAAVVFQNCNLYPRLPLSGQFNAITAQGRTDPNQNTGTSIHNCVIRAADD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV+M S +GSLI+P+GW  W GDFAL TLYY EY N GP
Sbjct  449  LAASNGTTKTYLGRPWKEYSRTVYMQSNMGSLINPSGWSIWSGDFALSTLYYAEYNNTGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TSNRVTW+GY +I  +  A  FT  N + GGDWLP T   +PY  GL
Sbjct  509  GSNTSNRVTWSGYHVIGPSDAAN-FTVGNFLLGGDWLPQT--GVPYTGGL  555



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q C +Y RKP+  QKN ITAQGR+DP+QNTGISI   +V AA D
Sbjct  352  VYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
                    K++LGRPW++YSRTVFM S + +L+DPAGWLEW G+FALKTLYYGEYKN GP
Sbjct  412  FKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GYR+I  +  A  FT  N I G  WLP T+  +P+  GL
Sbjct  472  GAPTSGRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATN--VPFTAGL  519



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  349  IYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  ++YLGRPW++YSRTVFM + +  LI+PAGW+EW G+FAL TLYYGEY N GP
Sbjct  408  LRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+ RV W+GYR+I  A  A  F+ AN I G  WLP T  K+P+ P L
Sbjct  468  GSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPST--KVPFTPSL  515



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ C++  RKP   QKN++TAQGR DP+QNTG SI +C+V  ++D
Sbjct  388  ITGTVDFIFGNAAVVFQNCDIVARKPDKGQKNMLTAQGREDPNQNTGTSIQNCKVTPSSD  447

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FK+YLGRPW+ YSRTVFM S I   IDP+GW  W GDFAL TLYYGEY N GP
Sbjct  448  LAPVKGTFKTYLGRPWKMYSRTVFMQSYIEDHIDPSGWFPWDGDFALSTLYYGEYANTGP  507

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G+DTS RV W GYR+IK  K A+ FT A LI GG WL  T
Sbjct  508  GSDTSKRVNWKGYRVIKDPKEAEQFTVAKLIQGGSWLKPT  547



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C +Y RKP+  Q+N ITAQGR+DP+QNTGISI   +V AA D
Sbjct  351  VYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K++LGRPW++YSRTVFM S + +L+DPAGWL+W GDFALKTLYYGEYKN GP
Sbjct  411  LESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFALKTLYYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTD  418
            GA T+ RV W GYRII  +  A  FT  N I G  WLP T+
Sbjct  471  GAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATN  511



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQ C L  RKP+  Q N++TAQGR+DP+QNTG  I +C + A+AD
Sbjct  376  VTGTVDFIFGNAAVVFQNCKLVARKPMSSQSNMVTAQGRTDPNQNTGTFIQNCNIIASAD  435

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  KSYLGRPW++YSRTV M S I   IDP+GW  W GDFALKTLYYGEY N+GP
Sbjct  436  LRPVKASIKSYLGRPWKEYSRTVVMQSYIADHIDPSGWSIWNGDFALKTLYYGEYMNRGP  495

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T  RV W GYRI+ +A+ AK FT A LI GG WL  T   + Y  GL
Sbjct  496  GAGTCKRVKWPGYRILTKAEEAKPFTVAELIQGGSWLKSTG--VAYTEGL  543



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C +  RKP+ +Q N++TAQGR+DP+QNTG SI  C V A++D
Sbjct  389  ITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCDVIASSD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   +SYLGRPW++YSRTV M S IG  IDPAGW EW GDFALKTLYYGEY N+GP
Sbjct  449  LEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I   + AK FT A LI GG WL  T   + Y  GL
Sbjct  509  GAGTSKRVKWPGYHVITDPEEAKKFTVAELIGGGSWLKSTG--VAYTEGL  556



>gb|EPS67025.1| pectinesterase, partial [Genlisea aurea]
Length=230

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ C ++ RKPLP QKN ITAQGR DP+QNTGISI  C++ A  D
Sbjct  63   IYGTVDFIFGNAAVVFQNCTIHSRKPLPFQKNTITAQGRKDPNQNTGISIHACRIVAEPD  122

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L    +DF +YLGRPW+ YSRTV+MLS IG  + P GWLEW   FAL +LYYGEY N GP
Sbjct  123  LEWGRADFPTYLGRPWKLYSRTVYMLSFIGDHVHPRGWLEWNSTFALDSLYYGEYLNYGP  182

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GADTS RV W G+ +I+ A  A  FT A  I G  WLP T
Sbjct  183  GADTSQRVNWTGHHVIQTAAEASKFTVAQFIFGSSWLPAT  222



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C +  RKP+ +Q N++TAQGR+DP+QNTG SI  C+V A++D
Sbjct  389  ITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCEVIASSD  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   +SYLGRPW++YSRTV M S IG  IDPAGW EW GDFALKTLYYGEY N+GP
Sbjct  449  LEPVKGSIRSYLGRPWKEYSRTVVMQSHIGGHIDPAGWSEWSGDFALKTLYYGEYLNRGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     AK FT A LI GG WL  T   + Y  GL
Sbjct  509  GAGTSKRVKWPGYHVITDPGEAKKFTVAELIGGGSWLKSTG--VAYTEGL  556



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++ VVFQ CN+Y+RKP+  Q+N +TAQGR+D ++NTGISI +  V AA+D
Sbjct  355  IYGTVDFIFGDAVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTGISIHNSIVTAASD  414

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FK+YLGRPWQKYSRTVFM + + SLI+PAGWLEW G F L TLYY EY N G 
Sbjct  415  LRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGA  474

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RV W GY +I  +  A  FT    + G  W+P T   +P+  GL
Sbjct  475  GADTSKRVNWPGYHVIASSSEASKFTVGGFLSGDSWIPATG--VPFSFGL  522



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++  V Q CN+Y+RKP+  QKN +TAQGR DP++NTGISI + +V AA+D
Sbjct  363  IYGTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNENTGISIHNSRVTAASD  422

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FK+YLGRPWQKYSRTVFM + + SLIDPAGWLEW G+FAL TLYYGEY N G 
Sbjct  423  LRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGA  482

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W G+ ++  +   K FT  N + GG W+      +P+  GL
Sbjct  483  GASTSRRVKWPGFHVMSASDAGK-FTVGNFLGGGSWIAA--AGVPFTSGL  529



>ref|XP_007163134.1| hypothetical protein PHAVU_001G209300g [Phaseolus vulgaris]
 gb|ESW35128.1| hypothetical protein PHAVU_001G209300g [Phaseolus vulgaris]
Length=562

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P+  Q N ITAQGR+DP+QNTG SI +  +KAAAD
Sbjct  395  IYGTVDFIFGNAAVVFQTCNMYPRLPMSGQFNAITAQGRTDPNQNTGTSIQNSTIKAAAD  454

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV    K+YLGRPW++YSRTV+M S + SLI+PAGW EW GDFAL T YY EY N GP
Sbjct  455  LAPVVGTVKTYLGRPWKEYSRTVYMQSFMDSLINPAGWHEWSGDFALNTSYYAEYNNTGP  514

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T NRVTW+GY +I  A  A  FT +N ++G DWLP T   +PY  GL
Sbjct  515  GSSTENRVTWSGYHVIN-ATDAVNFTVSNFLEGDDWLPQT--GVPYSSGL  561



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GT+DFIFGN+AVVFQKC L  RKP   Q+N++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  205  VTGTIDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCDIIASPD  264

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV  +F +YLGRPW+KYSRTV M S +G LIDP+GW EW GDFALKTLYYGE+ N GP
Sbjct  265  LKPVVKEFPTYLGRPWKKYSRTVVMESSLGGLIDPSGWAEWHGDFALKTLYYGEFMNNGP  324

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  TD  + Y  GL
Sbjct  325  GAGTSKRVKWPGYHVITDPAEAMSFTVAKLIQGGSWLRSTD--VAYVDGL  372



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT DFI GN+A VFQ CN+Y+RKPL  QKN +TAQ R+DP+QNTGISI + +V AA+D
Sbjct  360  IYGTQDFICGNAAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGISIHNSRVTAASD  419

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+  FK+YLGRPWQKYSRTVFM + + SLIDPAGWLEW G FAL TLYYGE+ N G 
Sbjct  420  LRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEFMNSGA  479

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RVTW GYR++  ++ A  FT  + + GG W+      +P+  GL
Sbjct  480  GASTSGRVTWPGYRVMS-SEEAGEFTVGSFLGGGSWIAA--AGVPFTSGL  526



>ref|XP_004299719.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20-like 
[Fragaria vesca subsp. vesca]
Length=566

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R+P   Q N ITAQGR+DP+QNTG SI +C + AA D
Sbjct  399  IYGTVDFIFGNAAVVFQNCNIYPRQPRQGQTNPITAQGRTDPNQNTGTSIQNCTITAADD  458

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV++ + + SLIDPAGWL W GDFAL TLYYGEY NKGP
Sbjct  459  LASSNFTVKTYLGRPWKEYSRTVYLQNFMDSLIDPAGWLAWSGDFALSTLYYGEYDNKGP  518

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTSNRVTW GY II  A  A  FT +N + G  WLP T   +PY  GL
Sbjct  519  GADTSNRVTWPGYHIIG-ATDASNFTVSNFVLGDSWLPQT--GVPYTGGL  565



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C +Y RKP+  Q+N ITAQGR+DP+QNTGISI   +V AA D
Sbjct  351  VYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
                    K++LGRPW++YSRTVFM S + +L+DPAGWL+W GDFALKTLYYGEYKN GP
Sbjct  411  FESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+ RV W GYRII  +  A  FT  N I G  WLP T+  + +  GL
Sbjct  471  GAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATN--VAFAAGL  518



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+A V Q C+++ R+P P QKN++TAQGR DP+QNTGI I  C++ A AD
Sbjct  326  VAGTVDFIFGNAAAVLQNCDIHARRPNPGQKNMVTAQGRDDPNQNTGIVIQKCRIGATAD  385

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+S F +YLGRPW++YSRTV M ++I ++I+PAGW EW G+FAL TL+Y EYKN G 
Sbjct  386  LVPVQSSFPTYLGRPWKEYSRTVVMQTQISNVINPAGWFEWDGNFALNTLFYAEYKNTGA  445

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+NRVTW G+R++K    A+ FTA   I GG WL  T    P+  GL
Sbjct  446  GAGTANRVTWKGFRVLKSDAEAQPFTAGRFISGGSWLAATG--FPFTLGL  493



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C +Y RKP+  Q+N ITAQGR+DP+QNTGISI   +V AA D
Sbjct  351  VYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALD  410

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
                    K++LGRPW++YSRTVFM S + +L+DPAGWL+W GDFALKTLYYGEYKN GP
Sbjct  411  FESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGP  470

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T+ RV W GYRII  +  A  FT  N I G  WLP T+  + +  GL
Sbjct  471  GAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATN--VAFAAGL  518



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+A VFQ CN++ R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  349  IYGTVDFIFGNAAAVFQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  K+YLGRPW++YSRTVFM + + SLI PAGWLEW G+FAL TLYYGEY N G 
Sbjct  408  LKPVQNSVKTYLGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALSTLYYGEYMNTGL  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T NRV W GY +I RA  A  FT  N I G  WLP T   +P+   L
Sbjct  468  GSSTRNRVKWQGYHVITRASEASKFTVGNFIAGNSWLPSTS--VPFTSTL  515



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N +TAQGR+DP+QNTGISI + +V AA+D
Sbjct  348  IYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGISIHNSRVTAASD  406

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   ++YLGRPW++YSRTVFM + + SLI+PAGW+EW G+FAL TLYYGEY N GP
Sbjct  407  LTPVQGSVRTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGNFALDTLYYGEYMNTGP  466

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I     A  FT  N I G  WLP T+  +P+  GL
Sbjct  467  GSSTANRVNWKGYHVITSPTEASQFTVGNFISGNSWLPGTN--VPFTSGL  514



>ref|XP_008386683.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Malus domestica]
Length=569

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P+  Q N ITAQGR+DP+QNTG SI +C ++AA D
Sbjct  402  IYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNTGTSIHNCTIRAADD  461

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L    S  ++YLGRPW++YSRTV+M S I S++DP GW EW GDFAL TLYY EY N GP
Sbjct  462  LASSNSSTQTYLGRPWKEYSRTVYMQSYIDSVVDPVGWQEWNGDFALTTLYYAEYNNTGP  521

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+NRVTW+GY +I     A  FT  N + G DWLP T   +PY  GL
Sbjct  522  GSNTTNRVTWSGYHVINSTDAAN-FTVTNFLLGDDWLPQT--GVPYTSGL  568



>gb|ACN40878.1| unknown [Picea sitchensis]
Length=655

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV QKC ++ RKP+P +K  ITAQGR DP+QNTGISI  C+V AA D
Sbjct  486  IYGTVDFIFGNAAVVLQKCTMFARKPMPNEKITITAQGRKDPNQNTGISIHDCKVTAAID  545

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV++ +++YLGRPW+ YSRTV++ + +  +IDPAGWLEW GDFAL TLYYGEY N GP
Sbjct  546  LVPVKASYRAYLGRPWKLYSRTVYLQTFLDDIIDPAGWLEWYGDFALNTLYYGEYMNSGP  605

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RVTW GYR+ K A     FT A  I G  WLP T
Sbjct  606  GAGLVKRVTWPGYRVFKTADQVYPFTVAQFISGSKWLPST  645



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVV Q C +  R+PL  Q NVITAQGRSDPHQNTGISI   +V A++D
Sbjct  360  IYGTIDFIFGNAAVVLQNCMIVARRPLHGQANVITAQGRSDPHQNTGISIHKSRVIASSD  419

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV S  K++LGRPWQ+YSRTV++ + +  L+DPAGWLEW G FAL TLYYGEYKN GP
Sbjct  420  LRPVLSSVKTFLGRPWQQYSRTVYLQTYLDGLVDPAGWLEWGGSFALNTLYYGEYKNIGP  479

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+ RV W GYR+I+    A  FT  N I G  WLP T   +P+  GL
Sbjct  480  GSSTARRVKWRGYRVIRNPSEASLFTVGNFISGRSWLPGTG--VPFTSGL  527



>emb|CDP17208.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ CNLY R P+  Q N ITAQGR+D +QNTG SI +C + AA D
Sbjct  344  VYGTVDFIFGNAAVVFQNCNLYPRLPMQGQFNAITAQGRTDINQNTGTSIQNCNIMAAPD  403

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV+M S +GSLIDPAGW  W GDFAL TLYY EY N GP
Sbjct  404  LASSNGTTKTYLGRPWKEYSRTVYMQSFLGSLIDPAGWTPWSGDFALSTLYYAEYDNSGP  463

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+DT+NRVTW GY +I  A  A  FT AN I G +WLP T   + Y  GL
Sbjct  464  GSDTTNRVTWPGYHVINAADAAN-FTVANFILGDNWLPQT--GVTYTSGL  510



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ C L  RKP   QKN ITAQGR+DP+QNTGISI +C++    D
Sbjct  388  ISGTVDFIFGNAAVVFQSCILVPRKPGANQKNAITAQGRTDPNQNTGISIHNCKITPGTD  447

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+PV+S F +YLGRPW++YSRTVFM S I   I PAGWLEW GDFALKTLYYGEY N GP
Sbjct  448  LVPVKSSFPTYLGRPWKEYSRTVFMQSYIDGFIQPAGWLEWDGDFALKTLYYGEYMNTGP  507

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T NRV W GYR+IK  + A  FT    I G  WL  T   + Y  GL
Sbjct  508  GSGTGNRVKWPGYRVIKSPQEASKFTVGEFIQGDSWLQSTG--VHYVDGL  555



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  351  IYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASD  409

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++  ++YLGRPW++YSRTVFM + +  LI+P+GW+EW G+FAL TLYY EY N GP
Sbjct  410  LRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYREYMNTGP  469

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T  RV W GYR++ RA  A  F+ AN I G  WLP T  K+PY P L
Sbjct  470  GSSTGRRVKWPGYRVMTRASEASKFSVANFIAGNAWLPAT--KVPYTPSL  517



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++  V Q CN+Y+RKP+  Q+N +TAQGR+DP++NTGISI + +V AA+D
Sbjct  363  IYGTVDFIFGDAVAVLQNCNIYVRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTAASD  422

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  FK+YLGRPWQKYSRTVFM + + SL+DPAGWLEW G+FAL TLYYGEY N G 
Sbjct  423  LRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMNIGG  482

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W G+ ++  +   K FT  N + GG W+  T   +P+  GL
Sbjct  483  GASTSRRVKWPGFHVMSASDAGK-FTVENFLGGGSWIAAT--GVPFTSGL  529



>emb|CAN60506.1| hypothetical protein VITISV_022717 [Vitis vinifera]
Length=260

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGNSA +FQ CNLY RKP+P QKN  TAQGR DP+QNTGISI +C ++AA D
Sbjct  93   VYGTVDFIFGNSACIFQNCNLYARKPMPNQKNAFTAQGRMDPNQNTGISIHNCTIEAAPD  152

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L    +   +YLGRPW++YSRTV+M S IGSLIDP GWLEW G   L TLYYGE++N GP
Sbjct  153  LAMDLNSTLNYLGRPWKQYSRTVYMQSYIGSLIDPXGWLEWNGTVGLDTLYYGEFENYGP  212

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA+TS RV W GY ++  A  A  FT  N   G  WL  T+  IP+Y GL
Sbjct  213  GANTSMRVQWPGYTLMN-ASQAVNFTVYNFTMGDTWL--TNLDIPFYGGL  259



>ref|XP_006853048.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
 gb|ERN14515.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
Length=532

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVVFQ CNLY R P+  Q NV TAQGR+DP+QNTG SIL+C V A++D
Sbjct  363  IYGTIDFIFGNAAVVFQNCNLYARMPMASQNNVFTAQGRTDPNQNTGTSILNCSVTASSD  422

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
                 S   SYLGRPW++YSRTV+M S I SLID +GWL W GDFAL TLYYGE+ N GP
Sbjct  423  FAWNSSSVNSYLGRPWKEYSRTVYMKSFIDSLIDSSGWLPWSGDFALNTLYYGEFNNSGP  482

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GADTS RV+W GY  I     A  FT +N I G  WLP T   + ++ GL
Sbjct  483  GADTSKRVSWPGYHAIMNVTDAGNFTVSNFIMGDVWLPAT--SVEFHAGL  530



>ref|XP_010058469.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=607

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT DFIFGN+AVVF  CN+Y+R   P + N ITAQGR++P+QNTGISIL+C+V A ++
Sbjct  349  IYGTTDFIFGNAAVVFHNCNIYVRNS-PNKVNTITAQGRTNPNQNTGISILNCKVIADSE  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LI V+S  K+YLGRPWQKYSRTVFM +   SLID AGWLEW  DFAL TLYYGEY N GP
Sbjct  408  LILVQSSVKTYLGRPWQKYSRTVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGP  467

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT---DPKIPY  403
            G+ T+NRVTWAGY +I     A  FT  NLI GG WL  T   +P + Y
Sbjct  468  GSSTANRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGY  516



>ref|XP_004498516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Cicer arietinum]
Length=606

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQKCN+Y RKP+ +QKN ITAQ R DP+QNTGISI  C++  A D
Sbjct  437  IYGTVDFIFGNAAVVFQKCNIYARKPMDQQKNTITAQNRKDPNQNTGISIHDCRILPAPD  496

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   ++YLGRPW+ YSR V+MLS +G  +DP GWLEW GDFAL TLYYGEY N GP
Sbjct  497  LAPVKGSVQTYLGRPWKMYSRAVYMLSYMGDHVDPHGWLEWNGDFALDTLYYGEYMNYGP  556

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RV W GYR+I     A  +T A  I G  WLP T
Sbjct  557  GAAIGQRVKWPGYRVITSNVEANRYTVAQFISGSSWLPST  596



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R P P + N ITAQGR+D +QNTGISI +C+V AA+ 
Sbjct  356  IYGTVDFIFGNAAVVLQNCNIYARDP-PNKTNTITAQGRTDSNQNTGISIHNCRVTAASS  414

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L    S  K+YLGRPW++YSRTV M + +GSLI+PAGWLEW G+FALKTLYY EY N GP
Sbjct  415  L---SSSVKTYLGRPWKEYSRTVVMKTNLGSLINPAGWLEWSGNFALKTLYYAEYANTGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV W GY +I  ++ +K FT  N I GG WLP T+  +PY  GL
Sbjct  472  GSSTSNRVKWTGYHVIGASEASK-FTVGNFIAGGSWLPATN--VPYTSGL  518



>gb|KDO40320.1| hypothetical protein CISIN_1g048471mg, partial [Citrus sinensis]
Length=183

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y R PL  Q   ITAQ R+DP+QNTG SI +C + A+AD
Sbjct  16   IYGTVDFIFGNAAVVLQNCNIYPRLPLNGQFIAITAQSRTDPNQNTGTSIHNCTITASAD  75

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       ++YLGRPW++YSRTV+M S + SLI+PAGW EW GDFAL TLYY EY N GP
Sbjct  76   LASSNQTVQTYLGRPWKEYSRTVYMQSFMDSLINPAGWHEWSGDFALATLYYAEYNNTGP  135

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+DT+NRVTW GY++I     A  FT +N + G +WLP T   +PY  GL
Sbjct  136  GSDTTNRVTWPGYQVINATDAAN-FTVSNFLLGDNWLPQT--AVPYTGGL  182



>dbj|BAM05619.1| pectin methylesterase 3, partial [Eucalyptus pilularis]
 dbj|BAM05621.1| pectin methylesterase 3, partial [Eucalyptus pyrocarpa]
Length=189

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C+LY RKP+P QKN ITAQ R DP+QNTGISI  C++ AA+D
Sbjct  20   VYGTVDFIFGNAAVVFQNCSLYARKPMPMQKNTITAQNRKDPNQNTGISIHACRILAASD  79

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L      F SYLGRPW+ YSRTV+M+S IGS + P GWLEW   FAL TLYYGEY N GP
Sbjct  80   LAASNGSFLSYLGRPWKLYSRTVYMMSYIGSHVHPRGWLEWNATFALDTLYYGEYMNYGP  139

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G     RV W G+R+I     A  FT    I G  WLP T
Sbjct  140  GGAIGQRVNWTGFRVITSPVEAGKFTVGQFIFGTSWLPST  179



>ref|XP_004299720.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Fragaria vesca subsp. vesca]
Length=565

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AV FQ CN+Y R+PL  Q N ITAQGR+D +QNTGISI +C V AAAD
Sbjct  398  IYGTVDFIFGNAAVAFQNCNIYPRRPLQGQSNTITAQGRTDVNQNTGISIQNCTVTAAAD  457

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRT+FM   I S IDPAGWL W GDFAL TLYY EY N GP
Sbjct  458  LASSTFTVKNYLGRPWKEYSRTIFMQGFIDSFIDPAGWLAWNGDFALSTLYYAEYNNSGP  517

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+NRVTW GY +I   + A  FT +N I G +WLP T   +PY  GL
Sbjct  518  GSNTNNRVTWPGYHVIGATEAAN-FTVSNFILGDNWLPQT--GVPYTGGL  564



>dbj|BAM05618.1| pectin methylesterase 3, partial [Eucalyptus pilularis]
Length=190

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVVFQ C+LY RKP+P QKN ITAQ R DP+QNTGISI  C++ AA+D
Sbjct  21   VYGTVDFIFGNAAVVFQNCSLYARKPMPMQKNTITAQNRKDPNQNTGISIHACRILAASD  80

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L      F SYLGRPW+ YSRTV+M+S IGS + P GWLEW   FAL TLYYGEY N GP
Sbjct  81   LAASNGSFLSYLGRPWKLYSRTVYMMSYIGSHVHPRGWLEWNATFALDTLYYGEYMNYGP  140

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G     RV W G+R+I     A  FT    I G  WLP T
Sbjct  141  GGAIGQRVNWTGFRVITSPVEAGKFTVGQFIFGTSWLPST  180



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++  V Q CN+Y+RKP+  QKN +TAQGR+DP++NTGISI + +V AA+D
Sbjct  363  IYGTVDFIFGDAVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASD  422

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+  FK+YLGRPWQKYSRTVFM + + SLIDPAGWLEW G FAL TLYYGEY N G 
Sbjct  423  LRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEYMNTGA  482

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA T  RV WAGY ++  A   K FT  + + GG W  +    +P+  GL
Sbjct  483  GASTGGRVKWAGYHVMSAADAGK-FTVGSFLGGGSW--IGSAGVPFTSGL  529



>ref|XP_009389951.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=596

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q C+L+ R+PLP QKN ITAQ R DP+QNTGISI  CQV AAAD
Sbjct  427  IYGTVDFIFGNAAVVLQNCSLWARRPLPMQKNTITAQNRKDPNQNTGISIHACQVVAAAD  486

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV++ F +YLGRPW+ YSR V+MLS +G  I+PAGWLEW G FAL TLYYGEY N GP
Sbjct  487  LEPVKASFSTYLGRPWKLYSRVVYMLSYMGDHINPAGWLEWNGSFALDTLYYGEYMNDGP  546

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            G+    RV W GYR+I     A  FT A  I G  WLP T   + +  GL+
Sbjct  547  GSALGMRVAWPGYRVITLPAEASKFTVAQFIYGSSWLPST--GVAFLAGLE  595



>gb|AAF23891.1| pectin methyl esterase [Solanum tuberosum]
Length=530

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GT+DFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  361  VSGTIDFIFGNAAVVFQKCQLVARKPSKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  420

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV  +FK+YLGRPW++YSRTV M S +G LIDPAGW EW G+FALKTLYYGEY N GP
Sbjct  421  LEPVVKEFKTYLGRPWKEYSRTVVMQSYLGGLIDPAGWAEWSGEFALKTLYYGEYMNNGP  480

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  T   + Y  GL
Sbjct  481  GAGTSKRVKWPGYHVITDPAEAMPFTVAELIQGGSWLSST--GVAYVDGL  528



>ref|XP_006360082.1| PREDICTED: pectinesterase 3-like [Solanum tuberosum]
Length=540

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  371  VTGTVDFIFGNAAVVFQKCQLVARKPNKRQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  430

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV ++FK+YLGRPW+KYSRTV M S +G  IDP+GW EW+GDFALKTLYYGE+ N GP
Sbjct  431  LEPVVNEFKTYLGRPWKKYSRTVVMQSYLGGHIDPSGWFEWRGDFALKTLYYGEFMNNGP  490

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  T   + Y  GL
Sbjct  491  GAGTSKRVKWPGYHVITDPAKAMPFTVAELIQGGSWLNST--SVAYVEGL  538



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGNSAVVFQ C++  RKP   QKN++TAQGR DP+QNT ISI  C +K +++
Sbjct  389  ITGTVDFIFGNSAVVFQNCDIVARKPDAGQKNMLTAQGREDPNQNTAISIQKCNIKPSSE  448

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPW+ YSRTV M S I + IDPAGW  W G+FAL TLYYGEY N GP
Sbjct  449  LAPVKESVKTYLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANNGP  508

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RVTW GYR+IK +K A  FT ANLI GG WL  T
Sbjct  509  GAGTSKRVTWKGYRVIKDSKEAAKFTVANLIQGGLWLKPT  548



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ RKP P + N +TAQGR+DP+QNTGI I +C+V AA+D
Sbjct  344  IYGTVDFIFGNAAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASD  402

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K++LGRPW++YSRTV++ + + SLI+PAGW+EW GDFAL TLYY EY N GP
Sbjct  403  LKPVQSSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGP  462

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY ++        FT  N I G  WLP T+  +P+  GL
Sbjct  463  GSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATN--VPFTSGL  510



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GT+DFIFGN+AVVFQKC L  RKP   QKN++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  376  VSGTIDFIFGNAAVVFQKCQLVARKPSKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPD  435

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV  +FK+YLGRPW++YSRTV M S +G LIDPAGW EW G+FALKTLYYGEY N GP
Sbjct  436  LEPVVKEFKTYLGRPWKEYSRTVVMQSYLGGLIDPAGWAEWSGEFALKTLYYGEYMNNGP  495

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  T   + Y  GL
Sbjct  496  GAGTSKRVKWPGYHVITDPAEAMPFTVAELIQGGSWLSSTG--VAYVDGL  543



>ref|XP_008219291.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Prunus mume]
Length=564

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CNLY R+P   Q N ITAQGR+DP+QNTG SI +C +K   D
Sbjct  397  IYGTVDFIFGNAAVVFQNCNLYPRQPNKGQSNAITAQGRTDPNQNTGTSIHNCTIKPTPD  456

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV+M + + SLIDPAGWL W GDFAL TLYY EY N GP
Sbjct  457  LASSNFTVKTYLGRPWKEYSRTVYMQTFMASLIDPAGWLAWSGDFALSTLYYAEYNNTGP  516

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++T+NRVTW GY +I  + VA  FT  N + G +WLP T   +PY  GL
Sbjct  517  GSNTTNRVTWPGYHVIN-STVAANFTVTNFLTGDNWLPAT--GVPYTGGL  563



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  349  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASD  407

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V    ++YLGRPWQ+YSRTVFM + + SLI+P GWLEW G+FAL TLYYGEY N GP
Sbjct  408  LMGV----RTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGP  463

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  N I G  WLP T   +P+  GL
Sbjct  464  GSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATS--VPFTSGL  511



>ref|XP_006371892.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
 gb|ERP49689.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
Length=229

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + G+VDFIFGN+AVVFQ C+++ R+P P QKN++TAQGRSDP++NTGI I  C++ A  D
Sbjct  62   IIGSVDFIFGNAAVVFQDCDIHARRPNPGQKNMVTAQGRSDPNENTGIVIQKCRIGATQD  121

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+  +S F+SYLGRPW+ YSRT+ M ++I  +IDPAGW EW GDFAL TL Y EY+N GP
Sbjct  122  LLAAKSSFRSYLGRPWKLYSRTIVMQTEISDIIDPAGWFEWDGDFALDTLVYREYQNTGP  181

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA+T+NRV W G++++  A   + F A N I G  WLP T
Sbjct  182  GANTANRVNWKGFKVVTSAIEVQPFIARNFIRGASWLPST  221



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GT+DFIFGN+AVV Q C++  R+P P Q+N++TAQGR DP+QNTGI I  C++ A +D
Sbjct  231  IVGTIDFIFGNAAVVLQNCDIQARRPNPRQRNMVTAQGRDDPNQNTGIVIQKCRIGATSD  290

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S F +YLGRPW+KYSRT+ M + I ++I+PAGW EW G+FAL TL+Y EY+N+G 
Sbjct  291  LKPVQSSFPTYLGRPWKKYSRTIVMQTDISNVINPAGWYEWDGNFALNTLFYAEYQNRGA  350

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRVTW G+R++  A  A+ FTA   I GG+WL  T    P+  GL
Sbjct  351  GARTSNRVTWRGFRVLTSAAEAQPFTAGRFIAGGNWLGATG--FPFSLGL  398



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+A VFQ C +  RKP+  QKN++TAQGR+DP+QNTG SI  C V A++D
Sbjct  380  ITGTVDFIFGNAAAVFQNCKIVARKPMAGQKNMVTAQGRTDPNQNTGTSIQKCDVIASSD  439

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F SYLGRPW++YSRTV M S IG  IDPAGW  W G+FALKTLYYGEY NKG 
Sbjct  440  LQPVKGSFPSYLGRPWKEYSRTVVMQSNIGDHIDPAGWSIWDGEFALKTLYYGEYMNKGA  499

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA TS RV W GY +I  A  AK FT A LI GG WL  T
Sbjct  500  GAGTSKRVKWPGYHVITSATEAKKFTVAELIQGGAWLKST  539



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+AVV Q C +Y RKP+  Q+ V+TAQGR+DP+QNTGISI + +V AA D
Sbjct  352  IYGTIDFIFGNAAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMAADD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV    ++YLGRPW++YSRTV++ S + SL++PAGWLEW G+FAL TLYYGE+KN GP
Sbjct  412  LKPVIKSVRTYLGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT  N I G  WLP T   +P+  GL
Sbjct  472  GSSTANRVKWKGYRVITSANEAAKFTVGNFIAGNSWLPGTG--VPFTAGL  519



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R P P + N ITAQGR+DP+QNTGISI + +V AA+D
Sbjct  344  IYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASD  402

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+ V    ++YLGRPWQ+YSRTVFM + + SLI+P GWLEW G+FAL TLYYGEY N GP
Sbjct  403  LMGV----RTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGP  458

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GY +I  A  A  FT  N I G  WLP T   +P+  GL
Sbjct  459  GSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPAT--SVPFTSGL  506



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVD+IFGN+AVVFQ CN+Y R P P + N +TAQGR+DP+QNTGI I + +V AA+D
Sbjct  353  IYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASD  411

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+S  K+YLGRPW++YSRTVFM + + SLI+PA W+EW G+FALKTLYY EY N GP
Sbjct  412  LKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPADWMEWDGNFALKTLYYAEYMNTGP  471

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ TSNRV W GY ++K A     FT  N + G  WLP T   +P+  GL
Sbjct  472  GSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTG--VPFTSGL  519



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C+++ RKP   QKN++TAQGR+DP+QNTGI I   ++ A +D
Sbjct  42   IAGTVDFIFGNAAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSD  101

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+  FK+YLGRPW++YSRTV M S I  +IDPAGW EW G FAL TL+Y EY N G 
Sbjct  102  LQAVKGSFKTYLGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGA  161

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRVTW GY++I  A  A+ FT  N I GG WL  T    P+  GL
Sbjct  162  GASTSNRVTWKGYKVITSATEAQAFTPGNFIAGGSWLSATG--FPFTLGL  209



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   Q+N++TAQGR+DP+Q TG SI  C + A+ D
Sbjct  381  VTGTVDFIFGNAAVVFQKCQLVARKPNKNQQNMVTAQGRTDPNQATGTSIQFCDIIASPD  440

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV ++FK+YLGRPW++YSRTV M S +G LIDPAGW EW GDFALKTLYYGE+ N GP
Sbjct  441  LEPVVNEFKTYLGRPWKEYSRTVVMQSYLGGLIDPAGWAEWDGDFALKTLYYGEFMNNGP  500

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  T   + Y  GL
Sbjct  501  GAGTSKRVKWPGYHVITDPAEAMPFTVAELIQGGSWLSST--GVAYVDGL  548



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+  VFQ CN+++R+P+ +QKN ITAQGRSDP+QNTGISI + ++ AA D
Sbjct  353  IYGTVDFIFGNAIAVFQNCNIFVRRPMSQQKNTITAQGRSDPNQNTGISIHNSRISAAPD  412

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+  F +YLGRPWQK++RT+F+   +  LI+PAGWLEW  +FAL TLYYGEY+N GP
Sbjct  413  LSPVQGSFATYLGRPWQKHARTIFLKCFLDDLINPAGWLEWSENFALSTLYYGEYRNTGP  472

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G++T  RV W GY  I     A  F+  + +DGG W+P T
Sbjct  473  GSNTGKRVKWNGYHFITSPSEASKFSVGSFLDGGSWIPAT  512



>ref|XP_009776000.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana sylvestris]
Length=598

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y RKP+  QKN ITAQ R DP+QNTGISI  C++ A  D
Sbjct  429  IYGTVDFIFGNAAVVLQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKILATPD  488

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   +  F +YLGRPW+ YSRTV+MLS +G  I P+GWLEW GDFAL TLYYGEY N GP
Sbjct  489  LEASKGSFPTYLGRPWKMYSRTVYMLSNMGDHIHPSGWLEWNGDFALDTLYYGEYMNFGP  548

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGLK  388
            GA    RVTW GYR+IK  + A  FT A  I G  WLP T   + Y  GL 
Sbjct  549  GAAVGKRVTWPGYRVIKSVEEASKFTVAKFIYGSSWLPST--GVAYLAGLN  597



>ref|XP_010269594.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Nelumbo nucifera]
Length=568

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ CN+Y R+P   Q N ITAQGR+DP+QNTG SI +C +KAAAD
Sbjct  401  IYGTVDFIFGNAAVVFQNCNIYARQPRKGQGNAITAQGRTDPNQNTGTSIQNCSIKAAAD  460

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L+      K+YLGRPW++YSRTV+M S I SL++P+GW  W GDFAL TLYY EY N GP
Sbjct  461  LVASNFTTKTYLGRPWKEYSRTVYMQSFIDSLVEPSGWSIWTGDFALSTLYYAEYNNWGP  520

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G++TSNRVTW GY +I     A  FT +N I G  W+P T   +PYY GL
Sbjct  521  GSNTSNRVTWPGYHVINATDAAN-FTVSNFILGDAWIPATG--VPYYGGL  567



>ref|XP_006350555.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Solanum tuberosum]
Length=585

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y RKP+  QKN ITAQ R DP+QNTGISI  C++ A  D
Sbjct  416  IYGTVDFIFGNAAVVLQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKIMATPD  475

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   +  F +YLGRPW+ YSRTV+MLS +G  I P GWLEW GDFAL TLYYGEY N GP
Sbjct  476  LQASKGSFSTYLGRPWKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGP  535

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RVTW GYR+IK  + A  FT +  I G  WLP T
Sbjct  536  GAAVGQRVTWPGYRVIKSVEEASKFTVSKFIYGSSWLPST  575



>ref|XP_004234960.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Solanum lycopersicum]
Length=583

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN+Y RKP+  QKN ITAQ R DP+QNTGISI  C++ A  D
Sbjct  414  IYGTVDFIFGNAAVVLQNCNIYARKPMANQKNTITAQNRKDPNQNTGISIHACKIMATPD  473

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   +  F +YLGRPW+ YSRTV+MLS +G  I P GWLEW GDFAL TLYYGEY N GP
Sbjct  474  LQASKGSFSTYLGRPWKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGP  533

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA    RVTW GYR+IK  + A  FT +  I G  WLP T
Sbjct  534  GAAVGQRVTWPGYRVIKSVEEASKFTVSKFIYGSSWLPST  573



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N +TAQGRSDP+QNTGISI +C+V AA+D
Sbjct  383  IYGTVDFIFGNAAVVLQNCNIFARDP-PNKTNTVTAQGRSDPNQNTGISIHNCRVTAASD  441

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   ++  K+YLGRPW++YSRTV M + + SLI P GW+ W G FALKTLYYGEY N GP
Sbjct  442  LKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGP  501

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT AN I G  WLP T+  +P+  GL
Sbjct  502  GSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATN--VPFTSGL  549



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ CNL  RKP+  Q+N++TAQGR DP+QNTG SI  C+V  + D
Sbjct  383  ISGTVDFIFGNAAVVFQNCNLIARKPMSHQQNLVTAQGRVDPNQNTGTSIQSCKVVPSDD  442

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+    +YLGRPW++YSRTVFM S I   +DP GW+EW GDFAL TLYYGEY N GP
Sbjct  443  LKPVKGSIPTYLGRPWKEYSRTVFMQSYIDDHVDPKGWMEWSGDFALDTLYYGEYANIGP  502

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWL  430
            GA TS RV W GY +I    VAK FT A LI GG WL
Sbjct  503  GAGTSGRVNWTGYHVITDPNVAKDFTVAGLIQGGTWL  539



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGNSAVV Q C +Y RKP+  Q+ V+TAQGR+DP+QNTGISI + +V A  D
Sbjct  353  IYGTVDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDD  412

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV    ++YLGRPW++YSRTV++ S + SL++PAGWLEW G+FAL TLYYGE+KN GP
Sbjct  413  LKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGP  472

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT  + I G  WLP T   +P+  GL
Sbjct  473  GSSTANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTG--VPFTAGL  520



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVV Q CN++ R P P + N +TAQGRSDP+QNTGISI +C+V  ++D
Sbjct  356  IYGTVDFIFGNAAVVLQNCNIFARNP-PSRINTVTAQGRSDPNQNTGISIHNCRVTPSSD  414

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L P ++  K+YLGRPWQ+YSRTV M + + SLIDPAGW+ W G FALKTLYYGEY N G 
Sbjct  415  LKPYQNSVKTYLGRPWQQYSRTVIMKTFLDSLIDPAGWMPWTGTFALKTLYYGEYLNSGS  474

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT AN I G  WLP T+  +P+   L
Sbjct  475  GSSTANRVNWPGYRVIYSAAEASKFTPANFIAGNSWLPATN--VPFKSNL  522



>ref|XP_010260073.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+A VFQ CN+Y R P+  Q N +TAQGR+DP+QNTG SI +C ++AA+D
Sbjct  396  IYGTVDFIFGNAAAVFQDCNIYARLPMQGQFNALTAQGRTDPNQNTGTSIQNCNIRAASD  455

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L       K+YLGRPW++YSRTV+M S I SLIDPAGW+ W GDFAL TLYY EY N GP
Sbjct  456  LASSSGTTKTYLGRPWKQYSRTVYMQSFIDSLIDPAGWMAWSGDFALTTLYYAEYNNTGP  515

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T++RVTW GY +I     A  FT +N + G +W+P T  K+PY  GL
Sbjct  516  GSGTTDRVTWPGYHLINATDAAN-FTVSNFLLGDNWIPTT--KVPYTSGL  562



>gb|AAR03544.1| pectin methylesterase isoform 1 [Fragaria x ananassa]
Length=224

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVV Q C+++ RKP   QKN++TAQGR+DP+QNTGI I   ++ A +D
Sbjct  57   IAGTVDFIFGNAAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSD  116

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L  V+  FK+YLGRPW++YSRTV M S I  +IDPAGW EW G FAL TL+Y EY N G 
Sbjct  117  LQAVKGSFKTYLGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGA  176

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TSNRVTW GY++I  A  A+ FT  N I GG WL  T    P+  GL
Sbjct  177  GASTSNRVTWKGYKVITSATEAQAFTPGNFIAGGSWLSATG--FPFTLGL  224



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 121/170 (71%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDFIFGN+AVVFQ   +  RKP P QKN++TAQGR DP+QNTG SI +C + A +D
Sbjct  382  IAGTVDFIFGNAAVVFQNSKIAARKPGPGQKNMVTAQGREDPNQNTGTSIQNCDIIATSD  441

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV+   K+YLGRPW+ YSRTVFM S IG  IDP GW  WQGDFALKTLYYGEY NKGP
Sbjct  442  LAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHIDPEGWSVWQGDFALKTLYYGEYMNKGP  501

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY I+  A+ A+ FT   LI GG WL  T   + Y  GL
Sbjct  502  GAGTSKRVKWPGYHILNAAE-ARKFTVGQLIQGGAWLKSTG--VAYTEGL  548



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            VYGTVDFIFGN+AVV Q CN++ R P P + N +TAQGR+DP+QNTGISI +C++ AA+D
Sbjct  359  VYGTVDFIFGNAAVVLQNCNIFARDP-PNKTNTVTAQGRTDPNQNTGISIHNCRITAASD  417

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   ++  K+YLGRPW++YSRTV M + + SLI P GW+ W G FALKTLYYGEY N GP
Sbjct  418  LKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGP  477

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT AN I G  WLP T+  +P+  GL
Sbjct  478  GSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATN--VPFTSGL  525



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGNSAVV Q C +Y RKP+  Q+ V+TAQGR+DP+QNTGISI + +V A  D
Sbjct  264  IYGTVDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDD  323

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV    ++YLGRPW++YSRTV++ S + SL++PAGWLEW G+FAL TLYYGE+KN G 
Sbjct  324  LKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGL  383

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            G+ T+NRV W GYR+I  A  A  FT  + I G  WLP T   +P+  GL
Sbjct  384  GSSTANRVKWKGYRVITSASEAAKFTVGSFISGNSWLPGTG--VPFTAGL  431



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            + GTVDF+FGN+AVVFQ CNL  R+P+  Q+N++TAQGR DP+QNTG SI +C V  A D
Sbjct  386  ISGTVDFVFGNAAVVFQNCNLTARRPMDNQQNLVTAQGREDPNQNTGTSIQNCNVVPADD  445

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            LIPV+    SYLGRPW+ YSRTV M S I S I+  GWLEW G+FALKTL+YGEY+N+GP
Sbjct  446  LIPVKGSIPSYLGRPWKAYSRTVVMQSYIDSHINSKGWLEWDGEFALKTLFYGEYQNRGP  505

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            GA T  RV W GY +I  A  AK FT A+LI GG WL  T
Sbjct  506  GAGTGGRVKWPGYHVITDANTAKAFTVASLIQGGSWLKET  545



>ref|XP_007220716.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
 gb|EMJ21915.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
Length=479

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 124/171 (73%), Gaps = 3/171 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGT+DFIFGN+A VFQ C +Y+R+PL  Q NVITAQ R+DP+QNT ISI + QV+AAAD
Sbjct  311  IYGTIDFIFGNAAAVFQSCIIYVRRPLKGQVNVITAQARNDPYQNTAISIHNSQVRAAAD  370

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQ-GDFALKTLYYGEYKNKG  544
            L PV S FK+YLGRPW +YSR VFM   + SL++P GWLEWQ  +FAL TLYY EYKN G
Sbjct  371  LKPVVSAFKTYLGRPWMQYSRVVFMKCYLDSLVNPVGWLEWQRSNFALSTLYYAEYKNFG  430

Query  543  PGADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            P + T  RV W G+ +I  A VA  FT ++LI G  WLP T   +PY  GL
Sbjct  431  PASSTRYRVKWPGFHVITSANVASKFTVSSLITGRSWLPATG--VPYTAGL  479



>emb|CAE76634.1| pectin methylesterase [Cicer arietinum]
Length=254

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFGN+AVVFQ C+LY RKP+ +QKN ITAQ R DP+QNTGISI +C++ A  D
Sbjct  85   IYGTVDFIFGNAAVVFQNCSLYARKPMAQQKNTITAQNRKDPNQNTGISIHNCRILATPD  144

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L   +  F++YLGRPW+ YS+TV+MLS +G  I P GWLEW   FAL TLYYGEY N GP
Sbjct  145  LEASKGSFQTYLGRPWKLYSKTVYMLSYMGDHIHPRGWLEWNATFALDTLYYGEYMNYGP  204

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVT  421
            G     RVTW G+R+I     A  FT A  I G  WLP T
Sbjct  205  GGAIGQRVTWPGFRVITSTVEANRFTVAQFISGSSWLPST  244



>pdb|1XG2|A Chain A, Crystal Structure Of The Complex Between Pectin Methylesterase 
And Its Inhibitor Protein
Length=317

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            V GTVDFIFGN+AVVFQKC L  RKP   Q+N++TAQGR+DP+Q TG SI  C + A++D
Sbjct  148  VTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCNIIASSD  207

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L PV  +F +YLGRPW++YSRTV M S +G LI+PAGW EW GDFALKTLYYGE+ N GP
Sbjct  208  LEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGP  267

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W GY +I     A  FT A LI GG WL  T   + Y  GL
Sbjct  268  GAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTG--VAYVDGL  315



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  900  VYGTVDFIFGNSAVVFQKCNLYLRKPLPEQKNVITAQGRSDPHQNTGISILHCQVKAAAD  721
            +YGTVDFIFG++  V Q CN+Y+RKP+  Q+N +TAQGR+DP++NTGISI + +V AA+D
Sbjct  365  IYGTVDFIFGDAVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNENTGISIHNSRVTAASD  424

Query  720  LIPVESDFKSYLGRPWQKYSRTVFMLSKIGSLIDPAGWLEWQGDFALKTLYYGEYKNKGP  541
            L P++  FK+YLGRPWQKYSRTVFM + + SLIDP GWLEW G FAL TLYYGEY N G 
Sbjct  425  LRPLQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGV  484

Query  540  GADTSNRVTWAGYRIIKRAKVAKYFTAANLIDGGDWLPVTDPKIPYYPGL  391
            GA TS RV W G+ ++  +   K FT  N + G  W+P T   +P+  G+
Sbjct  485  GASTSQRVKWPGFHVMSASDAGK-FTVGNFLGGDTWIPAT--GVPFTSGM  531



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1851063916768